GenomeNet

Database: RefSeq
Entry: NC_005787
LinkDB: NC_005787
Original site: NC_005787 
LOCUS       NC_005787            1836693 bp    DNA     linear   CON 14-SEP-2017
DEFINITION  Eremothecium gossypii ATCC 10895 chromosome VI, complete sequence.
ACCESSION   NC_005787
VERSION     NC_005787.5
DBLINK      BioProject: PRJNA10623
            BioSample: SAMN03081415
            Assembly: GCF_000091025.4
KEYWORDS    RefSeq.
SOURCE      Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 1836693)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 1836693)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (13-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1836693)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-OCT-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1836693)
  AUTHORS   Dietrich,F.S., Voegeli,S. and Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUN-2010) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 1836693)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-AUG-2007) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
  REMARK    Sequence update by submitter
REFERENCE   6  (bases 1 to 1836693)
  AUTHORS   Lerch,A., Brachat,S., Voegeli,S.E., Gaffney,T., Philippsen,P. and
            Dietrich,F.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Biozentrum, Klingelbergstrasse 50, Basel
            CH-4056, Switzerland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AE016819.
            On Aug 5, 2010 this sequence version replaced NC_005787.4.
            This genome has been completely resequenced to high accuracy (derf)
            and reannotated. Gene names have been maintained, though some genes
            have been added, and many protein sequences have been corrected.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1836693
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /culture_collection="ATCC:10895"
                     /db_xref="taxon:284811"
                     /chromosome="VI"
     source          29053..89763
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2564"
     source          89666..147977
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1587"
     source          116449..197112
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2422"
     source          176039..227038
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1668"
     source          233999..311485
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2166"
     source          290384..354254
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1930"
     source          341173..401664
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2002"
     source          401586..425221
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2080"
     source          407411..461926
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2224"
     source          442192..502222
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1894"
     source          497430..561198
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1841"
     source          550895..601595
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1903"
     source          580104..628149
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2033"
     source          636286..715959
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2107"
     source          677067..752846
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2527"
     source          715893..794333
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2313"
     source          791672..860856
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2358"
     source          835634..903842
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2194"
     source          891641..955641
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1538"
     source          930590..1012642
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1865"
     source          1004025..1060602
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2191"
     source          1034780..1097597
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2093"
     source          1069955..1141967
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1561"
     source          1103574..1144248
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2417"
     source          1160118..1246169
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2404"
     source          1235917..1269406
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1650"
     source          1263458..1335273
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2318"
     source          1311966..1369835
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2457"
     source          1342188..1393032
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2161"
     source          1369700..1456751
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2545"
     source          1456609..1536890
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2180"
     source          1546882..1597932
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1219"
     source          1573100..1624580
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG2408"
     source          1595424..1640045
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1953"
     source          1622989..1679451
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1888"
     source          1679379..1735976
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1779"
     source          1738272..1802897
                     /organism="Eremothecium gossypii ATCC 10895"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="taxon:284811"
                     /clone="BAC clone bAG1919"
     telomere        complement(1..399)
                     /note="Chromosome VI left end terminal telomere repeat.
                     Composed of approximately 20 copies of a 24 base repeat
                     unit, and occasionally sequence varients of this repeat."
                     /rpt_type=direct
                     /rpt_type=tandem
                     /rpt_type=terminal
                     /rpt_unit_range=24..47
                     /rpt_unit_seq="ggtgtggtgtatgggtctctcagc"
     telomere        complement(400..700)
                     /note="Chromosome VI left subtelomeric sequence. Shares
                     some sequence similarity with other subtelomeric regions."
     gene            <786..>2618
                     /locus_tag="AGOS_AFL235W"
                     /old_locus_tag="AFL235W"
                     /db_xref="GeneID:4621539"
     mRNA            <786..>2618
                     /locus_tag="AGOS_AFL235W"
                     /old_locus_tag="AFL235W"
                     /product="AFL235Wp"
                     /transcript_id="NM_210669.3"
                     /db_xref="GeneID:4621539"
     CDS             786..2618
                     /locus_tag="AGOS_AFL235W"
                     /old_locus_tag="AFL235W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL014W (MNT3) and YER001W (MNN1)"
                     /codon_start=1
                     /product="AFL235Wp"
                     /protein_id="NP_985315.2"
                     /db_xref="GeneID:4621539"
                     /translation="MRLKRYSLRLKSLPIVSVLLAVAISTISLGLMSQGYFGSRLASA
                     MEGFRTSSSSFYENRFNSGSSSLKEMFKESEDTSDAPNKEQLCKQYFQLTYRNDPSWS
                     NEAVRESNSLLNDASYTALLIERMRIFADCFMSGDVQLQAVLPEKSDMFEFHQRMYPF
                     LAKGRSWHDIWPTFSDVKTGDTYAPGMLNDGRRVHIDDSVSFWKNWQSFSKGRGIVIT
                     AGEEHIQMLLRLLAVLDHLGNTLPIELVLTESPSQERIQKIAHYLRDKTKQSLRIVDC
                     KKILEPSYRPLIFDFRYKWLAYLLNSFEEVVFIDLDVVPFVSIDKFFEMEGYKSTGIL
                     MFQDRVFNSIKNSKCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAAS
                     VYDRYLEGDRMHMVESGLVVVDKRKKISSLIISLMLHMNIAECSYGDKEYLWLGQLVS
                     GEDYYIHPLPPAILGMPQEVKHDNKKKYEVCSTQIAHMDHDGSILWVNGGMQNCKFPE
                     FADSEVESNNEYFSSQHSDKEVLRKFYESPINIQMAFIPNLVDSNWHAIATCNSYTWC
                     AEIKPDFTESSSRGNFIISGNDPRLPVYNEIKGIWMHAPSLSDI"
     gene            complement(<3695..>4267)
                     /locus_tag="AGOS_AFL234C"
                     /old_locus_tag="AFL234C"
                     /db_xref="GeneID:4621540"
     mRNA            complement(<3695..>4267)
                     /locus_tag="AGOS_AFL234C"
                     /old_locus_tag="AFL234C"
                     /product="AFL234Cp"
                     /transcript_id="NM_210670.1"
                     /db_xref="GeneID:4621540"
     CDS             complement(3695..4267)
                     /locus_tag="AGOS_AFL234C"
                     /old_locus_tag="AFL234C"
                     /note="NOHBY617; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AFL234Cp"
                     /protein_id="NP_985316.1"
                     /db_xref="GeneID:4621540"
                     /translation="MERQALLCRYADRSRKYDELKVGQVTSPLSRLVYWWFLSCSLGM
                     MYILVLGRSLGGLVAVIVIVLILRQLFEASVLDHDGKGTLWAVGSATVALAMGVFVVC
                     MLSEWLSLLQPEGGFTIEMYSWDYFSSDVIFDIIGIVSVLLLIVVLLICLLLSLITLF
                     QIIVYICESIHGFIKPQIGVRLYEEPSSYV"
     gene            complement(<5200..>5913)
                     /locus_tag="AGOS_AFL233C"
                     /old_locus_tag="AFL233C"
                     /db_xref="GeneID:4621545"
     mRNA            complement(<5200..>5913)
                     /locus_tag="AGOS_AFL233C"
                     /old_locus_tag="AFL233C"
                     /product="AFL233Cp"
                     /transcript_id="NM_210671.1"
                     /db_xref="GeneID:4621545"
     CDS             complement(5200..5913)
                     /locus_tag="AGOS_AFL233C"
                     /old_locus_tag="AFL233C"
                     /note="NOHBY616; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AFL233Cp"
                     /protein_id="NP_985317.1"
                     /db_xref="GeneID:4621545"
                     /translation="MLARKAARRLRGAVATIAVRRRRGLQLAAACSVLSSCVMAACFM
                     FRLYACMREHSARTGIALREHGGHVGADTEGLYAAAGPATILQANANFMAHSSFLKAE
                     MTSLLLLQLSHAILAVRTIEFFAGPASVPQCFVMVELLLVFGLMALWVSLYMQFACLV
                     LHGDSTWRAYAILESATHLALSLFRCMDRWPLLKIEYMLVLLMFGTPVVLTCLTCVAL
                     LVRCGESSNAPAPRACAAR"
     gene            <6883..>7707
                     /locus_tag="AGOS_AFL232W"
                     /old_locus_tag="AFL232W"
                     /db_xref="GeneID:4621541"
     mRNA            <6883..>7707
                     /locus_tag="AGOS_AFL232W"
                     /old_locus_tag="AFL232W"
                     /product="AFL232Wp"
                     /transcript_id="NM_210672.2"
                     /db_xref="GeneID:4621541"
     CDS             6883..7707
                     /locus_tag="AGOS_AFL232W"
                     /old_locus_tag="AFL232W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR106W (VAM3)"
                     /codon_start=1
                     /product="AFL232Wp"
                     /protein_id="NP_985318.2"
                     /db_xref="GeneID:4621541"
                     /translation="MSFLDLEAHPGERGAGTIAAPAAVQDGEVIGLLTELSTQVQNLR
                     KKVQLLGTARDDHTLRNSIESEDIPRCEQLRDRLQSNPRLTGRDKYVSDLHWLTVELL
                     QLKRNYQKRKLGSPLRSKSGAADGGAAAPPGHAPPHEEPGRNSYVSIQVRSDERTPLL
                     AQQQILRQQEHVPQEELDFHSLIQEVRSQEISNIHTQVQDVNAIFKQLGTLVQEQGKQ
                     VDTIDSNINGLTSNLQGANQHLRKAERYQRQRNKCGTLTLCVIAVVTLVVVLAALS"
     gene            complement(<7789..>9252)
                     /locus_tag="AGOS_AFL231C"
                     /old_locus_tag="AFL231C"
                     /db_xref="GeneID:4621548"
     mRNA            complement(<7789..>9252)
                     /locus_tag="AGOS_AFL231C"
                     /old_locus_tag="AFL231C"
                     /product="AFL231Cp"
                     /transcript_id="NM_210673.1"
                     /db_xref="GeneID:4621548"
     CDS             complement(7789..9252)
                     /locus_tag="AGOS_AFL231C"
                     /old_locus_tag="AFL231C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL103W (MET4)"
                     /codon_start=1
                     /product="AFL231Cp"
                     /protein_id="NP_985319.1"
                     /db_xref="GeneID:4621548"
                     /translation="MSLPPNHMQNLFGDDAGGSHNTGHGTGGEDVTPALLLEQLAYVD
                     NFMTDLDPDFSNLDTLLGDRGSSATTGLPLDERLAAELSAFADESFIFPDEDKHDGEG
                     NADRANEVGGSALSDAWTQSREDAAGNRRAQLLSERRNTFLAAQYDSTRQRFSRQAET
                     PGAGDTDHGGFINYDTAPAPAAGDFALDVEQAQAPATGTQVGQRGVTPPSYPNIQMPE
                     YSRIPTATLVALLPKVEVPPGALRSLLQVGFTRDQVDAVRAIMAYHQTRGVQSSTGTA
                     RTVPSLAQRSRMPLQSPSMAYGSVAPVSEARESPAGTADNNSATLFLELLSKQQGRRR
                     SSAEPTERHEEREHRSSVAPEEQQRTWPRTASRDIDTLSNGPLLGDGQSNSDNLSRSA
                     GHPLAEGSSAQVAEVKAAYGNTTKAHLRRKQKELELEKSVQELSQLATTLKQRIQTLE
                     MENRLLRNIVVEKGEPSKTEKDKATQRQFYPEVHEGA"
     gene            <10009..>10962
                     /locus_tag="AGOS_AFL230W"
                     /old_locus_tag="AFL230W"
                     /db_xref="GeneID:4621546"
     mRNA            <10009..>10962
                     /locus_tag="AGOS_AFL230W"
                     /old_locus_tag="AFL230W"
                     /product="AFL230Wp"
                     /transcript_id="NM_210674.1"
                     /db_xref="GeneID:4621546"
     CDS             10009..10962
                     /locus_tag="AGOS_AFL230W"
                     /old_locus_tag="AFL230W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR107W (RGS2)"
                     /codon_start=1
                     /product="AFL230Wp"
                     /protein_id="NP_985320.1"
                     /db_xref="GeneID:4621546"
                     /translation="METIPTLQDLLQGRQRDASGHDGASSTLLMFHEFLRRTHCDENL
                     QFVLMTDGFVAEQADPPVDPGVWNQIYDTFIRRDSPKECNFPESIRSVFDDSFQRQVV
                     PQQEHIVRARKHVLKLLEDAYTKFHRQLVEQGKSCGKTRVPRDSASSSSSGRASLSSA
                     SAAPANATPGRPLLMSPAESAQALVQPEFAVSDGEDDSIPELISSPTSVDRMWYSRQL
                     AQIPTKRVHTHVLQAPDPAPAAQSALLAPCSPPQAPARSPNEAGIPHAGSAAAAAVAS
                     TFHSAHLIASPLHNAKIRGKKQLFSKFKFGRRSSSSGSLSN"
     gene            <11805..>13622
                     /locus_tag="AGOS_AFL229W"
                     /old_locus_tag="AFL229W"
                     /db_xref="GeneID:4621547"
     mRNA            <11805..>13622
                     /locus_tag="AGOS_AFL229W"
                     /old_locus_tag="AFL229W"
                     /product="AFL229Wp"
                     /transcript_id="NM_210675.2"
                     /db_xref="GeneID:4621547"
     CDS             11805..13622
                     /locus_tag="AGOS_AFL229W"
                     /old_locus_tag="AFL229W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL104C (LEU4) and YOR108W (LEU9)"
                     /codon_start=1
                     /product="AFL229Wp"
                     /protein_id="NP_985321.2"
                     /db_xref="GeneID:4621547"
                     /translation="MFRHTLIRLAIGAGRSVTPHKPTYRNMLRDPSKKYKAPLKVPLA
                     RRDWPGKTISRAPRWLSTDLRDGNQALSDPMSLEQKKAFFHKLIEIGFKEIEVAFPSA
                     SQTDFDFTRYAVENAPDDVSIQCLVQSREHLIRRTVEALRGARRATVHTYLATSDMFR
                     EIVFNMTREEAITKAVEATRLVRSLTKDDPAQQSTRWTYEFSPECFSETPVEYAVEVC
                     EAVKAAWEPTEDNPIIFNLPATVEVASPNVYADQIEYFCKHISEREKVCVSMHTHNDR
                     GCAVAATELGLLAGADRVEGCLFGSGERTGNVDLVTVALNMYTHGISPELDFSDIPDV
                     TRVVERCNKIQVHPRTPYGGDLVVCAFSGSHQDAIKKGFAYRDRAREPHWRMPYLPLD
                     PADVGRDYEAVIRVNSQSGKGGAAWIIQKTLGLDMPRDMQTRFSTIVQDAADSAGREL
                     QAAEIAALFSQTYNYDKRLSHLELLDYDITRHSPERRELRGIARAGGRQFALSGFGNG
                     PVSAFVDALNNHLHSDLSVAQYAEHSLGSGSSTRAAAFILLSFTGPDGRRASRWGVGV
                     SEDVADASTEAVVAAANCILEAGGLQLPKQVRDTISAQN"
     gene            <13867..>17217
                     /locus_tag="AGOS_AFL228W"
                     /old_locus_tag="AFL228W"
                     /db_xref="GeneID:4621542"
     mRNA            <13867..>17217
                     /locus_tag="AGOS_AFL228W"
                     /old_locus_tag="AFL228W"
                     /product="AFL228Wp"
                     /transcript_id="NM_210676.2"
                     /db_xref="GeneID:4621542"
     CDS             13867..17217
                     /locus_tag="AGOS_AFL228W"
                     /old_locus_tag="AFL228W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR109W (INP53) and YNL106C (INP52)"
                     /codon_start=1
                     /product="AFL228Wp"
                     /protein_id="NP_985322.2"
                     /db_xref="GeneID:4621542"
                     /translation="MFVLVQREPQRRIAIISKSYALIFKAVKADCGSPGASGASRPLC
                     AIELLPKSHLREQNFEKLTNLEVYGFLGLIEIENKIFICTITGKSKVARPIPGETVNK
                     IYAVDFFCLNDDRWDFVEFDTNGYSIPTTEEDYASQQTVTKHPCHELKKLLSNGSFYY
                     SSDFDLTSLLQYRGLDSHSLSFDDFQEEYMWNSFLMQEIISFRDKLEDQARQVLDDEG
                     FLTTVIRGFAETFPTYIGSLPVWVTIISKQSWRRAGTRFNARGIDDEANVANFVETEF
                     IMYSNDYCYAFTEIRGSVPIFWEQDTSLINPKVQITRSIEATQPIFDEHFQRLVDKYG
                     PIHVVNLLSTKYSEMELSRRYRTHIERSKSLKLDENIFLTEFDFHRETKDQGFSAASR
                     IRPMIERSLLENGYFSYDVKENKPISKQRGVFRVNCLDCLDRTNLIQQFISRYAFLLF
                     LQDFQIVKSNVVNNMEDYEWFQKHNNLWADHGDAVSQIYTGTNALKSSFSRKGKMSLA
                     GALSDATKSVSRMYINNFMDKGKQQNIDSLLGRLPHQQPVQLYDPIKEYVTSKLETMA
                     HEFTKSSKISLLVGTFNVNGLTKKVDITDWLFPIGNKYLPDVVVLGMQEVIELNAGSI
                     LNADYSKSNFWQQLVNECLNQYNEKYLLLRAEQMSSLLILFFVKSTKVSHIKRVEGGS
                     KKTGFGGITGNKGAVAIRFEYGNTSFCFVNCHLAAGISNTEERRSDYESIAKGINFTR
                     SKKVPHHDSIFWLGDLNYRLALPNEDVRQILNNKEDGYIEKLLAYDQLTQEMSNGSSF
                     KGFMEPSIQFRPTYKYDHGTNRYDSSEKARTPSWTDRIIYKGKNLQPMAYGDVSLCLS
                     DHKPVYSAYKADVNFVDETIKMSLTKELYFRYKEAHPEQASNTSIALIDVVAESKGAR
                     KRNMESPINDWSETNLLDLEPASVVSIPSSNSSTPGMSPQPPAHVQKHIPGPGGRHRV
                     PPPPPPAPRGNGIAASGTNSQRSLQTNSTQGSPVPPAKVGPPVPARRGTLPPGFSDSI
                     LVPKNASSSALSSTSTNSGKAASNSPSPTPRPSSSVSAAGDSEANHASPTGSSAAYTS
                     TKQPPAVPKKKPELERLTLDSWKPLTPK"
     gene            complement(<17324..>17950)
                     /locus_tag="AGOS_AFL227C"
                     /old_locus_tag="AFL227C"
                     /db_xref="GeneID:4621543"
     mRNA            complement(<17324..>17950)
                     /locus_tag="AGOS_AFL227C"
                     /old_locus_tag="AFL227C"
                     /product="AFL227Cp"
                     /transcript_id="NM_210677.1"
                     /db_xref="GeneID:4621543"
     CDS             complement(17324..17950)
                     /locus_tag="AGOS_AFL227C"
                     /old_locus_tag="AFL227C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL107W (YAF9)"
                     /codon_start=1
                     /product="AFL227Cp"
                     /protein_id="NP_985323.1"
                     /db_xref="GeneID:4621543"
                     /translation="MAPAQAKRIKTLSVARPIVYGNTAKKMGDVRPAIAPSEHTHMWT
                     IFVRGPQGEDISYFIKKVVFKLHETYPNPVRVVDAPPFELTETGWGEFEINVKVHFVD
                     EANEKMLNFYHHLRLHPYTEEDGRRSDGDEVSSVFYDEIVFNEPNEAFFAKMIEQPGN
                     LLPSNKTPDCVFSLQLEQEEIDRIQQGIGKVDEEIEQLKQKLEQDLAK"
     gene            <18146..>19371
                     /locus_tag="AGOS_AFL226W"
                     /old_locus_tag="AFL226W"
                     /db_xref="GeneID:4621544"
     mRNA            join(<18146..18175,18229..>19371)
                     /locus_tag="AGOS_AFL226W"
                     /old_locus_tag="AFL226W"
                     /product="AFL226Wp"
                     /transcript_id="NM_210678.1"
                     /db_xref="GeneID:4621544"
     CDS             join(18146..18175,18229..19371)
                     /locus_tag="AGOS_AFL226W"
                     /old_locus_tag="AFL226W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL108C and YOR110W (TFC7); 1-intron"
                     /codon_start=1
                     /product="AFL226Wp"
                     /protein_id="NP_985324.1"
                     /db_xref="GeneID:4621544"
                     /translation="MTIKMIYVARHGYRSNWLPHGPYPEPPTGVNSDVPLAEHGLEQA
                     RELAHYLLSVDNQPELLFSSPFFRCLQTTEPIAEVMELPIHIERGIGEWYKPDRDVIP
                     EPAPFEVLENFFPGKLNGEWGATVVPSNKGETETDIFDRCREFWPRFIARVEQQYPDV
                     EKLMLVTHAATKIALGMSLLGFSSCREPIDEDGTIIRSGACSLDKYELLQEEEDLPFP
                     QRHWKMTMNGNTEFLSRGEEMHWDFRSGFEAGSDAEVKARSTAAATATDSDDAEDTEH
                     VYVCLDVPNHNYRERHEISHTATLQYAGLDRESPLVKVGENIYEGTWKKLIGTELAFP
                     SAATTKRKTADGAADSLHDENEKSNHDGSTEPPEKVLSERIYRIVDHLELNEVDHL"
     gene            <19502..>20158
                     /locus_tag="AGOS_AFL225W"
                     /old_locus_tag="AFL225W"
                     /db_xref="GeneID:4621549"
     mRNA            <19502..>20158
                     /locus_tag="AGOS_AFL225W"
                     /old_locus_tag="AFL225W"
                     /product="AFL225Wp"
                     /transcript_id="NM_210679.1"
                     /db_xref="GeneID:4621549"
     CDS             19502..20158
                     /locus_tag="AGOS_AFL225W"
                     /old_locus_tag="AFL225W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR111W"
                     /codon_start=1
                     /product="AFL225Wp"
                     /protein_id="NP_985325.1"
                     /db_xref="GeneID:4621549"
                     /translation="MSLIKGIEREYDVILASTSPHRYSIVTEVLGFHNVAVMKPNFAE
                     DLDKGSYRSNPVGYVEDTCKGKTTNAIQQLEAATPNRPKLVICADTVVLGADNVINEK
                     PGNSDVQLRMLHSFCRSSAPVRVVTAVRIVRWRSSDDVTTFAFTEETTVHFDPSTPEA
                     LLNAYVASGDGLQVAGGFKIQGFPATMIRKINGDYYNVVGLPANRTMAHILRATGRDV
                     "
     gene            <20331..>20951
                     /locus_tag="AGOS_AFL224W"
                     /old_locus_tag="AFL224W"
                     /db_xref="GeneID:4621550"
     mRNA            <20331..>20951
                     /locus_tag="AGOS_AFL224W"
                     /old_locus_tag="AFL224W"
                     /product="AFL224Wp"
                     /transcript_id="NM_210680.1"
                     /db_xref="GeneID:4621550"
     CDS             20331..20951
                     /locus_tag="AGOS_AFL224W"
                     /old_locus_tag="AFL224W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL110C (NOP15)"
                     /codon_start=1
                     /product="AFL224Wp"
                     /protein_id="NP_985326.1"
                     /db_xref="GeneID:4621550"
                     /translation="MARTTKHARASPQPAAADKPQPEPVSDAELDGFSDSDAEPSVTD
                     EQPQPAAAGHTILPQQPARRSGAKKQAARTDLSGIIYISRLPHGFHERELSTYFAQFG
                     DLKQVRLARNKKTGNSRHYAFIEFANPDDAVVAQETMHNYLLMGHLLQVSVLPKGRTI
                     EKLYKHKKRVHKENSIKDAARTQRRADAAHAARMQKLRDAGIDLKW"
     gene            <21070..>21567
                     /locus_tag="AGOS_AFL223W"
                     /old_locus_tag="AFL223W"
                     /db_xref="GeneID:4621551"
     mRNA            <21070..>21567
                     /locus_tag="AGOS_AFL223W"
                     /old_locus_tag="AFL223W"
                     /product="AFL223Wp"
                     /transcript_id="NM_210681.1"
                     /db_xref="GeneID:4621551"
     CDS             21070..21567
                     /locus_tag="AGOS_AFL223W"
                     /old_locus_tag="AFL223W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL111C (CYB5)"
                     /codon_start=1
                     /product="AFL223Wp"
                     /protein_id="NP_985327.1"
                     /db_xref="GeneID:4621551"
                     /translation="MIKFYDGSYIIHMGLQAQVAYGVNDQLLSLFTSPPTETTMPKLY
                     TYQEIAEHNSENDLWLIINGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFADIGHSD
                     DAVKMLEGLYVGDLDKDSEPVVSASEDRSSSTGGGEGNGALWLAFIVFFLAAVYYNYH
                     HNKWA"
     gene            <21758..>23956
                     /locus_tag="AGOS_AFL222W"
                     /old_locus_tag="AFL222W"
                     /db_xref="GeneID:4621552"
     mRNA            <21758..>23956
                     /locus_tag="AGOS_AFL222W"
                     /old_locus_tag="AFL222W"
                     /product="AFL222Wp"
                     /transcript_id="NM_210682.1"
                     /db_xref="GeneID:4621552"
     CDS             21758..23956
                     /locus_tag="AGOS_AFL222W"
                     /old_locus_tag="AFL222W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR112W (CEX1)"
                     /codon_start=1
                     /product="AFL222Wp"
                     /protein_id="NP_985328.1"
                     /db_xref="GeneID:4621552"
                     /translation="MSAVAGAAYLLFKSISGFQFPYAQDERAVQQTPLWDVYQGTRKA
                     DSQAVTLFVHSRQKKASDAGIEQLVRNAVRKAKTLKLPGLVRVLEVLDTDPNVVYIVT
                     ERVQPLFPELAGAVGELSLGLGLSQVFGALRILEENAHVTLGTLSRGSVYVNERGEWC
                     LFGLELCSAQTELAHLREHAARYRSLMAHTMFEVPATESAQVDSVLLAGLIRSVYTTG
                     VPRAWQAAVSMLAAGRLTVTQFVARVSGTPQLQTPLITIYSHLKELHIKDSQDKLVAL
                     AEVQNIILQEPGVLDNSTPGFVDGFIIPQLSETIRNEIVTNQQQIAGMQVFSNIVSLL
                     ATALQLTCSKNPNSTSAETFKSHIKPLIFETFKISDRQVRFLLLMYMSVYVDKLSGYE
                     IQNQVFPYFVQGLADSDNALRLHTLKNIVHIVEKITERQLNSDLLRQLAKTQVDSDVN
                     IRTWTILTITSLAEKLSAGSDRPSLLGTAFTKSLKDPAVMPRLAALHGLAKSIHLFDA
                     KTIANRILTVIAPGLLDSNAQVRSQAKELFSMYLKKLEDESSTADYQSDSEDYVDVDF
                     ESMQAEASQDEFISNFLSNLKVTADHSITNAPMSIGSQEKIDSDAWDTGDDFSWGDVD
                     ANEQQQPMRQASKPRISAQPRKPAGVKVNGLRMDSLDIRDSSQIKFGAVKTQNSWDNS
                     PKHQITSHKSHSTPNLPSKLVAQQRNPPKRDPIASLVPSAEDDDGWDEEW"
     gene            complement(<24180..>26519)
                     /locus_tag="AGOS_AFL221C"
                     /old_locus_tag="AFL221C"
                     /db_xref="GeneID:4621553"
     mRNA            complement(join(<24180..24577,25244..>26519))
                     /locus_tag="AGOS_AFL221C"
                     /old_locus_tag="AFL221C"
                     /product="AFL221Cp"
                     /transcript_id="NM_210683.2"
                     /db_xref="GeneID:4621553"
     CDS             complement(join(24180..24577,25244..26519))
                     /locus_tag="AGOS_AFL221C"
                     /old_locus_tag="AFL221C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL112W (DBP2); 1-intron"
                     /codon_start=1
                     /product="AFL221Cp"
                     /protein_id="NP_985329.2"
                     /db_xref="GeneID:4621553"
                     /translation="MSYAGNRDQQFNRSNFGGRDGDHRGQRPSDRNSYGRDGFGRGGR
                     GGFAGRGRGRSDDRLELTKPDWDVESLPKFEKNFYVEHEDVQKMSTDEVEQFRKENEM
                     KIVGHDVPKPIRTFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALSGRDMIGVAAT
                     GSGKTLSYCLPGIVHINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRN
                     TCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDM
                     GFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTIT
                     QLVEVVSDFDKRDRLVKHLEIASKDKDSKIIIFASTKRTCDEITSYLRQDGWPALAIH
                     GDKQQQERDWVLNEFRTGRSPIMVATDVAARGIDVKGINFVINYDMPGNIEDYVHRIG
                     RTGRAGATGTAISFFTEANKTLGAQLISIMREAKQEIPQDLLVYDRAPRGGFHPRYGG
                     RGGRGGRGGRGGRGYGGYGGGYGGYGGGYGGGHGGYGGKPKDSGWGNRN"
     gene            complement(<26750..>27157)
                     /locus_tag="AGOS_AFL220C"
                     /old_locus_tag="AFL220C"
                     /db_xref="GeneID:4621554"
     mRNA            complement(<26750..>27157)
                     /locus_tag="AGOS_AFL220C"
                     /old_locus_tag="AFL220C"
                     /product="AFL220Cp"
                     /transcript_id="NM_210684.2"
                     /db_xref="GeneID:4621554"
     CDS             complement(26750..27157)
                     /locus_tag="AGOS_AFL220C"
                     /old_locus_tag="AFL220C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL113W (RPC19)"
                     /codon_start=1
                     /product="AFL220Cp"
                     /protein_id="NP_985330.2"
                     /db_xref="GeneID:4621554"
                     /translation="MCTPSHLPHTASAMSNTEEQPKDVDMLADEQEDELDRDKIRLLP
                     QATSEDGTCASFQITDEDHTLGNALRYIIMKNPEVEFCGYSIPHPSENFLNIRIQTYG
                     KVTAVDALHKGLQDLMDMCDVVEDKFTQRIREL"
     gene            <27531..>28079
                     /locus_tag="AGOS_AFL219W"
                     /old_locus_tag="AFL219W"
                     /db_xref="GeneID:4621555"
     mRNA            <27531..>28079
                     /locus_tag="AGOS_AFL219W"
                     /old_locus_tag="AFL219W"
                     /product="AFL219Wp"
                     /transcript_id="NM_210685.1"
                     /db_xref="GeneID:4621555"
     CDS             27531..28079
                     /locus_tag="AGOS_AFL219W"
                     /old_locus_tag="AFL219W"
                     /note="NOHBY615; Weak homolog in Saccharomyces cerevisiae
                     YKL032C (IXR1)"
                     /codon_start=1
                     /product="AFL219Wp"
                     /protein_id="NP_985331.1"
                     /db_xref="GeneID:4621555"
                     /translation="MFSRPFNTTAIRAFQTNVSAQIAKKSGTNTLRKTLLKEQSPRRP
                     PAVYALYLKSIMPSVRSEHPNATFVELSRLANNKWKSMSDHQKKPYYDESHRLFKEYH
                     SARAEIEKTLPPKRPSTGFILFCNDVRPHVAAEHPLLKTTDIVRLLGEKWKALPFDKK
                     NRYLDLAARNREQWKLRNGFLS"
     gene            complement(<28250..>31837)
                     /locus_tag="AGOS_AFL218C"
                     /old_locus_tag="AFL218C"
                     /db_xref="GeneID:4621556"
     mRNA            complement(<28250..>31837)
                     /locus_tag="AGOS_AFL218C"
                     /old_locus_tag="AFL218C"
                     /product="AFL218Cp"
                     /transcript_id="NM_210686.2"
                     /db_xref="GeneID:4621556"
     CDS             complement(28250..31837)
                     /locus_tag="AGOS_AFL218C"
                     /old_locus_tag="AFL218C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR050W (TRK2) and YJL129C (TRK1)"
                     /codon_start=1
                     /product="AFL218Cp"
                     /protein_id="NP_985332.2"
                     /db_xref="GeneID:4621556"
                     /translation="MGLARSLSRHPTIQYFHSTYKKTVGHKLRDVISAIVHRLHPIFR
                     KLLPNFIAAHYFYIITMALLCSILVYPVKNAAYIDVLFLSAGAATQGGLNTIDICDLS
                     LYQQIVLYLVSMFTTPIWIHGMLVFVRLFWFERYFDGIKSWSKKNFQMRRTRTLVARE
                     LSRSMSSSRHWPKPDRHLKGSDRRLTRTSTATNDFQNRLFSGKLVNREESNVAPEDKE
                     PRVFSTACSEVAPSPSDSNSKASNRTSSLGTTSVSSGVAPGSISNKSEPDLSRQSPAE
                     PLSAKRDREVTPADLVRSITMMQSQHRKTEDEDGPALVIKGPHERTSGRTSGNEGEDY
                     EDEGVPSRDSTEKTRRLDLRKRPLSGRSSQGGMAWLTPSQSLSAIEQRRSGDYSDVSS
                     ALETATEAHDHPSWKQGGRTAEPTSELPRSTTSAEQLASATNNGPSIHFEIGNMPRPP
                     TRQNLQRHDTGSSKYGESSDNKKSGRPGLLRRLSASGGIKDFLMRNNGSASVTRGDND
                     HVPDSVSSDNDSAIESTGSEENDETGDSRNRTYFRQPSRDAQTPESIRAEDLRRSFRR
                     RRSTGLSLKKLQLSASFNKILGDRVPNALRRKSKRTSNASLTSADHSADSVDSYSNYY
                     DQESGYGGLDLDGNEMSHVMSTNYLSYNPNIGRNSIFIGLTDAQKVELGGVEYRATKL
                     LCRILVTYYFGFHALIVIFLLPWIHSSQKYKDIVASNGVSTTWWAFFTSQSAFNDVGF
                     TLTKDSMLSFSKASFPLVVMIFFIIFGNTGFPILLRFIIWVMFKLAPDLSLMKENLGF
                     LLDHPRRCFTLLFPRAATWWLFLIVVGLNSLDLILFIVLDLNSSLLNGMHAGQKVIDG
                     LFQAVNTRTAGLAVVDLSQLHPSIQVSYMLMMYISVLPVAISIRRTNVYEEQSLGIYG
                     NLMPIIAEASTTGTSAQSRLNKHGSTKEDVNIDQEQDTKSFVRDHLRKQLSFDLWYMF
                     LGLFIICIVEGDRIQDPNEPTFDVFHILFEVVSAYGTVGLSLGFPNTNQSFSAQFKPL
                     SKFVIVAMLIRGRHRGLPYKLDRAIMLPSDKLKQIDNLEDLKLQKTATSNKDPLLQYW
                     RRRAKPVSTGIAQVLSRTKSHTSRSSDHSHIPIAVERGEQATGAPLGPTASGSIKSDY
                     VMRRNSHKSTDQERSPSTISPLQPASEEDMDPSGHPSHTVDAEPNKFLA"
     gene            complement(<32234..>34309)
                     /locus_tag="AGOS_AFL217C"
                     /old_locus_tag="AFL217C"
                     /db_xref="GeneID:4621557"
     mRNA            complement(<32234..>34309)
                     /locus_tag="AGOS_AFL217C"
                     /old_locus_tag="AFL217C"
                     /product="AFL217Cp"
                     /transcript_id="NM_210687.2"
                     /db_xref="GeneID:4621557"
     CDS             complement(32234..34309)
                     /locus_tag="AGOS_AFL217C"
                     /old_locus_tag="AFL217C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL128C (PBS2)"
                     /codon_start=1
                     /product="AFL217Cp"
                     /protein_id="NP_985333.1"
                     /db_xref="GeneID:4621557"
                     /translation="MERNTVQRSGTMQTGGSSSASKNYSNINANLHARVKAFQEQRKL
                     QRSGSVGSKSSGQSQDSAAIQHIVNKPLPPLPPGKGKEAAPPLRRQGSMLKADSRPRS
                     MSSFTGSPPAVGASIADAEPVASAERPAPVLQANVGQEADSMPVQQSIPLKAAAVPGR
                     QPHQKTHSASDIFQRTSSHVLPQIPIPLNPIRKAPRPPDAGMGHQRGRQGSHSGIVLG
                     PQSGAGGTGSASDAPKHIMTKSKPSLSARRGLKLPSGGISLKMKQPLQEFASQPSNKD
                     TALATSGVVPGHRVSKSNPGSLTNGIQTTSTSSDKQVDTKGTEPSKSGNSGTNSNGGL
                     FAVFSKYVDIKSGSLNFAGKLSLSSQGVDFSNGSSFRITLDELEFLEELGHGNYGTVS
                     KVLHKPTNIMMAMKEVRLELDESKFRQILMELEVLHKCQSPYIVDFYGAFFIEGAVYM
                     CMEFMDGGSLDKSYDPHEIGGIEEPQLALITESVIRGLKELKDVHNIIHRDVKPTNIL
                     CSATQGTVKLCDFGVSGNLVASLARTNIGCQSYMAPERIKSLNPDKATYSVQSDIWSL
                     GLSIVEMALGAYPYPPETYDNIFSQLSAIVDGPPPRLPKDTFSSDAQDFVRLCLQKIP
                     ERRPTYASLLEHPWLKKYRGLDVHMSEYITKRLVQRQHYLEQSGGDELPKVLPALHGR
                     LVKPQPHIP"
     gene            complement(<34664..>34813)
                     /locus_tag="AGOS_AFL216C"
                     /old_locus_tag="AFL216C"
                     /db_xref="GeneID:4621558"
     mRNA            complement(<34664..>34813)
                     /locus_tag="AGOS_AFL216C"
                     /old_locus_tag="AFL216C"
                     /product="AFL216Cp"
                     /transcript_id="NM_210688.1"
                     /db_xref="GeneID:4621558"
     CDS             complement(34664..34813)
                     /locus_tag="AGOS_AFL216C"
                     /old_locus_tag="AFL216C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL127C-B"
                     /codon_start=1
                     /product="AFL216Cp"
                     /protein_id="NP_985334.1"
                     /db_xref="GeneID:4621558"
                     /translation="MINFFRQIRNVFKESHAPLQQILLSRRAFFRLLGYLGTCTLLIV
                     VAQNC"
     gene            complement(<34959..>36698)
                     /locus_tag="AGOS_AFL215C"
                     /old_locus_tag="AFL215C"
                     /db_xref="GeneID:4621559"
     mRNA            complement(<34959..>36698)
                     /locus_tag="AGOS_AFL215C"
                     /old_locus_tag="AFL215C"
                     /product="AFL215Cp"
                     /transcript_id="NM_210689.2"
                     /db_xref="GeneID:4621559"
     CDS             complement(34959..36698)
                     /locus_tag="AGOS_AFL215C"
                     /old_locus_tag="AFL215C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL127C (SPT10)"
                     /codon_start=1
                     /product="AFL215Cp"
                     /protein_id="NP_985335.1"
                     /db_xref="GeneID:4621559"
                     /translation="MIFRDSESIPLESNEAHDQEQHDIETYLTVLQPHTILLKDGETT
                     ATMYPIRANSDLLPLGLLAFLLDEFNMEVEKGDSFPYYEPLDLDEFRKMWFHTHGIVC
                     VMVLGEIPELDYSLELSEDQQLLQTEQLRQQGVTTERNTVQYQKRKERRNMNLNIQWE
                     KQCLGTFNLLPAYPGRSSHVVTGTFLVNAGIRGKGIGRTLVERFLEWAPQLGFTSCCF
                     PLVYGTNVGIRRILESSNFKRIGKLPESGILKGYDSPIDSFIYGKEFTHVSKQIDALN
                     SARNDSTKAKYERLKFYLETSEYPASCSRNEKARLRVMSKTHSILNGKLMFKGREVVY
                     EPRRQLEIAYETHAVDHQGINRVTSKVAERYHWKGIKQSVAKVISTCTRCQDTPAHDA
                     QHPGSGLVIDATGPANQTHVVVHAHANDDQLSRVAEAVVGSLQRAEDRDYAESTPADA
                     TPRARAYPPPGQLRRIRFHTQPAAKDPDPSMNSFTRYAEEHLPRSAKKRSRYSSAAHP
                     DSPKSASESATVLLDDTPPIDDALLHLEDNVIAAVEAVRKEQRAASLRRSPNTDDDYV
                     SDDPSFHDDRAYY"
     gene            complement(<36985..>38205)
                     /locus_tag="AGOS_AFL214C"
                     /old_locus_tag="AFL214C"
                     /db_xref="GeneID:4621560"
     mRNA            complement(<36985..>38205)
                     /locus_tag="AGOS_AFL214C"
                     /old_locus_tag="AFL214C"
                     /product="AFL214Cp"
                     /transcript_id="NM_210690.1"
                     /db_xref="GeneID:4621560"
     CDS             complement(36985..38205)
                     /locus_tag="AGOS_AFL214C"
                     /old_locus_tag="AFL214C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL125C (GCD14)"
                     /codon_start=1
                     /product="AFL214Cp"
                     /protein_id="NP_985336.1"
                     /db_xref="GeneID:4621560"
                     /translation="MSYFTEYKDLIAEGDLVLVWISRGNVKQLRIKSGEVFNTRYGSF
                     AHDDIVGRPYGSQIGVRTKGSNRFGFIHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQ
                     RLGCSPQSRVIEAGTGSGSFSHAFARTVGQLFSYEFHHMRYEQALAEFQEHGLIADGN
                     VTITHRDVCQKGFLIKAGDTTSYEFLEGQDSVSVNADCIFLDLPAPWEAIPHLDAVIA
                     KDRTARLCCFSPCIEQVDKTLEALELHGWEEIETVEIQGRQYESRRQMVRQLDDALER
                     LRDVKRRKQHGTERRKRLGEQLGSVEELTDDVRPKTPKTSYNPFGKGSRVKEGDNGFE
                     WKQVAKVESEIKSHTSYLTFASKILFKSRDENTVSQLLEQYKDFNPNVKAASKLDKRP
                     QETSFEESQASNSV"
     gene            <38882..>40270
                     /locus_tag="AGOS_AFL213W"
                     /old_locus_tag="AFL213W"
                     /db_xref="GeneID:4621561"
     mRNA            <38882..>40270
                     /locus_tag="AGOS_AFL213W"
                     /old_locus_tag="AFL213W"
                     /product="AFL213Wp"
                     /transcript_id="NM_210691.2"
                     /db_xref="GeneID:4621561"
     CDS             38882..40270
                     /locus_tag="AGOS_AFL213W"
                     /old_locus_tag="AFL213W"
                     /note="NOHBY614; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E15246g"
                     /codon_start=1
                     /product="AFL213Wp"
                     /protein_id="NP_985337.1"
                     /db_xref="GeneID:4621561"
                     /translation="MPAVLDRPKTYKKPTLEDVDPTINYIPAVVRDKLTHESQEMLQR
                     LRKFVDIECLGKEKLYLRELQAHGYESEQCPTVQLLRTRAEELDLQQLYVRKRVFDNQ
                     EPFYENRLSMLEYCMASFFLGKSQLAQAVMHAHCSMVNVGAMELLLRHGSPEQLSLFL
                     SPMISAQLHSSFMVSESEVSSSDALNVSTTCKIDDSNGTMTLNGSKWFVTSLEDNKCE
                     LWLLLAVTEFDEGNIYKRHSVVLLDKDAIKSEGITYERIDTGGPNSITDSNKYYRVQF
                     KNAVVPLNILGQRGEGFSMVQTRTSLAKLYQCMKLCGTGHEALRLAQLRASSRKVFGS
                     KLQKTDTFKTDVATWKIKIEVCKLLCCNAAVRCQVEGIKVARDDIAMAKIYTPREMSE
                     LVNWSIQIHGALGLCTLESPLLHMWHSCRATRINEGPDEALLSQLGKLEISNFAKNQK
                     TWDDELAKAKSS"
     gene            complement(<40439..>40897)
                     /locus_tag="AGOS_AFL212C"
                     /old_locus_tag="AFL212C"
                     /db_xref="GeneID:4621562"
     mRNA            complement(<40439..>40897)
                     /locus_tag="AGOS_AFL212C"
                     /old_locus_tag="AFL212C"
                     /product="AFL212Cp"
                     /transcript_id="NM_210692.1"
                     /db_xref="GeneID:4621562"
     CDS             complement(40439..40897)
                     /locus_tag="AGOS_AFL212C"
                     /old_locus_tag="AFL212C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL124C (LSM1)"
                     /codon_start=1
                     /product="AFL212Cp"
                     /protein_id="NP_985338.1"
                     /db_xref="GeneID:4621562"
                     /translation="MSHSKISEGEADLYLDQYNFTTTAAIVGSVDRKIFVLLRDGRML
                     FGVLRTFDQYANLILQHCVERIYIPEEGQYGECERGVFMVRGENVVMLGEVDIDKEDK
                     PLEQLERVPFEEAARYRDGQNETKFKVETQKSKELARYGLIHDFNKSDMY"
     gene            <41324..>41725
                     /locus_tag="AGOS_AFL211W"
                     /old_locus_tag="AFL211W"
                     /db_xref="GeneID:4621563"
     mRNA            <41324..>41725
                     /locus_tag="AGOS_AFL211W"
                     /old_locus_tag="AFL211W"
                     /product="AFL211Wp"
                     /transcript_id="NM_210693.1"
                     /db_xref="GeneID:4621563"
     CDS             41324..41725
                     /locus_tag="AGOS_AFL211W"
                     /old_locus_tag="AFL211W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR049C (FMP46)"
                     /codon_start=1
                     /product="AFL211Wp"
                     /protein_id="NP_985339.1"
                     /db_xref="GeneID:4621563"
                     /translation="MSLLRTLQMQPRVITVFAEHANVGAASEILGALKTASGPKCKVQ
                     VSTMFPTLEQLIYMSEINRTAVAAQVPRLSELLQKPSFSEEFSSPLAQCTQDGVWRSQ
                     GGLWVDWEKRLLGADGQSVHELLGSSTMTID"
     gene            complement(<41782..>43047)
                     /locus_tag="AGOS_AFL210C"
                     /old_locus_tag="AFL210C"
                     /db_xref="GeneID:4621564"
     mRNA            complement(<41782..>43047)
                     /locus_tag="AGOS_AFL210C"
                     /old_locus_tag="AFL210C"
                     /product="AFL210Cp"
                     /transcript_id="NM_210694.2"
                     /db_xref="GeneID:4621564"
     CDS             complement(41782..43047)
                     /locus_tag="AGOS_AFL210C"
                     /old_locus_tag="AFL210C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL123C (MTC1)"
                     /codon_start=1
                     /product="AFL210Cp"
                     /protein_id="NP_985340.2"
                     /db_xref="GeneID:4621564"
                     /translation="MTGAGKPSEADEVLEFLDSLPDGAGKKGGQTGTPNAEGNEDILE
                     FLDELEQSNLKVDAKKPAGAAVGVQKTVKAAGDTKGAAATGKAAAGVQKAAGDSAEAA
                     PLRAGQPEKQEVAEELHDPIKSLSNWWSSSGQATVSSIWSKTTERATQLKDRITLEQQ
                     DLTTKLNTNPIASKLSNATMLSELTSQLTKFVVGETEEVLRIHLVHDLVNFHDLSYEV
                     ESQFHDVLSSQVQGGIRIFVDQWDRPNESAAEGPAGNIHGLNMFQGKPTEGDKLCRAN
                     LDNAMKLFQKAMEESRRQRRERDIEAAADEESRISDVFIGILAVGQPQKGDEGAVVDS
                     THVGSFSFTIHLEDMSNGVSLLVRSQGFPIRWAGWLEGKSDLKKKEDEKPLEGEIDPS
                     EWVKDWIDKGLALSIGVLAQNYVIERMGV"
     gene            <43540..>44022
                     /locus_tag="AGOS_AFL209W"
                     /old_locus_tag="AFL209W"
                     /db_xref="GeneID:4621565"
     mRNA            <43540..>44022
                     /locus_tag="AGOS_AFL209W"
                     /old_locus_tag="AFL209W"
                     /product="AFL209Wp"
                     /transcript_id="NM_210695.1"
                     /db_xref="GeneID:4621565"
     CDS             43540..44022
                     /locus_tag="AGOS_AFL209W"
                     /old_locus_tag="AFL209W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL122W (ALB1)"
                     /codon_start=1
                     /product="AFL209Wp"
                     /protein_id="NP_985341.1"
                     /db_xref="GeneID:4621565"
                     /translation="MPSKNSINRPKQKLNLQHRVQKNAAKRSARERAGLLAPPRSSDQ
                     SQSGRAKSIPLDLFRGERVDQGPITTKTLSKKRAKKIERNLRYVEQRKLLVDVQAARE
                     SGMDIDVETAVSTKAKTQQTGPLQKVKESIWSALEDVAAQEMIVQTGAGTTLGGQFFP
                     "
     gene            complement(<44149..>44868)
                     /locus_tag="AGOS_AFL208C"
                     /old_locus_tag="AFL208C"
                     /db_xref="GeneID:4621566"
     mRNA            complement(<44149..>44868)
                     /locus_tag="AGOS_AFL208C"
                     /old_locus_tag="AFL208C"
                     /product="AFL208Cp"
                     /transcript_id="NM_210696.1"
                     /db_xref="GeneID:4621566"
     CDS             complement(44149..44868)
                     /locus_tag="AGOS_AFL208C"
                     /old_locus_tag="AFL208C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL121C (RPE1)"
                     /codon_start=1
                     /product="AFL208Cp"
                     /protein_id="NP_985342.1"
                     /db_xref="GeneID:4621566"
                     /translation="MVKPIIAPSILASDFANLECGCHRVINAGAEWLHIDVMDGHFVP
                     NITLGPPIVKSLRKAVPRVGDKESDKPKAFFDCHMMVAEPEKWVDVFVENGADQFTFH
                     YEATKNPLELVKLIKSRGIRAACAIKPDTPVDVLFELAPYLDMALVMTVEPGFGGQKF
                     MPDMMPKVAALREKFPQLDIQVDGGLGKETIPHAAKAGANVIVAGTSVFAAADQKDVI
                     SYMKDNVRDELRSRGLLDIDM"
     gene            complement(44965..45049)
                     /locus_tag="AGOS_t0130"
                     /db_xref="GeneID:4621567"
     tRNA            complement(join(44965..45001,45011..45049))
                     /locus_tag="AGOS_t0130"
                     /product="tRNA-Tyr"
                     /codon_recognized="UAC"
                     /db_xref="GeneID:4621567"
     gene            complement(<45815..>47434)
                     /locus_tag="AGOS_AFL207C"
                     /old_locus_tag="AFL207C"
                     /db_xref="GeneID:4621568"
     mRNA            complement(<45815..>47434)
                     /locus_tag="AGOS_AFL207C"
                     /old_locus_tag="AFL207C"
                     /product="AFL207Cp"
                     /transcript_id="NM_210697.1"
                     /db_xref="GeneID:4621568"
     CDS             complement(45815..47434)
                     /locus_tag="AGOS_AFL207C"
                     /old_locus_tag="AFL207C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)"
                     /codon_start=1
                     /product="AFL207Cp"
                     /protein_id="NP_985343.1"
                     /db_xref="GeneID:4621568"
                     /translation="MSRQVLHSDMRSVGTEVSAASQKKYLMEETVDIPTKPATAYITV
                     CLLCVFVAFGGFIFGWDTGTISGFVNQTDFRRRFAQVNDEGGYYWSNARVGLIVAIFN
                     IGCAVGGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIGRVISGLGV
                     GGIAVLSPMLISETSPKHLRGTLVSCYQLMITAGILLGYCANYGTKSRYDDSRQWRIP
                     LGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLATSNKVPVDDPAILAEVNNI
                     QAGVELERMAGSASWGELFTVRTKILQRVIMGAMIQSLQQLTGNNYFFYYGTTIFDSV
                     GLEDAFKTSIILGAVNFGSTFVAMYTVDRFGRRKCLLYGAAAMAVCMVIFASVGVTRL
                     WPNGPDQPSSRPAGNAMIVFTCLYIFFFATTWAPIAYVIVSETFPLRVKAKGMAIATA
                     ANWIWGFLIAFFTPYITNAIRFYYGYVFMGCLIFAFFYIFFFVPETKGLTLEEVEEMW
                     QEGVVPWRSESWVPSARRHAPYSSDKQAAGI"
     gene            complement(<48062..>50008)
                     /locus_tag="AGOS_AFL206C"
                     /old_locus_tag="AFL206C"
                     /db_xref="GeneID:4621569"
     mRNA            complement(<48062..>50008)
                     /locus_tag="AGOS_AFL206C"
                     /old_locus_tag="AFL206C"
                     /product="AFL206Cp"
                     /transcript_id="NM_210698.1"
                     /db_xref="GeneID:4621569"
     CDS             complement(48062..50008)
                     /locus_tag="AGOS_AFL206C"
                     /old_locus_tag="AFL206C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR341C and YHR091C (MSR1)"
                     /codon_start=1
                     /product="AFL206Cp"
                     /protein_id="NP_985344.1"
                     /db_xref="GeneID:4621569"
                     /translation="MLSGISAAYSISSLISSRRIFPAALRFTVTRVHSFRQHINIKMP
                     GDTISQQLAKLSIQAPTKMAGSHPEANVVDLIRNYITDELSRISGVAGPLIYEALEWT
                     NTLERGDLLIPVPRLRIKGSNPKDLAAEWAVAFPCGEYLDRVEANGSFIQFFFKPQFL
                     FNVVVPDVLTRKEDYGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYE
                     KMGWEVIRMNYLGDWGKQFGLLAVGFEKYGSEEALEKDPINHLFDVYVRVNKDIEQEG
                     DSLPLEESTNGRARAYFKKMEDGDPEALKIWQKFRELSIQKYIDTYARLNIQYDVYSG
                     ESQVKKESMENALKLFQEKGLTHEDKGAILIDLTKFNKKLGKTIVQKSDGTTLYLTRD
                     VGAAMDRYEKYKFDKMIYVIACQQDLHTAQFFEILKQMGHKWAENLHHVNFGMVQGMS
                     TRKGTVVFLDNILEETKEKMHEVMRKNEVKYAQVENPDEVADLVGISAVMIQDMQAKR
                     INNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNASEITPEKWVTADFSVLTEAAAV
                     TLVRLLAQYPDVLRNALKTHEPATIVTYLFKLTHQVSSCYDILWVAGQAPEVATARLA
                     LYASCRQVLNNGMRLLGLTPVDRM"
     gene            complement(<50502..>52142)
                     /locus_tag="AGOS_AFL205C"
                     /old_locus_tag="AFL205C"
                     /db_xref="GeneID:4621570"
     mRNA            complement(<50502..>52142)
                     /locus_tag="AGOS_AFL205C"
                     /old_locus_tag="AFL205C"
                     /product="AFL205Cp"
                     /transcript_id="NM_210699.1"
                     /db_xref="GeneID:4621570"
     CDS             complement(50502..52142)
                     /locus_tag="AGOS_AFL205C"
                     /old_locus_tag="AFL205C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR094C (HXT1)"
                     /codon_start=1
                     /product="AFL205Cp"
                     /protein_id="NP_985345.1"
                     /db_xref="GeneID:4621570"
                     /translation="MSAAIAQPDNRSVMSTHSSTASNKPSKEENKESGLVEIPVKPAS
                     AYITVSLLCILVAFGGFIFGWDTGTISGFVNQSDYKNRFGELNESGDYYLSDNRTGLI
                     VAIFNIGCAVGGIFLSKFADMYGRRIGLMIVTLVYVIGIVVQISSTDKWYQYCIGRVI
                     SGLGVGGIAVLSPMLISETSPKHLRGMLVSCYQLMITAGIFVGYCANYGTKAKYEDSK
                     QWRIPLGLSFAWAILMIGGMVLVPESPRYLVEVNKYEDAKRSLARSNKVPVDDPSIQA
                     EFDNIHAGIELERMAGSASWGELFSTKSKILQRVIMGVMIQSLQQLTGNNYFFYYGTT
                     IFKSVGLEDSFQTSIILGAVNFGSTFVAVWAVGKFGRRRLMLAGAAAMTVCMVIFASI
                     GVTKLWPNGEDQPSSKPAGNVMIVFTCIYIFCFATTWAPIPFVIVSETFPLRVKAKGM
                     AIATAANWIWGFLIAFFTPKITNAIKFNYGYVFMGCLIFAFFYMFFFVPETKGLTLEE
                     VEEMWQEGVVPWKSESWTPSYKRNAYETEEVKPEKTWA"
     gene            complement(<53050..>54657)
                     /locus_tag="AGOS_AFL204C"
                     /old_locus_tag="AFL204C"
                     /db_xref="GeneID:4621571"
     mRNA            complement(<53050..>54657)
                     /locus_tag="AGOS_AFL204C"
                     /old_locus_tag="AFL204C"
                     /product="AFL204Cp"
                     /transcript_id="NM_210700.1"
                     /db_xref="GeneID:4621571"
     CDS             complement(53050..54657)
                     /locus_tag="AGOS_AFL204C"
                     /old_locus_tag="AFL204C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR096C (HXT5) and YDR342C (HXT7)"
                     /codon_start=1
                     /product="AFL204Cp"
                     /protein_id="NP_985346.1"
                     /db_xref="GeneID:4621571"
                     /translation="MTVSEGMTPSKSELSGDGSNSHPIESKKDIVSVISTETKPFSAY
                     IFACLCCFMVAFGGFIFGWDTGTISGFVKQTDFIARFGQLSPSGEYELSDDRTGLIVS
                     IFNIGCAVGGIFLSKIGDAYGRKIGLATVTAVYVIGIVIQISASDKWYQYFVGRIISG
                     LGVGGIAVLSPMLISETSPKHLRGSLVSCYQLMITAGIFLGYCTNYGTKTNYTDSRQW
                     RIPLGLGFAWALLMIGGMAFVPESPRYLVEAENLPKARMSIARANKVAEDHPIVEHEL
                     NTLQTAIELEKLAGKARIVDLFNVKKKIFQRLIIGIFIQSLQQLIGNNYFFYYGTTIF
                     NAVGMDDPFVTSIVLGIVNFGSTFFSLYTVDKFGRRKCLIWGAFAMAICMAIFASVGV
                     TKLWPNGEDQPSSKPAGNVMIVFTCIYIFFFATTWAPIAYVIISEIYPLRVKARAMAL
                     ATAANWIWGFLIAFFTPRITSAIKFCYGYVFMGCLIFAFFYIFFFVPETKGLTLEDVD
                     EMWQEGVVPWGSESWLPRSDREVAHDA"
     gene            complement(<55339..>56496)
                     /locus_tag="AGOS_AFL203C"
                     /old_locus_tag="AFL203C"
                     /db_xref="GeneID:4621572"
     mRNA            complement(<55339..>56496)
                     /locus_tag="AGOS_AFL203C"
                     /old_locus_tag="AFL203C"
                     /product="AFL203Cp"
                     /transcript_id="NM_210701.1"
                     /db_xref="GeneID:4621572"
     CDS             complement(55339..56496)
                     /locus_tag="AGOS_AFL203C"
                     /old_locus_tag="AFL203C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR346C (SVF1)"
                     /codon_start=1
                     /product="AFL203Cp"
                     /protein_id="NP_985347.1"
                     /db_xref="GeneID:4621572"
                     /translation="MLKWIQGGISSVTGIAEPEYGPEFIHSATERVRGKQPFHETSRQ
                     DLAWRNISSTHVETATFYFTQIQTGMAGFAQIIYSKIGGLPRTAQFTFRLHHASRPEL
                     GTWTSTKLENFRVEGANFYADNLSLELDSTATSYTLQSSVTADSVVDITFKRLTPGVK
                     VGEDPTTYYGDNTKEPWGTMRHVFWPRNSVNGTVVVHGEMITLKNDYSVMILALQGMK
                     PHHAAKAWNFLNFHSETHSVLLMEFTTPKSYANTKVSIGILCDKDSVLSVTIDNEVEH
                     VKPKTDEVGWPVPKALSMKFTGIPSSVPDKEVASAEKLSARVDIELKNLVERVDVMAE
                     IPAFVKNIVSGVVGTKPYIYQYANEALLTYAGSEYKGFAWSEVTFISEFEN"
     gene            complement(<57613..>59058)
                     /locus_tag="AGOS_AFL202C"
                     /old_locus_tag="AFL202C"
                     /db_xref="GeneID:4621573"
     mRNA            complement(<57613..>59058)
                     /locus_tag="AGOS_AFL202C"
                     /old_locus_tag="AFL202C"
                     /product="AFL202Cp"
                     /transcript_id="NM_210702.2"
                     /db_xref="GeneID:4621573"
     CDS             complement(57613..59058)
                     /locus_tag="AGOS_AFL202C"
                     /old_locus_tag="AFL202C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL106C (PHO2)"
                     /codon_start=1
                     /product="AFL202Cp"
                     /protein_id="NP_985348.2"
                     /db_xref="GeneID:4621573"
                     /translation="MDNFEYPGGEFGRFNQEFGSPEEMLNNGHGELRSDNGEATGNSK
                     SPGHGELAEAADGGKPKSKRTRATGEALELLKKEFDINPNPNAQNRKRISEQTGLPEK
                     NVRIWFQNRRAKYRKSDRTFNQRTAATDMNTFGSISVTVEYDKIPLNINDNYYFIDAN
                     SLTVGSWKRLKSGNLHRESLSNIKYLSNLSPTSINMIMSNATDLMVLISKKNFEVNYF
                     FSAIANNTKILFRIFFPINSVLNCSLLLHAEGGKKDEDDANNVVQETTAPAAEQVCEL
                     KLNVSKPPNFAVYFSDMNDELTSNQWSICEDFSEGRQVSDAYVGGSNFPHVLTGLEAS
                     LKFMSSLILDYNSTTHVVPHAQPQPHPHSHPHHSSDPAQAIVLQPEPHSLAQSAFFRN
                     YGPHSTDDILDIQDPDQYETAQTTNTEFPSTSTAAGSHFLTAHLADTQIPKTPEFLNQ
                     HTDLHNDDQHGLNNLLNFNDQPHTSNAEQYY"
     gene            <59887..>61380
                     /locus_tag="AGOS_AFL201W"
                     /old_locus_tag="AFL201W"
                     /db_xref="GeneID:4621574"
     mRNA            <59887..>61380
                     /locus_tag="AGOS_AFL201W"
                     /old_locus_tag="AFL201W"
                     /product="AFL201Wp"
                     /transcript_id="NM_210703.1"
                     /db_xref="GeneID:4621574"
     CDS             59887..61380
                     /locus_tag="AGOS_AFL201W"
                     /old_locus_tag="AFL201W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR170C (ALD2) and YMR169C (ALD3); Tandem gene duplication
                     in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AFL201Wp"
                     /protein_id="NP_985349.1"
                     /db_xref="GeneID:4621574"
                     /translation="MSELFEEINVPETGFTYLQPLGLFIDNEFVAPMGGSQLQTTNPA
                     NGELIATFYAAGAADVDAAVAAARRAYEERWRHTSAQERGALLARLAELVDEEREVLA
                     GIETLDSGKPYHTNALADLDQVAYVTRYYAGGADKMHQGDAFALSHTKQAYTLEVPYG
                     VVAQIVPWNYPLAMASWKAQGCLAAGNCVVIKPSENTSLSLLYFASLVRRAGFPPGVF
                     NVLPGLGPEVGQRLAEHKGVDKIAFTGSTAVGQKVMAAAAMSNLKDVTLECGGKSPAV
                     IFADADLDSAVNYVAAGIFYNSGQNCTANSRIYVQEAVYDAFLDKFRAHVRSTYSFGS
                     GLFSKDCNMGPVISKTQYDRVMGYINHGINEKLAYEQFGSVPEKGYYIPPTIFLDVPQ
                     SSRLCREEIFGPVAVVAKFKDYDEAIRYANDTNYGLASCVFTENIRVAHRFVRDVQSG
                     TVWVNSSNDEEVGVPFGGFKMSGIGRELGKAGLQTYLQTKAVHLNFA"
     gene            <61572..>63362
                     /locus_tag="AGOS_AFL200W"
                     /old_locus_tag="AFL200W"
                     /db_xref="GeneID:4621575"
     mRNA            <61572..>63362
                     /locus_tag="AGOS_AFL200W"
                     /old_locus_tag="AFL200W"
                     /product="AFL200Wp"
                     /transcript_id="NM_210704.1"
                     /db_xref="GeneID:4621575"
     CDS             61572..63362
                     /locus_tag="AGOS_AFL200W"
                     /old_locus_tag="AFL200W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR168C (CEP3)"
                     /codon_start=1
                     /product="AFL200Wp"
                     /protein_id="NP_985350.1"
                     /db_xref="GeneID:4621575"
                     /translation="MARSTIIASKPCAVCIKRKVKCDRLVPCTNCVKRGGAAECERAD
                     TIKRPRLGNPSPGSDWLLLWQEYEYWVLKVGIFKDMPSNKRAAVDLNADLKAVKFWSN
                     YLQAETSFKLLDYSMEKLGGLYFGCLSDIGELYLKLEEYWARRENKDEPSSIDEYLWD
                     TLIWAVLTMAVYYMPLSELSSIMDDQPVVDWYGQKIPGWSEELQHGLYYGFLRTALTH
                     LKMADFMSCSDVRIIQIYLILSSTSFIQLERSLADSVLVQCIHVAKALQVDQFRPMVS
                     DSAALRLTKLTAQKIWYRLCFCDYLQSGPNKLLCIHTENDSLITHAAYYEEMPGVDIY
                     QSEDTYETLLWKLISLDRDLEQYSLKKPSLKSLDAIRRQLDIFTVKLDSIDDIHSFNS
                     KFESFQSRLILNLTYWKSCKLFLSYYSSQTSNDQLNTYTEIIIALVLKNIKSNLSSFN
                     RNPYVLYALSLLLGYHSMKNVFDYSEQNEQLVVDLRELLKTYLVAFQPTCIKILLVAK
                     RVTKLAYLWKNIRIIDTDDPVQHPVFKILKADIKAVQKKMNKLPTLLNFDTSAIALED
                     EGETKESTEFRAIIKEFETQNSFQKILYGN"
     gene            complement(<63372..>65744)
                     /locus_tag="AGOS_AFL199C"
                     /old_locus_tag="AFL199C"
                     /db_xref="GeneID:4621576"
     mRNA            complement(join(<63372..65537,65595..>65744))
                     /locus_tag="AGOS_AFL199C"
                     /old_locus_tag="AFL199C"
                     /product="AFL199Cp"
                     /transcript_id="NM_210705.1"
                     /db_xref="GeneID:4621576"
     CDS             complement(join(63372..65537,65595..65744))
                     /locus_tag="AGOS_AFL199C"
                     /old_locus_tag="AFL199C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR167W (MLH1); 1-intron"
                     /codon_start=1
                     /product="AFL199Cp"
                     /protein_id="NP_985351.1"
                     /db_xref="GeneID:4621576"
                     /translation="MGISDAQRIPDFHHVRVTEKHSAALILNATTSYLQRCVPQYRMH
                     LPSRIKALEASVVNKIAAGEIIISPVNALKEMMENSIDAGATNVDILVKDGGIKMLQI
                     SDNGCGIMKDDLPILCERFTTSKLKSFEDLSRIQTYGFRGEALASISHIARLHVVTKT
                     KENQCAWKAVYENGVMVGEPKPTAGKDGTTILVQDLFYNVPSRLRALRSPSEEFAKIV
                     DVVGKYAIHSDGVGFSCKKFGETQYALNVRGTSSKSDKIRAVFGAPVVANLVEVDISA
                     DPEHGLTSSSGQITTPDFNNKKSIPAVFFINNRLVSCDPLRRALSQVYSNFLPKGNKP
                     FIYMSLHITPENVDVNVHPTKREVRFLYEEELIERIGNLLHERLSQLDTSRTFKPGSL
                     TPGKHSSTVSSAFRQSATPASTQPKAKRAENMLVRTDGSQAKITNYVRASQSSTSSSF
                     STSLRKKSHAAASDELGSIGEDSQDTATSMTTSTQEPNHTKSRAILTLLNNEYEVVQR
                     ERTEVNLTSIKTLKQEVDEDMHKELTSVFADMTYVGVVDATRRLASIQHGLKLFLVDY
                     GSLCNELFYQIGLTDFANFGKIYIQDEVENREGLAIYQLLSKIDNASQSNILEITQQL
                     WDMREMLENYYSIEICGDETDLTNVRIKSVPLLLKDYVPPLSKLPFFLYRMGTKVDWS
                     SEKECLEGILRQLALFYIPEIIEHVDINDDTIDGDVRAYYISKAEHIGTVLEQVVFPT
                     IKRRLLASTRLLKDIVEVANLPGLYKVFERC"
     gene            <65813..>66967
                     /locus_tag="AGOS_AFL198W"
                     /old_locus_tag="AFL198W"
                     /db_xref="GeneID:4621577"
     mRNA            <65813..>66967
                     /locus_tag="AGOS_AFL198W"
                     /old_locus_tag="AFL198W"
                     /product="AFL198Wp"
                     /transcript_id="NM_210706.1"
                     /db_xref="GeneID:4621577"
     CDS             65813..66967
                     /locus_tag="AGOS_AFL198W"
                     /old_locus_tag="AFL198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL105W (NSE4)"
                     /codon_start=1
                     /product="AFL198Wp"
                     /protein_id="NP_985352.1"
                     /db_xref="GeneID:4621577"
                     /translation="MSDDAVNPKRRRLTSPDKGGAERGASGKEFQILQGYRNFEDDVA
                     HDRATVARTGDISVAVQRLEEVNMLFKQAGDLNLSVNSLFAQDSHAVMSVSELASLSI
                     RNLKLTNAGKLLSPEEFVNGAKRFLLEDYLELNHVSVPGSMYPETDDASNTQNDSIEN
                     DGDATSDALDESTNQHADAALRQSMQRNSYLRQFEAYGDFAQFNWFKMGALFQQLGGA
                     PTLVDHMLGPLAVQKKTRVATQRRAVENVGAKTTAEAVTRETLNSNQSETTPEQVKKC
                     FQVLIQKNGYNSISLFRFIIDPSSYARSIENLFYTSFLIKEGRLVLEDDDEGFPAIRP
                     KEPLPQDPAEKELERQRRNDARQKHIIFQMDMATWRKLIDKFHITESFLP"
     gene            complement(<66989..>68143)
                     /locus_tag="AGOS_AFL197C"
                     /old_locus_tag="AFL197C"
                     /db_xref="GeneID:4621578"
     mRNA            complement(<66989..>68143)
                     /locus_tag="AGOS_AFL197C"
                     /old_locus_tag="AFL197C"
                     /product="AFL197Cp"
                     /transcript_id="NM_210707.2"
                     /db_xref="GeneID:4621578"
     CDS             complement(66989..68143)
                     /locus_tag="AGOS_AFL197C"
                     /old_locus_tag="AFL197C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL104C (QRI7)"
                     /codon_start=1
                     /product="AFL197Cp"
                     /protein_id="NP_985353.1"
                     /db_xref="GeneID:4621578"
                     /translation="MLALPGALWRRLGRSYRVLSIETSCDDTCVAILDRSSRYRAPAV
                     VCHYRETLDSASDGGVVPTKAHEHHQRRIGGLVGRALESGPVDLICATRGPGMPGSLS
                     AGLTFGKALSVGLRRPLVGVHHMVGHLLVPRLASNGREPQFPFLSLLVSGGHTMLVLS
                     RSAVDHEVLCNTIDVAVGDALDKCARVLGLRGNMIAREMERFIDEDPPGARRRELLPL
                     VLPTPLANKAKRRDVQAFSFCPFITAVNRGLEGHAAPLSEAERRVAAFQIQEAIFDHL
                     ITKINLVLRLNADKVADVAQFVCSGGVCANRRLRARLETELFRPFDSFHYPAPDLCTD
                     NAVMIGWAGIELYEGHGLTTDVAALTIAKWPIDELLAVPGWVSARPAGDT"
     gene            <68418..>69503
                     /locus_tag="AGOS_AFL196W"
                     /old_locus_tag="AFL196W"
                     /db_xref="GeneID:4621579"
     mRNA            <68418..>69503
                     /locus_tag="AGOS_AFL196W"
                     /old_locus_tag="AFL196W"
                     /product="AFL196Wp"
                     /transcript_id="NM_210708.1"
                     /db_xref="GeneID:4621579"
     CDS             68418..69503
                     /locus_tag="AGOS_AFL196W"
                     /old_locus_tag="AFL196W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR166C"
                     /codon_start=1
                     /product="AFL196Wp"
                     /protein_id="NP_985354.1"
                     /db_xref="GeneID:4621579"
                     /translation="MFSFTSSIPVVGTHHEGGVHTRGGQKAGADGHEGDMPDRSSPEG
                     EPSSAHSPLLHCVLAGGIGGAIGDSVMHSLDTVKTRQQGAPGEVKYRHMISAYRTLAL
                     EEGVRRGLYGGYGAAMLGSFPSAAVFFGTYEWVKRQMINEWQIHETYSHLAAGFLGDL
                     FSSVVYVPSEVLKTRLQLQGCYNNRHFQSGYNYRGLSDAVRTIVRTEGVSALFFGYKA
                     TLSRDLPFSALQFAFYERFRKWAFLLERKPVDGHLSFTAEVVTGASAGGLAGIITTPL
                     DVVKTRIQTQPRGSAGTPDASAPARLNGSIFRSLLVVLRYEGLGGAFSGVGPRFIWTS
                     IQSSIMLLLYQTALRTLARSPRAEPAS"
     gene            <70036..>72114
                     /locus_tag="AGOS_AFL195W"
                     /old_locus_tag="AFL195W"
                     /db_xref="GeneID:4621580"
     mRNA            <70036..>72114
                     /locus_tag="AGOS_AFL195W"
                     /old_locus_tag="AFL195W"
                     /product="AFL195Wp"
                     /transcript_id="NM_210709.2"
                     /db_xref="GeneID:4621580"
     CDS             70036..72114
                     /locus_tag="AGOS_AFL195W"
                     /old_locus_tag="AFL195W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR165C (PAH1)"
                     /codon_start=1
                     /product="AFL195Wp"
                     /protein_id="NP_985355.1"
                     /db_xref="GeneID:4621580"
                     /translation="MQYVGRAIGSVTKSWSSINPATLSGAIDVIVVEHMDGEMSCSPF
                     HVRFGKFQIFKPSQKKVEVIVNGQPTDIPMKLGDTGEAYFVFQMDTDLNNIPEELITS
                     PVVSAASSPSLSPRISPGDDKKLPEPDFLDINDGSTDGTFSPKTEGDYVSTVERPVTP
                     TLKSGSVFKERLNKKLEQKRIPNRVDNKGNLLLDIEGYKSNQERVHDTDEMLKMLLQE
                     ELGQDNDISPFVKEDDNGHIRIVNPYDHLSGGPSPPSSPASSSLSMETVPSNNNGSEV
                     QSEYTDSLQSLETLSPLPKNPTGANYIKSIRLTSDQLHCLDLKYGENDLTFSVDKGRA
                     FVTAKLFLWKWDVPIVISDIDGTITKSDALGHVLTMIGKDWTHPGVAKLFTEIQRNGY
                     NIMYLTARSAGQADSTRSYLRCIQQDGCTLPFGPVILSPDRTIAALRREVILKKPEVF
                     KIACLNDIRKLYFHELQAADAETAPADGQPTPFYAGFGNRITDALSYRTVGIPSSRIF
                     TINPDGEVHMELLELTALRSSYVHINELVDQFFPHIRHSYLPDDDLKSLSPTPGSPAF
                     HPEERSFYRQHDEKFSDFNYWRDPVPNLDDLSDSSSVCSAEPSSPAPSTSPTPAPDPP
                     LEPLASPDPPRPPIDALLPLQPPGLGVRITAPLPRPAAPPTAPADLSDDDYSDDEFDE
                     DEFDDDDFPP"
     gene            <72669..>76175
                     /locus_tag="AGOS_AFL194W"
                     /old_locus_tag="AFL194W"
                     /db_xref="GeneID:4621581"
     mRNA            <72669..>76175
                     /locus_tag="AGOS_AFL194W"
                     /old_locus_tag="AFL194W"
                     /product="AFL194Wp"
                     /transcript_id="NM_210710.2"
                     /db_xref="GeneID:4621581"
     CDS             72669..76175
                     /locus_tag="AGOS_AFL194W"
                     /old_locus_tag="AFL194W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR164C (MSS11)"
                     /codon_start=1
                     /product="AFL194Wp"
                     /protein_id="NP_985356.2"
                     /db_xref="GeneID:4621581"
                     /translation="MDGITSNWGASSGRSSAGGKTGADAPDGHGDENGRADGGGGLLS
                     DVLVSDAMAKNSRQLLHAHIYNYLVHNKHHETAKRFLKEADVPLSKVIPDGTMDGQQL
                     LYARMLMNSPETFLLEWWESLWALHELVESQPVEALMLNRTFNERITPILPQHMLVPA
                     QAAPGLAHQQPPYMAQPPHAPQAQARPAQHMQLPQAAGRPGPRQVLPQQQGHSPHLMG
                     MGMYTQPSPTQAQAPVQPSPESQPFQQQQRQQPHHTSMGVPLQSSGQHVGQPALSHSP
                     TAPISRNPQLQQGAPIQKSAGRQFPSSGGVPNLSSSPYNPPSSMQAVQYSPMYPQSPM
                     MLNMNQPVNMHSQQTRAQQPQNNVNHSSSVGGTGPPMDPMVAYIQQQQQQQQQSQSQQ
                     QQQQQQQQPQSQPQQQQQQQQSQPQPQQKPQQTQPQQQQQQTQQQTPPPQQTPPQQQA
                     PPTLQKPKPQQSQQQQQQQSSPSQPQHHQQPQALPPAPLPQAPEPAQQHSQQPQPQQQ
                     PQAQQAKSPSQQHHQQQAQAQAQQQQDSQQEAPQTHTQIQAQAQAQAHAHAHAQAQAH
                     AQAQAHAQAQAQAQAQAQAQAQAQAQAHAQAQAQAQAQSQSQSQPQAQVQAQSQAAQA
                     QAQNQAQQTQVPPPQHAQQQLQSQPQQLKKNIQLQEMQQLHAQQMVYQMQSQQQRQVS
                     NIQKRPRRPKRESPQRILESPKKKGHLSVPAMPAMASLTASTGPGSSQLKKMMPNNLE
                     KIEIKGQKTNTQQAQLNWTKLQQQQLQQQVQQKQEQHQDELEQQHQQQHQEKEQEQHQ
                     QQHTPNHQLQLDKQSQDQLQQKSNIEGGTEAQPQQQTPQSATPQPRQLSQHQIQAHQQ
                     LSHDTKAEEQSLTEHQKAEEATPKRVQQVQFTQASLHIQPSAMIRDDHMVQESEKEQE
                     PQSQKHHLHHPNNQQQLTDPTPARGQPPPQLHPEQQQRKQGSPIRTSQPQGQASHLKQ
                     PLRKPSHQSHNQPSYLAQNMSQSQGLQQLDFMNPMSMIPPVRAATAGNISVQPIAESS
                     SAASQHHVMSTPYGPAGVNPEVDGLDPLFFQQQVRFPGSILDPAMFKTPAYAQLSSQA
                     SRKNPPDNVSDKKGRKQTGASFQPAQDGLQSVQDMNTILPDTSSQDRAEDQSLSTPLN
                     MDMDLDHFDITVFNNDFMGSWK"
     gene            <76779..>78737
                     /locus_tag="AGOS_AFL193W"
                     /old_locus_tag="AFL193W"
                     /db_xref="GeneID:4621582"
     mRNA            <76779..>78737
                     /locus_tag="AGOS_AFL193W"
                     /old_locus_tag="AFL193W"
                     /product="AFL193Wp"
                     /transcript_id="NM_210711.1"
                     /db_xref="GeneID:4621582"
     CDS             76779..78737
                     /locus_tag="AGOS_AFL193W"
                     /old_locus_tag="AFL193W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR163C (INP2)"
                     /codon_start=1
                     /product="AFL193Wp"
                     /protein_id="NP_985357.1"
                     /db_xref="GeneID:4621582"
                     /translation="MYYTPKGLLSGRPGQTMVRESESATGGEGIYAGSPLGNALDWGI
                     DVYTDRSPTVVNDDFEPLDSTMDELFLFPTCRDSYSGTPMGELIRRVFEHGALGGEHF
                     LEEFQYTIITSKGLNVNGMTAPVSSVTGISELNNQNAGPGKTMVHAPTKYGRLVGSRK
                     VLYLRKTVSFLPVALFCVRCFRRLLLVRSKSRKNIIVALLVAIYLALQQENFHSRYVR
                     HATMMNLGKMLNSWSDVEARMHRYHIRLKELTIYRPITLTGGKPPTYPTNNHSLLADL
                     LNMASDMLYYKIKHIVTELLSLADTENLVHYCGIYDVNMVTLYGYLHTTSDLGTADKI
                     NRLQLLKKFSLCILLSITRFDRIVTTRSAVVLKLFPNYKHRYMKETEKLLLLSKALGD
                     VADCLNEVSKVLESYKSQLKYIETSINDQHNNVLPQPVMIESGLERVTVTLNELNEIQ
                     NKLFHAESDDETLRKFVQEKLHELCHFWEHTTTKKPTSLLPPQVTSPHRQFHNTSNGF
                     VLNVVKAIETNPAMAPQLTSYEPVTPAGSESCLEQDFLESNFSTESGEHIYSTADEET
                     VAPQYLVDRFDKLSHEELRLRLDEQFKRLTVDTKPPKQHSKKDRLEVLNMNVRDGSNN
                     GYESGPFYSKEESIPVLYELNQLLSNRR"
     gene            complement(<78862..>80268)
                     /locus_tag="AGOS_AFL192C"
                     /old_locus_tag="AFL192C"
                     /db_xref="GeneID:4621583"
     mRNA            complement(<78862..>80268)
                     /locus_tag="AGOS_AFL192C"
                     /old_locus_tag="AFL192C"
                     /product="AFL192Cp"
                     /transcript_id="NM_210712.1"
                     /db_xref="GeneID:4621583"
     CDS             complement(78862..80268)
                     /locus_tag="AGOS_AFL192C"
                     /old_locus_tag="AFL192C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL103C (QRI1)"
                     /codon_start=1
                     /product="AFL192Cp"
                     /protein_id="NP_985358.1"
                     /db_xref="GeneID:4621583"
                     /translation="MRTKERYEAAGQGHLFEHWEQLTKEEQGELEQSLVQTDPARVLA
                     NLQRALESQDKSQEGDISALPETSYESAIDCSAETRARYREIGLEAVRRGEVAVVLMA
                     GGQGTRLGSSQPKGTYDVGLPSHKSLFQIQAERLGRLERLAGCAQPIPWYIMTSRATR
                     TATESFFREHGYFGLQQGQVTFFNQGTLPALDSDGRRLLLESKMSLLESPDGNGGLYR
                     ALQENGILDDLVSRGVKHIHMYCVDNVLVKLADPVFLGYAIDHEFDLATKVVRKRDAH
                     ESVGLIVAKDGKPCVIEYSEISKELAEAIDEESGLLKLRAANIVNHYYSVDVLRAKLE
                     SWCEQMPLHIAKKKIKYYDPCSDAVVCPADVNGIKLEQFIFDVFGSIPLERFGCLEVE
                     RSEEFSPLKNGVDAPNDNPLTARRDYLELSTKWLRDVGAVVDEGVLVEVSSALSYDGE
                     NLDRYHGERFSQDGAYLT"
     gene            <80619..>85346
                     /locus_tag="AGOS_AFL191W"
                     /old_locus_tag="AFL191W"
                     /db_xref="GeneID:4621584"
     mRNA            <80619..>85346
                     /locus_tag="AGOS_AFL191W"
                     /old_locus_tag="AFL191W"
                     /product="AFL191Wp"
                     /transcript_id="NM_210713.2"
                     /db_xref="GeneID:4621584"
     CDS             80619..85346
                     /locus_tag="AGOS_AFL191W"
                     /old_locus_tag="AFL191W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR162C (DNF3)"
                     /codon_start=1
                     /product="AFL191Wp"
                     /protein_id="NP_985359.1"
                     /db_xref="GeneID:4621584"
                     /translation="MARKKRAQSLRKQLFNKQLYARWQQQQEEGGERDEIQLKDLNAG
                     GGETCAAASGRQAAPTLWRRITAALRRSQAEPVEYGRRIPVALGRRGFAESAGGGGYV
                     DRRSGLPYIGNAITSSRYSVYSFLPRQLCAQFSKVVNSYFFGMAILQMVPNWSTTGQY
                     TTIVPLSIFMGISIAREGWEDFRRHKLDREENNKLVKVLAQAHDSEFGDNKDISAEAR
                     AASFTDFETLQANHGVAVVEKQWKDVEVGEFVLLNQDDWVPADLFLLATDGDNNECYV
                     ETMALDGETNLKCKHVLPKIASQTRTASGLATFRGMTTVEDPNIDLYNFEGKIEVETD
                     SGEQQAYSIGLDNVLFRGSIIRNTQTVVGMVVFTGEETKIRMNAIKNPRIKSPKLQTQ
                     INLIVLFMILVVAIFSFLSFGLQRFFKNREVDSDRAWYLMKVDAGLAPTIMSFIIMYN
                     TLIPLSLYVTMEIIKDMQSRLMEWDIDMYHLETNTGCTSRTATILEELGQVSYIFSDK
                     TGTLTDNRMIFRKFSFCGTAWEHDVARKDQETGCSQTKKDVEVISVESNSFIKNFELN
                     STDTRTSVEYKGLASATYTGRPSIASQIELMKLQQNSANTNKSSSPKISRLPTLDSSP
                     EPKLKTSLDLIMHIQLNPNTVFSQRAKFFILALALCHTCLPKKRQGADSGDFDSVEYQ
                     SSSPDELALVTAARDMGYVVLNRNGDELTIKTYPDGFEADCVLEKYEVLNTIDFSSDR
                     KRMSVLVRMHQHPEKVLLICKGADNVILERLHNSDLAQQKLNEINTSAGQRKIEEAEL
                     VLQHRKSLEQAITRDSIGGVLRQSMSLRPSRASLVLQAAKNGHSGISSSPHDQELHIN
                     SIDDFLGAVTKPEQDVENIFNMARKSTQKQQRDKYARTSTSYVQGSSDNQRVNNINSQ
                     VAETSSMAEYIGSPDLITNEEYVIERTLQDMDAFTTEGLRTLLYSFKWIGNQEYETWN
                     SRYSAAKAALVNRREQMDTVGEIIERDLTLLGTIGIEDKLQEGVPDAIDKLRRAGIKM
                     WMLTGDKRETAINIGYSCRLIHDYSTVIILAPNDENMASKITTITQEIEAGNVAHCVV
                     VIDGATLTIFEGNLTLMTLFIELCTKTDSVICCRSSPSQKALMVTKIRKTDKKLVTLA
                     IGDGANDIAMIQSADIGVDITGKEGLQASRSSDYSIAQFRYLLKLLLVHGRYNYIRTS
                     KFVLCTFYKEFVFYLTQLIFQINTMFSGTSQYEPWCLTVFNTLFTSLPVLCIGMFEKD
                     LKSVTLLSIPELYTTGRQSQAFNLVIFLRWMAIAALSSVIICFTNWQCWSLTAQSDNT
                     LYPIGLINYTAVVVLVNVKCQLLEMANRNWLAFASFFISVCGWLCWCLLLPAIYKETL
                     VYDVREGLYHQFGPDITFWATNLVLVLLPVMLDLLFKTCKVIIYPSDTEIFAELEQRD
                     AVRKKLEFGAFNELKQGWTWQRDPPTIKRLMNKAIGNKSDTFDGVINHTRSRKNTLPG
                     ATELPPGTPSKVTIHSSATYNTEEYEQLPSGKLIKRKNLVPDNSGGSGNDGFAAKLGR
                     KLKLKPAAEDIDEIIERRMQNLE"
     gene            complement(<85608..>86315)
                     /locus_tag="AGOS_AFL190C"
                     /old_locus_tag="AFL190C"
                     /db_xref="GeneID:4621585"
     mRNA            complement(<85608..>86315)
                     /locus_tag="AGOS_AFL190C"
                     /old_locus_tag="AFL190C"
                     /product="AFL190Cp"
                     /transcript_id="NM_210714.1"
                     /db_xref="GeneID:4621585"
     CDS             complement(85608..86315)
                     /locus_tag="AGOS_AFL190C"
                     /old_locus_tag="AFL190C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR161W (HLJ1)"
                     /codon_start=1
                     /product="AFL190Cp"
                     /protein_id="NP_985360.1"
                     /db_xref="GeneID:4621585"
                     /translation="MAEKEYTEEQEKLTLLIVDKDKHSFYELLQVDEKASDGDIKKAY
                     RKMAIKLHPDKNRHPRAAEAFKKVNRAFEVLSDEKKRRVYDQLGYDPDDRAAAQESYR
                     RGGASEASTNGFRPFTDEGMFFRGAGGAPEDLFDFFFRGGGPGGPFGMADPYDSFGPF
                     GGATTFTFGGPAGFKVYSGGSGGQFRRGPFGMAQAATEAQRQRANGQPEAQDPLQHVV
                     FVLLIVLLFLLLPSLGF"
     gene            <86926..>90204
                     /locus_tag="AGOS_AFL189W"
                     /old_locus_tag="AFL189W"
                     /db_xref="GeneID:4621586"
     mRNA            <86926..>90204
                     /locus_tag="AGOS_AFL189W"
                     /old_locus_tag="AFL189W"
                     /product="AFL189Wp"
                     /transcript_id="NM_210715.2"
                     /db_xref="GeneID:4621586"
     CDS             86926..90204
                     /locus_tag="AGOS_AFL189W"
                     /old_locus_tag="AFL189W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL102W (POL3)"
                     /codon_start=1
                     /product="AFL189Wp"
                     /protein_id="NP_985361.2"
                     /db_xref="GeneID:4621586"
                     /translation="MTNALKRAGEQQGELLEKKMRRQSYDYSAGSEPVSSIEIVPTDR
                     YTKQNVQGYRSTQAADTKGNGDATLFEHELQQMEHESAAAQERNQQVLWSRDKLPADF
                     AAATHDITFQQLDAEQAVLPGYIDGGTSAVVRFFGVTEQGHSVLCSVTGFKHYMYVPA
                     PANFDARTDVPVLVDYLNDMFDGVVDSVEVCQKQSIWGYSGDQKLQFLKVLVADPYGL
                     NKIRTAFEKGYITPNDTWFQGGTTTYDNIAYTLRLMIDCGIVGMSWITLPKGKYAMIP
                     KNKKISTCQLEVSINYKDLISRPADSDWSHSAPLRILSFDIECAGRVGVFPEPEVDPV
                     IQIANVVSIAGESKPFIRNVFTVDTCAPITGSQIFEHETEEAMLKHWRDFLVEVDPDV
                     IIGYNTTNFDLPYLINRAAALNVSSFPYFGRLVNSKQVIKETVFSSKAHGTRESKSIN
                     IEGRLQLDIFQFVRREYQLRSYTLNSVSAHFLGEQKEDVHHSIIASLHRGDSETRRRL
                     AVYCLKDAYLPLRLLEKLMALVNYTEMARVTGVPFPYLITRGQQIKVISQLYRKCLQI
                     DTIIPNMHGNHSDDQYQGATVIEPIRGYYDIPIATLDFNSLYPSIMMAHNLCYTTLCN
                     KATVQRLQLKENEDYIITPNGDYFVTSKKRRGILPIILEELIAARQRAKGELKKETDP
                     FKKDVLNGRQLALKISANSVYGFTGATVGKLPCLSISSSVTAYGRTMIETTKRAVEEK
                     YTIKNGYKHDAIVVYGDTDSVMIKFGTNELKQTMELGAEAAAYVSSLFKHPINLEFEK
                     VYFPYLLINKKRYAGLYWTKPEKYDKLDQKGLASVRRDSCPLVSIVMNKILRMILIER
                     NVPGALKFVENTIEDLLQNKADISKLIISKTLAPNYTNAQPHAILAERMKKRDGVGPN
                     VGDRVDYVIIGGNDKLYNRAENPLYVLEQNIQLDSKYYLTTQLQNPVVSIIAPIIGEK
                     QANAMFIVKSIKIATSNQKGGLMGFIKKVQTCKGCRGPLKKNEGPLCYSCKERSGELY
                     LKAVSDVRELEEKFSRLWTQCQRCSGSLHNEVLCSNQNCDIFYMRVKARKELQEKVED
                     LSKW"
     gene            complement(<90256..>91674)
                     /locus_tag="AGOS_AFL188C"
                     /old_locus_tag="AFL188C"
                     /db_xref="GeneID:4621587"
     mRNA            complement(<90256..>91674)
                     /locus_tag="AGOS_AFL188C"
                     /old_locus_tag="AFL188C"
                     /product="AFL188Cp"
                     /transcript_id="NM_210716.2"
                     /db_xref="GeneID:4621587"
     CDS             complement(90256..91674)
                     /locus_tag="AGOS_AFL188C"
                     /old_locus_tag="AFL188C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL101C (DUN1)"
                     /codon_start=1
                     /product="AFL188Cp"
                     /protein_id="NP_985362.2"
                     /db_xref="GeneID:4621587"
                     /translation="MLSLIPNKEQKIKIFDQPVIKIGRSRSCDVVLGEPDISTVHCEL
                     NLVEVDLDGDQKKLYNIVDRSRNGTFINGNRLMRKDYLLRNGDRIVFGKSASFLFKYV
                     HVEACEQPTDSPARPADEEKNSVFKKPLFSSQNTTRKPLRGKENRGVSFFDRYIPGKE
                     LGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQFREETKILMGLNHENIVKL
                     LERFVEPLSKSQVQTYLVLEKIQDGELFDRIVRKTKLQQDETRALFKQILAGLKYLHD
                     RNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAKFTGEMQFTT
                     TLCGTPSYVAAEVLTKTGYTSKVDLWSAGVLLYVCLCGFPPFSDQLAPPSMKEQILQG
                     KFAFYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKTSKVERPR
                     LSETNVPKTYSELSSIQQTASK"
     gene            complement(<91909..>94284)
                     /locus_tag="AGOS_AFL187C"
                     /old_locus_tag="AFL187C"
                     /db_xref="GeneID:4621588"
     mRNA            complement(<91909..>94284)
                     /locus_tag="AGOS_AFL187C"
                     /old_locus_tag="AFL187C"
                     /product="AFL187Cp"
                     /transcript_id="NM_210717.1"
                     /db_xref="GeneID:4621588"
     CDS             complement(91909..94284)
                     /locus_tag="AGOS_AFL187C"
                     /old_locus_tag="AFL187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR160W"
                     /codon_start=1
                     /product="AFL187Cp"
                     /protein_id="NP_985363.1"
                     /db_xref="GeneID:4621588"
                     /translation="MVLTRLARHIFELYIGWAGQQAGAGDKQARHSCRLSMSAVSQDG
                     AEFHKADRFEEGEQLQPQPDGQRRWFPWFGSAVSGHSDVDTAVTESSVPTVALPPLQA
                     PTTSLLQSVVGWMPFWQTAEDGLLIDQSTEYHQLTAKQVHTLEQEALQAVARGNDSWC
                     WHTEYLPDMGDMAGVWGLVEGELSVANTGSQNCQLPLKEYPLEVCPLEHQSEYVVGVN
                     NSVLLPGHSPVEYFHPMPWTTRIASAVRGYYEPGRESHLYLKKETEGTLKDKKVIIIS
                     IVGSLPERYEKMVLEKACSARYLGERLSEQLQSEAPRSISGISIHSPLDRKPIEDCVK
                     ECLMLLCNWRTSFQEYDALFVAGVYHSVPLAIYLIEEIIKHQSLFQLNRKSTIGLLSF
                     NSCLRGYQFWDHSVDTIIEEDTNLQASREKILFQGASKIQREILSKLKNYGKQNTEES
                     LAIKKSLDWLLYNCKSFKMTLVSTLHDNFMTVSQKLAIDYVHPSFVRHIWCDGEQLGL
                     DLQELSARPEFAKFDTTYPRIFAADLDIPKERLFEVYLVSNILLAINLGHEEFIPILQ
                     LINPFYISRSFNEHTTPANLKKQIHNEQKLWLAAADARWKNASFCSGSRIPVEAHTIQ
                     DLLQYLQYCRLKGSNSLEIRGSMYSDSNIYRAFVHNTIHTAPLLERQHVRVSDHTVVP
                     QSIYNGVNQYDLVWKFHECLSRFIKLRNVPQQPIPTILFTISTDNRFLHRIRKAAFTR
                     NTKESLRRLDLLWHSYNEWKPQTKGLKQLQEILSVLTLYSTTDDLVKDIAR"
     gene            <94329..>94703
                     /locus_tag="AGOS_AFL186W"
                     /old_locus_tag="AFL186W"
                     /db_xref="GeneID:4621589"
     mRNA            <94329..>94703
                     /locus_tag="AGOS_AFL186W"
                     /old_locus_tag="AFL186W"
                     /product="AFL186Wp"
                     /transcript_id="NM_210718.1"
                     /db_xref="GeneID:4621589"
     CDS             94329..94703
                     /locus_tag="AGOS_AFL186W"
                     /old_locus_tag="AFL186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR159C (ATG16)"
                     /codon_start=1
                     /product="AFL186Wp"
                     /protein_id="NP_985364.1"
                     /db_xref="GeneID:4621589"
                     /translation="MDLHQLYLDRLRQRDRIEGNFCYLFEAAVVLETAQPPQDSRDLV
                     AKSLREELHAHEQEIHKLKDIVHLRSKDAEKLNDEIISLNIENSLLQDKLTALQAEYD
                     KLIQRWLAKAQSEADAMNQGLA"
     gene            <94988..>97864
                     /locus_tag="AGOS_AFL185W"
                     /old_locus_tag="AFL185W"
                     /db_xref="GeneID:4621590"
     mRNA            <94988..>97864
                     /locus_tag="AGOS_AFL185W"
                     /old_locus_tag="AFL185W"
                     /product="AFL185Wp"
                     /transcript_id="NM_210719.2"
                     /db_xref="GeneID:4621590"
     CDS             94988..97864
                     /locus_tag="AGOS_AFL185W"
                     /old_locus_tag="AFL185W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR205C (PFK2)"
                     /codon_start=1
                     /product="AFL185Wp"
                     /protein_id="NP_985365.2"
                     /db_xref="GeneID:4621590"
                     /translation="MTMEVPLINGTNSVVVTAYSREQYAQCMQFYSAMLRLETLTKGE
                     NETVLTNKAVSVRVKYEEDKSRDQEARERREALAAAATTHDWRGEASTVVFSTVDVAK
                     VRQTLGLCQAYPSELAPLEVYTLDPQGNVVGFTQTKNAISTFTNVPSVVGPRHARDSM
                     TVSSAGSSTDLRSFGLDTTAHYPSLPKKSVAGDRKAIAVMTSGGDAPGMNANVRAIVR
                     SVIFKGCRAFTVMEGYEGLVRGGPEYIKECKWEDVRGWSTEGGTNIGTARCMAFRERS
                     GRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIQELLETGKITQAQYDRYR
                     HLNICGTVGSIDNDMSTTDATIGAYSSLDRICQAIDYLEATAKSHSRAFVVEVMGRNC
                     GWLALMAGIATSADYILIPEKPASSREWQDQMCDIVSTHRSRGKRTTIVIVAEGAIAA
                     DLTPITPKDVHQVLVDRLGLDTRITTLGHVQRGGSAVAFDRILATLQGVEAVNAVLES
                     TPDTPSPLIVLNENKIMRKPLMESVALTKSVADAIQAKDFKKAMGLRDPEFVEHLNNF
                     MAINSADHDEPKLRGEKRLNIAIVNIGAPAGGINSAVYSMANYCLSQGHKPFAIYNGW
                     TGLARHESVRTLNWKDMLGWQSRGGSELGTNRTVPEDADIGMIAYYFQKYKFDGLVIV
                     GGFEAFVSLHQLERARENYPAFRIPMVLIPATLSNNVPGTEYSLGSDTALNALMEYCD
                     VVKQSAASTRARVFVVDVQGGNSGYLATHAALAVGAQVSYVPEEGISLEQLSQDIETL
                     RESFEKAHGKGKHGKLILKSTNASKVFTTAVLADVITAEAKGDFDAKSAVPGHVQQGG
                     LPSPIDRTRGTRLAVRAIGFIEAKQDVIREARENEEAFDCADKAVSHTAAVLGITGSQ
                     LKFTSIRQLYDLETEFSKRMPKVIHWEPTRAIADHLEGRKRVTV"
     gene            <98211..>99377
                     /locus_tag="AGOS_AFL184W"
                     /old_locus_tag="AFL184W"
                     /db_xref="GeneID:4621591"
     mRNA            <98211..>99377
                     /locus_tag="AGOS_AFL184W"
                     /old_locus_tag="AFL184W"
                     /product="AFL184Wp"
                     /transcript_id="NM_210720.2"
                     /db_xref="GeneID:4621591"
     CDS             98211..99377
                     /locus_tag="AGOS_AFL184W"
                     /old_locus_tag="AFL184W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR204C (INP1)"
                     /codon_start=1
                     /product="AFL184Wp"
                     /protein_id="NP_985366.2"
                     /db_xref="GeneID:4621591"
                     /translation="MARPTNSAASDVIPPSSKTRMPKIKPFKTIRTTFLKKKNTIGNL
                     VSKGTHSSQSGGHKDSYMGDVESLTLRSPQSRGSWVESIDSKKIHSLSNDRVTLFRYE
                     HVRVTSYQSVRKKYRNSGDSRRGQERMESAVKGTDVLRRERASVIEPRGPLEIYQIIT
                     PISKEPSQKVTYLCLGRKEQIIKPILPKLRITMLTREGLQFSVLSFNPENSWKIEFLG
                     ALGDSAVPCNVILAFENAVKNICRYTSELNNDPIEEVGTEDDDDLEYLLYSDFAEDDD
                     TGSDITLNREHSSEPSDLLNCSTTNEMINDAFRKAIEHIRHVGSMPLIEAHGVKSFSS
                     QLKIDGEQVDPPPKASPRQRAVSVPVETRTWSKLSTHPVALSTWMDIEYDDIKE"
     gene            complement(<99588..>100748)
                     /locus_tag="AGOS_AFL183C"
                     /old_locus_tag="AFL183C"
                     /db_xref="GeneID:4621592"
     mRNA            complement(<99588..>100748)
                     /locus_tag="AGOS_AFL183C"
                     /old_locus_tag="AFL183C"
                     /product="AFL183Cp"
                     /transcript_id="NM_210721.1"
                     /db_xref="GeneID:4621592"
     CDS             complement(99588..100748)
                     /locus_tag="AGOS_AFL183C"
                     /old_locus_tag="AFL183C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR203W (TOM40)"
                     /codon_start=1
                     /product="AFL183Cp"
                     /protein_id="NP_985367.1"
                     /db_xref="GeneID:4621592"
                     /translation="MSATNPLSLGDFSKISPLPGIAAVPEQRTESFWSSNPISSYLIS
                     VYNNIHAHRQTLSLVNPGTMENLNKEVSRDVFLTQYFFTGLRADLNKAFALNPAFQTS
                     HTFSMGSENLPNYAFSALFANDDLFMQGNVDNDLSLSGRLHYGWDKNNVSKVTLQVSQ
                     GQPTMCQLEQDFQGSDFSLNLKTLNPSLSADGTFSGVAVGSILQSITPQLAVGIEAVY
                     SRGQSSMPADAAVSYATRYVSAKQDWIFSGQLQANGALTASFWRKVASNVEAGVESTL
                     QASMVPIMDPVIGQPIGIQPTIEGLTTIGAKYEYRQSVFRGFINSNGRVGCFLERKIL
                     PTLSVLFCGEIDHFKSDSKLGCGLQFETAGSEELLMMQQGLDANGNPLPLPA"
     gene            complement(<100956..>101339)
                     /locus_tag="AGOS_AFL182C"
                     /old_locus_tag="AFL182C"
                     /db_xref="GeneID:4621593"
     mRNA            complement(<100956..>101339)
                     /locus_tag="AGOS_AFL182C"
                     /old_locus_tag="AFL182C"
                     /product="AFL182Cp"
                     /transcript_id="NM_210722.1"
                     /db_xref="GeneID:4621593"
     CDS             complement(100956..101339)
                     /locus_tag="AGOS_AFL182C"
                     /old_locus_tag="AFL182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR010W (CSE2)"
                     /codon_start=1
                     /product="AFL182Cp"
                     /protein_id="NP_985368.1"
                     /db_xref="GeneID:4621593"
                     /translation="MSAQASPATELQNPTLGQVYATLTRHSAQQTEFIPHIFYALHQL
                     KNDNGHTNTFETATSNIRHRLKLCKAAIAGDAHAVEMLSRPCDEWPAVVCQKEQEIEA
                     KKRVHRQLRQRVEEIAGPLDAAAAP"
     gene            complement(<101362..>102030)
                     /locus_tag="AGOS_AFL181C"
                     /old_locus_tag="AFL181C"
                     /db_xref="GeneID:4621594"
     mRNA            complement(<101362..>102030)
                     /locus_tag="AGOS_AFL181C"
                     /old_locus_tag="AFL181C"
                     /product="AFL181Cp"
                     /transcript_id="NM_210723.1"
                     /db_xref="GeneID:4621594"
     CDS             complement(101362..102030)
                     /locus_tag="AGOS_AFL181C"
                     /old_locus_tag="AFL181C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR202W (ERG2)"
                     /codon_start=1
                     /product="AFL181Cp"
                     /protein_id="NP_985369.1"
                     /db_xref="GeneID:4621594"
                     /translation="MRYLRIGAVIAAVGYVMNAALYSWLPRNYMFDPHTLNRICNTVI
                     AKHNARGAVAPRALLQDVRDALAAHYGEEYINRYVEDEWVFNNAGGAMGQMLILHASV
                     SEYLILFGTAVGTEGHTGVHFADDYFTILHGEQSAALPHALEPEVYTPGMTHHLRMGH
                     AKQYAMPSGSFALELAQGWIPCMLPFGFLDTFSSTLDVYTLARTVQLTARDMFKNLVY
                     NFKF"
     gene            complement(<102238..>102765)
                     /locus_tag="AGOS_AFL180C"
                     /old_locus_tag="AFL180C"
                     /db_xref="GeneID:4621595"
     mRNA            complement(<102238..>102765)
                     /locus_tag="AGOS_AFL180C"
                     /old_locus_tag="AFL180C"
                     /product="AFL180Cp"
                     /transcript_id="NM_210724.2"
                     /db_xref="GeneID:4621595"
     CDS             complement(102238..102765)
                     /locus_tag="AGOS_AFL180C"
                     /old_locus_tag="AFL180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR009W (NRM1)"
                     /codon_start=1
                     /product="AFL180Cp"
                     /protein_id="NP_985370.2"
                     /db_xref="GeneID:4621595"
                     /translation="MVARQSSAHTRAQTIGMRSPLRELSGSQINQRRRDRAAKERAAP
                     AWGAGTPRSPRGRAAGRPPSPRPALLATPDSDGAQPGSPRARQQLHAMKVRLQLAYYK
                     YRTNQAHLNFHQLKQRYQCVKPRTLACTAALRTPVKVSGAGPSPTSTPTSVKAAKSLL
                     QLFSASAAAPTEHIH"
     gene            complement(<103261..>105198)
                     /locus_tag="AGOS_AFL179C"
                     /old_locus_tag="AFL179C"
                     /db_xref="GeneID:4621596"
     mRNA            complement(<103261..>105198)
                     /locus_tag="AGOS_AFL179C"
                     /old_locus_tag="AFL179C"
                     /product="AFL179Cp"
                     /transcript_id="NM_210725.1"
                     /db_xref="GeneID:4621596"
     CDS             complement(103261..105198)
                     /locus_tag="AGOS_AFL179C"
                     /old_locus_tag="AFL179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR008W (LRO1)"
                     /codon_start=1
                     /product="AFL179Cp"
                     /protein_id="NP_985371.1"
                     /db_xref="GeneID:4621596"
                     /translation="MAMVARKKSKRRSKAGRDEKTKGSSSNTEKVVLCEQPTEEKEVE
                     ITVQEVMVDQGKRRWRESRRLMFTLGAVLGLLLALYFGTDVHKQTYEGLDRIVNFETF
                     QDYFVDWKEVVPTNILSLVTDFQLRNTRSASLQDLTTSFAIGRQLQRDHELCDKHPVV
                     MVPGVTSTGIESWGLYKDAECDSEPHFRRRLWGSFYMLKTMVLDKACWLRHVMLDPET
                     GLDPPNYKLRAVQGFEAADFFMAGFWIWNKILQNLGAIGYEPNKMVTAAYDWRLAFLD
                     LERRDRYFSKLKMQVEMMYDATGEKSVLVGHSMGSQIIFYFLKWVEAEGELYGNGGPG
                     WVEKHIDSFVNVAGTLLGVPKAMPALLSGEMKDTIDLNALAMYGLEKFFSRKERLDLL
                     RSWGGIPSMIPKGGNLIWGNMTYSVEDVLHNNTDTYGNFIRFNKPQGPLSSRNLTMED
                     AIDYIFELAPGWLGRRATDQYSFGYATSPEQMQLNERHHAHWSNPLEVPLPRAPSMKL
                     YCLYGVGNPTERAYVYKEERKISSLNVTIDYESDTPVFFSDGDGTVPVLTHAMCHKWA
                     EGVSPYNPAGINVTIVEMQHQPDRFDIRGGAKSAEHVDVLGRAELNEYILRIAAGHGA
                     SIQPRFLTDMADWVARLNFPL"
     gene            <105476..>106324
                     /locus_tag="AGOS_AFL178W"
                     /old_locus_tag="AFL178W"
                     /db_xref="GeneID:4621597"
     mRNA            <105476..>106324
                     /locus_tag="AGOS_AFL178W"
                     /old_locus_tag="AFL178W"
                     /product="AFL178Wp"
                     /transcript_id="NM_210726.2"
                     /db_xref="GeneID:4621597"
     CDS             105476..106324
                     /locus_tag="AGOS_AFL178W"
                     /old_locus_tag="AFL178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR007C (ATG3)"
                     /codon_start=1
                     /product="AFL178Wp"
                     /protein_id="NP_985372.2"
                     /db_xref="GeneID:4621597"
                     /translation="MLRSTLSNWREYLTPVTHQSTFENTGQITPEEFIKAGDYLCHMF
                     PTWRWNQQQGGMVYRDFLPQDRQFLVTRKVPSNMRAADSVNVGGEEETSAGEYWVLQP
                     QQESADGGEEIDIDEMLQEMDIEDQSGEQDIIQLRPSHTRFYDLYITYSTSYRVPKMY
                     LVGFNNDGTPLTPQQMFQDIAPDYRTKTATIEKLPFFKSAVVAVSIHPCRHANVMRVL
                     MEKVRAAKQKPVEEEQPDGPREDWEDLQDEVDSSLRVDQYLVVFLKFITSVTPGIEHD
                     YTMEGW"
     gene            <106502..>107689
                     /locus_tag="AGOS_AFL177W"
                     /old_locus_tag="AFL177W"
                     /db_xref="GeneID:4621598"
     mRNA            join(<106502..106577,106644..>107689)
                     /locus_tag="AGOS_AFL177W"
                     /old_locus_tag="AFL177W"
                     /product="AFL177Wp"
                     /transcript_id="NM_210727.2"
                     /db_xref="GeneID:4621598"
     CDS             join(106502..106577,106644..107689)
                     /locus_tag="AGOS_AFL177W"
                     /old_locus_tag="AFL177W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR201C (RAD14); 1-intron"
                     /codon_start=1
                     /product="AFL177Wp"
                     /protein_id="NP_985373.2"
                     /db_xref="GeneID:4621598"
                     /translation="MRLYFNSLHRLLSVHGADRRAEGCCPNRRKALERLKQRGISKPA
                     HGGPAAGGVRASADFARPVVTTGLERQIEQNRQTARKRLQQTQQNLRDASSIINTGHA
                     LGSPSAHPTGNTGSRLRPAIRRQDYIEYDFSTMKNTNGGFINREDDQGYGDNALAQEK
                     QRSLEEWQREQRARRALYENQPPPAHMSLAPKCTQCNINTEMDPVMKDVFHLQVCKSC
                     VKAHPEKYSLLTKTECKEDYFLTDPELNDASLFDRLEKPNPHSGTFAHMQLFVRCEIE
                     KYAFEKWGGEEGLDNEWQRREEGKIERREKKYQQKVREMRLKTRAQEFTTRLKEKKYG
                     KDHTHEFGAPVDGGSNEDGIPVQKRRCFGCGIEIEEIML"
     gene            complement(<107864..>109678)
                     /locus_tag="AGOS_AFL176C"
                     /old_locus_tag="AFL176C"
                     /db_xref="GeneID:4621599"
     mRNA            complement(<107864..>109678)
                     /locus_tag="AGOS_AFL176C"
                     /old_locus_tag="AFL176C"
                     /product="AFL176Cp"
                     /transcript_id="NM_210728.1"
                     /db_xref="GeneID:4621599"
     CDS             complement(107864..109678)
                     /locus_tag="AGOS_AFL176C"
                     /old_locus_tag="AFL176C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNR006W (VPS27)"
                     /codon_start=1
                     /product="AFL176Cp"
                     /protein_id="NP_985374.1"
                     /db_xref="GeneID:4621599"
                     /translation="MNTEIQTVAALGECIQRATSESIPNGEIDLALALDVSDAVRSRR
                     LGARDSMRALKKRVLQTKSNPNTQLAAWRLVEVCVKNGGTHFLKEVCSREFMDCMEHV
                     AAQEKTVDNEDLVQLCRRIIFELYTAFKNDSQLSYVSQVHQRLQARGVEFPQAAPGYL
                     VNTMAMFDSKAPADWVDSDACMICSNAFTFLNRKHHCRSCGGIFCNEHSSHQLPLPEM
                     GITEPVRVCDNCYDEYEIKKHSSRRLRRQSQRRARPKAEREDEDDDLRRAIELSLRES
                     KTQDNLVPTVTRLENSDATKDDEDPEFLAAVQASLREHQLEQERQAAAAAAAAKHPSQ
                     PERAVQLPSLMDSRQAPVAQQRYSTLTNQEEDDIYLFANLVEKMKGQPMNAVLEDTQL
                     QMLYQKVLGTRPRLNHSLNDTFHKYNTLVDMNAKISDIMSIYDTMLERQLRNINLSQQ
                     YSMPHLPSDPYTYQMHRQPESSPANTVPYEKTQPEPTYRSYARSSSNAAELTPAILHT
                     TQSSPMENRQSQSVTGFEPQVSEPDIKKTLLSSPSEPLYPPEESIPDKEKEAQVPITQ
                     FEFPSVPAQKIKMATPQNERVTEDAGTTPQEETLLIEL"
     gene            complement(<110009..>110770)
                     /locus_tag="AGOS_AFL175C"
                     /old_locus_tag="AFL175C"
                     /db_xref="GeneID:4621600"
     mRNA            complement(<110009..>110770)
                     /locus_tag="AGOS_AFL175C"
                     /old_locus_tag="AFL175C"
                     /product="AFL175Cp"
                     /transcript_id="NM_210729.2"
                     /db_xref="GeneID:4621600"
     CDS             complement(110009..110770)
                     /locus_tag="AGOS_AFL175C"
                     /old_locus_tag="AFL175C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR200W (ROT1)"
                     /codon_start=1
                     /product="AFL175Cp"
                     /protein_id="NP_985375.2"
                     /db_xref="GeneID:4621600"
                     /translation="MVYVSWSAAALLCASFFSTVVLAQSAKDLYGTWSAKSNQVFTGP
                     GFYNPADELLIEPSLPGISYSFTEDGFFEMATYRVSGNPRNLACPSAVMTFQHGKYEI
                     LANGTLILRPFEVDGRQLVSEPCVDKGVSTYLRYSQVETFQRFAVELDEYHGKHALHL
                     FQFDGSPVQPLYLAYRPPLMLPTITLNPTDHAGATATAGPGHRKRSLGELVRAGLQDK
                     HKTTAVRNPSLFNAAFYWWCSAGVIAAGTVLFFMV"
     gene            complement(<111464..>113002)
                     /locus_tag="AGOS_AFL174C"
                     /old_locus_tag="AFL174C"
                     /db_xref="GeneID:4621601"
     mRNA            complement(<111464..>113002)
                     /locus_tag="AGOS_AFL174C"
                     /old_locus_tag="AFL174C"
                     /product="AFL174Cp"
                     /transcript_id="NM_210730.1"
                     /db_xref="GeneID:4621601"
     CDS             complement(111464..113002)
                     /locus_tag="AGOS_AFL174C"
                     /old_locus_tag="AFL174C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL256C (CLN2) and YMR199W (CLN1)"
                     /codon_start=1
                     /product="AFL174Cp"
                     /protein_id="NP_985376.1"
                     /db_xref="GeneID:4621601"
                     /translation="MSVSSCDVPLGLIVNAKQTYYPIELSNAELLAHYETIQDYHQEI
                     SENVLQHSCRVKPDPKLIDQQPEMNPQHTRTAIVNFAFELAQKTRVTNGIFFHAVRLY
                     DRYCSKRVVLRDQAKLVIATCLWLAAKTWGGCNHIINNVTVPTGGRFYGPNPRARIPR
                     LSELVHYCGGSNVFDESMFTQMERHILDTLSWDVYEPMVNDYVLNVDENCLIQYELYK
                     RQLEHNRQYANKRNSQDSNATEEDVSEEDEDLDNKIQLINIKKFLIDLAVWQYDLLKY
                     EVFELAHGIFSIINKFTNQDLGPLLLSPIPSTNNESLVLNVFINGVIKCPAALLESYH
                     EKFGVLQFVDQVKEYHESLQKKLQLAAAMDLSRRNNAKFYEAPSMPSPTYSQHSSYTP
                     LRNTSNSESSVFSSVSNQQSPITPQMYSFSVQKPGSACGSSVSVNSISQKRNRDEETN
                     YSIMGNDKENYDPTSTYTVPPRAKFAGHTYIFTGAAKEEQTSSTSNRSSLISLAIGNA
                     NSLV"
     gene            complement(<113592..>114683)
                     /locus_tag="AGOS_AFL173C"
                     /old_locus_tag="AFL173C"
                     /db_xref="GeneID:4621602"
     mRNA            complement(<113592..>114683)
                     /locus_tag="AGOS_AFL173C"
                     /old_locus_tag="AFL173C"
                     /product="AFL173Cp"
                     /transcript_id="NM_210731.2"
                     /db_xref="GeneID:4621602"
     CDS             complement(113592..114683)
                     /locus_tag="AGOS_AFL173C"
                     /old_locus_tag="AFL173C"
                     /note="NOHBY613; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F06512g"
                     /codon_start=1
                     /product="AFL173Cp"
                     /protein_id="NP_985377.2"
                     /db_xref="GeneID:4621602"
                     /translation="MRGWGNVWYSGPWALLVHAGHACLFHGNEAVEKWPVVGQVRCNF
                     SEDAVHLVVYAERAFQLQTVQLATRRRTEQAVVSVAYGVARFEVLWQDGIIVAMDGVG
                     GRVHCVDTRRQRTLGCVQTNADDGAIYVVGARAFQVFVRQLDKATATEQLFFNTYELG
                     ADGAVRLQQAVRLGSSAGRHFAARLGNVFAVVLSCPFTRRSALSLHVDGQPAPLAQLQ
                     LPFVHDAAFCDHWTLALALDARLALLRPLAGTLAAVPLAAARVHNGPARIIASPLGTP
                     GLPDPLDSPPAQPSPPDVVPSLCLLTARPQHIAALFAARPNWVYLWSPPDTSPAHPRL
                     TGIILPDALVAATPDDRYFAGSYTAYTLR"
     gene            <114853..>115914
                     /locus_tag="AGOS_AFL172W"
                     /old_locus_tag="AFL172W"
                     /db_xref="GeneID:4621603"
     mRNA            <114853..>115914
                     /locus_tag="AGOS_AFL172W"
                     /old_locus_tag="AFL172W"
                     /product="AFL172Wp"
                     /transcript_id="NM_210732.2"
                     /db_xref="GeneID:4621603"
     CDS             114853..115914
                     /locus_tag="AGOS_AFL172W"
                     /old_locus_tag="AFL172W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL255W (BBP1)"
                     /codon_start=1
                     /product="AFL172Wp"
                     /protein_id="NP_985378.2"
                     /db_xref="GeneID:4621603"
                     /translation="MGWLGDNSEDSTGAVRWVMDALLGKRESPSQKYRREFAQDDTNN
                     RLQVPRSAGARRRRTGSLDSEFRARYELLPDETEGAGASLLSPVDLRPAGTAARESGT
                     PGRAGWAGGAAGTLGGGDGGCDGGRDGDTFGRARGSEDVAFRPPRADNPLVSALFAQP
                     SSPDAGLPGSFPGRAPRARDPTHDYLALLDQLARNNRDLHSLQQDLEAREERDRRETS
                     YRDRYLQLRQELIQELKQSKTMYDNYTALYERYKALKDAEHPDYAELVSKLEAQIVDL
                     TIADQQKDRRHQEELLRLQLQYEARIHELERKLNHQNSTYTANDTATPASTVDSGSIS
                     PYHKYNDTIDTQFLNHIVK"
     gene            <116263..>117561
                     /locus_tag="AGOS_AFL171W"
                     /old_locus_tag="AFL171W"
                     /db_xref="GeneID:4621604"
     mRNA            <116263..>117561
                     /locus_tag="AGOS_AFL171W"
                     /old_locus_tag="AFL171W"
                     /product="AFL171Wp"
                     /transcript_id="NM_210733.2"
                     /db_xref="GeneID:4621604"
     CDS             116263..117561
                     /locus_tag="AGOS_AFL171W"
                     /old_locus_tag="AFL171W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL254W (HFI1)"
                     /codon_start=1
                     /product="AFL171Wp"
                     /protein_id="NP_985379.2"
                     /db_xref="GeneID:4621604"
                     /translation="MSMVQTPQHGSAMGGQLAEGGGMNGGGVNGGDAGRKSPGAGTPP
                     PPPRGNKRLDLEEMVAEFSALLGNENWSKYAQIISLFILGKLSRKELVQQLDVLLAPA
                     HSPGDARAPPVSRAVLVRLHNQLLLAILANSLRDSPLGSKAGDAWGFQNGATYQNKKR
                     TNKHNSQIETYKKIVMSLPSKDRQRLKAITKENGKRGFVLCSVLQNRLANIPKIPIVT
                     NQETLKRVKANSLKTPLEWSQEIVSGFSAPLASESYSLPDNDSLYLRMVSIAREHGLV
                     GTVDGRCVEILSLALEYYLKTILESAIDTVRYREKKYSDYYDLNDYGFQQAISETNKE
                     TKMDPAAYLSGNKVISLTNEDLQETFTIYPNLVEPSGALLRLNATGLVNDNELVQLKS
                     PIDDMPQFFEDKPTFTPVDERNMGTREELNWLIKDILTKE"
     gene            complement(<117692..>119593)
                     /locus_tag="AGOS_AFL170C"
                     /old_locus_tag="AFL170C"
                     /db_xref="GeneID:4621605"
     mRNA            complement(<117692..>119593)
                     /locus_tag="AGOS_AFL170C"
                     /old_locus_tag="AFL170C"
                     /product="AFL170Cp"
                     /transcript_id="NM_210734.1"
                     /db_xref="GeneID:4621605"
     CDS             complement(117692..119593)
                     /locus_tag="AGOS_AFL170C"
                     /old_locus_tag="AFL170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL253C (VIK1) and YMR198W (CIK1)"
                     /codon_start=1
                     /product="AFL170Cp"
                     /protein_id="NP_985380.1"
                     /db_xref="GeneID:4621605"
                     /translation="MNKTRIPSISLKRARECGEVDSQPPRYKRASGKSPLAEITNTAS
                     SSPHISEDKMLSTKSMFGSSGQSSRLMNKYYYGDPRVIEEVKRRERKVMKDIQHFKKS
                     IEEVERDMKTMVEESIPGLRYTLSKKAAVYKDLRVETAQVTARLDLLANKCGVMRANT
                     ELALNNITLEQQVEVQNLENELDRRINALREEWELKLLSLEKFKPNDDLVKEIEGLKQ
                     ELNKEQKTWDRLQRENEEKRKEFELILEQDFLRFKEEKLSLYEDLTEKREHLFQEKNK
                     KQLELKQLHSIVEQHRREKAELAIDIQAITEEIVHYEQQLKPSQARLQQLKEQLNTEV
                     HETEEIRKKASAAEQEYNTLYDKMEDEQLSRRRIENTIEELRGNIRVFAYVSDASVPY
                     TIDYASKTITVGSAKQYCFDRLIPKELVPLQELLEQECQAYMDMCLQNQYDSSVISLQ
                     QENDHSIRNTFIGWMLSQKHKRINFQCVVLSENSPSVDLLLRKRLSGETNREIKVTLD
                     NKSVLFESTSILVESGGSAEDIIKQLGTDYNKEGILILKFQIWGENETSTDVYFIEVT
                     PPAYNCLHSTGSAGSTGSSFGSSRIGAILRSLLMHTKPLLLLTLTQENSLLLDISQQI
                     GQREKQQPA"
     gene            complement(<119998..>120453)
                     /locus_tag="AGOS_AFL169C"
                     /old_locus_tag="AFL169C"
                     /db_xref="GeneID:4621606"
     mRNA            complement(<119998..>120453)
                     /locus_tag="AGOS_AFL169C"
                     /old_locus_tag="AFL169C"
                     /product="AFL169Cp"
                     /transcript_id="NM_210735.1"
                     /db_xref="GeneID:4621606"
     CDS             complement(119998..120453)
                     /locus_tag="AGOS_AFL169C"
                     /old_locus_tag="AFL169C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL252C (YAH1)"
                     /codon_start=1
                     /product="AFL169Cp"
                     /protein_id="NP_985381.1"
                     /db_xref="GeneID:4621606"
                     /translation="MLGRLLPISARAVRFARAPPFMRALRAHGHLSTPRKGEELQVTF
                     ILKDGSQRTFDVAPGDTLLDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALQEPD
                     DDENDMLDLAYGLTETSRLGCQIRMSKDINGLRVALPAMTRNVSNSDFS"
     gene            <120751..>121398
                     /locus_tag="AGOS_AFL168W"
                     /old_locus_tag="AFL168W"
                     /db_xref="GeneID:4621607"
     mRNA            <120751..>121398
                     /locus_tag="AGOS_AFL168W"
                     /old_locus_tag="AFL168W"
                     /product="AFL168Wp"
                     /transcript_id="NM_210736.1"
                     /db_xref="GeneID:4621607"
     CDS             120751..121398
                     /locus_tag="AGOS_AFL168W"
                     /old_locus_tag="AFL168W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR197C (VTI1)"
                     /codon_start=1
                     /product="AFL168Wp"
                     /protein_id="NP_985382.1"
                     /db_xref="GeneID:4621607"
                     /translation="MASLLKSYEADFQATLEQCQRLLRQAQGEPVAQRNATLQTLEQH
                     KDDLYDILDQMEVEVNNMVGDPARQVASRSALRDLRREAGMVKQQLRELMDARDRDAL
                     FPAGAADMDNEQRQQLLSNHAMLQQTGERLVDAMRLANETEGIGNQVMMDLRSQRETL
                     EHSRQNLFLADSYVDKSVRTLKTMSRRLVANKFISYAIIAVLILLILMVLYSKFK"
     gene            complement(<121503..>124760)
                     /locus_tag="AGOS_AFL167C"
                     /old_locus_tag="AFL167C"
                     /db_xref="GeneID:4621608"
     mRNA            complement(<121503..>124760)
                     /locus_tag="AGOS_AFL167C"
                     /old_locus_tag="AFL167C"
                     /product="AFL167Cp"
                     /transcript_id="NM_210737.2"
                     /db_xref="GeneID:4621608"
     CDS             complement(121503..124760)
                     /locus_tag="AGOS_AFL167C"
                     /old_locus_tag="AFL167C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR196W"
                     /codon_start=1
                     /product="AFL167Cp"
                     /protein_id="NP_985383.2"
                     /db_xref="GeneID:4621608"
                     /translation="MSRVDTSDLVGVTVEEQRLAENRQQSKYWLKWGPYLSERSWATV
                     REDYSFDGDAWRHFPFEQANARVFRWGEDGIFGVSDNRQLVCLNVGMWNGRDELLKER
                     MFGLTGPQGNHGEDCKELYYYLDNLPSHAYMKALYKYPFKRAFPYQELIAGNDARGYA
                     ERELEVYELDGLYREAATGDTPYYDVVFEMAKGDENPDDLNFRITVHNRSKTETGELY
                     LMPQVFFRNTWAWNTKGEESAKPRLHQSHRNVVTIEHAKYGTRRAIFAPSPGWFDSKD
                     SEDIEPELLFTENESNLRKLFNEPSNPAPYTKDAFDEYVVHGNTGAVNPAREGTKAAA
                     LYHFPKIPPNDYVTVRYKFTDEWLPRYNEELVIDEEAHDAVFDRREQEAENFYWRISP
                     VPIPPELRKIQRQAFAGLLWSKQFYHFIHEQWYEGDPLVKPRPPQDRANGRNKQWKHM
                     YTDDILSLPDKWEYPFFASWDTAFHCTPLAMIDPDFAKRQLDLLTREWYMHPNGQIPA
                     YEWNFSDVNPPVHAWAVYRVFKIERNIYHREDRLFLERVFQKLLLNFTWWVNRKDSDG
                     NNVFEGGFLGLDNIGVFNRSEPLPTGGKLEQADSTGWMAFFSLQMLNIALELAKENPV
                     YEDIASKFFEHFILISDAMSFSYGKSYNEGEPEKSQEGYLWNDEDKFYYDVISWGGPF
                     KQQLPIRSLVGLIPLYASMTLEPGVLDRFKSFKKRVEWFIEHRRDIFDRNIASMEKRG
                     VGERLLLSLVNKERLEAILRRMLDETEFLSDYGIRSLSKYHEEHPFEMEVGGMKYVVK
                     YLPGESDSGMFGGNSNWRGPIWFPTNFLLVESLQKFFLYYGSDFKVECPTGSGEFLNL
                     AQVAEEISHRLIHLFVPDANGLRAAYYGDHAEFLSKDEHFKDLIPFFEYFDGDTGRGL
                     GASHQCGWTSLVAKWIHDAGASCLRLPRTPRSHTSITNLGEATPTGHSLLPKLSRRKS
                     GRSLINLTGTHLELTEEEKILHTMGTMNSNSATTEDSYKDGQTGLSSPKLAAATGSNS
                     EHGLDGADSAHMSLEGIRMHAQRENSLIAQLKERLKNLTAAGELSADEEEELETH"
     gene            complement(<124955..>125338)
                     /locus_tag="AGOS_AFL166C"
                     /old_locus_tag="AFL166C"
                     /db_xref="GeneID:4621609"
     mRNA            complement(<124955..>125338)
                     /locus_tag="AGOS_AFL166C"
                     /old_locus_tag="AFL166C"
                     /product="AFL166Cp"
                     /transcript_id="NM_210738.1"
                     /db_xref="GeneID:4621609"
     CDS             complement(124955..125338)
                     /locus_tag="AGOS_AFL166C"
                     /old_locus_tag="AFL166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR195W (ICY1) and YPL250C (ICY2)"
                     /codon_start=1
                     /product="AFL166Cp"
                     /protein_id="NP_985384.1"
                     /db_xref="GeneID:4621609"
                     /translation="MHSDSPINYSPLDTYNAGAAWQHALRAAPLCEQLPQLSNTPDEL
                     DDMCYDELDMYAELSGLPPPGSVGDEDIFALDEDAQCAAGPGPSAAAHPLPRMIDVTK
                     GCELPADIEFANAARDNYRLWLASV"
     gene            <125643..>125927
                     /locus_tag="AGOS_AFL165W"
                     /old_locus_tag="AFL165W"
                     /db_xref="GeneID:4621610"
     mRNA            <125643..>125927
                     /locus_tag="AGOS_AFL165W"
                     /old_locus_tag="AFL165W"
                     /product="AFL165Wp"
                     /transcript_id="NM_210739.1"
                     /db_xref="GeneID:4621610"
     CDS             125643..125927
                     /locus_tag="AGOS_AFL165W"
                     /old_locus_tag="AFL165W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR194C-B (CMC4)"
                     /codon_start=1
                     /product="AFL165Wp"
                     /protein_id="NP_985385.1"
                     /db_xref="GeneID:4621610"
                     /translation="MYSGTTTWYRPTDRTQNMDNRRRSAEGQPPCKAQACAIQACLKR
                     TGYEEGRCAAAVEALYTCCAQFYEREGRDARSVCCPAPDVVAARRQEVDK"
     gene            complement(126091..126119)
                     /locus_tag="AGOS_AgSNR11"
                     /old_locus_tag="AgSNR11"
                     /db_xref="GeneID:4621611"
     ncRNA           complement(126091..126119)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR11"
                     /old_locus_tag="AgSNR11"
                     /product="AgSNR11"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR11; start and end coordinates are
                     approximates. Not in synteny."
                     /transcript_id="NR_149359.1"
                     /db_xref="GeneID:4621611"
     gene            complement(<126214..>126798)
                     /locus_tag="AGOS_AFL164C"
                     /old_locus_tag="AFL164C"
                     /db_xref="GeneID:4621612"
     mRNA            complement(<126214..>126798)
                     /locus_tag="AGOS_AFL164C"
                     /old_locus_tag="AFL164C"
                     /product="AFL164Cp"
                     /transcript_id="NM_210740.2"
                     /db_xref="GeneID:4621612"
     CDS             complement(126214..126798)
                     /locus_tag="AGOS_AFL164C"
                     /old_locus_tag="AFL164C"
                     /note="NOHBY612; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0D12518g"
                     /codon_start=1
                     /product="AFL164Cp"
                     /protein_id="NP_985386.2"
                     /db_xref="GeneID:4621612"
                     /translation="MYSTSVRTVQPCVTAARRLQQTWAPPTYFNTPAQAPRAQAAPAR
                     KPLLEGALFVAVGTLAFFAVDNYRERTAAEVRLQKQLLESQRMHEVFTRQVNAARRKR
                     ELQVLNERKATQIRQMKMALHIAMLREQLHDRGVEAVGVDQVLQEFDRHVRMENSISN
                     VSGTSLWVVDDAPAKPYVPNVRDYDPTGTPAGTS"
     gene            complement(<127515..>128042)
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /db_xref="GeneID:4621613"
     mRNA            complement(join(<127515..127801,128027..>128042))
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /product="60S ribosomal protein L36"
                     /transcript_id="NM_210741.1"
                     /db_xref="GeneID:4621613"
     CDS             complement(join(127515..127801,128027..128042))
                     /locus_tag="AGOS_AFL163C"
                     /old_locus_tag="AFL163C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL249C-A (RPL36B) and YMR194W (RPL36A); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="NP_985387.1"
                     /db_xref="GeneID:4621613"
                     /translation="MAVKSGIAVGLNKGKKVTPMTPAPKVSYRKGASSKRTTFVRSIV
                     REVAGMAPYERRLIDLIRNAGEKRARKVAKKRLGTFGRAKAKVEEMNEIIAASRRH"
     gene            complement(<128499..>129284)
                     /locus_tag="AGOS_AFL162C"
                     /old_locus_tag="AFL162C"
                     /db_xref="GeneID:4621614"
     mRNA            complement(<128499..>129284)
                     /locus_tag="AGOS_AFL162C"
                     /old_locus_tag="AFL162C"
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /transcript_id="NM_210742.1"
                     /db_xref="GeneID:4621614"
     CDS             complement(128499..129284)
                     /locus_tag="AGOS_AFL162C"
                     /old_locus_tag="AFL162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR193W (MRPL24)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /protein_id="NP_985388.1"
                     /db_xref="GeneID:4621614"
                     /translation="MVLQAFTGVGLGFKRNFSSGLHLLRAWKQIEVRKLAKQPEYKVG
                     DEKPRYIPSKRKTVPDYKYGESRIFKQSNNGLYGGSFIQFGNNISESKTKTRRTWLPN
                     IVRKSLWSEALQKDVRIKLTAKVLRTISKEGGLDNYLTKDKSARIKELGPKGWELRYR
                     VLVARERQLNPPHKDAQAITTEDGRTVTVYYEVPLNGTTLRITCGRRRLLFHLFNREH
                     REHKADGLHLTFKSFLDKHRDTPVPDIVSRLVALGHSMEELTV"
     gene            complement(<129492..>131981)
                     /locus_tag="AGOS_AFL161C"
                     /old_locus_tag="AFL161C"
                     /db_xref="GeneID:4621615"
     mRNA            complement(<129492..>131981)
                     /locus_tag="AGOS_AFL161C"
                     /old_locus_tag="AFL161C"
                     /product="AFL161Cp"
                     /transcript_id="NM_210743.2"
                     /db_xref="GeneID:4621615"
     CDS             complement(129492..131981)
                     /locus_tag="AGOS_AFL161C"
                     /old_locus_tag="AFL161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL249C (GYP5) and YMR192W (GYL1)"
                     /codon_start=1
                     /product="AFL161Cp"
                     /protein_id="NP_985389.2"
                     /db_xref="GeneID:4621615"
                     /translation="MVEAGAKISKGGTQQAAGHGLEGYASDGSTDLRSAGAAEHETQD
                     SAKAQENEASANSMDDGLELGRRGQGVSPVLTPPTEEEGDAPAQKNRRQRLKERKATA
                     AAAGALPGIGRARSGSVKEGGSPKAAGAESPRRGAGAAAKDAKISERAEGAGSPQQRK
                     QGTGAAAPGSPPRRRLEAAEPPATPPRRKQAEGEQSRPEGEQGRPENKNKKAKDKHDD
                     LPTRGPGTRRPQVRAVPPPLSEELKNEAFRKTLERVETVAPEVPLQAAEQRSEPSDFD
                     LIINRLRVNAQEYMSQDEQAQENLQEGVRQLKSSYTEFLQTIQPEEKKKGDVEELDEE
                     EEEMRKIDWQFWTSVVNNFATVAKNDSAKLEEKVSDGIPKQIRGIIWQLISNSKSKEI
                     RQLYQDLLQIPSEHEKAIQRDISRTKFIPVDKTESLFNVLKAYSLFDPEVGYTQGMAF
                     VTAPLLINVWEEADAFGLLIKLMKNYGLREFFLPDMPGLQLKLYEFDRLLEENSPQLY
                     NHLIRLGIRSSMYATQWFLTLFAYKFPLGFVLRILDVIFVEGIESLLKFAVILMLKNE
                     SVLVQLKFDKLLDFLKDGLFNYYLKENVRKRQEGKEDTNAIQNAEVSDSSSKSSTVGS
                     EILGVEYNINVFIQDAIREVKITPIQLRRYSSEYEEIHQLEFQREAQYEEMRIKNRQL
                     QREVRKLEHDYTLLNREHIMLANELIQNRLKIETLNDENKDLKLTVDVLKRHLSDEMR
                     KQTLPNPDAQIPTDLKEDLEKTMQRNLEVMNQNQELEDKVTALERQVKQLKKNRANTS
                     VEHGEDSSSEPRVRSHIVTPSISSWTFKKPW"
     gene            complement(<132308..>134254)
                     /locus_tag="AGOS_AFL160C"
                     /old_locus_tag="AFL160C"
                     /db_xref="GeneID:4621616"
     mRNA            complement(<132308..>134254)
                     /locus_tag="AGOS_AFL160C"
                     /old_locus_tag="AFL160C"
                     /product="AFL160Cp"
                     /transcript_id="NM_210744.1"
                     /db_xref="GeneID:4621616"
     CDS             complement(132308..134254)
                     /locus_tag="AGOS_AFL160C"
                     /old_locus_tag="AFL160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL248C (GAL4)"
                     /codon_start=1
                     /product="AFL160Cp"
                     /protein_id="NP_985390.1"
                     /db_xref="GeneID:4621616"
                     /translation="MRPPVIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRR
                     SPLTRAHLTEVETRLGQMEQLLRNAFVDLDADTLLKHRHDPQLREILFGRTVDIGALS
                     RTDEYMASPLPPLRQAEFQWYERRDLLTGTGFNMKQSPLHSLVAEAQQEGLMARPSKY
                     ERMQLEEQSTTLRYMQAYFEHFHWLYPVVDEHEFYLLYEDPSTAPDACLWTGLVNVVL
                     ALGAWCAGAPPAAHVFYYDKAESHVLGRMLRTGDRVLAIALLLMAHYNYMTHHRNTAW
                     MLLGLASQLATSLGLHRDLQGLPPKQRTLAQILWWGIYSTTTQVALELGRPSPLPRIG
                     HTDVPVPDMTNPLYSHLANEVNLVIQLQRIMHVPNPSVAVCLQWYQTVKDFYHNIHPG
                     AGDDRDSYLLPREATDEQPNRLFCKYRITWKFHICVVSILFNSIMGNVPNVDTNSCYS
                     MCLKFTNDIINSIATFFNTYSLPHLLSWYSINYMIRASTVPLYCLNSPPPKTSDLEFL
                     LRSQLIATKDFLKKFLPESKLALRYSDMLADACNRASLRSHSPCIGSVEPPPLVPEPA
                     AFSAFSAPHSPTAPCADTFSDLLPFWNRPAGKADSPLLNPNQISAAADCSAMFDDIAT
                     LNSPDLYTTAVKDPGTDSPLTDTA"
     unsure          134811..134818
                     /note="sequence of low quality; region difficult to
                     PCR/sequence; plasmids, PCR products, and sequence from
                     other strains confirms the basic structure; number of C's
                     may be slightly different"
     gene            <135171..>139142
                     /locus_tag="AGOS_AFL159W"
                     /old_locus_tag="AFL159W"
                     /db_xref="GeneID:4621617"
     mRNA            <135171..>139142
                     /locus_tag="AGOS_AFL159W"
                     /old_locus_tag="AFL159W"
                     /product="AFL159Wp"
                     /transcript_id="NM_210745.2"
                     /db_xref="GeneID:4621617"
     CDS             135171..139142
                     /locus_tag="AGOS_AFL159W"
                     /old_locus_tag="AFL159W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR190C (SGS1)"
                     /codon_start=1
                     /product="AFL159Wp"
                     /protein_id="NP_985391.2"
                     /db_xref="GeneID:4621617"
                     /translation="MTRSRCFPSLASQVRWAQESGVCTPDGTQIFGFLRGTGGGAAGK
                     RARQESGGADGRADGQGGGARAGGGAEEARAARGSAAQTGAGWAACSVHSSPERAAGA
                     GGPRGGEGQAEQAYALVRLLKRQCALLQRKCALLEGAEGAQRARPPQLQRVQAALDTV
                     ADEVRRAEAPLNRMESSLGSSVAAVGLPFAARSEPAGGTRAVRPAQVVAIETDDESDG
                     EEQPRAIAQRRVQRRLRLRQQEVSYRVPALDEDVGFRTRAGALRGATDDSDATAEAET
                     EDSHFLSTMDEDVDDEIHASDREFIADGLENYLQDGNSGDEDYVFNSAAETTHDGPYS
                     NTQSQALTCSQLCSQKTDYAAHQGSAQKLPRDDHVHTERTAQEIVINSSFQREPSEDL
                     LQEDSIPEINLLDQDEDEDLFADPILHSIQPTSPQAELEEEIEPIVGDLSDSDLEAFN
                     HEREFQTPVNDIKELDDDLKIISEKTLDSTVDLGNTVSTSTQSALPTLKTEGFLNANQ
                     DFLEDDDFSIIEIQELPTPHAGGPEALQDTSEPHALTHPWSAELYHKLHNVFKLPGFR
                     PNQLEAVNATLQGKDVFVLMPTGGGKSLCYQLPAIVKAGCTHGTTIVISPLISLMHDQ
                     VEHLLAKNIKASMFSSKGTAEQRRQTFNLFINGLLDLVYISPEMVSASVQCRNAIQKL
                     YRDKKLARIVVDEAHCVSNWGHDFRPDYKELKFFKVEYPDIPMLALTATASEQVRMDI
                     IHNLHLKEPVFLKQSFNRSNLYYEVLRKDKNSLKDISHSIKTRFKGQTGIIYCHSKNS
                     CEQTAAIVQDSGVRCAYYHAGMEPDERLAIQQQWQSDKIQVICATVAFGMGIDKPDVR
                     FVYHYTVPRTLEGYYQETGRAGRDGKYSYCIMYYSFRDVRNIQSMIQKDKNLDRENKE
                     KHLTKLQQVMQYCENTTDCRRQLVLSYFNEQFSSQECSKNCDNCQNGSNVEYEERDVT
                     DEALQITKLVQSVEGDKVTLIHCQDIYKGSKNAKVIQMCHDQSHYHGLGKRMTKSDIE
                     RIFFHLITSQILQEYSVLNGRGFASNYVKLGPRANQLLRGNMKVKMQFAINHLISRPL
                     SASGEPNLVTAPSANVPATSKANDEAHAMLSAIGNYRYQDTPYTTSGKTSKADCAMQN
                     FSSHPADTQRHISASYTKLHNIVTRKTKDYGYDSSDSFIPPDVLKQMALLLPQTQWDF
                     DQMSPNMQLGSKFKYFKNALVRLKRERASIASSSGHQRPKENNNTQTSSFEGPRSEFF
                     AASRDQETADQQILSQLRQTMAVSPNKRASQTPAKRSKPYRPPKRGKYRKSSKSGGRR
                     PIR"
     gene            complement(<139224..>140918)
                     /locus_tag="AGOS_AFL158C"
                     /old_locus_tag="AFL158C"
                     /db_xref="GeneID:4621618"
     mRNA            complement(<139224..>140918)
                     /locus_tag="AGOS_AFL158C"
                     /old_locus_tag="AFL158C"
                     /product="AFL158Cp"
                     /transcript_id="NM_210746.1"
                     /db_xref="GeneID:4621618"
     CDS             complement(139224..140918)
                     /locus_tag="AGOS_AFL158C"
                     /old_locus_tag="AFL158C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YAL067C (SEO1)"
                     /codon_start=1
                     /product="AFL158Cp"
                     /protein_id="NP_985392.1"
                     /db_xref="GeneID:4621618"
                     /translation="MPALELMVDILKELVVQPWRRLKWGFIPVRRRLEEDAGGVATTT
                     EDGSLKESGLQKTTSLDTFTEEKYEYRDESKRPWWKYLDEQEYRVTKAHASKRRSWSW
                     FGTATSKAEKKLLFKLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLV
                     NTQAMFTVGAVIFQLPFIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRF
                     LIGVFEAPAYLSYQYLFGCFYKHDEIVRRSAFYYLGQYAGILSSGGIQSAVSATLDGK
                     NGLSGWRWSFIIDAIISIIVGIIGFYMLPGDPNNCYSIFLTDDEIRLARRRLEESNID
                     KSDFSSKIFDKQLWKNIMTDWKIYILSIWNIFCWNNNNGPAGAYLLWMKSLERFSTPN
                     LNRLSMITPALGMVYLILTSLIADLGHSRLAAILLTQVFNFMGNVILAVWDVSESAKW
                     FAFMLQYFGWAMAPVLYSWQNDICRRDARARAVILVVMNTVAQAMQAWISVLVWKTSE
                     APRFLKGFTFTSVDIFCLSMWTFVVLWFYKRDERMHCRENNVIIVNPKKDEGKPPV"
     gene            complement(<141840..>143156)
                     /locus_tag="AGOS_AFL157C"
                     /old_locus_tag="AFL157C"
                     /db_xref="GeneID:4621619"
     mRNA            complement(<141840..>143156)
                     /locus_tag="AGOS_AFL157C"
                     /old_locus_tag="AFL157C"
                     /product="AFL157Cp"
                     /transcript_id="NM_210747.2"
                     /db_xref="GeneID:4621619"
     CDS             complement(141840..143156)
                     /locus_tag="AGOS_AFL157C"
                     /old_locus_tag="AFL157C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL247C"
                     /codon_start=1
                     /product="AFL157Cp"
                     /protein_id="NP_985393.2"
                     /db_xref="GeneID:4621619"
                     /translation="MDYRGGKRSSISFGSYQRPMEQFQNAGGGIYQRQSPMLYHPRSL
                     EVGAPHAYCADLPSPQFAVDWDACDRVAIGSYKEDAFNKLTVLQATPDLSHWDSVAQA
                     SVIYPLSKIQWMPKGTGKLATCSDSLRIWSVEEQLHEQLNLSLVKYGKSLGEVSNGRM
                     LGQLPPVTSFDWNALDTNLILSSSIDTTCTVWDLQASNYVKTQLIAHDSEVFDAKFLT
                     QSSNLFASCGGDGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQL
                     QKNSQSSALSSSASSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGS
                     PMLLLEGHAAPVNQLKWHPSKPNVLATCGDDCQILYWDLLELLSASQVWTGLTQQRWS
                     TTSTVRTLETPQMSYTAQYEVNNFVWRPSGDWIGYTAGKRFYNIRM"
     gene            <143544..>144242
                     /locus_tag="AGOS_AFL156W"
                     /old_locus_tag="AFL156W"
                     /db_xref="GeneID:4621620"
     mRNA            <143544..>144242
                     /locus_tag="AGOS_AFL156W"
                     /old_locus_tag="AFL156W"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="NM_210748.2"
                     /db_xref="GeneID:4621620"
     CDS             143544..144242
                     /locus_tag="AGOS_AFL156W"
                     /old_locus_tag="AFL156W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR188C (MRPS17)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="NP_985394.2"
                     /db_xref="GeneID:4621620"
                     /translation="MARQNFVGLVISHGKMQKTVKVRVETKVFNKRLNKEMMHRKDYL
                     VHDEGESAREGDVVRIEATRPLSRRKYFSVAEILKNQGQRQVEFQADAKRAVRADEAA
                     RAQAFLERREQRTTAGTTLVADVAALQEAYTQGTLDSPEVAAIRERYGVSEFTPDTLQ
                     KLLELDVTAMEQEVMRQRTRLEDVLSRLEAYMQDQAAADAYLRSKNVEAPEELKKHTR
                     KNLLRKHITADLLN"
     gene            complement(<144302..>145087)
                     /locus_tag="AGOS_AFL155C"
                     /old_locus_tag="AFL155C"
                     /db_xref="GeneID:4621621"
     mRNA            complement(<144302..>145087)
                     /locus_tag="AGOS_AFL155C"
                     /old_locus_tag="AFL155C"
                     /product="AFL155Cp"
                     /transcript_id="NM_210749.1"
                     /db_xref="GeneID:4621621"
     CDS             complement(144302..145087)
                     /locus_tag="AGOS_AFL155C"
                     /old_locus_tag="AFL155C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL246C (RBD2)"
                     /codon_start=1
                     /product="AFL155Cp"
                     /protein_id="NP_985395.1"
                     /db_xref="GeneID:4621621"
                     /translation="MDWKSMLRTGVHKPGALTAGLSVFLTLVYVLNWVFPINEKILLD
                     PGALRKLQLTRLSLYPLAHLSIFHLLLNLMSLFVPLSMFEASHGTVFTGITLNLLAIV
                     TGVVYCLVGMLLYPNVYVGGASGWCFTLCGYFAVQEAGFRPHYELASLKMPTLYIPLV
                     FLVLVTLLMPGSSFVGHLIGLGLGYLIGFRERWLQMATPPGWLIVKIETWLDRWISMI
                     PSVVKYHRESSVDRTAGYTPLYQESELPLHNDNFPGQGRVLGP"
     gene            complement(<145415..>146389)
                     /locus_tag="AGOS_AFL154C"
                     /old_locus_tag="AFL154C"
                     /db_xref="GeneID:4621622"
     mRNA            complement(<145415..>146389)
                     /locus_tag="AGOS_AFL154C"
                     /old_locus_tag="AFL154C"
                     /product="AFL154Cp"
                     /transcript_id="NM_210750.2"
                     /db_xref="GeneID:4621622"
     CDS             complement(145415..146389)
                     /locus_tag="AGOS_AFL154C"
                     /old_locus_tag="AFL154C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL244C (HUT1)"
                     /codon_start=1
                     /product="AFL154Cp"
                     /protein_id="NP_985396.2"
                     /db_xref="GeneID:4621622"
                     /translation="MGSQVRLVIAVCGIYATFLTWSLAQEPLTTSVWPNSAARFSHSS
                     FIVLCQALTAAVVGLCYLKAQRSGYGAREFIRKHWADVAGISLTQALSAPAANHSLQY
                     VDYVGYMLAKSCKLLPIMLVHVLVYRTPIGRDKALVGVLVSGGVALFTLGGAERKQGE
                     ASLYGLGMLLVSLFLDGLTNASQDRLLRRPASKKITGAHLMVALNTAIVLWNLAYLVL
                     FDRTQWQGSLQQLHADPAILTYLFTYCACGALGQCFVFFTLEHYSSLVLATVTVTRKM
                     VSMLLSIVVYGHSVRPVQWLGILVVFGGIIWETVKKGQRGSGQKSKQH"
     gene            <146710..>148437
                     /locus_tag="AGOS_AFL153W"
                     /old_locus_tag="AFL153W"
                     /db_xref="GeneID:4621623"
     mRNA            <146710..>148437
                     /locus_tag="AGOS_AFL153W"
                     /old_locus_tag="AFL153W"
                     /product="AFL153Wp"
                     /transcript_id="NM_210751.1"
                     /db_xref="GeneID:4621623"
     CDS             146710..148437
                     /locus_tag="AGOS_AFL153W"
                     /old_locus_tag="AFL153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL243W (SRP68)"
                     /codon_start=1
                     /product="AFL153Wp"
                     /protein_id="NP_985397.1"
                     /db_xref="GeneID:4621623"
                     /translation="MVTAVKYSPLRATYGVRSDQYLEDYDDYRHYHGKLNAKLMSLRR
                     RLQLTTRDTRRYSAKEKYSKVGAAEYQRNRLHGLAMLLHAERDIAYAETLKLRARERG
                     WLKKSERRLLTTRLKKAWRTAGKLLEMTADEGRWVVRAELLVYEKLARVEYLVHGKHS
                     RRKDSDRIAQELALSVAALEYLCTEGEVAAETVATINGRFDYMLRQHAQCFSSAELQA
                     FTAKVVNTRKDDPLLVLLLAHGYELPVEGAAAADGGLQTEVKWRSYNAQIHEPNVARL
                     LNEIKTQDATQVSEHDDPVLKWNAAIDAQRQSMERRQEEGVHYEGEDDQILLTYLQFN
                     YLCATMGRDVALLQPLWVEWQEGRRTARFTKYKQLNHVINNIITHAEEAMGLPGVYSD
                     DELTAYLKLVKVFYRAQLVGRGLAPLYQEEGKHQEALALYAGSMQNLRTAMSAMPRDT
                     AFDPFNILDNVSELQKALESSCRSVAALAEYTGNSSRPAQQYELSLLEKMNTNTFIDY
                     ANIYTGNLFPLRPRVMPVSAKPTLFDLAFNYIGCESSAVPPEQTSAAVTPAAETEQPR
                     KRGIFGIFR"
     gene            <148658..>149935
                     /locus_tag="AGOS_AFL152W"
                     /old_locus_tag="AFL152W"
                     /db_xref="GeneID:4621624"
     mRNA            <148658..>149935
                     /locus_tag="AGOS_AFL152W"
                     /old_locus_tag="AFL152W"
                     /product="AFL152Wp"
                     /transcript_id="NM_210752.1"
                     /db_xref="GeneID:4621624"
     CDS             148658..149935
                     /locus_tag="AGOS_AFL152W"
                     /old_locus_tag="AFL152W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR187C"
                     /codon_start=1
                     /product="AFL152Wp"
                     /protein_id="NP_985398.1"
                     /db_xref="GeneID:4621624"
                     /translation="MNFIYRKKYTCWICLEESDGLFSFAWTRHECGCSLQVHNKCLVR
                     WLFATNLRVWNECGTSDFYRIRSLPELKRRLCYVVDGHRNFQSEVNLAETVQGIPAVG
                     QTWAAFLCILEMAVRILLRIPPSEPPTDLWRGLPIEAVACPQCKKSITKGRLYWHTSS
                     LGLHAYSIYKSASTYVATIALFWFLYSNPWKQWFKIGLYLLRQVFPESILQQILDVST
                     TRAIDVYTDSMNGIECVPARQRFLILGFPLYLAGLLSPTLPLGYMQQIYPWTLVTACR
                     NSKVVLKVLSVELFVASLYTKVAAMLGRSLKKKLLSVRPYFNSPKDSTENNTFTEELL
                     RTTWLDCITDITLLFRISTFISNNILQPIPIITRLILKLDPTVSPNECICVQNLLAIG
                     AVCCGRELGRFFLAYKRSRELQQLQRIVEDDDI"
     gene            <150323..>151129
                     /locus_tag="AGOS_AFL151W"
                     /old_locus_tag="AFL151W"
                     /db_xref="GeneID:4621625"
     mRNA            <150323..>151129
                     /locus_tag="AGOS_AFL151W"
                     /old_locus_tag="AFL151W"
                     /product="AFL151Wp"
                     /transcript_id="NM_210753.2"
                     /db_xref="GeneID:4621625"
     CDS             150323..151129
                     /locus_tag="AGOS_AFL151W"
                     /old_locus_tag="AFL151W"
                     /note="NOHBY611; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0A03146g"
                     /codon_start=1
                     /product="AFL151Wp"
                     /protein_id="NP_985399.2"
                     /db_xref="GeneID:4621625"
                     /translation="MDGINRILPRSPYFCTPSTIPFKVMVAPQAKQEEYKDNESTLSD
                     ILSDSDASSDEPLTLYSGYRTKVKDYLVPTTDSDPNSVPFRLLRDGAILLRQLLCANA
                     TLGNNFSRGIVTSDLGQEALFWSGLPLYFSGMILPDAVANMHRLLFVVEVVCRRDLTS
                     FGKYGVLLLLALPLISKVIRRLFFAESIKLSTLEAGVAPAADSAMIWPLLGKFLNQYL
                     LMKIPYYRWLVEACTGNTDDALWFGNLLGCFLLLVVKDVAWWLNRKLLKG"
     gene            complement(<151290..>156230)
                     /locus_tag="AGOS_AFL150C"
                     /old_locus_tag="AFL150C"
                     /db_xref="GeneID:4621626"
     mRNA            complement(<151290..>156230)
                     /locus_tag="AGOS_AFL150C"
                     /old_locus_tag="AFL150C"
                     /product="AFL150Cp"
                     /transcript_id="NM_210754.2"
                     /db_xref="GeneID:4621626"
     CDS             complement(151290..156230)
                     /locus_tag="AGOS_AFL150C"
                     /old_locus_tag="AFL150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL242C (IQG1)"
                     /codon_start=1
                     /product="AFL150Cp"
                     /protein_id="NP_985400.2"
                     /db_xref="GeneID:4621626"
                     /translation="MTVQLDSPTKEKSRYVEKYLQSLGSAEKSGTNSRTLLQASPAKI
                     NSSPLKDEASAEKKSDKPLSKRTGGFQGGTKVKGGISNNPFLLQDSEVKHDSPNISPA
                     RSAVAKGSAKKPLQAAAKTRPENGNVSQPNESRREAAQHEVSPKAQKKVDTSGMSRET
                     LRYYEFLCRVGEAKRWIEDVIGETIPGELELAAGNSMRDGYFLAKVTQTIKPDLAPTI
                     VPPGRLQFKHTQNINAFFSLMDLVGVPDLFRFELTDLYEKKDVPKVFETLHAVANILN
                     SRFPGEIPEIHNLSGVLEFSPQELKECKQKLPNVRNFRSFKADGATNASSEKLPRNEG
                     LIKDWNPRSRELEPALVLGSKGTAPDEDEKFVVEVTPEPEPEPEPEPEPEPEPEPEPK
                     PESKLNPEPAPKPQAQPAPPEVIVVNDVSPKVPDRQMPTLEAQRVPDLLHMDHSGMAN
                     GFPRTPERQLNGSYLYSQRYISPQYPERSFMGSRTASILLSDPLLRTANTNLTYSPSK
                     NFSYYSPSISRRISYRTDSMKSLDREHLLYNHYLSNYPPYSPARRQRMSEDQFLDIVF
                     RIQAISRGANLRYGIYLKKKTFELFDEEISIFQAWCRAGSLRKQYSLKLRPVLSAESE
                     AQIFSLQSYISGYIYRSHLDILQLRCLKNDMVIRRFQNIVKSVLLRRASREALTKISL
                     CRAPLTKLQSYIRGSKLRTDFDYTYSNLRRVHYEVIHFQAHCRGLNVKTRYNYEIQCS
                     SIHRGLLEECQATLRGIAQRRKLYDTLFEIDFYDLALDHFSAVIKGGKVRHQLEAVNQ
                     YRDSTDPLTYLQARVRGVLARFAVELINDAVELYSINQFQAMLLGGKLRSELLASRRY
                     YRNNVRVVVQIQSAIRAYQMSSAYHELLNSTTPSLWAVKKFVHILNENETDTLYSQLH
                     KKKALVNDCNGEICRLQSTIRTLITKKSLLEHRGIQVSRYLSQAGLKSLERFSVERAS
                     KDVMQQNSLYERICYLLQVDSFYWKLLFKLEPYSCINFLPKLFSPTSGKISHRENLLF
                     IKMIMDLMLDELDETPTDFFLSSRNSKSPWRLLLAEYLPRHKNSDTVYLFGTVLESLS
                     EPGTDFESVPANIWKFLHPGEPMVASHIAIDDPLTNAKYVENMMNIWNTTESVRNILM
                     VMIDSIPMEIKYLCTKAFRAVADRSTDIYDPLRAISMVLIEHFVNGFFMNRASYGYQD
                     DVQDLEDKIQVLCSALSTIFNLREFNGYYSSLTPYAEAIKPDVVLLLKSMLISPDFEN
                     ECDSIVYRDMGSTERPFMVMKQEYLENMIKTFISHQSIFPHDDAIVELLKQMEKIFET
                     SVTKMSGVVEVELDPTVYHVPLEDDRSALLYNETKRGISYLIQVEDVETNLNDLLTSS
                     VFPEDDNVFTQLLLKYPAVREDLAKKNLDNTGYVTFKKHVMQRVKELKHLGIIDSANN
                     YQSVLNDIANTIRSRSYVGHMNERELIFMNDVYEHLKQKENYMSLLSQALSTAVSKSV
                     KQIQKCGHYQPIRKSGLGNKIKDAYRRVQGKHSDTPNGIHYTWSARQLYERGVLRDIK
                     GENLKDIAVTFFGSNAPRFPDISFRIATQNGEIYNVDMFVGRKRNMKYREVIKFKELL
                     DKESEDPESTIVLMRGRSATFKISALIDLLCEVFFR"
     gene            complement(<156568..>157433)
                     /locus_tag="AGOS_AFL149C"
                     /old_locus_tag="AFL149C"
                     /db_xref="GeneID:4621627"
     mRNA            complement(join(<156568..157298,157352..>157433))
                     /locus_tag="AGOS_AFL149C"
                     /old_locus_tag="AFL149C"
                     /product="AFL149Cp"
                     /transcript_id="NM_210755.1"
                     /db_xref="GeneID:4621627"
     CDS             complement(join(156568..157298,157352..157433))
                     /locus_tag="AGOS_AFL149C"
                     /old_locus_tag="AFL149C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL241C (CIN2); 1-intron"
                     /codon_start=1
                     /product="AFL149Cp"
                     /protein_id="NP_985401.1"
                     /db_xref="GeneID:4621627"
                     /translation="MEDLFPLRPDGSLDAKATARQFASFEKEIQSSIDDPSKLNAARK
                     RLVDVSLQLTNLAACLPRFDRERYGNKLERLLAAIQERELRNAPAGQKRFHFTRKPPK
                     QQKPQASTPLAAPCAAVTPANALASTYQVVRVGPADTHFADMRNCQLLSEATAPVTTS
                     ALHLQRIVASSVKLRPIPFEHGSLYIEDCEDVTFMLECPPESDIQIRLRCLRNCKLCI
                     TRPDAVAQKVVLERCTDCIFEKSSQEKVLIQDFGNLGFLDSQPTNYSFASWV"
     gene            complement(<157654..>159768)
                     /locus_tag="AGOS_AFL148C"
                     /old_locus_tag="AFL148C"
                     /db_xref="GeneID:4621628"
     mRNA            complement(<157654..>159768)
                     /locus_tag="AGOS_AFL148C"
                     /old_locus_tag="AFL148C"
                     /product="AFL148Cp"
                     /transcript_id="NM_210756.1"
                     /db_xref="GeneID:4621628"
     CDS             complement(157654..159768)
                     /locus_tag="AGOS_AFL148C"
                     /old_locus_tag="AFL148C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR186W (HSC82) and YPL240C (HSP82)"
                     /codon_start=1
                     /product="AFL148Cp"
                     /protein_id="NP_985402.1"
                     /db_xref="GeneID:4621628"
                     /translation="MSSQETYEFQAEITQLMSLIINTVYSNKEIFLRELISNASDALD
                     KIRYQSLSDPKVLESDPELFIRLTPKPEEKVLEIRDSGIGMTKAELINNLGTIAKSGT
                     KAFMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKHNDDEQYIWESNAGGSFTVT
                     LDEVNERIGRGTILRLFLKEDQLEYLEEKRIKEVVKRHSEFVAYPIQLLVTKEVEKEV
                     PVEEEEKKEETEDDKKPKLEEVDEEEEDKEKSKTKKVKENVKELEELNKTKPLWTRNP
                     SEVTQEEYNAFYKSISNDWEDPLAVKHFSVEGQLEFRAILFIPKRAPFDLFESKKKKN
                     NIKLYVRRVFITDEAEELIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIKKNIV
                     KKLIEAFNEIAEDSEQFEKFYSAFAKNIKLGIHEDSQNRASLAKLLRYNSTKSVDEQT
                     SLADYVTRMPEHQKNVYFITGESIKAVEKSPFLDALKAKNFEVLFLVDPIDEYAFQQL
                     KEFEGKQLVDITKDFELEESEEEKKQREEEIKEFEPLTAALKEVLGDQVEKVVVSYKL
                     IDAPAAIRTGQFGWSANMERIMKAQALRDSTMSSYMASKKIFEISPKSAIIKELKKRV
                     EDNGAQDRTVKDLTSLLYETALLTSGFTLEEPASFATRINRLISLGLNIDEEESTETA
                     AETATEAPVEEVAPETAMEEVD"
     gene            complement(<160054..>162870)
                     /locus_tag="AGOS_AFL147C"
                     /old_locus_tag="AFL147C"
                     /db_xref="GeneID:4621629"
     mRNA            complement(<160054..>162870)
                     /locus_tag="AGOS_AFL147C"
                     /old_locus_tag="AFL147C"
                     /product="AFL147Cp"
                     /transcript_id="NM_210757.2"
                     /db_xref="GeneID:4621629"
     CDS             complement(160054..162870)
                     /locus_tag="AGOS_AFL147C"
                     /old_locus_tag="AFL147C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR185W"
                     /codon_start=1
                     /product="AFL147Cp"
                     /protein_id="NP_985403.1"
                     /db_xref="GeneID:4621629"
                     /translation="MSNASGEQRKLEDVLQRRPDFVKDTPLDSFFENLQREFLSPLRT
                     SDGLNIYERIGCQDNGEFVTRCVERLTCLHGLAVEREQGEGAEHKLLPISLHDMKFFD
                     ELINLLIVHGVYANLPQGFGVPLQQRQLSQFKDIAERFQVPGKHVRSATTLEVASRGL
                     YIILSQDRAVDTVRDILLKGAGYIDALMGFIALRHDRPQRQEEYDNVLEKLESIQDTY
                     RLLSIYSLLVQSTCAREYLEWPLQQLSTLTVRRDDGVASLVDFVVGLRDEEQVSIEKF
                     DRVKQILLAKPKSLSNVEYFHRLFKQIYTCLADVNRPVLISCLNSVLVGFYYKNKRIV
                     YDFLFQRVARILFNVGSEAFSEKQLNDCFNVLISLSKSSSTELIGALVQYKGAQSFYF
                     HLWVYGLFLRKNQTIQPVESEAKYYMVVFSLLNTFVKLTGDFEALERLVPHLVNFDHE
                     TWRYAINLETHLPYVLPKSGDENAAADLNLHDAPETGLSKIQQLFSSMDFAVEAFIEL
                     LNLLGEEEVRKNIFLQVLRRWVEATSKSESVQQTAIGGDSVSHNLLALVDLKLLEKMH
                     AQFKDDIISRPHDILRLVADLLVYSHSQEDEHSAKDSDDEDSEDEEAAAEPAQGRPFS
                     ILLDLLSATLLSAPPADLVSEQPTLQLLAERLQAYPADASCRALQLRIRDVLARRAPA
                     PGADAVGAADNAAFSRALANVNDALPSLRAHGLYELRRLIERGSPSVGLTRVLDLHFL
                     LLRDPEPFVYLNAIKGLSTLCLSATATALPALLARYHDPQGRMPLDHALRLAEALAAF
                     IPAQNELLQGPHAAALVETCLSKVRARTADARLRMSALSLLGLCVRTNPLGVAAVLPD
                     ILDCALGVLQLEPVVASDDRTPLVRRAAAHLIHDLLSASGLDLLPPSDLRRLADVVRN
                     TATNEKDYLTAEPLADALQLLEGR"
     gene            <163008..>163604
                     /locus_tag="AGOS_AFL146W"
                     /old_locus_tag="AFL146W"
                     /db_xref="GeneID:4621630"
     mRNA            <163008..>163604
                     /locus_tag="AGOS_AFL146W"
                     /old_locus_tag="AFL146W"
                     /product="AFL146Wp"
                     /transcript_id="NM_210758.1"
                     /db_xref="GeneID:4621630"
     CDS             163008..163604
                     /locus_tag="AGOS_AFL146W"
                     /old_locus_tag="AFL146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL239W (YAR1)"
                     /codon_start=1
                     /product="AFL146Wp"
                     /protein_id="NP_985404.1"
                     /db_xref="GeneID:4621630"
                     /translation="MPLHQGPLDIEDQLAIIADARIGDLDSLKQIFSELIDPKLLPSC
                     SDPDTLCTPLHMAAANGHADVARYLLSLLEPAAARDWAAAQNATGNSALHWAALNGHL
                     EVVKLLCDDYAADPFVRNSFGHDAIYEAESCSRDDVEAYFLQKYDIAPTQDDSAGDAA
                     EGPADLNVAVTAGTEIEQVTRDAAEALRAQAERLDLAN"
     gene            <163861..>164709
                     /locus_tag="AGOS_AFL145W"
                     /old_locus_tag="AFL145W"
                     /db_xref="GeneID:4621631"
     mRNA            <163861..>164709
                     /locus_tag="AGOS_AFL145W"
                     /old_locus_tag="AFL145W"
                     /product="AFL145Wp"
                     /transcript_id="NM_210759.2"
                     /db_xref="GeneID:4621631"
     CDS             163861..164709
                     /locus_tag="AGOS_AFL145W"
                     /old_locus_tag="AFL145W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL237W (SUI3)"
                     /codon_start=1
                     /product="AFL145Wp"
                     /protein_id="NP_985405.2"
                     /db_xref="GeneID:4621631"
                     /translation="MSDLANELGFDPSLKKKKKVKKVAPEEAIGAAEASVEGDDLFAG
                     LKKKKKKAKEGSKEEEGTGDALDELTEALGELKLKKKKKKKEAAALDVFDKELEKAGV
                     SVEEGSAEPGVSAGAASEVQEDVGLPYSDLLSRFFKILRTNNPELAGDRSGPKFRIPP
                     PVCQRDGKKTIFANIQEISEKLQRSPEHLIQYLFAELGTSGSIDGQKRLVIKGKFLSK
                     QMENVLRRYIMEYVTCKTCKSINTELKKEQSNRLFFLVCKSCGSTRSVSSIKTGFQAT
                     VKRRRF"
     gene            complement(<164940..>165416)
                     /locus_tag="AGOS_AFL144C"
                     /old_locus_tag="AFL144C"
                     /db_xref="GeneID:4621632"
     mRNA            complement(<164940..>165416)
                     /locus_tag="AGOS_AFL144C"
                     /old_locus_tag="AFL144C"
                     /product="AFL144Cp"
                     /transcript_id="NM_210760.1"
                     /db_xref="GeneID:4621632"
     CDS             complement(164940..165416)
                     /locus_tag="AGOS_AFL144C"
                     /old_locus_tag="AFL144C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR184W (ADD37)"
                     /codon_start=1
                     /product="AFL144Cp"
                     /protein_id="NP_985406.1"
                     /db_xref="GeneID:4621632"
                     /translation="MKSFQNCTESEVSGYNDCPNFLFAAREHTAGSSHRRGLKARARG
                     RARRPDMPSDALQQMEPGELEEIRAEAMRKIEWLFETESRLAEVEFNFYRNKVRQNLG
                     RALADERTLLMMAAVLRQLPADLETAKDVLTTWLVSDVSVAAWCTALRKILENAVL"
     gene            complement(<165676..>166761)
                     /locus_tag="AGOS_AFL143C"
                     /old_locus_tag="AFL143C"
                     /db_xref="GeneID:4621633"
     mRNA            complement(<165676..>166761)
                     /locus_tag="AGOS_AFL143C"
                     /old_locus_tag="AFL143C"
                     /product="AFL143Cp"
                     /transcript_id="NM_210761.1"
                     /db_xref="GeneID:4621633"
     CDS             complement(165676..166761)
                     /locus_tag="AGOS_AFL143C"
                     /old_locus_tag="AFL143C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL236C (ENV7)"
                     /codon_start=1
                     /product="AFL143Cp"
                     /protein_id="NP_985407.1"
                     /db_xref="GeneID:4621633"
                     /translation="MLRMGEYICGCKPLWNLWANDVRITVNGKRYLVTGLLSDKGLTM
                     IYKVRSLQREQRGNFCIKAVHCPFGRAEHVAEAMREIDNYQAFHSPYITSLLDSQIVP
                     LEQGSKLVYMVLQYFPTGSLQQLIDTTLVEGVPLPEPRVLALMVEVCRAVRAVHQPGD
                     EGVESGSATQSEDTHLLADALEMDVLEASTSSPRRSFVLCDLRPSAVMLTPQGMPIIS
                     DLSACVRSGYALANATRLARMRAVLDTHGSPMYLAPELCALEPNACILPPADIWSLGC
                     ICYALMYGISPFEREEQLHGTPLRQARASGLFSFPDNPVYSLQLLDIVRQCLAVKPDA
                     RPTIDSLMSLFHDLLDDSAIGSLVLGE"
     gene            <166967..>168376
                     /locus_tag="AGOS_AFL142W"
                     /old_locus_tag="AFL142W"
                     /db_xref="GeneID:4621634"
     mRNA            <166967..>168376
                     /locus_tag="AGOS_AFL142W"
                     /old_locus_tag="AFL142W"
                     /product="AFL142Wp"
                     /transcript_id="NM_210762.2"
                     /db_xref="GeneID:4621634"
     CDS             166967..168376
                     /locus_tag="AGOS_AFL142W"
                     /old_locus_tag="AFL142W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL235W (RVB2)"
                     /codon_start=1
                     /product="AFL142Wp"
                     /protein_id="NP_985408.2"
                     /db_xref="GeneID:4621634"
                     /translation="MSIQTQEAHDMSLKSLSLIATHSHIVGLGLDENLQPKPSSQGMV
                     GQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGLSQSLGADVPFTAMAG
                     SEIFSLELSKTEALTQAFRKSIGVKIKEDTELIEGEVVEIQIDRSITGGHKQGKLTIK
                     TTDMETIYELGNKMIDGLTKEKVLAGDVISIDKACGKITKLGRSFARSRDYDAMGPDT
                     KFVQCPEGELQKRKSVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKV
                     AEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVIMATNRGISKTRGT
                     NYKSPHGLPLDLLDRSIIITTQNYSEQEIKTILSIRSQEEEVELTEDALDLLTKIGGE
                     TSLRYSSNLIAVSQQIAQKRKSSSVDVQDVKRAYLLFLDSTRSAKYLQEYESRYIDDH
                     GRVDISTTGRNADAMDTNE"
     gene            complement(<168568..>169062)
                     /locus_tag="AGOS_AFL141C"
                     /old_locus_tag="AFL141C"
                     /db_xref="GeneID:4621635"
     mRNA            complement(<168568..>169062)
                     /locus_tag="AGOS_AFL141C"
                     /old_locus_tag="AFL141C"
                     /product="AFL141Cp"
                     /transcript_id="NM_210763.1"
                     /db_xref="GeneID:4621635"
     CDS             complement(168568..169062)
                     /locus_tag="AGOS_AFL141C"
                     /old_locus_tag="AFL141C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL234C (VMA11)"
                     /codon_start=1
                     /product="AFL141Cp"
                     /protein_id="NP_985409.1"
                     /db_xref="GeneID:4621635"
                     /translation="MTDDLVNEYAPAFAPFFGFAGCAAAMILSSLGAAIGTAKSGIGI
                     SGIGTFRPELIMKSLIPVVMSGILAVYGLVVAVLVAGGLSPTEEYTLFNGFMHLAAGL
                     CVGFACLSSGYAIGIVGDVGVRKFMHQPRLFVGIVLILIFAEVLGLYGMIIALILNTR
                     GSGN"
     gene            <169942..>170595
                     /locus_tag="AGOS_AFL140W"
                     /old_locus_tag="AFL140W"
                     /db_xref="GeneID:4621636"
     mRNA            <169942..>170595
                     /locus_tag="AGOS_AFL140W"
                     /old_locus_tag="AFL140W"
                     /product="AFL140Wp"
                     /transcript_id="NM_210764.1"
                     /db_xref="GeneID:4621636"
     CDS             169942..170595
                     /locus_tag="AGOS_AFL140W"
                     /old_locus_tag="AFL140W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL233W (NSL1)"
                     /codon_start=1
                     /product="AFL140Wp"
                     /protein_id="NP_985410.1"
                     /db_xref="GeneID:4621636"
                     /translation="MPAEKLELTSEEIKHIHLQLKGILDEKIRLHLPQRHSVSESQDT
                     DDGSDSMARQVMVEVEKFLSSVMEMASDSVHVSDARSSVTVLDVVNDVQREYVEPFDL
                     ELNERVRQLYQEWEAETLRVAQLRQTGPRAITDAYLKEEGAAIAALDERIRKLEGLAE
                     ADQETQLPAADADFWSEVGDQYGRSLGLLKQAQSLLPRDRMQLEKLKKLVQYLENEV"
     gene            <170943..>171836
                     /locus_tag="AGOS_AFL139W"
                     /old_locus_tag="AFL139W"
                     /db_xref="GeneID:4621637"
     mRNA            <170943..>171836
                     /locus_tag="AGOS_AFL139W"
                     /old_locus_tag="AFL139W"
                     /product="AFL139Wp"
                     /transcript_id="NM_210765.1"
                     /db_xref="GeneID:4621637"
     CDS             170943..171836
                     /locus_tag="AGOS_AFL139W"
                     /old_locus_tag="AFL139W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR183C (SSO2) and YPL232W (SSO1)"
                     /codon_start=1
                     /product="AFL139Wp"
                     /protein_id="NP_985411.1"
                     /db_xref="GeneID:4621637"
                     /translation="MNQQNPYDSGNPYADAYEMQGYRNSGNGAGPAQSGAGGDDFVVF
                     MNGIGQINNELDRYSQLIGQIDVYQKRLLTEVNEEQEIMLRKQLDVFASQASDLQYQL
                     KDDIKRAQQQAAGDMSKEAQAENSRQRFLKLIQDYRITEANYRENNKEQAKRQYRIIQ
                     PEATDDEVEAAISDVGGQQIFSQALLSANRRGEAKTALAEVQARHQELLKLEKTMAEL
                     TQLFNDMEHLVIEQQEQVEFIDKQVEEAQQDVEQGVGHTNKAVKSARRARKNKIRCII
                     ILIIVLIIVAIAVAVPLATRK"
     gene            <172713..>178388
                     /locus_tag="AGOS_AFL138W"
                     /old_locus_tag="AFL138W"
                     /db_xref="GeneID:4621638"
     mRNA            <172713..>178388
                     /locus_tag="AGOS_AFL138W"
                     /old_locus_tag="AFL138W"
                     /product="AFL138Wp"
                     /transcript_id="NM_210766.2"
                     /db_xref="GeneID:4621638"
     CDS             172713..178388
                     /locus_tag="AGOS_AFL138W"
                     /old_locus_tag="AFL138W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL231W (FAS2)"
                     /codon_start=1
                     /product="AFL138Wp"
                     /protein_id="NP_985412.2"
                     /db_xref="GeneID:4621638"
                     /translation="MVMKPEVEQELAHVLLTELLAYQFASPVRWIETQDVFLKEYNTE
                     RVVEIGPSPTLAGMAQRTIKSKYESYDAALSLRRQVLCYAKDAREIYYTKDPAEVAAP
                     AAAAAAAAPATPAAAAPAAAAASAAAPAAAAPAAAPAAPAAALQDQPVEAKLVLHTLV
                     AQKLKKTYDAVPMAKSIKDLVGGKSTVQNEILGDLGKEFGTTPEKPEESALEELAEVM
                     QESFEGSLGKQSTSLISRLISSKMPGGYTITVARKYLQNKWGLGSGRQDSVFLVSLVH
                     EPASRLGSESDANAFFDSMAQKYASMAGIDLSAAQAGASSGGSAGSGDAVIDAAAFEE
                     LTKDQRIMARQQLEVLARYLKVDLNKGERKYLKSQDSFAALQAQLDYLTEELGSFFVQ
                     GVATSFSKKKARVFDSSWNWAKQSLLTLYFEIIHGVLKNVDREVVTAAINIMNRSNDA
                     LIKFMEYHVSHTDEEKGENYQLLKALGEQLIENCKQVIHLDPVYKDISKPTGPKTIVD
                     EKGNITYREEPREGVRKLSQYVQEMALGSHVTKQSQPTIQEDLTRVYKSISAQANEAN
                     ISEGTKLQFEKLYGELLQFLEASNEIDASATTTLAGVDDDSLDRDSTKEVASLPTKTA
                     IEKTVSSTIPRATVPFLHLKKQLASGQWVYDRQLSSMFLDGLEKAAINGVTFKDKYVL
                     ITGAGQGSIGAELLEGLLQGGAKVIVTTSRFSKKVTEYYQSVYTRFGAKGSTLVVVPF
                     NQGSKHDVESLIDYIYDDPKSGGLGWDLDVVIPFAAIPENGIELENIDSKSEFAHRIM
                     LTNILRMLGCIKKQKSARGIETKPAQVILPLSPNHGTFGADGLYSESKLALETLLNRW
                     HSESWSNQLTICGAIIGWTRGTGLMTANNIIAEGIEKLGVRTFSQKEMAFNLLGLLIP
                     ELVQLCQKSPVMADLNGGLQFIEDLKKFTVKLRADLMETSEIRRAVSLETSLEHKAVY
                     GPQADTGRDDVYVQPRANIQLNFPTLKPYSEIKKIAPGELEGLLDLEKVIVVTGFSEV
                     GPWGSSRTRWEMEAHGEFSLEGCVEMAWMMGLIRYHNGNLKGRPYTGWVNTKTNEPLD
                     DIDVKAKFEPYILEHSGIRLIDPQSFDGYDPQRKQLLQEVVVEEDLAPFEASKETAEQ
                     FKLEHGDRVDIFEIPETGEYSVKLLKGATLLIPKALRFDRLVAGQIPTGWNAKTYGIS
                     EDTISQVDPITLFVLVSVVEAFIASGISDPYEMYKYVHVSEVGNCSGSGMGGVSALRG
                     MFKDRYKDKPVQNDILQESFINTMSAWVNMLLISSTGPIKTPVGACATAVESMDIGVE
                     TILSGKAKICIVGGYDDFQEEGSFEFGSMNATSNSLEEFEHGRTPAEMSRPTTTTRSG
                     FMEAQGAGIQIIMNADLALKMGVPIYGIVALTATATDKIGRSVPAPGQGILTTAREHH
                     GSMKYPSPLLDIKYRKRHLTAREKQIKDSVESELSLLQYELDGIPEEEQSTFLAERTE
                     AIKRDAAKQLKAAQAQWGNEFYKNEPRIAPLRGALATYGLTIDDLGVASFHGTSTKAN
                     DKNESATINQMLKHLGRSEGNPIIGVFQKYLTGHPKGAAGAWMMNGAIQILNSGIVPG
                     NRNADNIDEVMEQFEYILYPSHSIKTDGIKAVSVTSFGFGQKGAQAVVVHPDYLYASL
                     SEKVYGTYMEKVAVRERCAYKYFHNGMINNSLFVSKDKAPYTDDLEQPVYLDPLARVS
                     NDKAGTLTFSAKNIQANQEGSFASKDTAEVVKQMTTHLASQGKTGGVGVDVELIRSIN
                     ISNETFILRNFTREEAEYCRNQPCAQSSFAGLWSAKEAVFKSLGVRSQGAGAPLREIE
                     IQRDTATGAPIVHLHGEAKKAATAAGVHSVRISISHDDFQAVAVAIAEK"
     gene            complement(178466..178889)
                     /locus_tag="AGOS_AgSNR83"
                     /old_locus_tag="AgSNR83"
                     /db_xref="GeneID:4621639"
     ncRNA           complement(178466..178889)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR83"
                     /old_locus_tag="AgSNR83"
                     /product="AgSNR83"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR83 (RUF3); start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149430.1"
                     /db_xref="GeneID:4621639"
     gene            <179512..>180045
                     /locus_tag="AGOS_AFL137W"
                     /old_locus_tag="AFL137W"
                     /db_xref="GeneID:4621640"
     mRNA            <179512..>180045
                     /locus_tag="AGOS_AFL137W"
                     /old_locus_tag="AFL137W"
                     /product="AFL137Wp"
                     /transcript_id="NM_210767.1"
                     /db_xref="GeneID:4621640"
     CDS             179512..180045
                     /locus_tag="AGOS_AFL137W"
                     /old_locus_tag="AFL137W"
                     /note="NOHBY610; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Zygosacchromyces rouxi ZYRO0E07744g"
                     /codon_start=1
                     /product="AFL137Wp"
                     /protein_id="NP_985413.1"
                     /db_xref="GeneID:4621640"
                     /translation="MFIYHRPMSCSQRVIIHIKLSPPLHICPASPPFAEGKRSTETQF
                     TTTTYIYDLLFRACVRLPPSVPTSASCHLTPSRHSSFVYRTHRRHRARTLPFRISEKN
                     AGRHYHIPVTANLPLHFHSIVAATFPKLQEHHLTSSGQEFQLQLIFWDLPPLESCYTF
                     KKFFDAYAGLLAVLPPI"
     gene            <180213..>181388
                     /locus_tag="AGOS_AFL136W"
                     /old_locus_tag="AFL136W"
                     /db_xref="GeneID:4621641"
     mRNA            <180213..>181388
                     /locus_tag="AGOS_AFL136W"
                     /old_locus_tag="AFL136W"
                     /product="AFL136Wp"
                     /transcript_id="NM_210768.2"
                     /db_xref="GeneID:4621641"
     CDS             180213..181388
                     /locus_tag="AGOS_AFL136W"
                     /old_locus_tag="AFL136W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL230W (USV1) and YMR182C (RGM1)"
                     /codon_start=1
                     /product="AFL136Wp"
                     /protein_id="NP_985414.2"
                     /db_xref="GeneID:4621641"
                     /translation="MGVQKRTTPGGGSKNQPRSFKCTGYGNCDMSFTRAEHLARHIRK
                     HTGEKPFQCEVCNRFFSRIDNLKQHRESVHSIPTISTTRSKRQSRSKSLQEGAGAVET
                     SFGGVLNTATAVRSASLPTFETQGSASPASPRQAPYIYGAGQPAQATAEPTGPGGHTP
                     RMILPPIFMTTPRAGAAGQPALLRQPLAGTSQQAEMHVARGQQRSYPGYYAGQQPLTP
                     NGSNGSCDRPFNVAWESRIYVAAPLGSATPPALPPPTLHQALSQNPPPYPKVPYGAEY
                     VVDSPPLENTALHSHVIPRNSFMHNPSKIERIAATSPAAADAPGTVPVTVISSKKLAP
                     VLARAQSPPPAGAQRLSTASRDAAPSAAMPAAPAPPAVRAAQDGARVGRISVSSMLS"
     gene            <181674..>182285
                     /locus_tag="AGOS_AFL135W"
                     /old_locus_tag="AFL135W"
                     /db_xref="GeneID:4621642"
     mRNA            <181674..>182285
                     /locus_tag="AGOS_AFL135W"
                     /old_locus_tag="AFL135W"
                     /product="AFL135Wp"
                     /transcript_id="NM_210769.1"
                     /db_xref="GeneID:4621642"
     CDS             181674..182285
                     /locus_tag="AGOS_AFL135W"
                     /old_locus_tag="AFL135W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR181C and YPL229W"
                     /codon_start=1
                     /product="AFL135Wp"
                     /protein_id="NP_985415.1"
                     /db_xref="GeneID:4621642"
                     /translation="MASTASPPARRGACCDVVQLSRDPEGLGARGDSCTKFGPSQFGL
                     SITQNRPYRTTEIVAKKLLRCLHVREQRPMPYPTPPLSNASLGTSADGGSAAGLAQQA
                     PAKSYYPLVPDGAQLTPPLLPVSTAGDDAGLYRYHKQISKSFQDDLIYCPRALLSKVE
                     LTQCYQLDMLLLMEQQQQAQPSVKFNPYTSQSFNPAGPASPGS"
     gene            <182634..>184070
                     /locus_tag="AGOS_AFL134W"
                     /old_locus_tag="AFL134W"
                     /db_xref="GeneID:4621643"
     mRNA            <182634..>184070
                     /locus_tag="AGOS_AFL134W"
                     /old_locus_tag="AFL134W"
                     /product="AFL134Wp"
                     /transcript_id="NM_210770.2"
                     /db_xref="GeneID:4621643"
     CDS             182634..184070
                     /locus_tag="AGOS_AFL134W"
                     /old_locus_tag="AFL134W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL228W (CET1) and YMR180C (CTL1)"
                     /codon_start=1
                     /product="AFL134Wp"
                     /protein_id="NP_985416.2"
                     /db_xref="GeneID:4621643"
                     /translation="MSSEKQEGSPRRVLSLSDLVNREDSKDASGNTAGAALKPLSNDE
                     VRRRLAHEDYSSNTASQVDDETDTDDGLGEVAFDRADFRFDFEGQERSGGRASGEAEA
                     ESGGPGHEKATQQPSDAIATSPDRESTEPRAMDIFEERASLESKKNNLRKDLRVLNEI
                     ASTARPGRYKVAPIWAQKWKPTVRALQNVNSKDLMKIDVSFTQVIPDDDLTKSVQDWV
                     YATLLSIPPEQRQYVEVEMKFGILMDRSSDSQRVTPPVSSQTVYMEADARMKPDVDER
                     VFVELNRYVKGISELTENTGKFNIIESHNKDEMYRAGINTQRPRFLRMSKDVKTGRVG
                     EFIEKRRISQLLLFSPKDSYDVKISINVELPVPENDPPEKYMGQAPLNSRTKERISYI
                     HNDSCTRIDITKVTNHNKGKRDDAEVTHEIELELNSQALLAAFDKIAQDSKDYATIVR
                     TFLNNGTIIRRKLTSLSYEIFEGGKKVV"
     gene            complement(<184172..>185128)
                     /locus_tag="AGOS_AFL133C"
                     /old_locus_tag="AFL133C"
                     /db_xref="GeneID:4621644"
     mRNA            complement(<184172..>185128)
                     /locus_tag="AGOS_AFL133C"
                     /old_locus_tag="AFL133C"
                     /product="AFL133Cp"
                     /transcript_id="NM_210771.2"
                     /db_xref="GeneID:4621644"
     CDS             complement(184172..185128)
                     /locus_tag="AGOS_AFL133C"
                     /old_locus_tag="AFL133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL227C (ALG5)"
                     /codon_start=1
                     /product="AFL133Cp"
                     /protein_id="NP_985417.2"
                     /db_xref="GeneID:4621644"
                     /translation="MYSLIGSLLLGGLLAAYTIVYLLSHSPRQAYPEELTYRTVGKDG
                     VVAQHALESVLDEKAGTAGIELSVVVPSYNETGRIESMLQEAVDHLRKVHAGKWEILI
                     VDDGSRDGTSEFCLELAQKLQLEREQMRVVKFTKNRGKGGAVRHGMLHIRGKYGLFAD
                     ADGASRFSDVEKLLRAIKEGERIQPGNVSIGSRSHMVKTDAVVKRSFIRNFMMYGLHT
                     LVYIFGIRTIGDTQCGFKLFDRKAVQAIFPHLHTEGWIFDVEILILAARKGMKISEIP
                     ISWHEVGGSKMVLVKDSINMAIDLVVIRLAYIFGIYGDKATH"
     gene            complement(<185438..>187414)
                     /locus_tag="AGOS_AFL132C"
                     /old_locus_tag="AFL132C"
                     /db_xref="GeneID:4621645"
     mRNA            complement(<185438..>187414)
                     /locus_tag="AGOS_AFL132C"
                     /old_locus_tag="AFL132C"
                     /product="AFL132Cp"
                     /transcript_id="NM_210772.2"
                     /db_xref="GeneID:4621645"
     CDS             complement(185438..187414)
                     /locus_tag="AGOS_AFL132C"
                     /old_locus_tag="AFL132C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR179W (SPT21)"
                     /codon_start=1
                     /product="AFL132Cp"
                     /protein_id="NP_985418.2"
                     /db_xref="GeneID:4621645"
                     /translation="MSGGQDALSQMLLKILYTVDNEATSFLTRSREPAPVRVEMVPMS
                     SPPAKVGVRIGIVEVAHVLGEVCKSSPELFQPAAGPAESDYNVYFKDVVEADEPFVSL
                     GLLSKLRGGDADETLVIGRICTNFTSLLPGGGRGCETLEVKMRFSKVLTRSNSHRGSL
                     VKAVPARRMNSAAAARRLPAPVGGPAKRRRDANPLPATKAFRTQSLPIWDNPKNSGIR
                     GGTIAHKIYMADRNKEQQSIQLSQQQQGTLQDRKPTYQVMSLQSDTTVTKFKVDDSIS
                     KRFEFMNKPKAKRATAPRQAATSSPAMASGAGKRVHKPKVQQGRGGAAQADSAKQSNT
                     PRDFGALGEDQSLQEFLSQSEIKSDLFELEEQNDESASSNKENVPPSSSSVFQQQLLP
                     TDMDDFFNLDLDHMKNTDDEWFQGLFGTPRDATTCNTMPIEDDNDISQADTASTMVHE
                     AQHSTTVLHNDHLSDLDRTSPIDTLSMPLLDLEPRSNQPAKFVSCADQLKRLPLLIKG
                     KEGATTNTPEDEHLEDDVTSLVIQMSTSPSPEDGDQDALPPKQPQEKHLLCDELPSDC
                     DDDDDDDDERLECMKKRKTMPSSPTSMFQPYRDLDGLGAENRADDTSFIATDDFAMAK
                     LPPHADSTPATHISSADDLKKKKDLTNSDNHYWS"
     gene            <188088..>191660
                     /locus_tag="AGOS_AFL131W"
                     /old_locus_tag="AFL131W"
                     /db_xref="GeneID:4621646"
     mRNA            <188088..>191660
                     /locus_tag="AGOS_AFL131W"
                     /old_locus_tag="AFL131W"
                     /product="AFL131Wp"
                     /transcript_id="NM_210773.2"
                     /db_xref="GeneID:4621646"
     CDS             188088..191660
                     /locus_tag="AGOS_AFL131W"
                     /old_locus_tag="AFL131W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL226W (NEW1)"
                     /codon_start=1
                     /product="AFL131Wp"
                     /protein_id="NP_985419.2"
                     /db_xref="GeneID:4621646"
                     /translation="MAPKKFKTLDSFMEEQGPDPSLTPSPFGGYFSKADAGQGGRRDW
                     NKGAARPGGQGGYQAGYAGYGYGGYGGYQAGYQAGYGGQGYQAQGYQAQGYGYQAPQG
                     GRAPQGAGVASPPAGITPSGSAVSLTSLTNSLSGMELTPLSKHVEALAGAGSIAEVRR
                     YVADATAEFDGEGAGARDIVGWDVAGVISKLLRPKNPALLREGAMLLISAIAARFSGH
                     GVDECHLLQLLPLALDGLAEKDATVKREAQHAVNAIYGAFPTEALAPAVLPALLSYLV
                     SGAKWQSKLGALKLVDNVREDSPSDMLEMKFKESVPVLTDLATDFKPELAKQGYATLL
                     AFVSILDNLDLQPRFKLIVDTLQNPKLVPDSVKSLSSVTFVAEVTEPALALLCPILNR
                     SLNLSSSSQEQLRQTVIVIENLTRLVNNRIEIESFIPQLLPGVKKVYQTATMPEVREL
                     AEKALQVLEEDESKDSKSFPGKITDEEGLEFLEGALKKLGQSPLEDAEANKESIEYLG
                     KVLTALANANDWKTLEKLLLKVLGDEHAEAIEQHFIRDLRLIFHQERAASGDDEGVEI
                     VNTDFSLAYGSRMLLNKTTLRLLKGHRYGLCGRNGAGKSTLMRSISNGQLEGFPSQDE
                     LKTCFVERALEGEDGSVDIVSFLASAPSLENTPRKEIVAALESVGFDADRRAQTVGSL
                     SGGWKMKLELTRAILQKADILLLDEPTNHLDVANVRWLEEYLLNNTEITSLIVSHDTG
                     FLDKVCTDIIHYENKKLAYYKGNLHDFVEQKPEAKSYYTLTDSNAQMHFPAPGILSGV
                     KSNTRAVAKMTDVTFTYPGAPKPSMADVSCSLSLSSRVAIIGPNGAGKSTLIKLLTGE
                     LVPTSGKVEKHPNLRIGYIAQHALQHVNEHKEKTANQYLQWRYRFGDDREVLLKESRK
                     ISSEEEMKMMETEIDIGDGRGKRAVEAIVGRQKLKKSFQYEIKWKWWKPKYNSWVPKE
                     VLVEHGFEKLVQKFDDHEASREGLGYRELVPSVITKHFEDIGLDAEIANHTPLGSLSG
                     GQLVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAMAIREWTGGVVMISHSTEFVG
                     ALCPEQWIVENGTMVQKGVVTVDQSRFADGGNAEAVGLNITKTVVDDDSPANIKVRQR
                     KKRMTRNEKKAQAERRRLRYLEWLSSPKGTPKPVDTDDEASDSE"
     gene            complement(<191721..>192611)
                     /locus_tag="AGOS_AFL130C"
                     /old_locus_tag="AFL130C"
                     /db_xref="GeneID:4621647"
     mRNA            complement(<191721..>192611)
                     /locus_tag="AGOS_AFL130C"
                     /old_locus_tag="AFL130C"
                     /product="AFL130Cp"
                     /transcript_id="NM_210774.1"
                     /db_xref="GeneID:4621647"
     CDS             complement(191721..192611)
                     /locus_tag="AGOS_AFL130C"
                     /old_locus_tag="AFL130C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR178W"
                     /codon_start=1
                     /product="AFL130Cp"
                     /protein_id="NP_985420.1"
                     /db_xref="GeneID:4621647"
                     /translation="MLVFRAKHIARWKTVQAGLQFRNNMSSACIVVIADEVLNGKIVD
                     TNSTFFARYCYGLGIPLKEIVTVGDDEAQIVGTLQRVRKQYDFIVTSGGIGPTHDDIT
                     YEAVAKSCGLPVELNAECQERMRRLSNPEARHSAAALRDHYRMATLPVGENVRNYYVA
                     DDLWVPVCSIDRQVFVLPGIPQLFERMLRELEPVVRATFWPGAGARAPFRRFFVTTPR
                     METEASSFLRGLQEEAVRLRKDVKIGSYPHFGMGFNTVSISGSEADEAYLRELVERTI
                     SELDGKEVSEEDERKFSDAR"
     gene            <192828..>193265
                     /locus_tag="AGOS_AFL129W"
                     /old_locus_tag="AFL129W"
                     /db_xref="GeneID:4621648"
     mRNA            <192828..>193265
                     /locus_tag="AGOS_AFL129W"
                     /old_locus_tag="AFL129W"
                     /product="AFL129Wp"
                     /transcript_id="NM_210775.1"
                     /db_xref="GeneID:4621648"
     CDS             192828..193265
                     /locus_tag="AGOS_AFL129W"
                     /old_locus_tag="AFL129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL225W"
                     /codon_start=1
                     /product="AFL129Wp"
                     /protein_id="NP_985421.1"
                     /db_xref="GeneID:4621648"
                     /translation="MSTFNAETADNLEDIEKQFAVVAVEQAETYWGLISKVPGSKLRL
                     TKYDDEIYETFMEHFPEYRDIERVARFQEEELKTKEAKERWRKFIGLFEKKIDDFNFG
                     TLLRTDARQEYGQFTTCFVVRLQFYAFEIARNKHGLNDWAVGH"
     gene            complement(<193301..>194668)
                     /locus_tag="AGOS_AFL128C"
                     /old_locus_tag="AFL128C"
                     /db_xref="GeneID:4621649"
     mRNA            complement(<193301..>194668)
                     /locus_tag="AGOS_AFL128C"
                     /old_locus_tag="AFL128C"
                     /product="AFL128Cp"
                     /transcript_id="NM_210776.2"
                     /db_xref="GeneID:4621649"
     CDS             complement(193301..194668)
                     /locus_tag="AGOS_AFL128C"
                     /old_locus_tag="AFL128C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR177W (MMT1) and YPL224C (MMT2)"
                     /codon_start=1
                     /product="AFL128Cp"
                     /protein_id="NP_985422.2"
                     /db_xref="GeneID:4621649"
                     /translation="MIKLKIPGLFRFEVGPVVPWGRVRALHLYAARLQVRKAGSGDRR
                     GEAEKALDKLEEFQAAKEGCAGHSHVHADGGHTHGHGGVSAARLAGLGGHTHTHGGNP
                     LLLLDREAIRRNAGVKITWIGLLMNVGLATGKFVGGVVFHSQALIADAVHALSDLVSD
                     FLTLFSVSLASRQPTQEFPYGYGKVETVGSLAVSSILAMAGLSIGWGSLCSILGPLVP
                     HALLELAATHAHVHAHAHDLTNINAAWIAGGSIVLKEWIFRATRKVAQETQSNVLMAN
                     AWHHRIDSLTSLVALVTISSGYLLSIQSLDAFGGLLVSGLVVKTGYAGMKQAASELVD
                     RCLPPTDTRYVDIHALTTRTLEQMISNNNAKRKYALHDLTVLASGPNTHAHLVLEVPR
                     QRWDNVLSIEEFELVTEHLRSVLSQQVPHLRKVHIEFFGERPTQPAPEAHSHADSPHN
                     HTHEH"
     gene            complement(<194909..>199474)
                     /locus_tag="AGOS_AFL127C"
                     /old_locus_tag="AFL127C"
                     /db_xref="GeneID:4621650"
     mRNA            complement(<194909..>199474)
                     /locus_tag="AGOS_AFL127C"
                     /old_locus_tag="AFL127C"
                     /product="AFL127Cp"
                     /transcript_id="NM_210777.1"
                     /db_xref="GeneID:4621650"
     CDS             complement(194909..199474)
                     /locus_tag="AGOS_AFL127C"
                     /old_locus_tag="AFL127C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR176W (ECM5)"
                     /codon_start=1
                     /product="AFL127Cp"
                     /protein_id="NP_985423.1"
                     /db_xref="GeneID:4621650"
                     /translation="MKMKHQVTADEIACHSEMISSSPLGCSTLDSSRTLQGEISDVES
                     AKIKSCGANGTVEPIKEGGVGYVHGGAPRTSRFMKSLDSSGPAVNAHHCNPYLYTQHK
                     TRPNAPFDMLHVRTKNLVRSCREVEKGSVSGFEYSVQDGSIPVFRVAKQQLPDPHVFY
                     EAVRSIGEKYGAVKLHIHEEHDDAMRLGSHVLSQSSVLNDFTLNTEYFWFKARRQYMN
                     SPSNENSKRLEFHRRLYRFYREGAKAAEGSTKGKRLIGKIPSIDKRTLDLYRLWNCVQ
                     LRGGFKTVCQKKLWAQLGRELGYSGRIMSSLSTSLRSAYSKVFSDFDAWELEQRKNTD
                     ESSSQPSDFSHIKQETRVDSDIGGKRPLDREGHTEDSQKRKKQHTVFQKVFELGGSSA
                     EFTRVRDVKRCKGLNTNFENVTEAIPGLTEPDQSTLPGYNFSFWQSGMEIYDKSCYET
                     KNSPIYNLRQYYEKSCRHFDLIQTQYSDIIPQVTSWTDKIELQQFEDLYFSILADPTN
                     SLDIDSGIDLPGIIHGSGFRTISRNSDNTAELLDPWNINNVPLAANSLLSYLDIDYGC
                     LTRPKMHVGMTFSTRGWSLGDQYLPTIEYNHLGCSLLWYFIAPESQEAFEKLVEEINL
                     GKRDHPTDELDVDPEFKKSEFYNSYLETNMRNRLNDTHKLRSKNGSHMFGQAARGPKS
                     YLLPNDIQIHPEELQKRGIKFYNAIQEAKTFIIKYPRAYNTSIAAGFHVSESCYLAPE
                     SWLSHLVPSDKWFSDRAMLQSINVFQFLHNIMTRCKSPDVVLYAKRLLAEYSIEELEN
                     RKKLVKHFPDMKIVANTFDFISDEDLGFTGASKVLLTTSSDCITLSIKSFLTQLHDET
                     ASLRDVIRGISKDEVHLSMHTFFSDKLLECLINDVDDPASPIEKLADVEAELTALITR
                     YPGRVPLSKLLPFIHVHHASNNPRISEVRQYLRELEPIITDCRLFLDTLHPASEKIVY
                     GSGFNIRELPTLNFQNSAKDLQRLCAQLRPLSVEFEEMTHVFALMHQFQCFHRQASVA
                     LHADDLEAMKSAYEFGISIGISTPLIPSLAAQILRTHWLHVFDLAIVRRSPSCYQDYQ
                     NYNLSDMYRFLRLGIRYLNANLHKDKLQKISSLLKSSQALIQRANAFFKKKNYRVSLN
                     DVELIMEKLSCDFIPLNPTFVDGLTKLMAAVKSTKQSIAPSWSRLAVRGDHVTQFVRH
                     FRDGDDAALSQICQFDGSEEDKRISMEEIAQEKEPQLFGRYVKECRAWLQDLNKLVPN
                     ARATLEGLLEQDLRCFELAKDEYLPLEHSQRQSVYCFCRQGDVGSTMVECEICREWYH
                     VACINRGRWALPEDDRCVFLCMICHPEPAERPRKVPLQDLLELLCRSASLHVIPDRVL
                     LQRLFELAGCALSFRRHLRRELFDNSNVRWGVSVHKLKFYLRKLEGARCELTSELATL
                     RDVVKEHDLQKLHKLRNANCVPVTGYEKLTARKQRTPLPQLPAEPAAPSVDIKPDPDT
                     AAKCAVSSAPRRIGIADLLSPLPEDTC"
     gene            <200198..>200527
                     /locus_tag="AGOS_AFL126W"
                     /old_locus_tag="AFL126W"
                     /db_xref="GeneID:4621651"
     mRNA            <200198..>200527
                     /locus_tag="AGOS_AFL126W"
                     /old_locus_tag="AFL126W"
                     /product="AFL126Wp"
                     /transcript_id="NM_210778.2"
                     /db_xref="GeneID:4621651"
     CDS             200198..200527
                     /locus_tag="AGOS_AFL126W"
                     /old_locus_tag="AFL126W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR174C (PAI3)"
                     /codon_start=1
                     /product="AFL126Wp"
                     /protein_id="NP_985424.2"
                     /db_xref="GeneID:4621651"
                     /translation="MLVIGSWPIAPNSRCCAPICCAPICCAPKCCDAPSWSSNCCERG
                     ACWYWAPKSACCWRPKPCSSPTLYWRSSLWPAFFRSSFWPLFLNIFPAADIMILAWCW
                     NKSREGN"
     gene            <201338..>202975
                     /locus_tag="AGOS_AFL125W"
                     /old_locus_tag="AFL125W"
                     /db_xref="GeneID:4621652"
     mRNA            <201338..>202975
                     /locus_tag="AGOS_AFL125W"
                     /old_locus_tag="AFL125W"
                     /product="AFL125Wp"
                     /transcript_id="NM_210779.2"
                     /db_xref="GeneID:4621652"
     CDS             201338..202975
                     /locus_tag="AGOS_AFL125W"
                     /old_locus_tag="AFL125W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR173W (DDR48)"
                     /codon_start=1
                     /product="AFL125Wp"
                     /protein_id="NP_985425.2"
                     /db_xref="GeneID:4621652"
                     /translation="MGIFDKVKNAIGEDNFNKLQDEVTSRLGALNQNDSGNNSQNASG
                     YNNGSGNAYGNTSSGYDNSQSGQGYGNSQSGGNNYGNNSGYGSGNQTSNNNNGYASNS
                     GYYNSNSDSNLNTNAYGRNDSKKNSYGNDNEDSSKNTYESKKSDSDNKYDSNKDENKD
                     ENKDENKDENKNENKDENKDENKDENKDENKDENKNENKDENKNKDEDKNKDEDKNKD
                     ENKDENKNKDENKNKDENKDSKNENKTDSTKNSYGSSKKNSYGSKNSDDGKDDSKDTY
                     GSKNSYGSSKKDSYSSSNKNSYDNDNEDSNKTSYGSKNSYGSSNKNSYDNEDSNKTSY
                     GSKNSYGSSNKNSYDDNEDSNKTSYGSSNKNSYGSKNSYENDNEDSNKTSYGSKNSYG
                     SSNKNSYDDNEDSNKTSYGSSNKNSYGSKNSYENDNEDSNKTSYGSKNSYGSSNKNSY
                     DNEDSNKTSYGSSNKNSYGSKNSYENDNEDSNKTSYGSSNKNSYGSKNSYGNDNEDSY
                     GSKNQYDSNRGSYDRQNDNESSNLYDSSEYESSNRYR"
     gene            complement(<203079..>204968)
                     /locus_tag="AGOS_AFL124C"
                     /old_locus_tag="AFL124C"
                     /db_xref="GeneID:4621653"
     mRNA            complement(<203079..>204968)
                     /locus_tag="AGOS_AFL124C"
                     /old_locus_tag="AFL124C"
                     /product="AFL124Cp"
                     /transcript_id="NM_210780.1"
                     /db_xref="GeneID:4621653"
     CDS             complement(203079..204968)
                     /locus_tag="AGOS_AFL124C"
                     /old_locus_tag="AFL124C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR172W (HOT1)"
                     /codon_start=1
                     /product="AFL124Cp"
                     /protein_id="NP_985426.1"
                     /db_xref="GeneID:4621653"
                     /translation="MIDPVTHIVTPSNDEQRQGRSDGGMQLGLEDLHGGGGGLGQQKV
                     SGMAEGTDSIVDVLTNPSSSVNLHSNILSVSTNVEEGQGMQPAAIQGGGTAAGRRFSS
                     VPISDSPVGCGQHGMGTASTQVPSHGSTANLLSMGNPVATNVQVCQRMDEVSARLIVM
                     EETVNKLLGNIDAQQQQIASMRSESMEMLGSLMKEVRELKQQVPVLDDPDNNEKDKFV
                     TDLLNSITNVSSNYLKKVSSRNLQRFKRQRDIMSTSDLPSLGNTQSSSHFMQDLVNPY
                     ASTQDFQSFTVLKDKAKEFTLNPTAINKRRRLSAQPLNTLQMSQDQLQQQRGSVQSLI
                     SIPTSGQKNANFGPQLQNYLIGLQNIPMSEAEKVSSPTVLKQFQNSTTDPDLKTGRRN
                     PGLDFQIGSGDDENDENDGASGEDEDGYLEDDEGYRSQSQRTMSSEDDEQFTGGNQGE
                     DEAGPRAAGRNPKSLPSSIVRRFANSGSQVSVSGTPETERLVLKNNDKYDKNTMPAPN
                     TKPRAVLASNPEDTLTDVQYTMVKAPDSVRAIWDEYTIGVGGKPSIRQLEQTYGNKWR
                     TKRNKKTFARRKRIYKFILNGVRNGKSESEMIDILESRRVYRTEDNELKKRTIGWLQQ
                     SLSGI"
     gene            <205462..>207459
                     /locus_tag="AGOS_AFL123W"
                     /old_locus_tag="AFL123W"
                     /db_xref="GeneID:4621654"
     mRNA            <205462..>207459
                     /locus_tag="AGOS_AFL123W"
                     /old_locus_tag="AFL123W"
                     /product="AFL123Wp"
                     /transcript_id="NM_210781.2"
                     /db_xref="GeneID:4621654"
     CDS             205462..207459
                     /locus_tag="AGOS_AFL123W"
                     /old_locus_tag="AFL123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL222W (FMP40)"
                     /codon_start=1
                     /product="AFL123Wp"
                     /protein_id="NP_985427.2"
                     /db_xref="GeneID:4621654"
                     /translation="MTEARGILQALRDCGTSTVVRYLVPDYAVPSVAKAVALHKGTEP
                     GAAEAFHRPRLVRNGDGVPHFAFVVPEERGEYRTLVQSERALKDLGLRADQELEAHCQ
                     GSRVYHDEQRGIFPYALAYAGHQFGVFAGQLGDGRVANLYDIRDSRGRYQTLQLKGSG
                     MTPFSRFADGKAVLRSSVREFIVSEALAAIGIPSTRALQLTLLPKTRARRTMFEPCAV
                     VARFAPSWIRLGNFDMFRWRGDDHGLLQLVDYCIQHVFAAGREFPTEISVNAFQEDFF
                     PDPLEKIPATDELPKAVAGVTTYDLFFRHVVNLNAECVAYWQAYGFCNGVLNTDNTSL
                     MGLSMDFGPFSFMDKYRPEYTPNHDDIEGRYSFSNQPYVIWWNLTKFAEALVLLLGSG
                     EQHIGFVKTIPERSVIPENIADELGQRVNALVNCAANEYRFRYHVKYAEIMAKRLGIQ
                     LNIPLIQSDNLSLIAERVRGFMDSVVNPLLDILSKSMVDYNSFFVALQEYQGPFHSTA
                     GVRGVDPAFLQIFFTEEDFQLLTKHANGVSSLDPGTATQFFDLVEKIDSWLINYLQSI
                     PEREERYRLQKLVNPLFIPRSYVFDEVLEELEKMHRNVTDANSADIDTTILTQLYTIA
                     TNPYDRTKWYGILDDAKIKAWTEGTTNMPNDDYLKQCSCSS"
     gene            <207898..>210066
                     /locus_tag="AGOS_AFL122W"
                     /old_locus_tag="AFL122W"
                     /db_xref="GeneID:4621655"
     mRNA            <207898..>210066
                     /locus_tag="AGOS_AFL122W"
                     /old_locus_tag="AFL122W"
                     /product="AFL122Wp"
                     /transcript_id="NM_210782.2"
                     /db_xref="GeneID:4621655"
     CDS             207898..210066
                     /locus_tag="AGOS_AFL122W"
                     /old_locus_tag="AFL122W"
                     /note="NOHBY608; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0A03784g"
                     /codon_start=1
                     /product="AFL122Wp"
                     /protein_id="NP_985428.2"
                     /db_xref="GeneID:4621655"
                     /translation="MSNNTDLLTSGGLSVRCQEASSAIENVGSDGCSDLRFRHEIEPP
                     EIDPWGGRYSISLAELPKLPPSYENTLSQAAVPSTFEIGVSKEMVREEIKLLQIIDAS
                     DDESIMDYRFCYFPPDTYRLSRTIEAHLADVTRRENELIERPRPPSRRPLTRKDPKQN
                     EYGHLLDNYGSDSLERELTSQFKKVSLAGGASGSNTYNGASGQGMGSIQEQQNIRNRS
                     NSPIGCSITQKELLNLAPAINFGEFATDIEIPSVSNGSQSQRQLSIDSNSLENRSNTR
                     ASQESLVHPDSRFHGDQKSMRSDTKSRVTFMSTDTGASESRNTVSSIKKQSTGPARCR
                     AGTDDSQSVSSLEIKSLERSTMDSRDMCDFLMPNSANLLAGTRDTKDGFSNIETQRTR
                     SSAFTSRERVRKHRISRASRSPKRASVMKNTIPYSHSDREFRNKLNDMLEQTGVLNIS
                     DGSTLSINGQDLISEKPYTNRRMYNTWRGVRSKLVSSRCSSLLSTTDPRACGNPTAKG
                     RLPDLKMPKKPWFKRVHETNQRLLKSAARVMFSKIDEFQGMSFERLSEAAKKFDRRRQ
                     DRSAEPRTATESCHTPADAPQSAAPTFGPCHTTTLPPEPSVPLPPPEDRRPSPPAASP
                     ARPRHSTFSFQPPVLKPQNLFVTTCAAPGSITPPPEPISHSVSSMPSAWKVRLNPDAK
                     PRGGPRSPKIALAQQIIPLKAVGYKTDQLPNNSHGMYGYL"
     gene            <210369..>213383
                     /locus_tag="AGOS_AFL121W"
                     /old_locus_tag="AFL121W"
                     /db_xref="GeneID:4621656"
     mRNA            <210369..>213383
                     /locus_tag="AGOS_AFL121W"
                     /old_locus_tag="AFL121W"
                     /product="AFL121Wp"
                     /transcript_id="NM_210783.2"
                     /db_xref="GeneID:4621656"
     CDS             210369..213383
                     /locus_tag="AGOS_AFL121W"
                     /old_locus_tag="AFL121W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBL022C (PIM1)"
                     /codon_start=1
                     /product="AFL121Wp"
                     /protein_id="NP_985429.2"
                     /db_xref="GeneID:4621656"
                     /translation="MGLFGKDRGERIAEFPCYLLETGTHLVPLPGILYNLVIERTYGE
                     RILGQFRGIGEAVDGALTGAGEAAEVPGRVAEVMKAFQERYDSGDKTQAVYICLVTEA
                     AAGRHIGCIARLTGARAEGGELSVLLRGLVRAVVGQPVPSRRNEMWNGSVTVLDDAQR
                     VATWGARQLDFARQGVFGAFEELDAGIGTFTARFKSSQKRGADGAAHLLTLSPLANTL
                     FFHFSRSSFERSWKILRTMMHGFRDAKKDIRTAMDMLSVADLTVGLLPTTTAQRLEFL
                     QAEDPAARIKTFVRHMQQLLEVFGSLYRATEYVHDRFETHGPIAKSQLIANQLRSLRF
                     YIDDIKRNKPESGPGGRSRRLLPRPASGNSAAAGEEDDSEDSELVAIKRYVDEIEVKG
                     VHADGVKMLKKDYRSLSKMHVQSTEYQMLRNYFDFIMGIPFGIYVSTPEIDLVASSRK
                     LDNDHYGLVQVKKRLLEYLCVLKLSANSPGVTADAGAIEDGSATKRAVVYENKAQEQR
                     KTKVPFLLLVGPPGVGKTSVAKSVADVLGRRFQRISLGGIHNEAEIRGHRRTYVGAMA
                     GMIVNALCKAGCMNPLILLDEIDKVLSVPAGAGASRLNGDPGAALLEVLDPEQNHTFT
                     DHYVGFPVDLSQVLFFCTANDLSGMSEPLVDRMEVIHIEGYTYEEKIAIGRHFLLPKQ
                     IRLNSFDMTGINLSLTDDAWRTVVVDYTREAGVRNLDRQLGAIVRGKIVEYVENNMSG
                     SGDDVVTQKNLPKFLGLPPHSLREEVTQTTSFAEKYGVVHGLSYNSDGTGGVLVFEVI
                     RSGDSRDKRLTVQTTGNLGTVLSESVSIATSLVKSLLARHVVHSSADDTSVAEFFRSE
                     CHLHVPFGAVPKDGPSAGAAISLALLSLALKRPVDPALCVTGEITLRGKILPVGGVKE
                     KLLAAQLQGMGLALVPRGNRNDLVELAEDNAETQQRLLADPALPELATLQHKLGMAVH
                     YCSDFRDLVLHAWPTADNLWHACEDSSVRPQL"
     gene            <213848..>215911
                     /locus_tag="AGOS_AFL120W"
                     /old_locus_tag="AFL120W"
                     /db_xref="GeneID:4621657"
     mRNA            <213848..>215911
                     /locus_tag="AGOS_AFL120W"
                     /old_locus_tag="AFL120W"
                     /product="AFL120Wp"
                     /transcript_id="NM_210784.1"
                     /db_xref="GeneID:4621657"
     CDS             213848..215911
                     /locus_tag="AGOS_AFL120W"
                     /old_locus_tag="AFL120W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL139W (FLC3) and YPL221W (FLC1)"
                     /codon_start=1
                     /product="AFL120Wp"
                     /protein_id="NP_985430.1"
                     /db_xref="GeneID:4621657"
                     /translation="MRLLAVCWLVWSLAGLTEARRKLSTNSLVSCMEDSQLTAKSFDV
                     VFNPDDLSLNFRLDLSTEINGTVRAVVEVWAYGFKVITEAKDMCGIGWKQFCPVTPGD
                     IQIQAVQYVSAEYANKIPGVAYQVPDIDAYLKVMVHETQSNDQVACIQAHFTNGRTVA
                     QTAVKWATATIAGLGLLASATLSAFGNSNAASHISATTMSLFLYFQSVVVVSMENVER
                     LPPIADAWAQNLAWSMGLIRVEFMQRIFRWYVQASGGEPSLHLTSTTTSVLAQRSLDA
                     LVGRPVSKATQSLFASTHTMIFRGIRRLAYRANIESSSVVCTGLTFFLLFGYLIAVAF
                     TLFSGLLELLIRMKLMNPVRFLDFRKTWVIVLKGVLLRYIFLGFTQLTILCFWEFVNV
                     DSPALVVLAVLALLLSLSIMVWAAYRTIYFGRASIGVHSNPAAILYGNENVLHKYGFF
                     YTMYSATHYWWSCMILAHILLKAVFIAFAHNSGKTQAVALFVIEIIYLAALAKCRPYL
                     DRATNILNIMISSVTLVNSFLFLFFSGLFGQPASVSSIMAWVFFILNAVFSLILLIMI
                     LVCIALVVFTRNPDLRFKPARDDRRSFQRKSTINILGKASTAELLALGTTAKAHNENW
                     EDELKKQQTVTVDDQVVSPEDSPFAEPVQEPKTSVSGYIKRKLSLKRDKSTRSNRSQY
                     DRLQD"
     gene            complement(<216140..>217402)
                     /locus_tag="AGOS_AFL119C"
                     /old_locus_tag="AFL119C"
                     /db_xref="GeneID:4621658"
     mRNA            complement(<216140..>217402)
                     /locus_tag="AGOS_AFL119C"
                     /old_locus_tag="AFL119C"
                     /product="AFL119Cp"
                     /transcript_id="NM_210785.1"
                     /db_xref="GeneID:4621658"
     CDS             complement(216140..217402)
                     /locus_tag="AGOS_AFL119C"
                     /old_locus_tag="AFL119C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL138C"
                     /codon_start=1
                     /product="AFL119Cp"
                     /protein_id="NP_985431.1"
                     /db_xref="GeneID:4621658"
                     /translation="MRGFFYVAVLLYLDAFVHAFLVKMGTDPICAVPPDKTLLARTMQ
                     LLLGIKRLPRRFHSLPDKFTGFRFHKSYRFNHRFFRARKTLKISYCQEGRLQFQVDHM
                     LAKEIDWNIPFCVLDAPVEQGKFWQQGSTNLNALNCFKLARRKKYAKRSFDIFLPDTW
                     VGGLFHCNVTNDVKTKLVSLMDQNLNIRLDTEGGDNMFDITNVCTRENSIPLQPIMSS
                     DYKQYWTNYKTQSRIPLVRQIYKMQVEKIIPFFETPVSVGAGRIKWGLPLDEQFASMA
                     EFWRQNSKTPWYEEIEVQENYNYNPTEEQDISTAHNITMTLLEPFLKYSRKLLTSFLD
                     HDGTLRAQAPERFKEMIDSLGAFKRNIWHFLSTSDVVSSLGPEVHEVLSEIKKLWDDL
                     NLAPEKFTYGEDLKKDITTVIKVYRSGP"
     gene            <217686..>220337
                     /locus_tag="AGOS_AFL118W"
                     /old_locus_tag="AFL118W"
                     /db_xref="GeneID:4621659"
     mRNA            join(<217686..217703,217857..>220337)
                     /locus_tag="AGOS_AFL118W"
                     /old_locus_tag="AFL118W"
                     /product="AFL118Wp"
                     /transcript_id="NM_210786.1"
                     /db_xref="GeneID:4621659"
     CDS             join(217686..217703,217857..220337)
                     /locus_tag="AGOS_AFL118W"
                     /old_locus_tag="AFL118W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL137W (SEC27); 1-intron"
                     /codon_start=1
                     /product="AFL118Wp"
                     /protein_id="NP_985432.1"
                     /db_xref="GeneID:4621659"
                     /translation="MKLETKKTFVSRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYET
                     QTEVRSISVCEAPVRAGKFIPRKSWIIVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRA
                     LAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPNTFATAC
                     LDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTK
                     SCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCV
                     AAHPTGKRNFIAAGFDNGFTVLAIGNDEPRLSLDPVGKLVWCGGKTSSATDVLTAVIR
                     GNEEAEDGAVLSLQSKELGTVDVFPQALKHSPNGRFVTVVGDGEFVVYTALAWRNKAF
                     GKCTDFVWGLDSNSYALINEHGEVRYYKNFKEVSGWSISLDYSAEKIFPGILLGVKTD
                     GCVCFFDWENGTLVRKISVDAHDVIWSENGELLMIVNSNSDSYDEPGAYMLEYNSAAY
                     EQAIENETLDPEEDADDMFEVLHEVNEPLTSGKWVGDVFIYTTSSNRLNYFVGGKSYN
                     LAHFDKQMYLLGYLVRDNKVYLADREIHVYGYKISIEVLEFQTLVLRGELDMAKNSVL
                     PNVQGNTNLLRISRFLEGQGLLEDALEVSPDPEQQFDLALKLGKLALARDLVKDGSEH
                     KWRTLGDAALEKFNFKLATEFYKNANDLDSLFLIYSSFSNQQELVKLGQEAEQSGKYN
                     LAFNAYWIAGDINKARDVLSKSGRHSEAVLLASTYTSDNDAINAAVEKWKEQLNSAGR
                     VSIAERIILSGEDDFPAAPQTLVEMDDGSESASK"
     gene            complement(<220427..>221338)
                     /locus_tag="AGOS_AFL117C"
                     /old_locus_tag="AFL117C"
                     /db_xref="GeneID:4621660"
     mRNA            complement(<220427..>221338)
                     /locus_tag="AGOS_AFL117C"
                     /old_locus_tag="AFL117C"
                     /product="AFL117Cp"
                     /transcript_id="NM_210787.2"
                     /db_xref="GeneID:4621660"
     CDS             complement(220427..221338)
                     /locus_tag="AGOS_AFL117C"
                     /old_locus_tag="AFL117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL136C (MRM2)"
                     /codon_start=1
                     /product="AFL117Cp"
                     /protein_id="NP_985433.2"
                     /db_xref="GeneID:4621660"
                     /translation="MPVQGLPSVSITPMRELLRGFCRFNSSGRWLSRQRRDPYTREAK
                     VQELRSRAAFKLIEIDEQFRLFRAGQRVLDLGFAPGAWSQVAHQRTQPGGKVMGVDVL
                     PCKPPTGVSSIQANVLSRKTHELVRLYFSRHFQLNMHDELHKKHGYFQHMLEERLEEL
                     QKDNSFQPLYGMADPVHEHPLDVVLSDMYEPWPQVTGFWNNFTNAAYSRMANTSGVAV
                     KDHYMSMDLCDAALLCAIALLRPGGSFVCKLYTGKEDQLLERRLRKVFTKVRRFKPEA
                     CRSESKELYFVGLDKRKDIDKVAVFTQ"
     gene            <221651..>222304
                     /locus_tag="AGOS_AFL116W"
                     /old_locus_tag="AFL116W"
                     /db_xref="GeneID:4621661"
     mRNA            <221651..>222304
                     /locus_tag="AGOS_AFL116W"
                     /old_locus_tag="AFL116W"
                     /product="60S ribosomal protein L1"
                     /transcript_id="NM_210788.1"
                     /db_xref="GeneID:4621661"
     CDS             221651..222304
                     /locus_tag="AGOS_AFL116W"
                     /old_locus_tag="AFL116W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL135W (RPL1B) and YPL220W (RPL1A)"
                     /codon_start=1
                     /product="60S ribosomal protein L1"
                     /protein_id="NP_985434.1"
                     /db_xref="GeneID:4621661"
                     /translation="MSKITTTHVRDNVKELLKYSNETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGTLKLPVCPRPNMSVCIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKK
                     LAKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYSKVTDVRSTIKFQLK
                     KVLCLAVAVGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAFRLY"
     gene            <222669..>223829
                     /locus_tag="AGOS_AFL115W"
                     /old_locus_tag="AFL115W"
                     /db_xref="GeneID:4621662"
     mRNA            <222669..>223829
                     /locus_tag="AGOS_AFL115W"
                     /old_locus_tag="AFL115W"
                     /product="AFL115Wp"
                     /transcript_id="NM_210789.1"
                     /db_xref="GeneID:4621662"
     CDS             222669..223829
                     /locus_tag="AGOS_AFL115W"
                     /old_locus_tag="AFL115W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL219W (PCL8) and YGL134W (PCL10)"
                     /codon_start=1
                     /product="AFL115Wp"
                     /protein_id="NP_985435.1"
                     /db_xref="GeneID:4621662"
                     /translation="MTTSPPLSHSCGSDLVDDTDMEQDLAEMLELPLKTRCLSNNFAE
                     LLDYKKSRVSEGEGAERRNVEELLQDASRLNDLVGQGMAAGAVARGWGSRDSCASQTN
                     YSAAATAASTTCGSITHFRLSESDSDEDLPFDEHLKRVISRRLAMRQWHREDGRLDML
                     SESEFDTVSNSPTASSASPRAAKGTYRGKNSALLTPQENKDNGCAPGAQHMTAEEALQ
                     QFKDDICIVVHLSQGSMAATTDRNPFEMKAPASVTYTQYLDRINAKCMFAPIVYQTAG
                     CLLLRLTLKWPPSETGPVQIRWPIAESYVHRLIVALIRVSTKIVEDTVHSHEYFSKVC
                     GISKKLLMRLELALILVLRGEGLMVTAAALNAASNARARLREQSALPAAAAQ"
     gene            <224188..>224760
                     /locus_tag="AGOS_AFL114W"
                     /old_locus_tag="AFL114W"
                     /db_xref="GeneID:4621663"
     mRNA            <224188..>224760
                     /locus_tag="AGOS_AFL114W"
                     /old_locus_tag="AFL114W"
                     /product="AFL114Wp"
                     /transcript_id="NM_210790.1"
                     /db_xref="GeneID:4621663"
     CDS             224188..224760
                     /locus_tag="AGOS_AFL114W"
                     /old_locus_tag="AFL114W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL218W (SAR1)"
                     /codon_start=1
                     /product="AFL114Wp"
                     /protein_id="NP_985436.1"
                     /db_xref="GeneID:4621663"
                     /translation="MAVWDLFGWFRDILSSLGLWNKHGKLLFLGLDNAGKTTLLHMLK
                     NDRLATLQPTWHPTSEELAIGSIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAAD
                     SERFNEARVELDALFQIPELKTVPFVILGNKIDAPSAVSETELRAALGLLNTTGDARI
                     EGQRPVELFMCSVVMKSGYLEAFQWLSQYI"
     gene            complement(<224956..>228444)
                     /locus_tag="AGOS_AFL113C"
                     /old_locus_tag="AFL113C"
                     /db_xref="GeneID:4621664"
     mRNA            complement(<224956..>228444)
                     /locus_tag="AGOS_AFL113C"
                     /old_locus_tag="AFL113C"
                     /product="AFL113Cp"
                     /transcript_id="NM_210791.2"
                     /db_xref="GeneID:4621664"
     CDS             complement(224956..228444)
                     /locus_tag="AGOS_AFL113C"
                     /old_locus_tag="AFL113C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL217C (BMS1)"
                     /codon_start=1
                     /product="AFL113Cp"
                     /protein_id="NP_985437.2"
                     /db_xref="GeneID:4621664"
                     /translation="MDQSNKEHRPKKEKATAKKKLHSQGHNAKAFAVAAPGKMAKQMQ
                     RSSDKRERALHVPMVDRTPDDDPPPVIVAVVGPPGTGKTTLIKSLVRRLTKTTLGEIN
                     GPITVVSGKRRRLTFIETPADDLNSMVDIAKVADLVLLLMDGNFGFEMETMEFLNLAQ
                     HHGMPRVLGVATHLDLFKSQATLRASKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDR
                     EILNLSRFISVMKFRPLKWRNEHPYLLADRMTDLTHPEVLETQGTHVDRKVALYGYLH
                     GTPLPSTPGFKVHLAGVGDFPIAHVERLPDPCPTPFFQQKMEEYEREKAKSGEASSTG
                     TTTRRRRRLDDNQKLIYAPMSDVGGVLMDKDAVYIDVGGKKGEEASFVPGKERGEGEK
                     LVTGLQAVDQNLQERFDGVGLQVFSNGTELRAVDEDDDLDEEDLDEDSTEPVNTGRSS
                     LRHARLHGKSVQEANDDIDNLESDEEEDFGADEQYDRDDQRMKRADTEFSDADEKLAL
                     VTDSEFELSDTETWEQSVAGKLNGTIQKHKKWDISKLVYMNNIDPSDVIKRWNNELPD
                     EDLEEEDIHDDDDFFRKKESQIPSKLAGNTAGDLEFFAPSFQSLSELASKWSTIDSIK
                     DFFVGAPVLGSNTNGGEEDGDEEEVYGDFEDLEAADEEDSAKKETEDPDSDSSFADFE
                     EEEKKDLTQQEERDLNAAKKEKLRLQFEMEEGDNFKEDDPENEYDTWYELQKAKMAKQ
                     LEINNAEFEAMTPEQRQKIEGFKSGSYVRIVFEDIPKEFVEHFDPKFPIVMGGLLPAE
                     LKFGIINSRLRRHRWHKKILKTNDPLVVSLGWRRFQTLPIYTTSDSRTRTRMLKYTPE
                     HAYCTASFYGPLCAPNTPFCGVQVVANKETTGSFRIAATGIVEEIDSSVEIVKKLKLV
                     GYPYKIFRNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFED
                     KILLSDIVILRTWYPVKIKKFYNPVTSLLLKEKKEWTGLRLVGRIRAEQGMETPLNPD
                     SAYKKVERVERHFNGLKIPKSVQKELPFKSQVHQMKPQKKKTYMAKRAVVLGGEEKKA
                     RSLMQQVMTIAHAKEDKRKAKKAEERKERLKRLAKAEEAKSEKEKQSKKEFFAKHGKK
                     RQFAGGEGNKSYKKKR"
     gene            <228840..>232424
                     /locus_tag="AGOS_AFL112W"
                     /old_locus_tag="AFL112W"
                     /db_xref="GeneID:4621665"
     mRNA            <228840..>232424
                     /locus_tag="AGOS_AFL112W"
                     /old_locus_tag="AFL112W"
                     /product="AFL112Wp"
                     /transcript_id="NM_210792.2"
                     /db_xref="GeneID:4621665"
     CDS             228840..232424
                     /locus_tag="AGOS_AFL112W"
                     /old_locus_tag="AFL112W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL133W (ITC1) and YPL216W"
                     /codon_start=1
                     /product="AFL112Wp"
                     /protein_id="NP_985438.2"
                     /db_xref="GeneID:4621665"
                     /translation="MVLYKRKPIVLPTPKPLPANLECKVWHINETGEWFLTYQEYLER
                     LDFYTRHYFTCEITGTSCLTFFDALNSEESQFKNVEERFPLKLREPVARFLHFNEVRR
                     LDLLVEQVYAKFKTDFFPGEVVYLRKNRQEVTPAPEDLFREGEVGMQSAPHSSPNSAA
                     SSHQSQSLQYQKPYVVKEKAHFNAIVDPETKRQISPAYSKYMLVEEHSSGNTGYIIAD
                     QSQIYRDRSSFTKHLIKCFCKITLRRASSKMGAPWCVKEDYLPMYGLTMDWPVDMLKY
                     KEDQMEQRPNSLSKRAREEAATSDLDGQIQPWDHENESYDAAKEHKKKVKKDQPGSQA
                     ECPIATTDIEVNPAENQLEEQGASVSLHVPNENAPITSIMEDLKLPFVGQHQPLSSLM
                     TYSRNLDAIPHTSRIPTFRNFEKVIQCYAFLNTFNEKLCISNFTWENFITTFRCTDVK
                     LLSGKVVLVNVTSENTTDTESGEKDSDIEVLDVVDQDDTYMSADVLDFIKAQNNEHIT
                     YSIEDDDSLDDEYLDAIKDNGSALLVECFVSLLRLFIDEQGDWKTLVMENWYDEEDED
                     EDKVSGGGRGNTSEESTGLNSKITNGNASCDQGNFDAKVQDNDKNAVEVKTENLVQND
                     DHEITTPEIDTLLDKCLTFRKINWSERLTKRQFQNGFWLIVLLGVYQDCMHLPMYTKF
                     IHDFIKSVVPKDGTSTQLNKTLWRNFCRNLDVEQKVTALWILVDLCSNFSHDIKAAVE
                     DSMELCGQIRSERYKIGRDLKVEYQTLTDLQETSRKLAEKTADSPELMELEQKMARQE
                     DKIARLQEDKSYLDRVLCENDLQRLKPLGMDRYGNKYYWLELHGITRPSKSEGDTYRS
                     LTAGRIWIQGPNSWDYNYILGISEDQISQWLSIRLEQGSAAATRKVFGVYRAENGSYW
                     LDDESSGQAIELVDQKGALNYNVTLTALQKKIIDETPDGLLLSDSQWYCINSVRDYKI
                     LADWWENWGRREHDLLRQVKNVETEIMGSLEGDTSALDTLQKEKELMQKFKDHQLTPE
                     ELQLAANGEQKDQEQSFKTEDQLEQIAEEIMKLDDSSKTRKILDRIKVLEAKRDELLA
                     KKQHVEQHKPGSRIQLRSEYKRQKLNIDQKLRLQEEVLTELVNFSFSERQRETIEWEN
                     ERALNLWGFPLVKGASGKTKVQMQGTVDDKLSSILKNTLKHQDTATAA"
     gene            <232814..>233800
                     /locus_tag="AGOS_AFL111W"
                     /old_locus_tag="AFL111W"
                     /db_xref="GeneID:4621666"
     mRNA            <232814..>233800
                     /locus_tag="AGOS_AFL111W"
                     /old_locus_tag="AFL111W"
                     /product="AFL111Wp"
                     /transcript_id="NM_210793.2"
                     /db_xref="GeneID:4621666"
     CDS             232814..233800
                     /locus_tag="AGOS_AFL111W"
                     /old_locus_tag="AFL111W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL215W (CBP3)"
                     /codon_start=1
                     /product="AFL111Wp"
                     /protein_id="NP_985439.2"
                     /db_xref="GeneID:4621666"
                     /translation="MIKGVGRPSIGYLNNVTRSILGGVRMQSSGVKGSPESPEALTKS
                     SRLESKPMDFSNNAPVNPHTKRPMLSDSKYESRNYQLPKWKEALGELVVRAFRLDMDR
                     VRAGPVAGSYYYAMCKEQGLQFENEELSRSGKFFYEDLKLPRTFSQWYQITILHEWIL
                     FVRMRALPFKYGRNYQQKLVDRTFSDIELRLFEEMNVKSSRIADQYLKDFHSQMMGAV
                     FAYDEGFFTDDATLAAALWRNLFGGRKNVDMVHLEAMVRYVRSQLYVLSKLSDREFGM
                     GEFKFVPPDEAVEVLSEQDEAQLKERVKEKYLAIDRNPATLPSEKSNLSYEN"
     gene            complement(<233889..>235532)
                     /locus_tag="AGOS_AFL110C"
                     /old_locus_tag="AFL110C"
                     /db_xref="GeneID:4621667"
     mRNA            complement(<233889..>235532)
                     /locus_tag="AGOS_AFL110C"
                     /old_locus_tag="AFL110C"
                     /product="AFL110Cp"
                     /transcript_id="NM_210794.1"
                     /db_xref="GeneID:4621667"
     CDS             complement(233889..235532)
                     /locus_tag="AGOS_AFL110C"
                     /old_locus_tag="AFL110C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL214C (THI6)"
                     /codon_start=1
                     /product="AFL110Cp"
                     /protein_id="NP_985440.1"
                     /db_xref="GeneID:4621667"
                     /translation="MKEVDYSLYLVTDSSMLPQGTTLDSQVTAALQNGATLVQLREKD
                     ADGCDFVEAALRVKRICAEFNVPLLINDRVDVALAVDADGVHVGQQDIPPPLVRKLVG
                     PSKIVGWSVGRPEEVQQLAEWGQGCVDYIGVGMIFPTETKKNPRKVPMGISGAIEIMD
                     ALEECRATWCRTVLIGGLHADNIGRVLLQCASSNGKRAADGVAVVSEIMAASDARGAT
                     QRLRRLLDDGAYRFVVGKFTEDVDYRAPDDMETYVPMLLEASPLVHHVTNKVHQNFAA
                     NVTLAAGSSPIMSEVSSEFEDLSTAAHSALVLNTGSLVDLEVATAAVRAYNKARRPVV
                     FDPVGFAASRTRLDYNGHLLNMGQYTCIKGNASEILALSSSEHRAMRGVDSEHDVDID
                     TLCNAARQVAYRYRTVVVLTGQNDIVVNGALDCSFNLGFGSAPPQDHLPAYIVSCDSI
                     PLFSKVTATGCSLGSVIACFLGALPPDGSPFHAVLSAVLIYKSAGYFAAGRATGGASF
                     QTELLDELDTLFEKGSHGQMAKIYPFGSWPVKVERVDIP"
     gene            <235723..>236436
                     /locus_tag="AGOS_AFL109W"
                     /old_locus_tag="AFL109W"
                     /db_xref="GeneID:4621668"
     mRNA            <235723..>236436
                     /locus_tag="AGOS_AFL109W"
                     /old_locus_tag="AFL109W"
                     /product="AFL109Wp"
                     /transcript_id="NM_210795.1"
                     /db_xref="GeneID:4621668"
     CDS             235723..236436
                     /locus_tag="AGOS_AFL109W"
                     /old_locus_tag="AFL109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL213W (LEA1)"
                     /codon_start=1
                     /product="AFL109Wp"
                     /protein_id="NP_985441.1"
                     /db_xref="GeneID:4621668"
                     /translation="MKLTPASILEAPVYYADHIHGKYDVDKVVILRDCGYVSENEIMP
                     QTLKLLPERTNIVDFTNNELEELPPLGHNDTVHTLLLSRNRLGRLDASRLPRYLVNLN
                     LAMNRFEKFEQLQGLRSAPKTLKNLNLRGNVICHKEQYRETVIALCPQLAVLDGERVR
                     QAERQAAPQNEKTDTPTEGPQPVALQATSEKELQLMDHVVNKMDKDTLEDIKQQLAKA
                     TTLAEIERLEKLLSGGVIQ"
     gene            complement(<236472..>240833)
                     /locus_tag="AGOS_AFL108C"
                     /old_locus_tag="AFL108C"
                     /db_xref="GeneID:4621669"
     mRNA            complement(<236472..>240833)
                     /locus_tag="AGOS_AFL108C"
                     /old_locus_tag="AFL108C"
                     /product="AFL108Cp"
                     /transcript_id="NM_210796.2"
                     /db_xref="GeneID:4621669"
     CDS             complement(236472..240833)
                     /locus_tag="AGOS_AFL108C"
                     /old_locus_tag="AFL108C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL131C (SNT2)"
                     /codon_start=1
                     /product="AFL108Cp"
                     /protein_id="NP_985442.2"
                     /db_xref="GeneID:4621669"
                     /translation="MPEAPGSGGRRRNAAKKINYNEKMADAELARRIKQLEKGRGRGG
                     ARAGGRGRASNFKYQWYLQDRSVGWNFIPSLPPTCRKHSRFSNILELEEALVDVRRQV
                     VVHGGSTLLRRDEHIYMVSEPPGEPYYIGRVMEFVGKTEFRKLIEDAVSEGVAHVFPA
                     RYFQARMNWYYRARDIQDNPQNADPRLLYASLHSDLCPLHSYRGKCTVVHRSDAEEGY
                     ATRPNYFVFDQLFDRYTLSYYDVWRTEKLLALGPGSKYLEALSERYPHVYVEEKYPLE
                     HVVRRYIVGENVPDKVDGQLWDQRCGQCREWCEQAQSLRCDSCKVPLHLFCFDPPLDR
                     KPAKGVSWICSDCVRTQNNETNSDQMSAAEESEFEKLSSVALRELGKGINLENWWFQY
                     FGSRLVCHLQDCLSTALVLPYPIKCSRVGNKVQWSSCNEPEWLPRPYTGEECERGEDS
                     SLELLWSLDTAKITPETLDAYLERCSSTLPEPLGITPQATNFLDMVLKALVDCRFDLE
                     AAFTWCRNNMTRKTLKEPTLTEEEVEKFENAVAEHGSELHPVCKYVGSQPMSMIVRFY
                     YYWKKTPNGRRIWGNFKGRSKRGRQKYDDGLPENTPSDSTRKRKRIATEKVEEVSKQW
                     RHVDESCFDSEQISKVKACFQCMFCNVDYSPLWYRVTGGCDDEKVQSRMKTGVNEKTN
                     TSEKAPSQQITKDDNKLTALCIRCARMWRRYAVKWHAPLDVLKRLNGPSMNNVQSNLQ
                     QFLDDPNESVVKTSPAQAQTKMVEWELVQDMELIIKQRLEIISNPERLIKMKRNCLSA
                     HAQLNKLVKKLIPESLMSESDMKKELEVYIAHYAAELKKKEQKMQQKNKHLLSVKEHN
                     LEAIGSKMKTELNSTTSVEQLGAVQKPKRQKTQKTLQNTAVLLDIPGISEPEFTEKIT
                     LDNNFEHIKIPEAIHNKLFGSMFNDNADHTEDLALINGQNNHQRQLSLRQSPFNSNDI
                     PIVRHMQYEGILREYNSHNASYAVWRKNHSGAFTNVEKSGPNKSKSCTPPSSAGRSRA
                     HTLVSVDNLMATNAVEPRDFCCICFGKFKTDEYELLCSNCGLNVHTYCYGVNKPRTSV
                     SPGALWLCDPCSNDRNVLVSTNYQCTLCMAREIDHDSSRKRLKKAVPDALKPDVNGNW
                     CHVICALFNEQIKFGSATNYQPVYNIGPTLLKNNGVKCGICTMLGGGLVRCDKCPFKF
                     HVTCAQDSKNFTLCFKKYMVAIANSPTHVVDGDEIYTVKPKILCPQHHSDSNTGAYLP
                     LNHTISSGAPLLQFYMENYKACTFVNSYTTIGLRAMEREACSLLLAQYDNLESPPHNG
                     ISKEATNKCVKCAATLALCWFENLCHSCSIVVAAESDVIEVDDTPVLPDQGTIDEALA
                     EELLHGIDSTKLSIELNILHSAKGKRKGGRYGKRNLPKPSIDASNVVVQPMGTNLPPQ
                     TGVAITTTDTEPPNGAC"
     gene            <241066..>242457
                     /locus_tag="AGOS_AFL107W"
                     /old_locus_tag="AFL107W"
                     /db_xref="GeneID:4621670"
     mRNA            <241066..>242457
                     /locus_tag="AGOS_AFL107W"
                     /old_locus_tag="AFL107W"
                     /product="AFL107Wp"
                     /transcript_id="NM_210797.1"
                     /db_xref="GeneID:4621670"
     CDS             241066..242457
                     /locus_tag="AGOS_AFL107W"
                     /old_locus_tag="AFL107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL130W (CEG1)"
                     /codon_start=1
                     /product="AFL107Wp"
                     /protein_id="NP_985443.1"
                     /db_xref="GeneID:4621670"
                     /translation="MDSRDAPEVPGIRQPANVTTDLKMIICKLLNSPKPAKTFPGSQP
                     VSFQHVDIEEKLLAQDYYVCEKTDGLRALMLIIMNPVTKEQGCFLIDRENNYYLLNGF
                     RFPRLPRANRKELLETLQDGTLVDGELVVQTNPATRLRELRYLMFDCLAINGRALVQS
                     PTSSRLAHLGKEFYKPYYDLRAYYPDRCATFPFKLSMKHMNFSFDLDRVAGSLDKLPH
                     VSDGLIFTAVDTPYTVGGKDSTLLKWKPEQENTVDFKMILEIPVVEDDTLPKKDRNRF
                     YYNFDVKPSFHLYIWQGGPDVNTRLHDFEQPFSKKELEILHRTYKVFAELQISDEQWA
                     KMKALEQPLNGRIVECAKDQETGEWKFLRFRDDKLNGNHVSVVQKVLESISDSVKLED
                     LEHMIPRIKARWEERKSKKRTHSSISGPMLPPVAETKAPREATQSRYIDDEDWSDEAD
                     DDDEDSLKRARIE"
     gene            complement(<242546..>243868)
                     /locus_tag="AGOS_AFL106C"
                     /old_locus_tag="AFL106C"
                     /db_xref="GeneID:4621671"
     mRNA            complement(<242546..>243868)
                     /locus_tag="AGOS_AFL106C"
                     /old_locus_tag="AFL106C"
                     /product="AFL106Cp"
                     /transcript_id="NM_210798.2"
                     /db_xref="GeneID:4621671"
     CDS             complement(242546..243868)
                     /locus_tag="AGOS_AFL106C"
                     /old_locus_tag="AFL106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL129C (RSM23)"
                     /codon_start=1
                     /product="AFL106Cp"
                     /protein_id="NP_985444.2"
                     /db_xref="GeneID:4621671"
                     /translation="MLRLQARAFSSSCSVLATARKQAQKKGYNKKDTAAAKPVVKKVV
                     SGSLYKPWKFAVGTSKLNANAPALELPVFNPAEPKNEVAVFSGEQQQFLHRIGAFRLG
                     QFHELFSRPVCYTREATGQLLERLSGTEHQRVILTGQPGVGKSTLLAQAQVAAFEKGS
                     VIINISHPELFLNGRNDFRHDTTGEQEQYTQPMYLKKLLTKILKSNKKSVLSSVALTQ
                     EYKFPVADTRESASKRVTRLVPGKNTLYDLLSMKTTPAARGMLFQAVIDELVAQSAVP
                     VYLTVDNFSRILSEPLSAYKDTSCRSIHVLKLQLGRIIMNFVSGATKLNHKDSRVVLA
                     TSGVDRETKTLPTGLGQTPHDPYAAKYNYDAVLAEMMLKGGVKEFRVEPLSKPEVAEL
                     VDFYAKAGILSEKDQENRREGRLVDEKYLLSGNGNLRELLKSLTLYPF"
     gene            complement(<244069..>245655)
                     /locus_tag="AGOS_AFL105C"
                     /old_locus_tag="AFL105C"
                     /db_xref="GeneID:4621672"
     mRNA            complement(<244069..>245655)
                     /locus_tag="AGOS_AFL105C"
                     /old_locus_tag="AFL105C"
                     /product="AFL105Cp"
                     /transcript_id="NM_210799.2"
                     /db_xref="GeneID:4621672"
     CDS             complement(244069..245655)
                     /locus_tag="AGOS_AFL105C"
                     /old_locus_tag="AFL105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL212C (PUS1) and YGL063W (PUS2)"
                     /codon_start=1
                     /product="AFL105Cp"
                     /protein_id="NP_985445.2"
                     /db_xref="GeneID:4621672"
                     /translation="MPSDASTGYVDDQPGDEAYKRGALYKQTKARRADYDSDKEAKRP
                     CTEDSDVALAGTSEEKEARLPKRKVAVMVGYCGTGYHGMQYNPPNRTIEAELFEAFVK
                     AGAISRANSTDLKKNGFMRAARTDKGVHAGGNVISLKLIIEDPAIKDKINEHLPPGIR
                     VWGISRVNKAFDCRKLCGSRWYEYLLPTYSFIGPKPNTYLARTIEQCGEAASEKPDRD
                     QESLDFWEAFRKAVDEKFTQEEQDAIVNYVAPSKEDFDENSGLYQKVKQYKQMENAHR
                     RSYRVSSAKLARFREAMKQYLGPHNFHNYTLGKDFKDPSTVRFMKDITVSDPFVIGEM
                     KTEWVSIKIHGQSFMLHQIRKMISMATLVARCNCSPERIAQSYGPQKINIPKAPALGL
                     LLESPVYEGYNKRLLEFGYEPIDFRNYQKEMDTFKMVHIYDKIYKEEVDENVFNAFFN
                     YIDAFNQVTGAQGEPTKSHDPAKIQLSIIDFLLPCSSSPQENASPEAQKAPETPAGDN
                     TISAEQPKTATEVPTTQSDA"
     gene            <246109..>246654
                     /locus_tag="AGOS_AFL104W"
                     /old_locus_tag="AFL104W"
                     /db_xref="GeneID:4621673"
     mRNA            <246109..>246654
                     /locus_tag="AGOS_AFL104W"
                     /old_locus_tag="AFL104W"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="NM_210800.1"
                     /db_xref="GeneID:4621673"
     CDS             246109..246654
                     /locus_tag="AGOS_AFL104W"
                     /old_locus_tag="AFL104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL211W (NIP7)"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="NP_985446.1"
                     /db_xref="GeneID:4621673"
                     /translation="MRQLTEEETKVVFEKLAGYIGRNISYLVDNKEQPHVFRLQKDRV
                     YYMPEHIAKLATCVARPNLMSLGICLGKFTKTGKFRLHITALTVLAQHAKYKVWIKPN
                     GEMPFLYGNHVLKAHVGKMSDDIPEHSGVIVFSMHDVPLGFGVSAKSTSEARDLQPMG
                     IVAFRQADIGEYLRDEDTLFT"
     gene            complement(<246762..>248606)
                     /locus_tag="AGOS_AFL103C"
                     /old_locus_tag="AFL103C"
                     /db_xref="GeneID:4621674"
     mRNA            complement(<246762..>248606)
                     /locus_tag="AGOS_AFL103C"
                     /old_locus_tag="AFL103C"
                     /product="AFL103Cp"
                     /transcript_id="NM_210801.1"
                     /db_xref="GeneID:4621674"
     CDS             complement(246762..248606)
                     /locus_tag="AGOS_AFL103C"
                     /old_locus_tag="AFL103C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL210C (SRP72)"
                     /codon_start=1
                     /product="AFL103Cp"
                     /protein_id="NP_985447.1"
                     /db_xref="GeneID:4621674"
                     /translation="MAGKDLKSLIERLNLSSSKDEHSQVAAAYLELVANGCDDVCGAL
                     EKCVTALIKQDRYEQAMEVFAEYADVCKEGRFALLKLYTFYKLGQSAAFETEWAQVAE
                     KVEASLAQDTVTAELRPLLHVRAQFDYKMGRYSDMFRTYKYLAAHNEEEADDGMELAC
                     NERVPLAFLPAEAVAEVSGKLVEDSYDMLLNESMVCSSKGQLEQAESLLKRALELARA
                     EEVEDDVHTIQLQLAYVTQLLGRKKESRKLLTDLQKQVSAVSPLVSIIKTNLKSLDDL
                     SRYSENSNLPLVLRELDAERLASSSSKTYSHDQWLRLQANLLFMRLFSNTIIRSKSTI
                     LSRTLAQYSKLVDNVCLESYTVQAKTLFDHVLSLIAKKDENAVGVLVLAVQLQLKAKN
                     IGRAILLCEKYWENMAAESHKELVSSLLVHLYKQTRRKRSLLRHLAEITESFDPVNVR
                     QSYDYWKFIGFQLLENQLGSARDVFAALAEVRPADSLVAKVLNPADQHELSEDMITDL
                     VRDIDVEALIANGVDPLEASCRIPKASAGKVSKKRRTGKPKLPKAFDPEKQPDPERWL
                     PLRDRSSYRPKKRHGKQTQGGVVDKRAESNLDITKQKKKPKQKKAGHR"
     gene            <248850..>250514
                     /locus_tag="AGOS_AFL102W"
                     /old_locus_tag="AFL102W"
                     /db_xref="GeneID:4621675"
     mRNA            <248850..>250514
                     /locus_tag="AGOS_AFL102W"
                     /old_locus_tag="AFL102W"
                     /product="AFL102Wp"
                     /transcript_id="NM_210802.1"
                     /db_xref="GeneID:4621675"
     CDS             248850..250514
                     /locus_tag="AGOS_AFL102W"
                     /old_locus_tag="AFL102W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL064C (MRH4)"
                     /codon_start=1
                     /product="AFL102Wp"
                     /protein_id="NP_985448.1"
                     /db_xref="GeneID:4621675"
                     /translation="MSSVGIASASLWLRGPVKSALKGRWLSCEQMRRYGTKSAPAVRK
                     GGHSKKARQAPSLPFVFGRHKQLTGPEFTRRTRIGNLSDKITKFEQLKLLPEVREVMM
                     KVIASESVLNKSLDDEDCGLDDKRVAAFLGQVQPTPIQTAVIKKMAKTLMEPQLQVHM
                     VAAETGSGKTMSYLMPLVDYLKQEEQAAGTEEGRARLGALRSLILVPTHELVEQVYMT
                     LEKLQEPLQLKTFKLDRDTPYKDIVEAFKGRVDIMVTTPGKLRGLFKIRMLHRPDRIL
                     SQVRFAVVDEADTLMDQSWVQETYSCIKSLRDANHLVFCSASVPMEFEKAMNKLFPNL
                     QVVASEKLHRINKHSNIKIINVALRPYNGSKMKALAQALYAIMKDGTSEGYEKRCVVF
                     VNEADSVNSIVDTLRDKFGHDVHGLTGEHSLDDRLATIAPFMRSPPRIQDQVRPSELK
                     KPQERRLPNSNIKVADSKDNGQRSVSSPLKVLVTTDVLSRGINFKGVKHVILYDVPAK
                     SIDLVHRVGRTSRMNERGHVYIFVGKKGSAQAKGLNPVVKKNRPIQ"
     gene            complement(<250575..>251678)
                     /locus_tag="AGOS_AFL101C"
                     /old_locus_tag="AFL101C"
                     /db_xref="GeneID:4621676"
     mRNA            complement(<250575..>251678)
                     /locus_tag="AGOS_AFL101C"
                     /old_locus_tag="AFL101C"
                     /product="AFL101Cp"
                     /transcript_id="NM_210803.1"
                     /db_xref="GeneID:4621676"
     CDS             complement(250575..251678)
                     /locus_tag="AGOS_AFL101C"
                     /old_locus_tag="AFL101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL209C (IPL1)"
                     /codon_start=1
                     /product="AFL101Cp"
                     /protein_id="NP_985449.1"
                     /db_xref="GeneID:4621676"
                     /translation="MDADAILKKDQRRSSLKQRNLLLSMRLNQTTATNGAPPQARVQP
                     GKGYRNPGKVLSPIRNQEMSPGKRPTLEISELKNVSPINQAHKTGKARAGGVPLSKLQ
                     NLKLADFEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKKDIIQYNIEKQFRREVEI
                     QSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASYYVYQMAD
                     ALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSKRKTLCGTVDYLSPE
                     LIRSREYNEKVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFPDHVDTEAR
                     HLISRLLEYDPGDRIPLKEVKKHPWIEKNKPFW"
     gene            <252056..>253786
                     /locus_tag="AGOS_AFL100W"
                     /old_locus_tag="AFL100W"
                     /db_xref="GeneID:4621677"
     mRNA            <252056..>253786
                     /locus_tag="AGOS_AFL100W"
                     /old_locus_tag="AFL100W"
                     /product="AFL100Wp"
                     /transcript_id="NM_210804.2"
                     /db_xref="GeneID:4621677"
     CDS             252056..253786
                     /locus_tag="AGOS_AFL100W"
                     /old_locus_tag="AFL100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL208W (RKM1)"
                     /codon_start=1
                     /product="AFL100Wp"
                     /protein_id="NP_985450.2"
                     /db_xref="GeneID:4621677"
                     /translation="MDVSRLEKLLAWGLEHGIRLPEHVKFCEAPGKGIAAFASDEVAS
                     GAAFELPHELILTSGLALEHFNKTRDGNMWLKLLLAKMRFGGGPVNVRGCDVAAKFEP
                     YVACLPARVGSPLEWPVEMWALLQGTNLGKSVGQKLLEVVQQWRDMLAALGAELDTAV
                     QAQAAAAAELLAAGVAEWPAFHARVAGGPATSWLSFQAFLWGHLMLTSRAFPERVLRS
                     DCDESAVVLLPVLDLLNHSTDARVEWSGKDGFTIRQLQPLRQGQEVCNNYGGKSNEEL
                     MLGYGFAIEDNLFDHVALRVCPPAATVQAMLDAGLKLPTLDDYTTYAFERHPATSSVH
                     DASAYSKGVLFLLGRSNVALEQLLDLFAFQEAAAEECHKALRCRLQAMQNLIELLRGR
                     LHVIQEGEMAADEQETAAKSYPQAMATVRIYRKQQQELLRAAVKTLKRWEKETLAAIK
                     EKTVAFKNVTKHDPGFVDELLPALFSSDVEFENYDDILLLWIILRGKSSVETPKRFQS
                     LFAAYVTYARGPADLSEDLQTMFESKYRAWFPKGSKQVSLDEVLDAASFFMRHSYVRA
                     STGESIIIVE"
     gene            <254140..>256458
                     /locus_tag="AGOS_AFL099W"
                     /old_locus_tag="AFL099W"
                     /db_xref="GeneID:4621678"
     mRNA            <254140..>256458
                     /locus_tag="AGOS_AFL099W"
                     /old_locus_tag="AFL099W"
                     /product="AFL099Wp"
                     /transcript_id="NM_210805.1"
                     /db_xref="GeneID:4621678"
     CDS             254140..256458
                     /locus_tag="AGOS_AFL099W"
                     /old_locus_tag="AFL099W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL207W (TYW1)"
                     /codon_start=1
                     /product="AFL099Wp"
                     /protein_id="NP_985451.1"
                     /db_xref="GeneID:4621678"
                     /translation="MCGANLDAEEPFLSGIPGSAILAAVLASYIGTGGRISIGCVVTA
                     LYLLANIEAKKNASFAAALGVPVSGKGKGCCGGKNGGCCSTKAAAKPTGHKCSCSGAK
                     VTKSKAPVAASAAARSQEEAFPIAIDFTNSFKAPQSKVPPVKKTPKVISGTAKKKQKD
                     AFIKSGLTVSNEKLLASQIYIFYSSLQGAAKRSAELVLAELRELKPLELEPILLNLDE
                     IDDLDKYFVDVPCENALYVLVLPSYDSDSPLDLFLETLEENFNDFRIDNYPLRKLVGY
                     SILGIGDSEMWPEKFCYQAREADLSIAKLGGRRIYPVGEVCVKFGGDPKVEEWARLFV
                     ETLQDDEPMLYEYDESVEDELDESSDAAAEALVDLEDIGNGSGGNGTGALKKMVAKDS
                     PTYKNLTKQGYSIVGSHSGVKICRWTKNDLRGRGSCYKHSLFNIVSSRCMELTPSLAC
                     SSKCVFCWRHGTNPVAKNWRWELDEPEFILENALKEHYSKIKQMRGVPGVIAERFAKA
                     FQVAHCALSLVGEPILYPYITRFIELLHQKNISSFLVCNAQHPDQLEALGKVTQLYVS
                     IDAPTKTELKRVDRPLYKDFWERLMRCLELLRTSQAHQRTVFRLTLVKGFNMADVSSY
                     ADLVQKGIPCFIEVKGATFCGSSDGNGNPLTMQNIPFYEECVSFVKEFVAELQKRGLA
                     YDIAAEHAHSNTVLIAHTKFKRGDKWYTHIDFEEFFKLLNSGASFTHMDYMAETPEWA
                     LFGNGGFAPGNTRFYKKKNRKDEASVREGKLA"
     gene            <256774..>258318
                     /locus_tag="AGOS_AFL098W"
                     /old_locus_tag="AFL098W"
                     /db_xref="GeneID:4621679"
     mRNA            <256774..>258318
                     /locus_tag="AGOS_AFL098W"
                     /old_locus_tag="AFL098W"
                     /product="AFL098Wp"
                     /transcript_id="NM_210806.1"
                     /db_xref="GeneID:4621679"
     CDS             256774..258318
                     /locus_tag="AGOS_AFL098W"
                     /old_locus_tag="AFL098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL065C (ALG2)"
                     /codon_start=1
                     /product="AFL098Wp"
                     /protein_id="NP_985452.1"
                     /db_xref="GeneID:4621679"
                     /translation="MMTPLNIALIHPDLGIGGAERLVVDAAIGLQDQGHRVTIYTSHC
                     DKNHCFEEIKRGDLKVVVVGDFLPTNILGKFFILCANLRQLALVFKLVINGSIDKHDL
                     FIVDQLSTCVPLLHLFSASGRVLFYCHFPDQLLAQRKSLVSKLYRVPFDLLEQLTMGC
                     SDSVVVNSYFTRSVFFDTFKILRLNPRVVYPCVAMDELPIEKIDIGFYDQIIGPNNRY
                     YLSINRFERKKDIALALNAFKASKEGHSSDTKLIICGGYDSRVAENVEYLSELQLICE
                     KANIAHVTIFYSEFSRTPEHYTFPTGVREKKVIFLASISSSLKELLLKKAQLLLYTPS
                     REHFGIVPLEAMKHGTPVLAVDNGGPLETVVTLKSDNQDTATGWLRRADAGIWAEAID
                     EQAEYVKKNPGIFATNGPKWVKDKFSRDAMTSSFLHNIDNIFMTDRVIQPWAVMVILA
                     ASYILWRSSHVFGDACRYIYLLTGGILVLRSRYLLAIFWVLLFVMQPQLSVGVDTITA
                     TLKPKL"
     gene            complement(<258354..>259934)
                     /locus_tag="AGOS_AFL097C"
                     /old_locus_tag="AFL097C"
                     /db_xref="GeneID:4621680"
     mRNA            complement(<258354..>259934)
                     /locus_tag="AGOS_AFL097C"
                     /old_locus_tag="AFL097C"
                     /product="AFL097Cp"
                     /transcript_id="NM_210807.1"
                     /db_xref="GeneID:4621680"
     CDS             complement(258354..259934)
                     /locus_tag="AGOS_AFL097C"
                     /old_locus_tag="AFL097C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL066W (SGF73)"
                     /codon_start=1
                     /product="AFL097Cp"
                     /protein_id="NP_985453.1"
                     /db_xref="GeneID:4621680"
                     /translation="MTDIHSNIKRLKTHIRLGNLDTEGNSGWKDLIPIAKSSSSERFL
                     EDEREHGAAGSLLGAQQLTSAYLSHTVAPLEPPVDYRVCNDCGRPIAYSALLVHLQEH
                     CRRRKESENGAKSPPPEMSPATVKQLKRSSSTDMELSPSKKQRKVATPSTKRQRKVKQ
                     RNPTEPHLVDLDKQCGVELPERGVCGRSLTCKSHSMGAKRAVQGRSKPFDVLLTEYQK
                     KNHIKNASKGARAKGQPLNQQQKQKLLDKEQEQDVPILSPEEETTQVLNGVSRSLPLP
                     LETNILTSTKTRTKYFRMREMFASSFSIRPGYSTPGYGAIHSRVGCIDLDRTTEYTFR
                     IRVPQLVNQNSPQGSPPQHVHAIQHHRMKQPAQQMQDMPSITHSLPQQQMPAHVSEEH
                     LQYRPQQGSDIKTMENLTGIVDRPITPRDVQTQQLLMQQQQQQQQHRQQHHERQHLPQ
                     EKQQQQQNEQLQRIQQRKRLEDASAQLDTASKLMQGSPINVSGSMVNNSGVGSPVNVK
                     NQGMVNMGLNNGYDSRGN"
     gene            complement(<260408..>261358)
                     /locus_tag="AGOS_AFL096C"
                     /old_locus_tag="AFL096C"
                     /db_xref="GeneID:4621681"
     mRNA            complement(<260408..>261358)
                     /locus_tag="AGOS_AFL096C"
                     /old_locus_tag="AFL096C"
                     /product="AFL096Cp"
                     /transcript_id="NM_210808.1"
                     /db_xref="GeneID:4621681"
     CDS             complement(260408..261358)
                     /locus_tag="AGOS_AFL096C"
                     /old_locus_tag="AFL096C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL206C (PGC1)"
                     /codon_start=1
                     /product="AFL096Cp"
                     /protein_id="NP_985454.1"
                     /db_xref="GeneID:4621681"
                     /translation="MPQIIGHRAYRGKYPENTLLAYDKAYEAGVDMIETDIQMSDDGV
                     VVINHDMDTGRMYDRSMSIADTEWRKLQKLRLASHPDIGMLSLRDALLWLMKHDNVKL
                     LLDVKATNKRLILVRAVDEMLSLVDDLDYWRSRILFGLWQLDWFEYGVSTTILRGFPL
                     VYIGLSLDQAAEFLDYSETLAHPDYRLHAVSLHHVATWAPEFHAEWQRFQRSGIQLFL
                     WTVNSALDTKYLAHVPVAGVVTDVPVDMSHDTKKWPRKDSPLTPPSIMTREGLRFHFF
                     LAVYRVARALTTSSWAKRPIFGPYSVNLICIILLRRIHFI"
     gene            <262306..>269913
                     /locus_tag="AGOS_AFL095W"
                     /old_locus_tag="AFL095W"
                     /db_xref="GeneID:4621682"
     mRNA            <262306..>269913
                     /locus_tag="AGOS_AFL095W"
                     /old_locus_tag="AFL095W"
                     /product="AFL095Wp"
                     /transcript_id="NM_210809.2"
                     /db_xref="GeneID:4621682"
     CDS             262306..269913
                     /locus_tag="AGOS_AFL095W"
                     /old_locus_tag="AFL095W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YHR211W (FLO5)"
                     /codon_start=1
                     /product="AFL095Wp"
                     /protein_id="NP_985455.2"
                     /db_xref="GeneID:4621682"
                     /translation="MRSLLGVLAALLTTALAQEAVPVQQLQACDPLRANPNLTPRSGF
                     DITYYDYPWLSYSDRVNRGVPDRTTYLSDPYLRGGYANYQRLGSSTGVTNLTFINEFG
                     LGRGRERVRGNLPPNYNFPDEINISNFAYVGTGYFRADQDGSYNFTLDFVDDYAAITV
                     GGGRAFTCCREESTVTSPSDFQISAVWSREAPAGRAWTVVNLQRGAYYPLRVFYVNTN
                     NWAGIRFTFTDPSGVHHEDFQNHIFHFDDQPNECPEIVATTTHPYDGTETVTAYTTLS
                     TYTNSDNQLTTGRVVVINTPYPRGETTTTNGWTGSYTTTLSTGVATVTGTDGYGTIET
                     IYHVVTPEASAVTTTTSGWTGTHTTTLSTGLTTVTGPDGIATTETTYYVVTPEAQAVT
                     TTTSGWTGSFTTTMSTGVTTVTGSDGIATTETTYYVVTPEAEAVTTTTSGWTGSYTTT
                     MSTGVTTVTGTDGIATTETTYYVVTPEAQAITETTSGWMGTYTTTLSTGVTTVTGTDG
                     IATTETTYYVVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIYHVVTP
                     EGVLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPEAELVTTTTSGWA
                     GTYTTTFSTGVTTVTGPDGIPTLETTYYVVTPEAEAVTTTTSGWTGSFTTTMSTGVTT
                     VTGSDGIATTETTYYVVTPEAEAVTTTTSGWTGSYTTTMSTGVTTVTGTDGIATTETT
                     YYVVTPEAEAITTTTSGWTGSYTTTMSTGVTTVTGTDGIATTETTYYVVTPEAEAITT
                     TMSGWTGSYTTTMSTGVTTVTGTDGIVTTETTYHVVTPEAHAITETTSGWMGTYTTTL
                     STDVTTVTGTDGIATTETTYYVVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGI
                     ATTETIYHVVTPEGLLTATVTSGWTGSITTTLSTGVTTVTGTDGIATTETTYYVVTPE
                     AELVTTTTSGWAGTYTTTFSTGVTTVTGPDGIPTLETTYYVVTPEAEAVTTTTSGWTG
                     SFTTTMSTGVTTVTGSDGIATTETTYYVVTPEAEAVTTTTSGWTGSFTTTMSTGVTTV
                     TGSDGIATTETTYYVVTPEAQAITETTSGWMGTYTTTLSTDVTTVTGTDGIATTETTY
                     YVVTPEAHAITTTTSGWTGTYMTTLSTDVTTVTGTDGIATTETIYHVVTPEGLLTATV
                     TSGWTGYYTRTLSTGVTTVTGTDGIATTETTYYVVTPEANYVTTTTSGWAGTYTTTYS
                     TGITTVTGYNGIPTIKSTYYVVTPEASVVTTTASGWRRTYTTTRSTGITTVTGTDGIA
                     TTETTYYVVTPEAHAVTTTTSGWTGTYKTTLSTDVTTVTGTNGIATTETIYHVVTPEA
                     HAITETTSGWMGTYTTTLSTDVTTITGTDGIATTETTYYVVTPEAHAITTTTSGWTGT
                     YMTTLSTDVTTVTGTDGIATTETIYHVVTPEGVLTATVTSGWTGSITTTLSTGVTTVT
                     GTDGIATTETTYYVVTPEAELVTTTTSGWAGTYTTTYSTGVTTVTGPDGIPTVESTYY
                     VVTPEASAVTTDVHGWTGSYTTTLSTGFTTFTGTDGIATTETSYYVVTPEARAARRTT
                     SGWTGTYMTTLSTGVATVTGTDGIATTETTYYVVTPSPVTTPVSIRYNTTTAWLNTTF
                     TESTTVVESVPTTETVLVTTTDIHGETSVSTSTLTTTHVVPTTAWWNTTVVRPTTFLN
                     ITLVPTTVMSTTSVPTTKTAWANTTATIRENVTRSEVETVITTVTNTQSISTVAWANS
                     TITVQPTTIVNPTEMVTLTETINYTTTKSDGEKTVETTVVTTEVLPTTVWRNSTISAG
                     PTTVVTVPEPGTTTETYYITSTRPDGQTTIEATTTVVTKHVVPTTVWMNSTISHCTDC
                     STAVIHPTESVTMTETHYITSTAVNGSTAAKTVTTVVTTVVPESTVWLSTTVCGDTTA
                     SHCTDCVTTVVHPTDLVTTTETYYITSTAADGSKATETVTTVVTTVVPESTVWLSTTV
                     RDPTTIVTTKQAPTAAWQNTTVLTRSTEVITTTETQFVTKTGTDGSPTIETTETVITR
                     DPLTTTAWVTTTIDGKTTVVPPPPEPTTTTETILLTTTNAKGVTIVETTTNVVTKEAE
                     CPTSGRETTVTTAPVLTSLTEQVTITETISYTVTGDDGVKTLETTTVRTSTAVITTEI
                     PGPKPPVPTGPGPEIDRSSSSVPGHSSPTGSEPCHSPPPATSQPCPPPATSQPAQSSS
                     SASQPCPPPATSQPAQSSSSASQPCPPPATSQPAQSSSSASQPCPPAATSQPAQSSSS
                     ASQPCPPSATSQPAQSSSSASQPCPPSATSQPAQSSSSASQPCQTAPATQESTQSAPT
                     TVESAVPCTGGNAGPSTTEIVAPKSSDRSVCGTLTTTVIVTTCPVRTDGPSATAGPAS
                     TAGSTASVSGGASSIADKTAAAAAVPTDTISRYTKGTTAQTASTSTGSLSSSTGSRYT
                     KATAHPAPSGKFSLGNPGSNSSPLSYFTGAAGRLHGSGTSLGSIVALFLSMLFLC"
     gene            complement(<270537..>273344)
                     /locus_tag="AGOS_AFL092C"
                     /old_locus_tag="AFL092C"
                     /db_xref="GeneID:4621683"
     mRNA            complement(<270537..>273344)
                     /locus_tag="AGOS_AFL092C"
                     /old_locus_tag="AFL092C"
                     /product="AFL092Cp"
                     /transcript_id="NM_210810.2"
                     /db_xref="GeneID:4621683"
     CDS             complement(270537..273344)
                     /locus_tag="AGOS_AFL092C"
                     /old_locus_tag="AFL092C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YHR211W (FLO5)"
                     /codon_start=1
                     /product="AFL092Cp"
                     /protein_id="NP_985456.2"
                     /db_xref="GeneID:4621683"
                     /translation="MRTSLSVLALAAVAAAHEDVLQACDPLRGGASARPGFDLTIWNY
                     PWTSYNHQTNRGVPDRTTFESAAYLQGGYAQYEELGRARAVTNLTFVNEFELGRGREM
                     VRGRLPPNYNFPDEFNISNFAYLATGYFRAEQDGAYNFTLDFVDDYASVALGGGRAFD
                     CCQKDTGVKSPEGFQIDARWARNGPVGRAWTVVNLQRGAYYPLRVFYVNTNNWAGIRF
                     TFTDPSGVHHEDFQNHIFHFDDQPNECPEIVATTTQPYDGTETVTAYTTLSTYTNSDN
                     QLTTGRVVVINTPYPRGETTTTNGWTGSYTTTLSTGVATVTGTDGYGTIETTYYVVTP
                     EAVVSTTTTSGWTGTHTTTLSTGLTTVTGPDGIATTETTYYVVTPEAQAVTTTTSGWT
                     GSFTTTMSTGVTTVTGSDGIATTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVAT
                     VTGTDGIATTETIYHVVTPEAQAVTTTTRGWAGNHTTTLSTAVATVTGTDGIATTETI
                     YHVVTPEALSVTKTAIFSSGSSWQNVTAEATKSSSFDGRVNQTIDSVAGTHTQISESL
                     TTVTSSAPTEDVCASLEQETVTVILSPMTTMTIPTTGAPQVMTIVKTVYSTITKDYSE
                     DMSESPFEPTTVSAPTNSAQVSSTNGPDTQQRISVDELAGGKLATTMNSSAANVSSQF
                     LENTIVPPTSEVYTSGSSRSFSLGNTDEMVTILPIGGASGISGISIGNVSTEPSTVQS
                     SFIAVSTGSAEYLTGTSEQPVTATPSTKSSVKASSFQSETKEDTNIPISVTSISYSSS
                     GTQASRTSTAEYGTAAVTGIPESSGGPANDNETASEEAETELPEESYGQEPSAGSNVA
                     TTEDEEDAYGTTVVEEYPLPTPQTAFTGSGFVSSAGVVSSSFPNLTKPLLPFFGGAVQ
                     LNTNMNKICSALVFVVTTLLL"
     gene            <273862..>275298
                     /locus_tag="AGOS_AFL091W"
                     /old_locus_tag="AFL091W"
                     /db_xref="GeneID:4621684"
     mRNA            <273862..>275298
                     /locus_tag="AGOS_AFL091W"
                     /old_locus_tag="AFL091W"
                     /product="AFL091Wp"
                     /transcript_id="NM_210811.1"
                     /db_xref="GeneID:4621684"
     CDS             273862..275298
                     /locus_tag="AGOS_AFL091W"
                     /old_locus_tag="AFL091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL204W (HRR25)"
                     /codon_start=1
                     /product="AFL091Wp"
                     /protein_id="NP_985457.1"
                     /db_xref="GeneID:4621684"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLEPIRT
                     KHPQLDYESRVYKYLSGGIGIPFIRWFGREGDYNAMVIDLLGPSLEDLFNYCHRKFSL
                     KTVMMLALQMICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKFRDFR
                     THNHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLRA
                     TTKRQKYDRIMEKKLCISVEQLCVGLPIEFVEYMRYCRNLRFDERPDYMYVARLFKDL
                     SIKLEYHNDHLFDWTMLRYTKAMIDKQSQAAETQHQSQQQAQEPANGDSDTDSKNASF
                     MKVKKLAMMKFPSHFHYWKPTDTHHPSPEEIKHQTVQNTQIVSTIPDEVLSEIDKNME
                     ALKQEAEQGRARPGNALPQQSNGAVVTLLEQQQAQEQGQQEQQLQQQQQQQHHHPQTQ
                     VTPAQAQSPQAQPPAKPDGNAGGAGIWL"
     gene            <275767..>276807
                     /locus_tag="AGOS_AFL090W"
                     /old_locus_tag="AFL090W"
                     /db_xref="GeneID:4621685"
     mRNA            <275767..>276807
                     /locus_tag="AGOS_AFL090W"
                     /old_locus_tag="AFL090W"
                     /product="AFL090Wp"
                     /transcript_id="NM_210812.1"
                     /db_xref="GeneID:4621685"
     CDS             275767..276807
                     /locus_tag="AGOS_AFL090W"
                     /old_locus_tag="AFL090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL203W (TPK2)"
                     /codon_start=1
                     /product="AFL090Wp"
                     /protein_id="NP_985458.1"
                     /db_xref="GeneID:4621685"
                     /translation="MEIMEQELCVAEEARRRSMLPQRSTVSKGKYSLQDFQIMRTLGT
                     GSFGRVHLVRSIHNGRYYAIKVLKKQQVIRMKQIEHTNDERRMLKVVEHPFLIRMWGT
                     FQDARNLFIVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVTLALEYLHAHNIIYRDL
                     KPENILLDRNGHIKITDFGFAKEVDTVTWTLCGTPDYIAPEVITTKPYNKSIDWWSLG
                     ILIFEMLAGYTPFYDVTPIKTYEKILAGKVVFPPFFHPDAIDLLGKLITDDLTRRLGN
                     LQSGSQDIKSHPWFSEVIWEKLLAKDIETPYEPPITAGVGDSSLFDQYPEEHLDYGVQ
                     GDDPYASYFVDF"
     gene            complement(<276890..>277390)
                     /locus_tag="AGOS_AFL089C"
                     /old_locus_tag="AFL089C"
                     /db_xref="GeneID:4621686"
     mRNA            complement(<276890..>277390)
                     /locus_tag="AGOS_AFL089C"
                     /old_locus_tag="AFL089C"
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /transcript_id="NM_210813.1"
                     /db_xref="GeneID:4621686"
     CDS             complement(276890..277390)
                     /locus_tag="AGOS_AFL089C"
                     /old_locus_tag="AFL089C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL068W (MNP1)"
                     /codon_start=1
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /protein_id="NP_985459.1"
                     /db_xref="GeneID:4621686"
                     /translation="MLRQVSRSARVVLRYGTAGRQAVRLNSTSAGAVDPKIAQIVEQI
                     STLTLLETSALIGELKTRLNIPDIAMAVGGAAAPAAPAAPEAAAEEEVKEEKTIFAVK
                     LEAFDAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKVLRENVAKEEAEKVKASLEALG
                     AKVVLE"
     gene            <277606..>277974
                     /locus_tag="AGOS_AFL088W"
                     /old_locus_tag="AFL088W"
                     /db_xref="GeneID:4621687"
     mRNA            <277606..>277974
                     /locus_tag="AGOS_AFL088W"
                     /old_locus_tag="AFL088W"
                     /product="AFL088Wp"
                     /transcript_id="NM_210814.1"
                     /db_xref="GeneID:4621687"
     CDS             277606..277974
                     /locus_tag="AGOS_AFL088W"
                     /old_locus_tag="AFL088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL070C (RPB9)"
                     /codon_start=1
                     /product="AFL088Wp"
                     /protein_id="NP_985460.1"
                     /db_xref="GeneID:4621687"
                     /translation="MTTFRFCRDCNNMLYPREDKEEQRLLFECRTCTYAEEAGTPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPRCHSHDNVFFQSQQRRRDTSMVLFFV
                     CLGCSHIFTSDQKNKRTTFS"
     gene            complement(<277997..>279355)
                     /locus_tag="AGOS_AFL087C"
                     /old_locus_tag="AFL087C"
                     /db_xref="GeneID:4621688"
     mRNA            complement(<277997..>279355)
                     /locus_tag="AGOS_AFL087C"
                     /old_locus_tag="AFL087C"
                     /product="AFL087Cp"
                     /transcript_id="NM_210815.1"
                     /db_xref="GeneID:4621688"
     CDS             complement(277997..279355)
                     /locus_tag="AGOS_AFL087C"
                     /old_locus_tag="AFL087C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL071W (AFT1) and YPL202C (AFT2)"
                     /codon_start=1
                     /product="AFL087Cp"
                     /protein_id="NP_985461.1"
                     /db_xref="GeneID:4621688"
                     /translation="MEYSQDAWGKQSPLDASPSAWSVSETAGDVPSGASATTASGHNV
                     EGSGARSSPYSEASYNNVLSDQAIERIRRQQNQNKLIHLEPIPDFKDKNDIKPWLQKI
                     FYPQGIEIVIERSDKIKVVFKCKASKRTKSGSAPGSQAGAAEDELGGQYETLPLSPVV
                     TASQLRKKKRAVSPYNTCPFRVRAAYSLKRKRWSIVVVNNGHSHPLKFNPDSAEYRKF
                     KNNLRQECDWDAVKKFDELEYRSKFNLPTEPTPIPCDCGLTQEIESFNVILPSTNILG
                     SSAPVFTEKKTVSKPRCRKTLQRDRCSQLRRQSTQSKLTHELHTALSPTLGSSADTLG
                     SPVRYAAQDAEVDFTEVFLRSLPPAKPLHSARAPDAARDSWHALEQLLDDPADAPPRT
                     PLPSASADCVNPLLHFAQRPADDPVDSLAYELNALSAMDSPFARPAPDAQFLWEDPKY
                     FP"
     gene            <279672..>281033
                     /locus_tag="AGOS_AFL086W"
                     /old_locus_tag="AFL086W"
                     /db_xref="GeneID:4621689"
     mRNA            <279672..>281033
                     /locus_tag="AGOS_AFL086W"
                     /old_locus_tag="AFL086W"
                     /product="AFL086Wp"
                     /transcript_id="NM_210816.2"
                     /db_xref="GeneID:4621689"
     CDS             279672..281033
                     /locus_tag="AGOS_AFL086W"
                     /old_locus_tag="AFL086W"
                     /note="NOHBY605; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AFL086Wp"
                     /protein_id="NP_985462.2"
                     /db_xref="GeneID:4621689"
                     /translation="MYAALFQAEAFAAAAVEQVEPGLHHGHVGHVCDPELVCNVGATE
                     RSPVPAVVVLVQVEQRAVRVLAEHEELAQRGPLHEARLLARDHGEPMLARVVAQHARG
                     GAHEHHAVVGAPGHARDGVVVARSAHGQGAERGRAHGPAVEVHVRAVRDAEKLAVAAE
                     RRAGDAGRQLERVARGRRAPRAEVIHRRVRAAQRDEPRRLVVPHVVHRVRPELHVGRA
                     PRAQVHAQEPPAVRARHERVRARRHHARDLLRAEPQKTEVRHARRLAPVRDQAPPPVR
                     APQAPARACAVARAHRAVAHRARAPQRPHVAHHLLVEHTAPARGRRWRRPRHLALVRS
                     QLACHEQRCRNAHLCPFRSLPLCVCYTLPYIPARRNVCYYPRENIHPMRTAELAGNLE
                     PRLCRSYGETAKIAQLLISGAVVHGRRNAAHAQVRFFSVAGPGRAGRRRPDFVHGRPR
                     WLW"
     gene            complement(<281143..>282963)
                     /locus_tag="AGOS_AFL085C"
                     /old_locus_tag="AFL085C"
                     /db_xref="GeneID:4621690"
     mRNA            complement(<281143..>282963)
                     /locus_tag="AGOS_AFL085C"
                     /old_locus_tag="AFL085C"
                     /product="AFL085Cp"
                     /transcript_id="NM_210817.2"
                     /db_xref="GeneID:4621690"
     CDS             complement(281143..282963)
                     /locus_tag="AGOS_AFL085C"
                     /old_locus_tag="AFL085C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL073W (HSF1)"
                     /codon_start=1
                     /product="AFL085Cp"
                     /protein_id="NP_985463.2"
                     /db_xref="GeneID:4621690"
                     /translation="MLTRPIDLMNGEATHGGGDSGGATTRLRAAPDAPDGDDAGAGGG
                     GAGGDRRGGGSAATALEDAGGVVEDIVNPALDAGALPHMLAEEDDAVSTMMMPFSPLL
                     PHHLPLNSSTAGAGDHIVRRGTPVGVYGSATPELAGEHGSQLHSGLLSYNLRSSKLLT
                     QKPSLVGRGPSKAGSSPPQLGGMPKKKLAAAKTKPAFVNKLWSMVNDPVNQSLIHWSH
                     DGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYGWHKVQDVKSGSIQSNSDDRW
                     EFANENFLRGREDLLANIIRQKSSAGSRDGAGMSVGAAHPNAVLVANGEEVDLGILFS
                     ELETVKYNQLAIAEDLKRISKDNELLWKENMLARERHQNQQQALEKIVKFLSSLYGSN
                     TTRLLSDHVFREPQQAVAAPQGYGVHSTASMSPLHMADPLDAAPSPDVTATPVHRPRL
                     LLKQRASPASDWPAQVQELRTSQVPSPVLQPLPARIHEIHPDAQLPADTPVLSPAVVD
                     QASFFNDLQDNLDKQGESIQEIQDWIDKLSPASPFSRFDPRDYLAAPGFPAPPPDAAD
                     PISPRPAYKRPSNHREETRSEDYSPASKKQRQLSARDPPT"
     gene            <283597..>284613
                     /locus_tag="AGOS_AFL084W"
                     /old_locus_tag="AFL084W"
                     /db_xref="GeneID:4621691"
     mRNA            <283597..>284613
                     /locus_tag="AGOS_AFL084W"
                     /old_locus_tag="AFL084W"
                     /product="AFL084Wp"
                     /transcript_id="NM_210818.2"
                     /db_xref="GeneID:4621691"
     CDS             283597..284613
                     /locus_tag="AGOS_AFL084W"
                     /old_locus_tag="AFL084W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL075C (MPS2)"
                     /codon_start=1
                     /product="AFL084Wp"
                     /protein_id="NP_985464.2"
                     /db_xref="GeneID:4621691"
                     /translation="MWREEAREQLRRGRCCFAAASVVSTAKHNKSLGNCTHGSGVMTE
                     AEGILNNVWDAVDSKQQGFIYAKDMPDLVGRFGQFLAQSLTSRANDEAIAAFASEKPF
                     YKLDKEQFKSTFQTLVGTSLQTAVELAGHGEPRPRLFGAIRRASATGDEQAREELERK
                     SAELSRVRDELDEWKSKYQFLEREFLFYQTHHENSVDSTQHEFIISEMKRTIEEQTRM
                     IGQLRRQVQGGTQVLARAGKRASPVDVFMYVSRQGLLLLMRMPKAAFLLLLLGYFVWY
                     TVMGGAVQGPDPSVALPEPPKQPWWEQNNIISALYWYLTDTFEPSQRINDTVNDNYNS
                     LFGL"
     gene            complement(<284734..>285495)
                     /locus_tag="AGOS_AFL083C"
                     /old_locus_tag="AFL083C"
                     /db_xref="GeneID:4621692"
     mRNA            complement(<284734..>285495)
                     /locus_tag="AGOS_AFL083C"
                     /old_locus_tag="AFL083C"
                     /product="AFL083Cp"
                     /transcript_id="NM_210819.1"
                     /db_xref="GeneID:4621692"
     CDS             complement(284734..285495)
                     /locus_tag="AGOS_AFL083C"
                     /old_locus_tag="AFL083C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL199C"
                     /codon_start=1
                     /product="AFL083Cp"
                     /protein_id="NP_985465.1"
                     /db_xref="GeneID:4621692"
                     /translation="MSVVLDRGAFLSQDRDYNHATDGEYKRLRDLADQAFKKRAELSH
                     QSQQAYKQGDGARAKELSEQAKRQLEAAERYNMQAAEYVFTSNNADSGSDEIDLHGLY
                     VKEAQWIMKKRIAAGVQSGEPRLRVIVGKGLHSANGVAKIRPAVEELCSEAGLRSYVD
                     SKNAGVLIVDLENANVPASWDTTPYSGQLQPSKPPAAHTGGQPQAGYQAPAQPQYQQQ
                     PAAGQAPGQGAQNGPENPLVAALLTFFCQTICKLK"
     gene            285797..285852
                     /locus_tag="AGOS_AgSNR39b"
                     /old_locus_tag="AgSNR39b"
                     /db_xref="GeneID:4621693"
     ncRNA           285797..285852
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR39b"
                     /old_locus_tag="AgSNR39b"
                     /product="AgSNR39b"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR39b; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149383.1"
                     /db_xref="GeneID:4621693"
     gene            <286109..>287321
                     /locus_tag="AGOS_AFL082W"
                     /old_locus_tag="AFL082W"
                     /db_xref="GeneID:4621694"
     mRNA            join(<286109..286116,286384..286477,286692..>287321)
                     /locus_tag="AGOS_AFL082W"
                     /old_locus_tag="AFL082W"
                     /product="60S ribosomal protein L7"
                     /transcript_id="NM_210820.1"
                     /db_xref="GeneID:4621694"
     CDS             join(286109..286116,286384..286477,286692..287321)
                     /locus_tag="AGOS_AFL082W"
                     /old_locus_tag="AFL082W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL076C (RPL7A) and YPL198W (RPL7B); 2-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="NP_985466.1"
                     /db_xref="GeneID:4621694"
                     /translation="MADKILTPESQLKKSKAQQKSAEQVAAERAARKAANKEKRAAIL
                     ERNAAYHKEYETAERAVIQAKREAKANGSYYVESQPKLVFVIRIKGINKIAPKPRKVL
                     QLLRLNQINSGVFVKVTKATTELLRLVEPYVAYGYPSYSTIRQLVYKRGYGKINKQRI
                     ALSENSIVEANLGKYGIISVDDLIHEIITVGPHFKQANNFLWPFKLSNPSGGWGVPRK
                     FKHFIQGGAFGNREEFINKLVKSMN"
     gene            286556..286630
                     /locus_tag="AGOS_AgSNR3959"
                     /old_locus_tag="AgSNR39_59"
                     /db_xref="GeneID:4621695"
     ncRNA           286556..286630
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR3959"
                     /old_locus_tag="AgSNR39_59"
                     /product="AgSNR39_59"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR39 and SNR59; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149382.1"
                     /db_xref="GeneID:4621695"
     gene            <287773..>289401
                     /locus_tag="AGOS_AFL081W"
                     /old_locus_tag="AFL081W"
                     /db_xref="GeneID:4621696"
     mRNA            <287773..>289401
                     /locus_tag="AGOS_AFL081W"
                     /old_locus_tag="AFL081W"
                     /product="AFL081Wp"
                     /transcript_id="NM_210821.1"
                     /db_xref="GeneID:4621696"
     CDS             287773..289401
                     /locus_tag="AGOS_AFL081W"
                     /old_locus_tag="AFL081W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL077C (HNM1)"
                     /codon_start=1
                     /product="AFL081Wp"
                     /protein_id="NP_985467.1"
                     /db_xref="GeneID:4621696"
                     /translation="MSLAERDSMDLVKRHPSGQCCEDGEKSNVGMTTCQVDEGQLLRK
                     SFSLWSVLGVGFGLTNSWFGISVSMITGIGSGGPMMIVYGIVIIALVSVCVGVSLAEL
                     SSAYPHAGGQFWWSLKLAPPKHRRLAAYLCGSLAWAGSVFTSASTTLSAATELVGMYA
                     LVRPEFVVRKWHVFVCYQILHCFLMLFNCYGRSLPLVSSSALYVSLFSFVTITITVVA
                     CSRGHFNDPKFVFATFRNETGWQNSAIAFIVGLINPAWSFSCLDCATHMAFEVEQPER
                     VIPIAILGTVAIGFLTSFCYVIAMFFSLRDLSEIMTSNTGVPILDIYYQALGSRAGAL
                     VLGSLVLLTSVGCIISSHTWQARLCWSFARDGGLPYSHLWARVNRSVGVPLNAHLMSC
                     VCISLLGILYMASSTAFNSLITGCIAFLLLSYIVPVICLLLKKRQIKHGPFWLGPFGA
                     FCNYVLLAWTVFVLIFFSLPPLKPVTKDNMNYVSVVVVGYILYVLIFWRLQGRWSFHL
                     VEEEEECTELEGEPQMTPEGSEEREMIPTTKISP"
     gene            <289639..>291246
                     /locus_tag="AGOS_AFL080W"
                     /old_locus_tag="AFL080W"
                     /db_xref="GeneID:4621697"
     mRNA            <289639..>291246
                     /locus_tag="AGOS_AFL080W"
                     /old_locus_tag="AFL080W"
                     /product="AFL080Wp"
                     /transcript_id="NM_210822.1"
                     /db_xref="GeneID:4621697"
     CDS             289639..291246
                     /locus_tag="AGOS_AFL080W"
                     /old_locus_tag="AFL080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL078C (DBP3)"
                     /codon_start=1
                     /product="AFL080Wp"
                     /protein_id="NP_985468.1"
                     /db_xref="GeneID:4621697"
                     /translation="MSKHELKDKKRKSVDGEDVSKSKKVKKDKKDKKDKKAKDGNDKV
                     KDKKDKNKKDKSKTDKNLKEVQETEAHTGSETAPVGDSTAAAGYVESKELASVPQADV
                     DTFFSENEVAVEDPESLGFRPLLSFSHLNLHSAIQKEISKFPKPTPIQAVSWPYLLAG
                     KDVIGVAETGSGKTFAFGVPAINSLMSEKSTPRGVKCLVISPTRELASQIYDNLVQLT
                     DKVGLNCCCVYGGVQKDSQREQLKKAQVVVATPGRLLDLIEEGSAKLAGVQYLVLDEA
                     DRMLEKGFEEDIKRIIKETKSDVRQTLMFTATWPKEVRELASTFMRAPVKVSIGNRDE
                     LSANKRITQVVEVIDPFKKEKRLLELLKQYQSGAKKNDKVLIFALYKKEASRVERNLK
                     YNGYNVAAIHGDLSQQQRTQALSEFKAGTANLLLATDVAARGLDIPNVKTVINLTFPL
                     TVEDYVHRIGRTGRAGATGVAHTLFTEQEKHLAGALVNVLNGAGQPVPEELMKFGTHT
                     KRKEHNAYGAFYKNVDLTKKAKKITFD"
     gene            <291568..>293184
                     /locus_tag="AGOS_AFL079W"
                     /old_locus_tag="AFL079W"
                     /db_xref="GeneID:4621698"
     mRNA            <291568..>293184
                     /locus_tag="AGOS_AFL079W"
                     /old_locus_tag="AFL079W"
                     /product="AFL079Wp"
                     /transcript_id="NM_210823.2"
                     /db_xref="GeneID:4621698"
     CDS             291568..293184
                     /locus_tag="AGOS_AFL079W"
                     /old_locus_tag="AFL079W"
                     /note="NOHBY604; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E19569g"
                     /codon_start=1
                     /product="AFL079Wp"
                     /protein_id="NP_985469.1"
                     /db_xref="GeneID:4621698"
                     /translation="MAVLSKSEVEERIANGEVIVIYKSAVLKLDKWIKYHPGGDKAIY
                     HMVGRDATDEMNAYHSDESVQQFMRWKIGHVEGEWKNLVPPIQRNACETSMQPGTPGD
                     EDTCYEDDACDAKVETMGQAYKNHVVVDPMQLSELFDEERAALDRKLFPSADSETQQR
                     ISAEYNKLHQELIDAGFYACPYWKYGVELLRISTLLGASYFTLIRLNWQIVSALLLGV
                     AWQQAVFIAHDAGHISITHNYQVDSVFGMLVSAWFGGLSLGWWKRNHNVHHLVTNDPE
                     HDPDIQHLPFFAVTSRLFTGLKSTYYERDLAFDLPARIFIPLQHILYYPILAFGRFNL
                     YVLSWTHLLGGKGPRHGQAAWFRYFELCGLVFFCYWFCYRLLACSLSTATDRVLYVLV
                     SHLTTMIVHVQITLSHFAMSTADLGVSESFPQRQLRTSMDVACPRWLDFFHGGLQFQV
                     IHHLFPRLPRHNLRDAQPYLLRFCERVGIKYSIYGFSHCNSMVLSHLEQIAQQARTVL
                     ACAHTMGPHKDVAMPAPGGDSRQYSNPKHA"
     gene            <293366..>294079
                     /locus_tag="AGOS_AFL078W"
                     /old_locus_tag="AFL078W"
                     /db_xref="GeneID:4621699"
     mRNA            <293366..>294079
                     /locus_tag="AGOS_AFL078W"
                     /old_locus_tag="AFL078W"
                     /product="AFL078Wp"
                     /transcript_id="NM_210824.2"
                     /db_xref="GeneID:4621699"
     CDS             293366..294079
                     /locus_tag="AGOS_AFL078W"
                     /old_locus_tag="AFL078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL196W (OXR1)"
                     /codon_start=1
                     /product="AFL078Wp"
                     /protein_id="NP_985470.2"
                     /db_xref="GeneID:4621699"
                     /translation="MDGWRSRFKRLHRTLSVGEEQCTPAIKLNSPDATLQTEACAPED
                     EGGLPPVQLCGYLSSTRDRLLTAELCAELRPLMPSRIQLYTKWCLLYSLEQHGASLHS
                     LYEHVRPEEPAKARVGYLLIMRDRRGGLFGAYANEPFRPTESRRYSGNGECFLWSADL
                     HPMLRLRAYPYTGLNEFCIYCTSGFLSMGAGSGHYGLWCDEGLVHGVSERSPTFGNDA
                     LSREGPRFHIVALEVWRVG"
     gene            complement(<294119..>294691)
                     /locus_tag="AGOS_AFL077C"
                     /old_locus_tag="AFL077C"
                     /db_xref="GeneID:4621700"
     mRNA            complement(<294119..>294691)
                     /locus_tag="AGOS_AFL077C"
                     /old_locus_tag="AFL077C"
                     /product="AFL077Cp"
                     /transcript_id="NM_210825.1"
                     /db_xref="GeneID:4621700"
     CDS             complement(294119..294691)
                     /locus_tag="AGOS_AFL077C"
                     /old_locus_tag="AFL077C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL079W (KXD1)"
                     /codon_start=1
                     /product="AFL077Cp"
                     /protein_id="NP_985471.1"
                     /db_xref="GeneID:4621700"
                     /translation="MSDDVDSETRSRTPSISSRQFIIPEDELATLDSENSSLDSGGEE
                     ASSGGSDAYSAAGGSTPVFSRLGQHPSTFFTGSQVAPIFDTSLYLFESLTQSLDSVDF
                     SEALSLQTKTSATINSKSRELQLLVGEVQTHLRRLQTAFEQGQHTAQRVRHNLRDITR
                     GVESLKQTFARSYPIEYHQALERAYERRAE"
     gene            <294832..>297531
                     /locus_tag="AGOS_AFL076W"
                     /old_locus_tag="AFL076W"
                     /db_xref="GeneID:4621701"
     mRNA            <294832..>297531
                     /locus_tag="AGOS_AFL076W"
                     /old_locus_tag="AFL076W"
                     /product="AFL076Wp"
                     /transcript_id="NM_210826.1"
                     /db_xref="GeneID:4621701"
     CDS             294832..297531
                     /locus_tag="AGOS_AFL076W"
                     /old_locus_tag="AFL076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL195W (APL5)"
                     /codon_start=1
                     /product="AFL076Wp"
                     /protein_id="NP_985472.1"
                     /db_xref="GeneID:4621701"
                     /translation="MSSLYAPTDEVKRRLRPFGLFFEKSLKDLIKGIRSQQSPEQLHE
                     FLTRVLSECREEVKHADFNMKTNAVLKLTYLEMYGFDMSWANFHVLEVMSSTRFQQKR
                     VGYLAASQSFYKDHDILMLATNLLRKDLKYSLSNETVRMGVALSGLSAMVTPELARDI
                     CEDLFLMLHSTKPYIRKKAVTALFKVFLQYPEGLRDNFEKFVDRLEDDDLSVVSATVS
                     VICELSKHNPQPFIQLSPILYQMLIKVDNNWVIIRLLKLFTNLAQIEPKLRVKILPNV
                     LELMDSTTAISVVYESINCIVKGNMLNSDDYDSAVACLDKLHDFCTSNDPNLRYLSCV
                     LFYKIGKINTDFIANFDVLILRLLVDVDVSIRSKTLELLEGIVTEDNLVDFVQRLLKQ
                     FVDVDKICVNDQEFSIDIPEYYKSKMIHAICKITAMKNYANVTDFEWYIALLSDLCIV
                     SQDLQDKTLAQKLGEQIRNIMVKVPDLRDRTLAQIVQLVKSEDITARLPGVLKECIWC
                     LGEYSSLLDNKDEYILLLAENSKLYEPELQQTLIPAILKIYSNWCNESVVDTGRIKWV
                     TERIITPLEDLIISKNFEVQERSSEALEFLRLCLDSLSEDASDSLPLLLTEVLPSFFN
                     AFELQPITSGTQRKLQQSISVDCDTPFLTESELEQLLADDTSVDGIVSPDVSDTESDS
                     EMYVPGAAPKDKGSSPTHELTTAELEAINERRKQERVGNPFYLDDADVGSVKKVDILD
                     NLSNSKPSSSGSLVRLSSESKAKEKKKKVKVRVISDAVIVDGVNTADVTDDRPSNTPS
                     ARNKIALQLKNKLDSFDFTKPRDEGDYDPDVDLQKLREKFAQQRLLDESAAAEEEVVV
                     VKKKKRSKDGSKSSKKKSRSKSKPSSKGGDTAEAELLPGLTTE"
     gene            <297725..>299356
                     /locus_tag="AGOS_AFL075W"
                     /old_locus_tag="AFL075W"
                     /db_xref="GeneID:4621702"
     mRNA            <297725..>299356
                     /locus_tag="AGOS_AFL075W"
                     /old_locus_tag="AFL075W"
                     /product="AFL075Wp"
                     /transcript_id="NM_210827.1"
                     /db_xref="GeneID:4621702"
     CDS             297725..299356
                     /locus_tag="AGOS_AFL075W"
                     /old_locus_tag="AFL075W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL194W (DDC1)"
                     /codon_start=1
                     /product="AFL075Wp"
                     /protein_id="NP_985473.1"
                     /db_xref="GeneID:4621702"
                     /translation="MSFRAVITSSEHQAVWSRLILTLSTINQDIKFTIMSNELILWSM
                     NSTDTTMYQVRLKASFFSEFSFDPGNIVFGEEGLQVIEDLQKQQHTLYSFVINGRHLS
                     ILSRKPEYDNIKEFSLSIDNSTAAPEAIINRLHIRVYTESLITKEFSPAFNPVKYDPI
                     VIDLKYKKKFLDVYGTEESVNGEQADPRLLDFFRQVRKQLEEAKFNEGIIDAPRPAEL
                     RSEHEINFLSMDSLIWRNAIDLCTNNTEELKLDLTMNKMVITAFTKGVQNMKSSDVLK
                     QAISISNSVSTEDVEHYCLFTTSGNPGMSKKDADSKQAVFKLRDFRNFFSANQAWKEN
                     ATVNCWFCSPGDPILFEIDRGHVKLSLVQITDTAGKAVGAAPDLAIHPVLVSPRKPVS
                     PLRAACTNTNAASNALHGVQLDAANMDAIKTLFVQDVEIGVSAAAMAHSPANRCTDEN
                     LRSMCSISQQGQHSCDGSPATNLRRVSRAGTTIAWGAGKDHVMCPDSDYGVAQDVNQL
                     KRRKVGELAHASQSPESQDYGLGPTQQYQPKGIFD"
     gene            complement(<299448..>299813)
                     /locus_tag="AGOS_AFL074C"
                     /old_locus_tag="AFL074C"
                     /db_xref="GeneID:4621703"
     mRNA            complement(<299448..>299813)
                     /locus_tag="AGOS_AFL074C"
                     /old_locus_tag="AFL074C"
                     /product="AFL074Cp"
                     /transcript_id="NM_210828.1"
                     /db_xref="GeneID:4621703"
     CDS             complement(299448..299813)
                     /locus_tag="AGOS_AFL074C"
                     /old_locus_tag="AFL074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL080W (FMP37)"
                     /codon_start=1
                     /product="AFL074Cp"
                     /protein_id="NP_985474.1"
                     /db_xref="GeneID:4621703"
                     /translation="MSQPVQRAAAQSLISKYVNKETLKYMLTTHFWGPVSNFGIPIAA
                     IYDLKKDPELISGPMTLALVVYSGIFMRYSMAVTPKNYLLFGCHFINESAQLGQAFRW
                     LKFNYFGEKPAVKGTEKTA"
     gene            <300152..>301159
                     /locus_tag="AGOS_AFL073W"
                     /old_locus_tag="AFL073W"
                     /db_xref="GeneID:4621704"
     mRNA            <300152..>301159
                     /locus_tag="AGOS_AFL073W"
                     /old_locus_tag="AFL073W"
                     /product="AFL073Wp"
                     /transcript_id="NM_210829.1"
                     /db_xref="GeneID:4621704"
     CDS             300152..301159
                     /locus_tag="AGOS_AFL073W"
                     /old_locus_tag="AFL073W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL193W (RSA1)"
                     /codon_start=1
                     /product="AFL073Wp"
                     /protein_id="NP_985475.1"
                     /db_xref="GeneID:4621704"
                     /translation="MQNTSGNLPKPTFSGTLDGPSTQRTRPWEQGSEQPYATQSYAAP
                     FPQQAPGYSNASLPLYGGASAAYAGQWQQPVLYTAQPYYQPPPPAGAPHLLPLEPYQT
                     SVVGGRKPDARRGGARQAAGRVRKAPRAAYSGEKRKASHGGAQGTTVTQAEGSGDEGD
                     EQAETGSEAGPTVDGAIAGTSIVLSTTEDIEKWRSERRKMWLLKISNQKEKHMEELGV
                     SEQELRCSPLVQGRKDKKFISGIQSHVMRFTSKQNLSVGLVQRTMAAENAKILGFIKE
                     LGDANLLEHVLTEKEKEALFGKAMRAAENRKQFAGRSFTSQNDGRGRPPTRQPAGGPT
                     N"
     gene            complement(<301212..>301571)
                     /locus_tag="AGOS_AFL072CA"
                     /db_xref="GeneID:9487581"
     mRNA            complement(<301212..>301571)
                     /locus_tag="AGOS_AFL072CA"
                     /product="AFL072C-Ap"
                     /transcript_id="NM_001355335.1"
                     /db_xref="GeneID:9487581"
     CDS             complement(301212..301571)
                     /locus_tag="AGOS_AFL072CA"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL192C (PRM3)"
                     /codon_start=1
                     /product="AFL072C-Ap"
                     /protein_id="NP_001342276.1"
                     /db_xref="GeneID:9487581"
                     /translation="MVDEPDTPPPQGVDALADPEVTLVHSRPQLQESKETRLDLLAEQ
                     NWETLEKITYVAPEKRPRVKGRIKKPSRRKKSKRRKSRHHQEQQQPASQDGLFHGLLL
                     GSFIGAALAEFVLAKFK"
     gene            complement(<301898..>302842)
                     /locus_tag="AGOS_AFL072C"
                     /old_locus_tag="AFL072C"
                     /db_xref="GeneID:4621705"
     mRNA            complement(<301898..>302842)
                     /locus_tag="AGOS_AFL072C"
                     /old_locus_tag="AFL072C"
                     /product="AFL072Cp"
                     /transcript_id="NM_210830.1"
                     /db_xref="GeneID:4621705"
     CDS             complement(301898..302842)
                     /locus_tag="AGOS_AFL072C"
                     /old_locus_tag="AFL072C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL081W"
                     /codon_start=1
                     /product="AFL072Cp"
                     /protein_id="NP_985476.1"
                     /db_xref="GeneID:4621705"
                     /translation="MEHFGSHEQRRLIFNINEGLAEVIGRASERDAERVARADNLFFA
                     ERSLSKQHAMLYVKRFTGPGGAQDGDEENIRIWVEDLGSTHGLVDLQSTARGVSQLID
                     LKNGERFGVVYMDKPITSTQSRGARLKFQVNVMQKQGPLWELLVRDVTFGDSPCITKG
                     SPLDGTDGSLTPYHTEPSSDWSYSEMWCGEDMCRIPSDVECSHHAHQKERNMLQSNYV
                     DLLQHQEELGVPSSAAESDFGSLDEPVKLLDEYEKGRPLLPEELHAGQQLGPSVGARA
                     PRGEKHQRARTIWSARSILFGTLFGFVIGFIFGAANLD"
     gene            complement(<303114..>304208)
                     /locus_tag="AGOS_AFL071C"
                     /old_locus_tag="AFL071C"
                     /db_xref="GeneID:4621706"
     mRNA            complement(<303114..>304208)
                     /locus_tag="AGOS_AFL071C"
                     /old_locus_tag="AFL071C"
                     /product="AFL071Cp"
                     /transcript_id="NM_210831.2"
                     /db_xref="GeneID:4621706"
     CDS             complement(303114..304208)
                     /locus_tag="AGOS_AFL071C"
                     /old_locus_tag="AFL071C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL082W and YPL191C"
                     /codon_start=1
                     /product="AFL071Cp"
                     /protein_id="NP_985477.2"
                     /db_xref="GeneID:4621706"
                     /translation="MSLTFATKGITVNGRPSRILLQNENGPCALIALSNVLLLSPNYA
                     ETTSQLRNLAQAPTVTLRDLVAVLADIAMQLGGDSHRDMDRMLELLPKLQTGLLIDPA
                     FNGTFREGDEMALFRMFQVGLVHTWLMDVSQAPQDYSRLSQCSYEEAQRLLVEAYDIQ
                     QGSVASEKADQLLQDAHILRSFLSRSATQMTSYGLQHLKRVLPEGAYAVLFRNDHFAT
                     ICKQEGELFILVTDLGYQYRHDIVWQSLSYPDGSEDTFYTGDFVPTRLEDDSSLFPDT
                     AAGEDPFADKNATFSAPSLPPDSAFLTDEELARHLQQEEDGLYVRSLQRQQERSHRRP
                     APDPPARNASRASRTKTKSKNTKRKICIIM"
     gene            complement(<304701..>306974)
                     /locus_tag="AGOS_AFL070C"
                     /old_locus_tag="AFL070C"
                     /db_xref="GeneID:4621707"
     mRNA            complement(<304701..>306974)
                     /locus_tag="AGOS_AFL070C"
                     /old_locus_tag="AFL070C"
                     /product="AFL070Cp"
                     /transcript_id="NM_210832.1"
                     /db_xref="GeneID:4621707"
     CDS             complement(304701..306974)
                     /locus_tag="AGOS_AFL070C"
                     /old_locus_tag="AFL070C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL190C (NAB3)"
                     /codon_start=1
                     /product="AFL070Cp"
                     /protein_id="NP_985478.1"
                     /db_xref="GeneID:4621707"
                     /translation="MSEDNDKLKAIMDALKKSQDFASDGAESDDKQDAAKEELGAESN
                     SEEDSNGSDLYREEETESAGEPMEAVIAAEDGLSVEEDEVSGLGGVEDSSENREDYDP
                     LKDDADDATRASDSGDDDMAATEKGREDTAVVVVPENDEKENKEGSSDGRRRDSKSGE
                     EQEVALQSREAVGSGGKEDDRVCNENIDRDLLQRQVQYVLDSDMLSLPEFQELSSREK
                     VVAIVTLLNSNGDTSMPSKGSSTGVSEAIKRRRFPPPDMSQAMTPEERQRYTEYLRGE
                     NRITEIEHFPPKSRLFIGNLPLKNVTKEDLFRIFSPYGHIFQINIKNAFGFIQYDNAQ
                     SVKDAIECESGTMNFGKKLILEVSSSNSRPQFDHGDHGTNSSSTFVTSSKRPFDEQGE
                     EEDMYSDNHYKKTKKRIPQCMILVKRTADRSYANEVFNIFRNGSGLETDMVFLKPRME
                     LRKLINDAAYDGVWGVILVNKTRNVDIQTFYKGPQGETKFDEYVSVSCEDSIAIFNNL
                     KTTRAGRTGSISPPVQQRAKLPPQQQQQPPPPPRQQQYYAGYAMPPQQPPYVAQPSIY
                     GAINPASQPPPPQRQQQQYASMQPYGAFPAQQLPIAAPPTHATAPMDQSQLLAAIQHL
                     PQNVLSSLLSMTQQQPNQQQQQQQLLGLIQQLQSGQQPQLQQPLPSNVGAPYAAFGSP
                     PQNANMLAGSPPPMPPQQQIPQPQQHQPPQPPQPQPPQPQPQPPHQKQPSVPQVQPQQ
                     AGSNVQSLLDSLAQLQK"
     gene            complement(<307397..>307573)
                     /locus_tag="AGOS_AFL069C"
                     /old_locus_tag="AFL069C"
                     /db_xref="GeneID:4621708"
     mRNA            complement(<307397..>307573)
                     /locus_tag="AGOS_AFL069C"
                     /old_locus_tag="AFL069C"
                     /product="AFL069Cp"
                     /transcript_id="NM_210833.1"
                     /db_xref="GeneID:4621708"
     CDS             complement(307397..307573)
                     /locus_tag="AGOS_AFL069C"
                     /old_locus_tag="AFL069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL189C-A (COA2)"
                     /codon_start=1
                     /product="AFL069Cp"
                     /protein_id="NP_985479.1"
                     /db_xref="GeneID:4621708"
                     /translation="MHLKAATRNRVTNKLFVTTFLVAFSSVALGSVLPCPAHSLDSDT
                     PVRERNEGARAAQE"
     gene            complement(<307843..>310185)
                     /locus_tag="AGOS_AFL068C"
                     /old_locus_tag="AFL068C"
                     /db_xref="GeneID:4621709"
     mRNA            complement(<307843..>310185)
                     /locus_tag="AGOS_AFL068C"
                     /old_locus_tag="AFL068C"
                     /product="AFL068Cp"
                     /transcript_id="NM_210834.1"
                     /db_xref="GeneID:4621709"
     CDS             complement(307843..310185)
                     /locus_tag="AGOS_AFL068C"
                     /old_locus_tag="AFL068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL083W (SCY1)"
                     /codon_start=1
                     /product="AFL068Cp"
                     /protein_id="NP_985480.1"
                     /db_xref="GeneID:4621709"
                     /translation="MGLWSTRSGISVNYSYSSSPTFTAEPWSVHTGRPRSSSSGSSRV
                     SVFIFDKRKFENYLLNYGVIQSRSSSADRQLISDAYDILRTQVNNMAKLKHPMLLGLV
                     APLEEHSKSFMFVTEYVSGCLLSIYQGHDSDQDLFSTESQDIIIQRGILQISHGLDFI
                     HNTASSVHLDLNPRTVFVNEHSDWKVFGLGHLFKLAAGTNTAEYFMPQYDSRVPSFMQ
                     LDLNYTAPEIVFENTVSPRSDYFSLGALVYFLYYGRNLFNCDNSTSNYRDEYSRFERK
                     LSQMSWESIFSKLPDKVRATIPRLMSRDLYARYEDINEFIASEFFEDPLIKTLVFLDD
                     LPTKSTEEKTVFLNGLAKLLPKFPAQLLQRKFLTALLQLLDQSSSSNEINSECLSQTL
                     HIIIQIGRSLSQLTFNEKVAPYLTSKHNFDILLKNASMCLISNLETLKEKLKSEVFCE
                     QMLKPLFAHALSSANDSAVELQCSALSKLHVALETLDFTSAKRSFFPLITELFVRTTS
                     LTVKVSCISSFLEMVKRRSIDKFTVLEELLPLVRSMKTRDSRVLVKFLDLFRVLPDFI
                     QDDEAFVQSILPIMWTFSMSKTLSPAQYSEFTEVLNNITQQIQRSHLQALHKNESHQK
                     KTSNFSKVIEKPASPPVEQPPAVATPVLQPKKPARPANKYNLLAKPNGGYGTASSADK
                     PTAKPSGGYGVASSTDKPAVKPLTLSKGMPLGTRRARGSPRIPQPAPQVPEDDFDAFV
                     SSSEHKPSPPKPSAAALPPGFSASLLQPSKRSSTPAAPGT"
     gene            complement(310402..310472)
                     /locus_tag="AGOS_t0131"
                     /db_xref="GeneID:4621710"
     tRNA            complement(310402..310472)
                     /locus_tag="AGOS_t0131"
                     /product="tRNA-Gly"
                     /codon_recognized="GGC"
                     /db_xref="GeneID:4621710"
     gene            <310646..>312382
                     /locus_tag="AGOS_AFL067W"
                     /old_locus_tag="AFL067W"
                     /db_xref="GeneID:4621711"
     mRNA            <310646..>312382
                     /locus_tag="AGOS_AFL067W"
                     /old_locus_tag="AFL067W"
                     /product="AFL067Wp"
                     /transcript_id="NM_210835.2"
                     /db_xref="GeneID:4621711"
     CDS             310646..312382
                     /locus_tag="AGOS_AFL067W"
                     /old_locus_tag="AFL067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL084C (GUP1) and YPL189W (GUP2)"
                     /codon_start=1
                     /product="AFL067Wp"
                     /protein_id="NP_985481.2"
                     /db_xref="GeneID:4621711"
                     /translation="MLHSLWDATLTCVSRLFSLEALDARLAPSNDPKIRQRITMQATP
                     SRWKTAEFKFYYAVFAIAVPLMFKAAVDATNAWNPNYKKIEPLLDQGWLFGRKVDNSD
                     SQYGFFRGNFALLFALAAGHLLTKRVALMLFPIQKLTFDLYFGLFFIVVAHGVNTFRV
                     LIHVVIMFAIARILRNQRKAATILCWVYGIGTLFFNSKYDTYPFGDVLPFLSFLDTAY
                     KGLIKRWDVFYNFTLLRILSHNLDYLEKWSDEPQQEASRSVSPSQEFDTFKDGKCPEL
                     LDERSRLTAPHPISDYNMANYLAYVAYTPLYIAGPILTFNDYLYQTRRTLPSITPSRT
                     FYYALNFLCCIMTMEVVLHFIYVVAAAKAKAWEGDTPFQLSMIGLFNLNIIWLKLLIP
                     WRFFRLWALIDGIDPPENMIRCVDNNYSTLAFWRAWHRSYNKWVVRYIYVPLGGSTNR
                     ILTSLAVFSFVAIWHDIELKLLVWGWLIVLFLLPEIVASSVLSAYSNRVWFRFLCSVG
                     AIVNIWMMMIANLVGFCLGTDGTITLLKDMFSTVKGISFFIVANGALFVGTQTMFEQR
                     EHEKRQGIYVKC"
     gene            complement(<312428..>313258)
                     /locus_tag="AGOS_AFL066C"
                     /old_locus_tag="AFL066C"
                     /db_xref="GeneID:4621712"
     mRNA            complement(<312428..>313258)
                     /locus_tag="AGOS_AFL066C"
                     /old_locus_tag="AFL066C"
                     /product="AFL066Cp"
                     /transcript_id="NM_210836.1"
                     /db_xref="GeneID:4621712"
     CDS             complement(312428..313258)
                     /locus_tag="AGOS_AFL066C"
                     /old_locus_tag="AFL066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL085W (LCL3)"
                     /codon_start=1
                     /product="AFL066Cp"
                     /protein_id="NP_985482.1"
                     /db_xref="GeneID:4621712"
                     /translation="MSDNSVATPAHLLQAKVIFLSFLLTGGFVATYSAFNRHLRQITS
                     VHDIPTNVFRRKYLYGKVTSVGDGDNFLFFHTPGGVLGGWHWLRKVPTLQRKGILPRR
                     AQKATGNALSTLSPLNLFRGLVGLRSEGGGRDQFALYRGRRKLPTLSIRLCGVDAPER
                     AHFGNSSQPLSEEAYKWLNKTLLGRFVWVKPLSTDQYGRCVAKVEYWSWFRWKNVSIE
                     LLKQGLGVVYESKSGAEFDGQDTLYRYHESKAKKSKRGVWGLRHFETPGAYKKRINKQ
                     "
     gene            complement(<313433..>315412)
                     /locus_tag="AGOS_AFL065C"
                     /old_locus_tag="AFL065C"
                     /db_xref="GeneID:4621713"
     mRNA            complement(<313433..>315412)
                     /locus_tag="AGOS_AFL065C"
                     /old_locus_tag="AFL065C"
                     /product="AFL065Cp"
                     /transcript_id="NM_210837.2"
                     /db_xref="GeneID:4621713"
     CDS             complement(313433..315412)
                     /locus_tag="AGOS_AFL065C"
                     /old_locus_tag="AFL065C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL086W (MAD1)"
                     /codon_start=1
                     /product="AFL065Cp"
                     /protein_id="NP_985483.2"
                     /db_xref="GeneID:4621713"
                     /translation="MSQTGDSSSFVEEPASPEARQRELERQVLGLEYRLRTEHSEAEM
                     ARLALERELAGMQGKYKQCMGELEAALADTRYLYEQNAALEARARAADEDAGGAAAAE
                     RAAAAEERARAAEARARELEEALQAARGEAAAAGRAAAGAAAGAAAAEQSGLLRKYEA
                     EIERQMGELRALAERLAEREDEVAGLKAQRVLQAHRSYSAEEVEELGVLRRTLQEQLA
                     LSKELERANLEQANELKRLRQRSESQQFLQLENSKLRARLEKTDALRQQLDDLQLENV
                     QLQEKLTKWEVYQADGSSPENVLHEMALAKQERLALVEQVGKLQLDLNNMKILNDELA
                     LERNQLLDLNKKYESSILNLKKLNYEIEQQKLLSFEECKLLRQQLDDLSEVDKDHTPD
                     TRDRKKIQTLVDTYKNQTEDLTNELKKLNEQLLERSDLDGNPRKRRKASDDLAFNYSQ
                     RLNELQLRNKDLERRLANSDENASLLEEKLRKLQSLNEKKIRILQLRNNPLLKDQFVK
                     QKQLTLLKQENLELAQQLDAQQGLEAVPRSVYERQQYDIQLLEDELFSINKRTTRLKE
                     MFNRKSLEFIDAVNSLLGFKLEFQVGGKVKMIPCFKTDRYLIADLQTNTLKSNLDKVM
                     PEWDAMLAEYVGKRQQLPCFLAKIMLLLAESSSSQ"
     gene            <315643..>316111
                     /locus_tag="AGOS_AFL064W"
                     /old_locus_tag="AFL064W"
                     /db_xref="GeneID:4621714"
     mRNA            join(<315643..315653,315706..>316111)
                     /locus_tag="AGOS_AFL064W"
                     /old_locus_tag="AFL064W"
                     /product="AFL064Wp"
                     /transcript_id="NM_210838.1"
                     /db_xref="GeneID:4621714"
     CDS             join(315643..315653,315706..316111)
                     /locus_tag="AGOS_AFL064W"
                     /old_locus_tag="AFL064W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL087C (MMS2); 1-intron"
                     /codon_start=1
                     /product="AFL064Wp"
                     /protein_id="NP_985484.1"
                     /db_xref="GeneID:4621714"
                     /translation="MSKVPRSFRLLEELEKGEKGMGPESCSYGLADGDDISMTHWNGT
                     ILGPPHSSHENRIYSVVIECGAEYPDRPPKVRFISRINLPCVDPSTGEVRPEAFHALR
                     DWKRSSNMETLLQDLRKEMASSANKKLPQPPEGSTF"
     gene            <316245..>317396
                     /locus_tag="AGOS_AFL063W"
                     /old_locus_tag="AFL063W"
                     /db_xref="GeneID:4621715"
     mRNA            <316245..>317396
                     /locus_tag="AGOS_AFL063W"
                     /old_locus_tag="AFL063W"
                     /product="AFL063Wp"
                     /transcript_id="NM_210839.1"
                     /db_xref="GeneID:4621715"
     CDS             316245..317396
                     /locus_tag="AGOS_AFL063W"
                     /old_locus_tag="AFL063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL188W (POS5)"
                     /codon_start=1
                     /product="AFL063Wp"
                     /protein_id="NP_985485.1"
                     /db_xref="GeneID:4621715"
                     /translation="MKKLQVWRSVPRPWGARGYAGLPRAGAEVRAASALGVSRAPSFP
                     CVPGSRLRALVWPQAPANVFVVKKPGSAETTAAAIELIRHMHAQYPGLNVMVAADTAE
                     ELRAGLCAAAPGCVLYTGTDSEIAARADLLLSLGGDGTILRAAGLFSEARVPPVLAFS
                     LGTLGFLLPFEFSEHAQALDDVLQSRAHCLQRSRLVCRVLRDGLPVDGRWAHAMNDVF
                     IHRGGAPHLAHLDIYVGKQFLTSTVADGVAVATPTGSTAYSLSAGGSIVSPQVPSILL
                     TPICPRSLSFRPVILPSTSLLRLVIGAKSAQDPAAIKLCMSVDGVSKPPLSVGDELHV
                     TDEVSTAHAPRDAGVYCVARSENDWTRGINELLGFNMGFRGGRRTHPPS"
     gene            complement(317424..317647)
                     /locus_tag="AGOS_AgSNR10"
                     /old_locus_tag="AgSNR10"
                     /db_xref="GeneID:4621716"
     ncRNA           complement(317424..317647)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR10"
                     /old_locus_tag="AgSNR10"
                     /product="AgSNR10"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR10; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149358.1"
                     /db_xref="GeneID:4621716"
     gene            <318116..>318463
                     /locus_tag="AGOS_AFL062W"
                     /old_locus_tag="AFL062W"
                     /db_xref="GeneID:4621717"
     mRNA            <318116..>318463
                     /locus_tag="AGOS_AFL062W"
                     /old_locus_tag="AFL062W"
                     /product="AFL062Wp"
                     /transcript_id="NM_210840.1"
                     /db_xref="GeneID:4621717"
     CDS             318116..318463
                     /locus_tag="AGOS_AFL062W"
                     /old_locus_tag="AFL062W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL187W (MF(ALPHA)1) and YGL089C (MF(ALPHA)2)"
                     /codon_start=1
                     /product="AFL062Wp"
                     /protein_id="NP_985486.1"
                     /db_xref="GeneID:4621717"
                     /translation="MKISLLFSVSALLGAVIAIPVNGSRPEVTIDDVRGNIPEDAVLG
                     FLDLSDVEGLAVRPIQTEERTGLLFVNRQLAEKGTEAASSQGSPKLEKDIARVYKRLM
                     EYGHRRIFPAIDL"
     gene            complement(<318880..>320529)
                     /locus_tag="AGOS_AFL061C"
                     /old_locus_tag="AFL061C"
                     /db_xref="GeneID:4621718"
     mRNA            complement(<318880..>320529)
                     /locus_tag="AGOS_AFL061C"
                     /old_locus_tag="AFL061C"
                     /product="AFL061Cp"
                     /transcript_id="NM_210841.2"
                     /db_xref="GeneID:4621718"
     CDS             complement(318880..320529)
                     /locus_tag="AGOS_AFL061C"
                     /old_locus_tag="AFL061C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL184C (MRN1)"
                     /codon_start=1
                     /product="AFL061Cp"
                     /protein_id="NP_985487.2"
                     /db_xref="GeneID:4621718"
                     /translation="MSYQEYQGLGFQHPSRMQSPLSETHSMTPTSDISISNRAQAWSD
                     PMYDQTWGTAGYGGNGAAYGLAQPPMGRYEASGLCSESSNGSGTVGESQAPPMGVLAQ
                     YAQVSHPMTLQSGQMNNPRDFTSAPSRTVYLGNVPPYITTKELLDHVRSGVVEEVKIL
                     PEKMCAFISFVEENSALLFHSDAILKRLNIDDRDIKIGWGKPTQIDPIVAAGITNDGA
                     TRNVYIGKLNTNKDICAQWGVDPNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVH
                     FSSIFAAIKVVANLANINPYYAQKKIFYGKDRCAFITKTQQHNAAQFLGIQPGMESFF
                     SNDRELISQTLLQQSAAAAAIATSAGGANNLGNRTIYLGNLPKDVKLEEICNSVRGGL
                     LQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLHGLTIHNKRCKIGWGKHSGPLPNPLA
                     LAVSRGASRNIYLGNIDFAADKKSQHPIFTEAALRAVFQEFGEVEQINFLYERNCCFI
                     NFANISSAILAIDKIKSIPTFKDLKINFGKDRCGNVPRQFC"
     gene            <321263..>322852
                     /locus_tag="AGOS_AFL060W"
                     /old_locus_tag="AFL060W"
                     /db_xref="GeneID:4621719"
     mRNA            <321263..>322852
                     /locus_tag="AGOS_AFL060W"
                     /old_locus_tag="AFL060W"
                     /product="AFL060Wp"
                     /transcript_id="NM_210842.2"
                     /db_xref="GeneID:4621719"
     CDS             321263..322852
                     /locus_tag="AGOS_AFL060W"
                     /old_locus_tag="AFL060W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL091C (NBP35)"
                     /codon_start=1
                     /product="AFL060Wp"
                     /protein_id="NP_985488.2"
                     /db_xref="GeneID:4621719"
                     /translation="MSPNGAGLELADPGGAGGQQAGGGAAGGSELAREGVCVGVCGVE
                     ARAQLCGATAQRPGRRCVRGGREAWRDGLEQRQRRTRGPGGEAGLFEQPGAVAAEYGP
                     VAVEHGVGGVVCGGEEVEGGGVAQPARGRGRCERDAWRCDAERGELVAELCVGREGLA
                     IGPEGDRKPGGHGLRGGRCRRRALLRKPRRFAVAHHMQTSAEMGGIIEAMPALAQDGY
                     ALEQAPPEHCPGPASENAGKGDACQGCANKDICESLPKGPDPDVALITQNLAPVRHKV
                     LVLSGKGGVGKSTFSAMLGWALSADEALQVGVMDLDICGPSLPHMLGCVNETVHESSV
                     GWTPVYVADNLAAMSIQFMLPEDDSAVIWRGAKKNALIKRFLKDVYWDELDYLVVDTP
                     PGTSDEHITINTLLKESGIDGALVVTTPQEVALLDVRKELDFCRKAGIRVLGLVENMS
                     GFVCPSCENESTIFKPTTGGGRALCEELGIKFLGAVPIDPRIGRCCDSGESFLDAYPD
                     SPASTAIMHVVEALRDAVGDV"
     gene            complement(<322932..>326888)
                     /locus_tag="AGOS_AFL059C"
                     /old_locus_tag="AFL059C"
                     /db_xref="GeneID:4621720"
     mRNA            complement(<322932..>326888)
                     /locus_tag="AGOS_AFL059C"
                     /old_locus_tag="AFL059C"
                     /product="AFL059Cp"
                     /transcript_id="NM_210843.1"
                     /db_xref="GeneID:4621720"
     CDS             complement(322932..326888)
                     /locus_tag="AGOS_AFL059C"
                     /old_locus_tag="AFL059C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL092W (NUP145)"
                     /codon_start=1
                     /product="AFL059Cp"
                     /protein_id="NP_985489.1"
                     /db_xref="GeneID:4621720"
                     /translation="MFGAASGGNSLFGGANASTPTPTPAPAGNLFNFNKKPGEGFAGA
                     GQNNVSTPSPAGDLLGAKSTTTGGLFGPKTEQKPAGGLFGQSSAAPNGTGGGGLFAST
                     GNSGSTQLGGLFGNSAAGGGGSLFGAGSAANNNASTSLGNLFGKPNDTAPAAGGGLFS
                     NRPNTATTNTVSSTNSLFSNNQGNGAQNNGGLFGAKPTGGLFGNSTAQPQSSLFGASS
                     SQNNQQQQQQTQQLSLLGSNPYGLNLTGVPVTTMPESITAAITSKKKNELPLVHEKKR
                     MFSTSSASNVLPLVSNQSTLISKLSSRLNSGKNGESTRGLFSPSRKVLSQGPLVAADN
                     TRDLNPPLNHPSSSIPSRPLLSLANRTDLSDMRKLKLDPHRSAAKKLRLLNGQSATTK
                     LKILDTNYQSQREESSEIFVSTKTDRQPLEEKCEVSSTTGIPESDNGCDGYWCSPSIE
                     QLQRLTPQQLSAIPNFVIGRKGYGSISFDLDVDLTAFSDDFKHALFGSVIMFNENKTV
                     EVYPDDSLKPPIGLGLNVPATITLERIYPIDKKTNQPITENSDLAKVQYFVKRLKSMR
                     DMEFISYNPYGGVWTFKVKHFSIWGLVNDSDVEIDDVELEAAREAEIKQRIVAIPKRP
                     GFGKQADSTVPGGFDQLVHIPSSVDIDMTQTSPDDYSLTSAPVDALLHDEAMTDLIEE
                     KPYEPSDVDEEDFEGLEAEPNLEVSSDWHQQLQLAADPYKSVFANSTSLNRVNKMDDV
                     IFNTFQKDMDEFKSIRRQRRLDSAPSFVRFNNDSTITMKTDKSTSGCTVTASPLPLQT
                     QRSSIDSVLKKSLIDSTIELRNNNYPIVKQFSLTFDDIAAAYKPIPAEYRIWKLASIL
                     FDPISVSKSRSHPDDAVKDVLVKKKQYELLCDWIINEINSEVGAKIASAGPLEKIFLY
                     LVKRDIIGATTAAIASNNNHLAVLVTLLGSNDPLVRELSTSHLSKIKKLGSSLDINII
                     KIYQLLTGSPFAESANSVISEGLSWLATLGLQIFYGDIDALSLRELIERGLEYSCKDQ
                     WPLNDISANILRLYCSDVTPDILVGNLKISSNNLDVRLSWFFIQILTRDDISPSLRDH
                     LTLQYVEQLKLNRMFGEALFIMCFINDDRLAKQQVDHLLSSQITFFSQDSNYELLTRL
                     RIPKSSYYAFLALLDKYNRNHLSEARNLLKAGHFQEAEKVVIVSVAPKLVLDGSAANL
                     QTLRQLLETFPAQQMETWTHGLGVFEKYLQIALDNNHNQELLSDLVRVLPVLATDFGS
                     HRELSVVCCVMSKLVCHIILENYRQALETPSFKDRLLALPLGQPETIYLKRALAST"
     gene            complement(<327354..>330044)
                     /locus_tag="AGOS_AFL058C"
                     /old_locus_tag="AFL058C"
                     /db_xref="GeneID:4621721"
     mRNA            complement(<327354..>330044)
                     /locus_tag="AGOS_AFL058C"
                     /old_locus_tag="AFL058C"
                     /product="AFL058Cp"
                     /transcript_id="NM_210844.1"
                     /db_xref="GeneID:4621721"
     CDS             complement(327354..330044)
                     /locus_tag="AGOS_AFL058C"
                     /old_locus_tag="AFL058C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL093W (SPC105)"
                     /codon_start=1
                     /product="AFL058Cp"
                     /protein_id="NP_985490.1"
                     /db_xref="GeneID:4621721"
                     /translation="MEPHKRYSLPPRSILKQKSNYDDDERTSDTLQISSQIQFPTHGL
                     TKDQLLNGNNTTSRINTTQLEAKLNRRVSFAPDVTLHKFDFIPEVPVKFREPRRKSSL
                     SVLEKSHDNDTMELTNPVTHAFDGLGRVEEPDAGYEAVFDKEVSMEITQLFTKHSARP
                     ESEAEGAEAGLGRAPVEETMELTNLHNLHGPLNTGTGDESMEMTDTHQAGPAPNEAEK
                     NDANNGAEEEEDGGDDAPTPATEESMEITGQQSVGRIPSSGSPSAKLSGVATARMVSM
                     DGDSMEITGLQQLSQAHEYREAPDATLTLSNVFEGPKHLNEQRAEETMDFTAFPKLNE
                     ALTIDSQVVTSTQEPPAYKALSTIKISPKRRKIAEGIYVSPVKPNPIEELFSDAERLS
                     PIPLPPEYSPSRQANSSNPVLSPADVPKLPHDNYAMKAVDQQPKEEPVEPISLQMFLD
                     TTGISFVIDLDGVQNYDPITFTYTDRIEDISTRQIYDALYLQIPLLEIYAFIVKELHR
                     RILDSQRLFQELEEQISNNPPPYLFRNYFESSDEVKQLMKEQIVLIKSFARLEAKKVW
                     FEWRCQHLKGIKSVLEENLSLVQTEYAEVVARLNEISDIKHRLQALEQSLRHELELLR
                     NGEKPMRVTTLADRLKIEKIKSELKANMIKLNNTANLEEQKEAISADINALRSQIKDV
                     REEISSLKSLVLKNKLHTAHDVSKLRLLFSQMQLFTGVSFRGLSGSELQLALNSTINV
                     SFDLTQVDNIKDIAVSYQTESQFERHISTLFINEARHAAPNAFTFVLAVQSKLQHIRN
                     VCMEYDRLQAIFPTRLVTVRDTDLIELTDLDAVRNAKVHYHIGIPDFVAAVTSADQKK
                     ITIRARVAYGKGVTQELLERHLLSRTKKPLPWFRQFQVVL"
     gene            <330294..>330536
                     /locus_tag="AGOS_AFL057W"
                     /old_locus_tag="AFL057W"
                     /db_xref="GeneID:4621722"
     mRNA            <330294..>330536
                     /locus_tag="AGOS_AFL057W"
                     /old_locus_tag="AFL057W"
                     /product="AFL057Wp"
                     /transcript_id="NM_210845.1"
                     /db_xref="GeneID:4621722"
     CDS             330294..330536
                     /locus_tag="AGOS_AFL057W"
                     /old_locus_tag="AFL057W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL183W-A (RTC6)"
                     /codon_start=1
                     /product="AFL057Wp"
                     /protein_id="NP_985491.1"
                     /db_xref="GeneID:4621722"
                     /translation="MFSTRICSLLARPFMVPIVPRFGSALLQKPLNGVVVPQFTRGFK
                     VRTSVKKFCAHCYIVRRKGRVYVYCKSNNKHKQRQG"
     gene            complement(<330647..>333577)
                     /locus_tag="AGOS_AFL056C"
                     /old_locus_tag="AFL056C"
                     /db_xref="GeneID:4621723"
     mRNA            complement(<330647..>333577)
                     /locus_tag="AGOS_AFL056C"
                     /old_locus_tag="AFL056C"
                     /product="AFL056Cp"
                     /transcript_id="NM_210846.1"
                     /db_xref="GeneID:4621723"
     CDS             complement(330647..333577)
                     /locus_tag="AGOS_AFL056C"
                     /old_locus_tag="AFL056C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL183C (RTT10)"
                     /codon_start=1
                     /product="AFL056Cp"
                     /protein_id="NP_985492.1"
                     /db_xref="GeneID:4621723"
                     /translation="MNMSLDKVNDIAPCTAVRILGDGRCLAGCGPEIYVYEYRGGVLL
                     NRCRVFQRNKVHGICVQDGWVIAYGDRSVSILELEDVMTRRNLKYHEYMTPEWVLGAA
                     FSADGRSCYLLTCYNSVLEMDLEMRVVRSINAGERSLLYSGSVKVVGDAVYVCAGTVM
                     GGVVVWELHTGAVVQRLEGHEGSIFCAVVSDDGRLVASCSDDRSIRVWSLETGEQVGI
                     AWGHTARIWDLRFLRVADKLVSVSEDCTCRVWAVGAERMQEEAVYDVHQTKSVWAVDV
                     QEDDMVAVTAGNDGRLRLVDLTRPGSRERPAIDLTTEGLYNMDHTTFKGFCWFERGPI
                     AITSCGKILQRRMLGRWECILADQRLAGYSVTRRERALGLAVIANASADVLVLRVDTH
                     EPLASKWHRVPEIGKCTNILVTRSGEDLLILAESPQPSDPLVCLRLESQTLAMKAQYV
                     FRKPAEFSTRALGVYEHYIIVGSRFSTVAVFDLDDPSYEFVLRKLLPGDTITAITHIS
                     GHLFAITDRDGHYNFVCFDFAKRAHRVVHSNKVQKGFLEGIIRNAKGDYITYGFKADS
                     FYMYNETKQYEIGTVLCGGANRQWDLVHRIDDSFLLCYIKAGDPYVCLVRDFPFSRVL
                     GNGLHGREIRDISIRSDEPYKNGYLFITGSEDTNIKLNCFDVDTGEIRTFWTLKEHVS
                     GLQRCEFINKRLFVSCSAREELFLWQVTDTFDIPYVHLLQKLPVSSSNPDLRIMDFSC
                     KFVNGTENFVIATVCSDSSIRLWYYDSEKNAFTLLVNGFYTQCCILNAELIVLQGRLY
                     LLVSATDGHLVVWDMAPVMPFAVEDQLQQLEGAAMAETKLPEPSVLLKVHQSGVKALG
                     VSVRKSEFVVYSGGDDNALAISIFSCSNDSALVAKIAAFNPSAATSTITSLSVVSEGS
                     YILTSSIDQILRVWSVARDQLQLHSQSYTTVADTGPTAVVASPSGTWALAGGAGLTLR
                     RLLP"
     gene            <333836..>337324
                     /locus_tag="AGOS_AFL055W"
                     /old_locus_tag="AFL055W"
                     /db_xref="GeneID:4621724"
     mRNA            <333836..>337324
                     /locus_tag="AGOS_AFL055W"
                     /old_locus_tag="AFL055W"
                     /product="AFL055Wp"
                     /transcript_id="NM_210847.2"
                     /db_xref="GeneID:4621724"
     CDS             333836..337324
                     /locus_tag="AGOS_AFL055W"
                     /old_locus_tag="AFL055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL094C (PAN2)"
                     /codon_start=1
                     /product="AFL055Wp"
                     /protein_id="NP_985493.2"
                     /db_xref="GeneID:4621724"
                     /translation="MNQWQLSYQSPVELTEHLRKSYWAYDAKEKSATKMAFDQDVNLI
                     WVGDTYGRVSSYDPSYSLYTRHTAHIGAEPVVELLSHKQGVLSLGGESLNFANRRSVT
                     KLHVTSADIAQLCDMRAMCYGSNSQNTVYCGGTNLASGLVAVDLVKGRLSNTVQYSSK
                     VKLMQSSNRLMAVARQNGMLDLLDPNSNTVVKTFSGHSCMVSSMDFRDHTLVTAGKSK
                     RFNMMYPDQFVNVYDLRIMKQLPPISFSKNTEYMGNGACYMVGADFVQLHPILPTVVV
                     IGSVTGAFDFVDLSNPTVRTQYCHPCQSVTQLQLSPSGDYIAFIEHDNNINMWSRSNG
                     MTGFTSTATTILEYPDYPDDGILAGATSIDDYSYPLSSVGLPYYNEKLLSAWHQTVFR
                     SDGTIPMKVPLPPKSSAASSSHTALSTSSDSRPNTARSGNPSSGGQKYRLLPYDRHKY
                     GHRNVAVPYRSLRERKKKLLITDEDGKDKQELMNYKPSNDREVPPAFTKLQMVYGRFG
                     VQDFDFKAFNKTRYSGLETDIDNVYTNAVLQMYRFVPEVYNFLVSCLKMENFSDNSLL
                     TELGSLYDMMVRANGEICRSSNFQEALASIPKSYLLGLITDSIDNALEPNTTVSGTSI
                     SDSDASGSSMTAKLESMVLGDDKTTISCHDNNDNSLTTPQKFNTFLLNRLLFEELQMK
                     INTTQSIVLEELLGIDVQVTTRSISPCANFTRRSDIIPVLTVTSPISNNIKYVNKKLN
                     NQTILPYIESSMSRLKHTKAMCEKCFKCETVESEKTVRNLPPLLSLNISLTSDEWATA
                     KTVRGWLTKEFYATISKDRPILKLQPTDLKTTNAIFKYELNGYVARICDYITEPHLVA
                     YSKIFDPTTRTYKWYMFNDFLVQEVDEEEALNISYWWKTPEIAIYSDAEELTKPFVPA
                     SFYTINYSILYRDHFANGMRESIKKEYRLLTAEEAPKPGSLVALDAEFVALSEDQVEI
                     SCKGTKTLIKPAKTALARVSVLRGEGDLAGVPFIDDYIVNTKHIEDYLTKYSGIEPGD
                     LDPDTSSKPLVTRRVVLRKIWLLLQLGCIFVGHGLYNDFRNINIHVPKEQTRDTALYY
                     LQGRRYLSLRYLAYALLDKDIQKGNHDSIEDAYTALVLYRKYLDLREKGIFETVLNRI
                     YEEGRASNYRVPGDLQ"
     gene            complement(<337610..>339664)
                     /locus_tag="AGOS_AFL054C"
                     /old_locus_tag="AFL054C"
                     /db_xref="GeneID:4621725"
     mRNA            complement(<337610..>339664)
                     /locus_tag="AGOS_AFL054C"
                     /old_locus_tag="AFL054C"
                     /product="AFL054Cp"
                     /transcript_id="NM_210848.2"
                     /db_xref="GeneID:4621725"
     CDS             complement(337610..339664)
                     /locus_tag="AGOS_AFL054C"
                     /old_locus_tag="AFL054C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL180W (TCO89)"
                     /codon_start=1
                     /product="AFL054Cp"
                     /protein_id="NP_985494.2"
                     /db_xref="GeneID:4621725"
                     /translation="MSSGACRGRSFRSEADMGGHGGHGGAAGHGGGKTRGKKLKQFST
                     RSRSKSNANFKGLVSLHRTSSHDGTYSRGDGEPSNGSMKRTRSYDSLSKRKALSMLSM
                     TALGRTETGADGRAGRGAHGRLVLQLHEQGGSSADEEVDYFSGEDLRDGGRWGAGDEA
                     EGDEAEGGAARAAPALPALPALPALPALPAGAGGSTQGLGRMQLSYKAPSSLRNKQLD
                     SNDEDRIEHSKDYGAGYGDCEVSKALHAGETIAESAHSLQRQGATAAEGRTEYPSTPR
                     RAEGPEQADRTGRPERTPEADGARAAEVAEQPGDGGKAGKSAVEAQEGNVHGDPDKDS
                     DHYAPDMILSQSTGVERHFNQTLSRQNSVASHAAMIDNSAYDTQHANHNRFNYINNDL
                     ASSLKSGELKAEEKPSKDFSTSISSLTSHLQGRAPNSRSGNRTNNLMALRTSQNALLR
                     GQQASFLGEHGLGQGQQRSGTQVPLNHFSQFLQSNDQNNESRTQQKLWLQRESSFLDV
                     SAQSATGSDALFLASNVEVRREFERISREYMSVRRFGNPLNDAMTRVVTQHKIDVKKH
                     NKSSSPMYDASNGSLFGSYQRNMKTFGELHPDIRNRDMEIRQILTSLWNEGTTEFNKD
                     SNPLSQKGPYLQQNPKVAAAPRSRTTGPTPHHNQRLINSLQPTTRAFNRRMETALNQQ
                     RL"
     gene            <340067..>341812
                     /locus_tag="AGOS_AFL053W"
                     /old_locus_tag="AFL053W"
                     /db_xref="GeneID:4621726"
     mRNA            <340067..>341812
                     /locus_tag="AGOS_AFL053W"
                     /old_locus_tag="AFL053W"
                     /product="AFL053Wp"
                     /transcript_id="NM_210849.2"
                     /db_xref="GeneID:4621726"
     CDS             340067..341812
                     /locus_tag="AGOS_AFL053W"
                     /old_locus_tag="AFL053W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL095C (VPS45)"
                     /codon_start=1
                     /product="AFL053Wp"
                     /protein_id="NP_985495.2"
                     /db_xref="GeneID:4621726"
                     /translation="MDLFKVADFYLERVVNWQNRATLSVVEQSRVRLLLLDKHTTAVI
                     SVVTTQSELLAREIYMIDRLENAERDVMRNLGCVCFVKPTEETIEWLLRELEEPRYGK
                     YQIFFSNTVSKTQLERLAERDDLEVVARVEEVFLDYGVVNADLFVLEQATPQLLAGPG
                     TWRPAGLDEVRRSVLAVLLSLKLNPRVVFEAGSELCARLARELQHEIDKNAKTLFDFP
                     ALDTAPVLLLLDRRHDPLTPLLQPWTYQSMIHEYIGIHGNLVDLSGVAELDEELKQVV
                     LSPKQDQFFRETMYLNFGDLGDRVKQYVAQYKSKTKSNSQINTIEDIKHFIEKYPEFK
                     KLSSNVSKHMAIVAELDHQLQKSDIWQLSEIEQNMSVHEDDNNDYHEMLKLLQSPTLD
                     SYYKLKLACIYSLKPNPVAQKLQQVAKLLSVSCSPREMAIFHKFREQFGAHVSQVRKS
                     PENDLISGLSKKFNKLNHNSADNVYMQHKPKLGAILADLAKGRLSQDIFSSTSGALPT
                     NKPVQDVVLFIVGGVTLDEARLVHQFNESSRRQEGSLRVVLGGNTLLRTRDFIDEFEQ
                     LYCSAGKETGLGDLL"
     gene            complement(<341883..>343238)
                     /locus_tag="AGOS_AFL052C"
                     /old_locus_tag="AFL052C"
                     /db_xref="GeneID:4621727"
     mRNA            complement(<341883..>343238)
                     /locus_tag="AGOS_AFL052C"
                     /old_locus_tag="AFL052C"
                     /product="AFL052Cp"
                     /transcript_id="NM_210850.1"
                     /db_xref="GeneID:4621727"
     CDS             complement(341883..343238)
                     /locus_tag="AGOS_AFL052C"
                     /old_locus_tag="AFL052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL181W (CTI6)"
                     /codon_start=1
                     /product="AFL052Cp"
                     /protein_id="NP_985496.1"
                     /db_xref="GeneID:4621727"
                     /translation="MTRAELKEPQSMDHALLHRKRARVHDDGQDGRVMDEEDEDEDVA
                     HEAEEDGDDDEEGETRCVCGELDPPDASGFFIQCESCSVWQHGYCVGIMEGESTPDKY
                     WCEQCRPEQHAVYTNDLGKRRSNYKPTQQRRRQSRRAKRGDRSADSASDADRQRRRYD
                     DELRPRSRDSGQYDDDARGPNSSAGSEQDERRLLNRKRATLSAREEKQYQLMLEAIRE
                     SRRTSQPEEVLKAEHKDLSDRELSGEDTSPTTATSSTSMGTLPPVTTKQEQGKGSSSE
                     ASRVLGSGPPVSSGSAGAMRKRTRGKSATSNSSSEEDGGRKRSRRGGTRKSAGSSMQR
                     VPPGSNSSVGGNNASTNGQEVGIGKPIKPRLPTQKTSISEMRRRIYAILEYLSRTQSQ
                     LTDGELGKEQLIQFVENDDFICKINTIFQDYSKSLKLMDSLTRKLLLWEQKYASEGPA
                     T"
     gene            <344000..>345607
                     /locus_tag="AGOS_AFL051W"
                     /old_locus_tag="AFL051W"
                     /db_xref="GeneID:4621728"
     mRNA            <344000..>345607
                     /locus_tag="AGOS_AFL051W"
                     /old_locus_tag="AFL051W"
                     /product="AFL051Wp"
                     /transcript_id="NM_210851.1"
                     /db_xref="GeneID:4621728"
     CDS             344000..345607
                     /locus_tag="AGOS_AFL051W"
                     /old_locus_tag="AFL051W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL179W (PPQ1)"
                     /codon_start=1
                     /product="AFL051Wp"
                     /protein_id="NP_985497.1"
                     /db_xref="GeneID:4621728"
                     /translation="MGNSPSKDSPYAFQSTTQQAGAGSQQQSSLADENPNEPNDPDDS
                     RLTPTHTKNISISKPRNSHVITSGVSAVAPTSVRRSPYYDLKIDVNMARALQPVSTSS
                     DSFSSSSSSSSAASSSSTASSSTSLCAKPGETAAVPGHCGYGREHGFLSLKSSLSSSS
                     DTALSSINVSGGGSLPTIAEERENSHIIARNSKATSAPSYSHMAKKSRIANPRSETPI
                     VLKRNPHDPYNNDKLNIDDAIEKLLYIGDSRSYHSRDFPFHSWEVQLICATVREIFLE
                     QPSLLRLQAPIKIVGDVHGQFTDLLRILKLSGVPDETNYLFLGDYVDRGKQSLETILL
                     LLCYKIKYPDRFFMLRGNHESASVTKMYGFYDECKRRMSTKTWKQFVDVFNTLPFAAI
                     VQDKIFCVHGGISPQLSNMRQIEKIARPTDIPEEGLLTDLLWSDPDPAVSDWSLNDRG
                     VSYTFGKRNVYDFCANFKFDLIIRGHMVVEDGYEFFAKKKFVTIFSAPNYCGQFQNWG
                     AVMSVTTGMMCSFELLKPHGLKDTRRK"
     gene            complement(345945..346016)
                     /locus_tag="AGOS_t0132"
                     /db_xref="GeneID:4621729"
     tRNA            complement(345945..346016)
                     /locus_tag="AGOS_t0132"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4621729"
     gene            <347055..>347711
                     /locus_tag="AGOS_AFL050W"
                     /old_locus_tag="AFL050W"
                     /db_xref="GeneID:4621730"
     mRNA            <347055..>347711
                     /locus_tag="AGOS_AFL050W"
                     /old_locus_tag="AFL050W"
                     /product="AFL050Wp"
                     /transcript_id="NM_210852.1"
                     /db_xref="GeneID:4621730"
     CDS             347055..347711
                     /locus_tag="AGOS_AFL050W"
                     /old_locus_tag="AFL050W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL178W (CBC2)"
                     /codon_start=1
                     /product="AFL050Wp"
                     /protein_id="NP_985498.1"
                     /db_xref="GeneID:4621730"
                     /translation="MSLAEFDELRWDHSCDRLDVPSNYLKRKARKTPGGLEELRKSMT
                     SATIYVGNLSFYTSEEQLYELFSKCGSIEKIIMGLDRFKFTPCGFCFIIYQTPQEALA
                     ALKYLSKTKLDDREITIDLDPGFEEGRQFGRGKNGGQVSDELRFEFDASRGGFYVPLE
                     NRIGAVNHFGARRIRDPHKNHHHHHHGHHHHHGQPHAAAAKVNPMEVEEELDSYIPGQ
                     "
     gene            complement(<347977..>348750)
                     /locus_tag="AGOS_AFL049C"
                     /old_locus_tag="AFL049C"
                     /db_xref="GeneID:4621731"
     mRNA            complement(<347977..>348750)
                     /locus_tag="AGOS_AFL049C"
                     /old_locus_tag="AFL049C"
                     /product="AFL049Cp"
                     /transcript_id="NM_210853.1"
                     /db_xref="GeneID:4621731"
     CDS             complement(347977..348750)
                     /locus_tag="AGOS_AFL049C"
                     /old_locus_tag="AFL049C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPL177C (CUP9) and YGL096W (TOS8)"
                     /codon_start=1
                     /product="AFL049Cp"
                     /protein_id="NP_985499.1"
                     /db_xref="GeneID:4621731"
                     /translation="MPGNPIKLPSIHHILNIVDVVDTEQYPYGEQPVGYAHGHSPRAV
                     APGLNEFGAAPPAEAPVFFGRMRSPSLPQIRPWPQPPPRHHSISHFLSPVEGAPAAPA
                     TEPFTVYGRDDQQEPAPDGTKGKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPS
                     PQEKKELLKQTGLNPVQLSNWFINVRRRKIFQNYYKLSKSYSGNITAQSPSEPSSDQG
                     EISRSDSELDKRFSIMPLTRRKKLIDRLEDLKNLSGTNA"
     gene            <350866..>352353
                     /locus_tag="AGOS_AFL048W"
                     /old_locus_tag="AFL048W"
                     /db_xref="GeneID:4621732"
     mRNA            <350866..>352353
                     /locus_tag="AGOS_AFL048W"
                     /old_locus_tag="AFL048W"
                     /product="AFL048Wp"
                     /transcript_id="NM_210854.2"
                     /db_xref="GeneID:4621732"
     CDS             350866..352353
                     /locus_tag="AGOS_AFL048W"
                     /old_locus_tag="AFL048W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR250W (SPO23)"
                     /codon_start=1
                     /product="AFL048Wp"
                     /protein_id="NP_985500.2"
                     /db_xref="GeneID:4621732"
                     /translation="MPIKKSILSSSRTEPYYAPCNQELSGTKCKVIQLKNLKCRGTLI
                     KHKTPVPPILVFNSLNFENNPLMDVHDSANLRVQLVLSHDTCYLPGIFTQQESLATTT
                     ASARSSADDEMLLQSKSVFAGYVHITVKGQSGVLFQDLKVQLSGYSSEFVCLTQFGEK
                     VVRLLKDLTSDSCSHLRPMIQDTIHFKPKLTLLSPGTYTYPFNFVLDPYHFHASIGTH
                     LGSTQYRMELTCTIMRQKAQYETIFLSRPFAVKKTLPPGNLLRYDCVESQGTWRDGLL
                     DYKIYLSTKLLEFDQPFQFHLHLVKGEAHQIEVQTIEVILEQNMLIPCVKKKDLHKPV
                     AKAKSYMATNMFLLAKHSVTSKHDIQHILQFPDLLVSSSKQSIVMGKSLHPYYCEMSD
                     TFGADRCKLKITHVLKAQVSLRLHDGGKVTNMLICLKLPVLLVDKDMSSGLHLPPYRE
                     SCSASAKDTLSTLCPTMSDDSRLCSSPPTYAELFDSAYPPAESSS"
     gene            <353030..>354124
                     /locus_tag="AGOS_AFL047W"
                     /old_locus_tag="AFL047W"
                     /db_xref="GeneID:4621733"
     mRNA            <353030..>354124
                     /locus_tag="AGOS_AFL047W"
                     /old_locus_tag="AFL047W"
                     /product="AFL047Wp"
                     /transcript_id="NM_210855.1"
                     /db_xref="GeneID:4621733"
     CDS             353030..354124
                     /locus_tag="AGOS_AFL047W"
                     /old_locus_tag="AFL047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR249C (ARO4)"
                     /codon_start=1
                     /product="AFL047Wp"
                     /protein_id="NP_985501.1"
                     /db_xref="GeneID:4621733"
                     /translation="MTSFPMFAADADQAEDVRILGYDPLVSPALLQSQIPATQACLET
                     AQKGRREAIDIITGKDDRVLVVVGPCSIHDLDAAQEYAQRLKKLAEELEGDLVVVMRA
                     YLEKPRTTVGWKGLINDPDVNNTFNINKGLQAARQLFVNLTSIGVPIGSEMLDTISPQ
                     YLTDLLSFGAIGARTTESQLHRELASGLSFPIGFKNGTDGSLDVALDAVKASSHSHHF
                     MGVTKHGVAAITTTKGNEHCFVILRGGKRGTNYDATSVAEAKAKLPPTGVLMIDYSHG
                     NSNKDFRNQPKVNEVVSEQIANGEDKIVGVMIESNINEGSQKIPPEGKAGLKYGVSIT
                     DGCISWETTEEVLRKLAGAVRKRRDLRKTK"
     gene            <354394..>356043
                     /locus_tag="AGOS_AFL046W"
                     /old_locus_tag="AFL046W"
                     /db_xref="GeneID:4621734"
     mRNA            <354394..>356043
                     /locus_tag="AGOS_AFL046W"
                     /old_locus_tag="AFL046W"
                     /product="AFL046Wp"
                     /transcript_id="NM_210856.1"
                     /db_xref="GeneID:4621734"
     CDS             354394..356043
                     /locus_tag="AGOS_AFL046W"
                     /old_locus_tag="AFL046W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR248C (HIS7)"
                     /codon_start=1
                     /product="AFL046Wp"
                     /protein_id="NP_985502.1"
                     /db_xref="GeneID:4621734"
                     /translation="MVQVVHIVDVESGNLQSITNAIEHLGYEVKLIRSGADPELDKAE
                     TLILPGVGNFGHFTRNMRARGFVDAISSYIASGRPLMGICVGLQVLFRSSEEDPGAEG
                     LALVDMSLSRFRDESKPVPEIGWNTLQLDGDQFFGLDPCGRYYFVHSYAAMLANGAGR
                     LREQGWRVATARYGDERFVAALARGNLFATQFHPEKSGKLGLQLLANFLKQQHPSIDR
                     GSQDIELLTNDYSNYGLTRRIIACLDVRANDEGDLVVTKGDQYDVRDKQESGAIRNLG
                     KPVELAQLYYEQGADEITFLNITSFKDCPLRDAPMLEVLRLAAKTTFVPLTVGGGIRD
                     IVDPDGTRISALDVAGLYFRSGADKVSIGTDAVYAAERYYEAGTRGDGSSPIETISKA
                     YGSQAVVISVDPKRVYVDSPDDTPNKTIESKYPNSKGQRWCWYQCTLKGGRECSKIGV
                     WELVRACEALGAGEILLNCIDRDGTNVGYDLELLKLVKYAVKIPVVASSGAGKPEHFQ
                     EAFLETGVDACLGAGIFHRGEYTVREVKDHLSRNGLKVRLI"
     gene            complement(<356222..>357682)
                     /locus_tag="AGOS_AFL045C"
                     /old_locus_tag="AFL045C"
                     /db_xref="GeneID:4621735"
     mRNA            complement(<356222..>357682)
                     /locus_tag="AGOS_AFL045C"
                     /old_locus_tag="AFL045C"
                     /product="AFL045Cp"
                     /transcript_id="NM_210857.2"
                     /db_xref="GeneID:4621735"
     CDS             complement(356222..357682)
                     /locus_tag="AGOS_AFL045C"
                     /old_locus_tag="AFL045C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL097W (SRM1)"
                     /codon_start=1
                     /product="AFL045Cp"
                     /protein_id="NP_985503.1"
                     /db_xref="GeneID:4621735"
                     /translation="MESVKMQKRGSSPMSSPRKKRKHLVSTLNKHYKSINKLDDYRQL
                     YISDSRMDIFVWGTGSMCELGLGPLAKNKEVKRPRLNPLLQREKAGIVSFAVGGMHCL
                     ALDSDNNVWSWGTNDSGALGRDTSGAAEQLRDMDAAESSDDEDGDLNELEATPTMLPR
                     DSLPLDTQKVVQLAATDNLSCVLFENGDVYAWGTFRCNEGILGFYQDAIESQRSPWKL
                     PSFSGSRIVQMAPGKDHILFLDEHGVVYAWGNGQQYQLGRKIMERSRLRTLDPRAFGL
                     DGVKYIASGENHSFALADDGRLFAWGLNQFGQCGISNEVEDGAMVTVPTEVLLPPDVK
                     VESIAAGEHHSIVLTQDGDLYTFGRLDMFEVGISAEDYPESTYKDVHGKARSVPVPTK
                     LKGLPKFKAIAAGSHHSLAVARNGIIYSWGFGETYAVGLGPAGEDVEVPTRIKNTATQ
                     HESIVFVGCGGQFSVAGGIELSDEEAEKRAKEMGDE"
     gene            <358144..>359520
                     /locus_tag="AGOS_AFL044W"
                     /old_locus_tag="AFL044W"
                     /db_xref="GeneID:4621736"
     mRNA            <358144..>359520
                     /locus_tag="AGOS_AFL044W"
                     /old_locus_tag="AFL044W"
                     /product="AFL044Wp"
                     /transcript_id="NM_210858.2"
                     /db_xref="GeneID:4621736"
     CDS             358144..359520
                     /locus_tag="AGOS_AFL044W"
                     /old_locus_tag="AFL044W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR247C (ENP1)"
                     /codon_start=1
                     /product="AFL044Wp"
                     /protein_id="NP_985504.2"
                     /db_xref="GeneID:4621736"
                     /translation="MGRATIGRTKKQRHDPLLQDLASQHGKLRKQANAQTEETEEQDE
                     EYVDAQASRKILQLAREQQEELEEEDQARAQSETMNRFRVADYGLAKDSDEEEMAEEI
                     SDFEPEEELEEEVVEIDEEDAAMFEQYFKRSSDFNSANGTYILADKIMAAIREKEMEM
                     KVKAQAAQAGDAGMPSEGVALPERVIRAYTTVGSILKTWTHGKLPKLFKVIPSLNNWE
                     DVLYVTNPEAWSPHVVYEATKLFVSNLSAKGAQKFINMVLLERFRENIETSEDHSLNY
                     HIYRALKKSLYKPAAFFKGFLFPLVETGCNVREATIAASVLARVSVPALHSSAALTYL
                     LRLPFNPATTVFIKVLLEKKYALPYQTVDECVFYFMRFRAVDDGSTGEDATRVLPVVW
                     HKAFLSFAQRYKNDITQDQRDFLLETVRQRGHRDIGPEIRRELLAGKSREFVSDVGNT
                     ADLMIDVQ"
     gene            complement(<359619..>360383)
                     /locus_tag="AGOS_AFL043C"
                     /old_locus_tag="AFL043C"
                     /db_xref="GeneID:4621737"
     mRNA            complement(<359619..>360383)
                     /locus_tag="AGOS_AFL043C"
                     /old_locus_tag="AFL043C"
                     /product="AFL043Cp"
                     /transcript_id="NM_210859.2"
                     /db_xref="GeneID:4621737"
     CDS             complement(359619..360383)
                     /locus_tag="AGOS_AFL043C"
                     /old_locus_tag="AFL043C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL098W (USE1)"
                     /codon_start=1
                     /product="AFL043Cp"
                     /protein_id="NP_985505.2"
                     /db_xref="GeneID:4621737"
                     /translation="MSEVETAETASIADRLRAQYASLPVDSDSVLDYVLVSKLATNLA
                     CIREQTVARELQDGSGSEDYDKELGKLELDTLHKLYRYRKGLISLYNEQKEAKARRRY
                     SVDFDSADPRLDEESEAIGDTGQLNGDDDSLQQLRQRLIGGQEGKEDREALEKQMQVQ
                     DDVQRELVSDMAQLVTSLRRGAEAFQNALAEDSTVLRATELGLQATSQSLSTLGTKLK
                     KYNRSRVGFFFYMGCAFFIIMSLLVTYLIIRIFPKM"
     gene            complement(360613..361005)
                     /locus_tag="AGOS_AgSNR82"
                     /old_locus_tag="AgSNR82"
                     /db_xref="GeneID:4621738"
     ncRNA           complement(360613..361005)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR82"
                     /old_locus_tag="AgSNR82"
                     /product="AgSNR82"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR82 (RUF2); start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149429.1"
                     /db_xref="GeneID:4621738"
     gene            complement(<361030..>362955)
                     /locus_tag="AGOS_AFL042C"
                     /old_locus_tag="AFL042C"
                     /db_xref="GeneID:4621739"
     mRNA            complement(<361030..>362955)
                     /locus_tag="AGOS_AFL042C"
                     /old_locus_tag="AFL042C"
                     /product="AFL042Cp"
                     /transcript_id="NM_210860.2"
                     /db_xref="GeneID:4621739"
     CDS             complement(361030..362955)
                     /locus_tag="AGOS_AFL042C"
                     /old_locus_tag="AFL042C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL099W (LSG1)"
                     /codon_start=1
                     /product="AFL042Cp"
                     /protein_id="NP_985506.2"
                     /db_xref="GeneID:4621739"
                     /translation="MPLKKEPVKKWKQPVGPKPIQRKNKNTIGLGKAIQNARSKENAI
                     EYLPDGEMRFTVDKHEANWVKLRSVTQESSLDAFLSTAELAEKDFTADRHSNVKIIRM
                     DAGADVATSHGIMLSNQQRAALNEKQRAHSAELIVPRRPYWDEEMTRFELERQEKEAF
                     LNWRRKLATLQEENDDLLLTPFERNIEVWRQLWRVVERSDLVVQIVDARDPLLFRSTD
                     LEEYVKELDERKQNLLLVNKADLLTTKQRIIWAKYFIAKGIAFTFFSARRANELLELQ
                     KELGEDYVQREEQDEPVAMVDGETVDAEVLERIRILKIEELEDLFLSKAPSEPLQEPR
                     PGHEPLIQIGLVGYPNVGKSSTINALVGAKKVSVSSTPGKTKHFQTIKLSDRVMLCDC
                     PGLVFPNFAYNKGELVCNGVLPIDQLRDYIGPSTLVAERIPKYFLEAVYGIHIETRSE
                     EEGGGEHPSAQELLVAYARARGYMTQGFGSADEPRAARYILKDYVNGKLLYINPPPHL
                     EDDTPYTREECKEFNKALYTLQNLPESRREQLLEAAKNKGITSLDLARDLSKLTFSSH
                     IGGDSLTQAKSVTHGGKQAALYNAAKDLDREFFQLNGIQGKLTKPFHQANAQQGNGKK
                     HNKKNKKGKKKAAMFSD"
     gene            complement(<363155..>364264)
                     /locus_tag="AGOS_AFL041C"
                     /old_locus_tag="AFL041C"
                     /db_xref="GeneID:4621740"
     mRNA            complement(<363155..>364264)
                     /locus_tag="AGOS_AFL041C"
                     /old_locus_tag="AFL041C"
                     /product="AFL041Cp"
                     /transcript_id="NM_210861.1"
                     /db_xref="GeneID:4621740"
     CDS             complement(363155..364264)
                     /locus_tag="AGOS_AFL041C"
                     /old_locus_tag="AFL041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR246W (RRT2)"
                     /codon_start=1
                     /product="AFL041Cp"
                     /protein_id="NP_985507.1"
                     /db_xref="GeneID:4621740"
                     /translation="MQEITVLERARSEFPPCAVRIMDGGYVVVGTYELDKTSGARHGS
                     IEVYDGGLQLVGRTATYGAVLDLKASPFDKETLVSAHSTGNVMVWRMAEGVLAAVANL
                     QLFGCDSVVTSVNFSTQEPGLLVVTTAGGAVATVDVETGAPDVRYASAAKVYEKADLK
                     EYDVQGKREVAADLSRGVREFSRGHSVECWIGEFGALSPLENVVFSGGDDCAVHAYDV
                     RTGGLIWANSAVHGGGVVALRPSTPSFRPHMPTALLTGSYDDRIRSLDLRMMGNTLCP
                     GNVRPLAVSELDLGGGVWRFVESPSNALAAETNELLVCCMYDGARIVAVDGHDFTVKN
                     VLKEGHESMCYGADWCDQFAVTCSFYDKSLQLWKP"
     gene            <364593..>367853
                     /locus_tag="AGOS_AFL040W"
                     /old_locus_tag="AFL040W"
                     /db_xref="GeneID:4621741"
     mRNA            <364593..>367853
                     /locus_tag="AGOS_AFL040W"
                     /old_locus_tag="AFL040W"
                     /product="AFL040Wp"
                     /transcript_id="NM_210862.1"
                     /db_xref="GeneID:4621741"
     CDS             364593..367853
                     /locus_tag="AGOS_AFL040W"
                     /old_locus_tag="AFL040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR245C (ISW1)"
                     /codon_start=1
                     /product="AFL040Wp"
                     /protein_id="NP_985508.1"
                     /db_xref="GeneID:4621741"
                     /translation="MENQEYAEKLRPFQEGLGHKPDAVETRARYLVGGGQNRRRFDTE
                     GTTKRFQHLLGLSPLFRHFIERKAAKDERFGQVLRVLDDGRQAGRHEDKRRRKTEREE
                     DAELLREEDAELLREEEEGPDAAAADYEFQFRESPGFVDGRLRPYQVQGVNWLVSLHK
                     NNLAGILADEMGLGKTLQTITFLGYLRYIEKKRGPFLVIAPKSTLNNWQREINRWTPD
                     VDAFILQGDKEERARLCQERLLACNFDVAIASYEIIIREKASFKKIDWEYIVIDEAHR
                     IKNEESMLSQVLREFSSRNRLLITGTPLQNNLHELWALLNFLLPDIFSDSAAFDEWFS
                     SEASDDDKDKIVKQLHTILQPFLLRRIKSDVETSLLPKKELNLYVGMSSMQRKWYKQI
                     LEKDLDAVNGSNGSKESKTRLLNIMMQLRKCCNHPYLFDGAEPGPPYTTDEHLVYNSA
                     KLKVLDKLLKKLKEDGSRVLIFSQMSRLLDILEDYCYFRGYEYCRIDGSTAHEDRIEA
                     IDEYNAPDSRKFIFLLTTRAGGLGINLTTADVVVLYDSDWNPQADLQAMDRAHRIGQK
                     KQVKVFRLVTDNSVEEKILERATQKLRLDQLVIQQGRTSISKKENAKDAKDALLSMIQ
                     HGAVDMFRSTDTSNASSAKGTPQPETGDKDDEVDLESLLNKSENKTKSLNEKYAALGL
                     DQLQKFNQDSAYEWDGQNFKKKLTKDIINPLWIEPTKRERKENYSIDNYYKGVLNTGG
                     ARPNQAAVPRMPKPQPFNSHQLLPPQLKILYEKERMWMAKRTKYTPTMEDVKTTYGDI
                     ESEEERASKLELLKIAVANAQPLTEEEEKNKAEWEREGFHNWNKLEFRRFITASGKYG
                     RNSIKAITAELGGTKTEEEVRAYAEAFWTHLERIEDYEKYVKAIETEEEKLKRVKMQQ
                     EALRRKISQCTNPLFDLSLKHPPSSNNKRTFSEEEDRFILIMLFKYGLDRENVYELIR
                     DEIRDCPLFELDFYFQSRTPAELQRRAFTLLQCLEKEFSTGVVLDDAMKARMKEEDTA
                     AEKLRAEEAKRIKEEEDAEKERESPMPVHVDAVADPVAEVPTANEDGPEAKKPRIE"
     gene            complement(<368010..>368657)
                     /locus_tag="AGOS_AFL039C"
                     /old_locus_tag="AFL039C"
                     /db_xref="GeneID:4621742"
     mRNA            complement(<368010..>368657)
                     /locus_tag="AGOS_AFL039C"
                     /old_locus_tag="AFL039C"
                     /product="AFL039Cp"
                     /transcript_id="NM_210863.1"
                     /db_xref="GeneID:4621742"
     CDS             complement(368010..368657)
                     /locus_tag="AGOS_AFL039C"
                     /old_locus_tag="AFL039C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIR037W (HYR1) and Syntenic homolog of Saccharomyces
                     cerevisiae YBR244W (GPX2)"
                     /codon_start=1
                     /product="AFL039Cp"
                     /protein_id="NP_985509.1"
                     /db_xref="GeneID:4621742"
                     /translation="MIRIGSRLTPSLRHYTSSSQRITKFTMSGFYDLSPLDAKGEPFP
                     FSQLKGKVVIIVNVASKCGFTPQYEELEELYKKYKDQGFEVIGFPCNQFAHQEPATNE
                     EIVQFCKLNYGVTFPVLKKVDVNGADADPVYVYLKSQKSGLLGFKGIKWNFEKFLVDR
                     KGQVKDRYSSITKPLSLEKTIETLLKEEGGPAPTATTEATATATADAAKPSGESL"
     gene            complement(<369012..>370004)
                     /locus_tag="AGOS_AFL038C"
                     /old_locus_tag="AFL038C"
                     /db_xref="GeneID:4621743"
     mRNA            complement(<369012..>370004)
                     /locus_tag="AGOS_AFL038C"
                     /old_locus_tag="AFL038C"
                     /product="AFL038Cp"
                     /transcript_id="NM_210864.2"
                     /db_xref="GeneID:4621743"
     CDS             complement(369012..370004)
                     /locus_tag="AGOS_AFL038C"
                     /old_locus_tag="AFL038C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL100W (SEH1)"
                     /codon_start=1
                     /product="AFL038Cp"
                     /protein_id="NP_985510.1"
                     /db_xref="GeneID:4621743"
                     /translation="MKPFTTGHEDLVHDICYDFYGRHVATCSSDQHIKVFRLDKDTNE
                     WTLSDSWKGHDSSVVALDWASPEYGRILASVSYNKTIKVWEEDPDAPEGSGRRWTRLC
                     TLNDATGPLYSVKFAPGHLGLRLGAIGNDGVLRIYDALEPSDLRSWTLTSEVKVLATP
                     PASHLQSDFSLDWCPSRFSAERLVVCALDQAFVYERNKAGKLFQAARLPGHQGLIRSV
                     SWAPSFGRWHQLIATGSKDGRVRIFQLTEKLDATDDASTDDASTDDAGPAPHISVQLL
                     SEHADHKGEVWSVSWNLTGTILSSSGDDGKVRLWKSSFSNEFKCMSVICAQKKK"
     gene            <370180..>371544
                     /locus_tag="AGOS_AFL037W"
                     /old_locus_tag="AFL037W"
                     /db_xref="GeneID:4621744"
     mRNA            <370180..>371544
                     /locus_tag="AGOS_AFL037W"
                     /old_locus_tag="AFL037W"
                     /product="AFL037Wp"
                     /transcript_id="NM_210865.1"
                     /db_xref="GeneID:4621744"
     CDS             370180..371544
                     /locus_tag="AGOS_AFL037W"
                     /old_locus_tag="AFL037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR243C (ALG7)"
                     /codon_start=1
                     /product="AFL037Wp"
                     /protein_id="NP_985511.1"
                     /db_xref="GeneID:4621744"
                     /translation="MAVIRVCALLAIAGTAIVYSKYSSAVWSAAGFAIIGYLATNTLI
                     PRVADSFIRVGLYGKDLGKPGRPVIAETMGAVAATVYLFMMFLSIPFVFYKYLVVTSG
                     AGARDWSEEAAGRGAFPHGKLSEYLSAILSLQSTVLLGVADDLFDLRWRHKLYFPIIS
                     AIPLLVVYYADFGVTYVLVPKFVHQWVPQLSEFALIDLGWFYYIYMASMTIFCTNSIN
                     ILAGINGLEVLQSIILAIVCLVNDALYLVWGSERTRESHLFSIVMLLPFLGVSYSLWK
                     WNSWPARVFVGDTYCYFAGMIFAMIGILGHFAKTMMLFFTPQIFNFAYSIPQLLGLVP
                     CPRHRLPRFNEEDGLMYTSRTDLQKRPPMRPVALALKLLAYLHLLDVTVDEQGNLLDC
                     NNMTLINLCLVWFGPMREDQLCLTVCGIQLVVGLLCVFARHAVGTLLFGEDNYTRIIK
                     YIRT"
     gene            complement(<371575..>372216)
                     /locus_tag="AGOS_AFL036C"
                     /old_locus_tag="AFL036C"
                     /db_xref="GeneID:4621745"
     mRNA            complement(<371575..>372216)
                     /locus_tag="AGOS_AFL036C"
                     /old_locus_tag="AFL036C"
                     /product="AFL036Cp"
                     /transcript_id="NM_210866.2"
                     /db_xref="GeneID:4621745"
     CDS             complement(371575..372216)
                     /locus_tag="AGOS_AFL036C"
                     /old_locus_tag="AFL036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL101W and YBR242W"
                     /codon_start=1
                     /product="AFL036Cp"
                     /protein_id="NP_985512.2"
                     /db_xref="GeneID:4621745"
                     /translation="MPATWTPEEHIPAEIKALLAEPSPNYVLTFLHIVELLKTQRRTG
                     WVDHGILPCESISDHMYRMGITSMLIKDPAVDRNRCVRIALVHDLAESLVGDITPVAE
                     VTKEEKHRREWETIQYLCQQLIAPYNPVAADEIMRDWLAYENTDCLEARYTKDIDKFE
                     MLVQCFEYERRHGGTKNLQQFWSAVDSIKTDEVRSWVQDLQARRNRFFESLAH"
     gene            complement(<372377..>373031)
                     /locus_tag="AGOS_AFL035C"
                     /old_locus_tag="AFL035C"
                     /db_xref="GeneID:4621746"
     mRNA            complement(join(<372377..372777,372983..>373031))
                     /locus_tag="AGOS_AFL035C"
                     /old_locus_tag="AFL035C"
                     /product="60S ribosomal protein L28"
                     /transcript_id="NM_210867.1"
                     /db_xref="GeneID:4621746"
     CDS             complement(join(372377..372777,372983..373031))
                     /locus_tag="AGOS_AFL035C"
                     /old_locus_tag="AFL035C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL103W (RPL28); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L28"
                     /protein_id="NP_985513.1"
                     /db_xref="GeneID:4621746"
                     /translation="MPTRLTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGMHHHRTN
                     LDKYHPGYFGKVGMRYFHKQKNHFWRPVLNLDKLWTLVPEEKREQYLSSASKSAAPVI
                     DTLAAGYGKVLGKGRIPNVPVIVKARFVSKLAEEKIKAAGGVIELIA"
     gene            <373258..>374682
                     /locus_tag="AGOS_AFL034W"
                     /old_locus_tag="AFL034W"
                     /db_xref="GeneID:4621747"
     mRNA            <373258..>374682
                     /locus_tag="AGOS_AFL034W"
                     /old_locus_tag="AFL034W"
                     /product="AFL034Wp"
                     /transcript_id="NM_210868.2"
                     /db_xref="GeneID:4621747"
     CDS             373258..374682
                     /locus_tag="AGOS_AFL034W"
                     /old_locus_tag="AFL034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR241C and YGL104C (VPS73)"
                     /codon_start=1
                     /product="AFL034Wp"
                     /protein_id="NP_985514.2"
                     /db_xref="GeneID:4621747"
                     /translation="MSQDQLLLGSERPPRGSVTPALAGSVFVVCLGALQFGYHMAELN
                     APQEVLMCHGPLDPGYADTWWGRHGWEQCLHLDDSQYGLVTSIFSVGGLLGSLCTGSQ
                     ADRYGRRAAAIGSSVLAAAGSAAMVFANSYAQLLLGRLVAGVGCGGGIVVTSLMLNEM
                     APAELKGALGALNQTCINLGILVTQLLAFAWANSVQWRLLFAVSAAVAVAHCGLLLGV
                     EESPRWLAANGHEQRAERALRWLRADDAAAAHELREWRRAREHEAAAQCSSLRRYIAD
                     ARYAHVRRVVAVLLMGQQFCGINSIVFYGVKLINGALPGLSIAVNFGISAVNLVVTLT
                     AAALVDRVGRRPLLQCSAAAMAVASTLMAAGILLESAAVLVVCTFAYITFFALGFGPI
                     PFLIIAELSSPGTAAVAQSYGLALNWVATFFVGFGFPVLNQLIGGYVFMLFGAFAAFM
                     ALYVRNRVPETRGKHDYREVWQGF"
     gene            <374916..>376064
                     /locus_tag="AGOS_AFL033W"
                     /old_locus_tag="AFL033W"
                     /db_xref="GeneID:4621748"
     mRNA            <374916..>376064
                     /locus_tag="AGOS_AFL033W"
                     /old_locus_tag="AFL033W"
                     /product="AFL033Wp"
                     /transcript_id="NM_210869.1"
                     /db_xref="GeneID:4621748"
     CDS             374916..376064
                     /locus_tag="AGOS_AFL033W"
                     /old_locus_tag="AFL033W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR240C (THI2)"
                     /codon_start=1
                     /product="AFL033Wp"
                     /protein_id="NP_985515.1"
                     /db_xref="GeneID:4621748"
                     /translation="MFPDRNERHRAGARKPRIRCFTGCWACRFKKRRCDEGVPFCALC
                     VKHGDACSYDVRLVWLEENMLLVSRTDGQMRSCAVRAPAARRGLSKSEFQTLAQYRRR
                     QAGLSLAAQDDATQSSFTISLRRLKVYDNAVEAIHGRPRRYEAGHVVRRLEQCLQQIE
                     AGPPGSAGPYGAFPLRPADIAREAAVGRRALAEKFFAHHWWPLISACDNVVLHNVAYA
                     QWIAAHVSAVAHDTQDFPTDIFEAIALRSINLPRWLTRLRGASVPEQVVCYMLLSLLL
                     SAQELHASVLRLLRGLRPLPLAACALIANLDMHPAAKQLLFAQVSPADVLEKQLAASV
                     ASEMAAQRATPGGSGAQPRCIEPDYSSTYLCKRPRPCAPDLANDSTFS"
     gene            complement(<376057..>377172)
                     /locus_tag="AGOS_AFL032C"
                     /old_locus_tag="AFL032C"
                     /db_xref="GeneID:4621749"
     mRNA            complement(<376057..>377172)
                     /locus_tag="AGOS_AFL032C"
                     /old_locus_tag="AFL032C"
                     /product="AFL032Cp"
                     /transcript_id="NM_210870.1"
                     /db_xref="GeneID:4621749"
     CDS             complement(376057..377172)
                     /locus_tag="AGOS_AFL032C"
                     /old_locus_tag="AFL032C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL105W (ARC1)"
                     /codon_start=1
                     /product="AFL032Cp"
                     /protein_id="NP_985516.1"
                     /db_xref="GeneID:4621749"
                     /translation="MPDLVSKFESLSLTVPERGPEQAAYEAQWRSVLQTGQVQAKLGE
                     LNLFLRDHSFVAGTERPLRVDAELFEAVLPVTREVLAASKDVREQCGKHRHVIRWAKY
                     LQELLDVPEAERVLVDEAMELPREVIEKKKKEAKGEVAAAPAGGKGKAEDKAEGKAAR
                     GKPDEATLARLREEAKAKKAAKKAAGAQQQQQQAAAPAKTSPGMIDFRVGFIQKAIKH
                     PDADALYVSTIDLGEPEGPRTVCSGLAKHIPLEEMQQRHVVVVCNLKPVNMRGIKSAA
                     MVLCGSSDGKVELVIPPANSAAGDKVFFEGYGDEEPLKQLNPKKKIWEQEQPHFTTTA
                     DLEVAYKDDSDAVPLRKLTNARGETFKVSSLAHAHVS"
     gene            <377592..>379145
                     /locus_tag="AGOS_AFL031W"
                     /old_locus_tag="AFL031W"
                     /db_xref="GeneID:4621750"
     mRNA            <377592..>379145
                     /locus_tag="AGOS_AFL031W"
                     /old_locus_tag="AFL031W"
                     /product="AFL031Wp"
                     /transcript_id="NM_210871.2"
                     /db_xref="GeneID:4621750"
     CDS             377592..379145
                     /locus_tag="AGOS_AFL031W"
                     /old_locus_tag="AFL031W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR239C (ERT1)"
                     /codon_start=1
                     /product="AFL031Wp"
                     /protein_id="NP_985517.2"
                     /db_xref="GeneID:4621750"
                     /translation="MMTVHRDKAAKRKKTNVACVNCSRSHVTCESQRPCTRCVKKGLE
                     MSCVNAPRKRRKYLADVPEDQLPIPLKPADADAGPGMSERDGAAESGSKGPEHQFQDQ
                     GKIVHKPKFLSNAANLEYSTLSDIIHQDTLLNKIPVSLLYNGTDSPTPPSEALSGTHS
                     ASHGADVAGSRLSERPVHNVLNSMSSSRFVLRGLLGPQTDSILSSNVDLFKVHFPLVP
                     QAVADGTLDFKRHSQGSMVAKKLRYDKSINQYYLSPACALPEVPNPNKHLCNGTVSFS
                     LESRAPDEHQVLYRSDWPHSLRYGTPMEIYTLISEPFCHTSGFHSLLKYLHSRFHRHD
                     LVEMCRSIAEFRPIFIASAVDLTEEDMIFMEQSYQRTLLEYDRFITQIGTPTCVWRRN
                     GQISYLNDEFCLLTGWTREELLSKMTFIVELLDDNSVREYFKTFSKVAYKDFKGFEQM
                     ETCVLLSPIEGRTIECSCMWTWKRDVFGMPMMIVGHFLPVIAHPEPRDTDRLADSDFC
                     ISAGEGNPI"
     gene            complement(<379246..>379674)
                     /locus_tag="AGOS_AFL030C"
                     /old_locus_tag="AFL030C"
                     /db_xref="GeneID:4621751"
     mRNA            complement(<379246..>379674)
                     /locus_tag="AGOS_AFL030C"
                     /old_locus_tag="AFL030C"
                     /product="AFL030Cp"
                     /transcript_id="NM_210872.1"
                     /db_xref="GeneID:4621751"
     CDS             complement(379246..379674)
                     /locus_tag="AGOS_AFL030C"
                     /old_locus_tag="AFL030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL106W (MLC1)"
                     /codon_start=1
                     /product="AFL030Cp"
                     /protein_id="NP_985518.1"
                     /db_xref="GeneID:4621751"
                     /translation="MSRINKDIFTLFDKQAKGSISKSQLGDYLRAIGYNPTNALIQEI
                     GSRLPEQLTLDDIASVEQSHAKVLEATTEGRLEDFVKAFQVFDKENTGKVTVGDIRYM
                     LTGLGERLTDDEVDELMKGVEVDSEGGVDYKKFIEDVLRQ"
     gene            <384489..>386492
                     /locus_tag="AGOS_AFL029W"
                     /old_locus_tag="AFL029W"
                     /db_xref="GeneID:4621752"
     mRNA            <384489..>386492
                     /locus_tag="AGOS_AFL029W"
                     /old_locus_tag="AFL029W"
                     /product="AFL029Wp"
                     /transcript_id="NM_210873.1"
                     /db_xref="GeneID:4621752"
     CDS             384489..386492
                     /locus_tag="AGOS_AFL029W"
                     /old_locus_tag="AFL029W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR238C and YGL107C (RMD9)"
                     /codon_start=1
                     /product="AFL029Wp"
                     /protein_id="NP_985519.1"
                     /db_xref="GeneID:4621752"
                     /translation="MFRFVQQSQLRKAWVPNQLVSASRNSLHAQNSLRFNSAAAVERT
                     AETVGGGANGYGGSGDAGAPLDRAVNKVRSMRRGFKLGKSFPKPPSPESPWYHKVCAF
                     DEYVASSLNAGNETGSAGWAKSQRATMFWDSITKAMNLYRELLLSQELTQARVSRLLS
                     LLHLALKINRSNMTGLNKKPDYDSQSFHKTMTNYLYASFKEISQDVLNGQVTVAHVGA
                     FHLLESFRELLLAEEAVLLWRTATASEKPGLVAPFMHPDPVGIMLPLLHEGGMTFEEV
                     SALYEKCKKGQNPTALHCLTLGMIKVCLSAGANAEAVGLFQEICSLPGNSVSKATLTG
                     IHLAFIGECKDLQLATVFFNRALSGETPYKMNIHVSSVKQLLQNIWDQTEDFEQVFDV
                     WRRASNYYVGLSSQGIFSSLNSKFFEIFFQKYRNDKVAGMQHLMEIITGYNEIRSVDE
                     PFLNIILTKCVVWKDLEIIENIEESYQIYQLSKSIVSCRILLKAMGCVEVSNEQIYSR
                     WLRLVQKADQIGQTYIANADWAALRDATVGYIHQNQKEEHADSPENLATSYPDYNPAL
                     EAANASGAFDSDLPFGEHGNAIKKHIIATDDRSELYFRMVKKFGQYCRDSKQLVRITR
                     GITESYPFTKEYSDNFMSMDVSDIQMPKLVNLRSKSQLFASYF"
     gene            <386889..>387323
                     /locus_tag="AGOS_AFL028W"
                     /old_locus_tag="AFL028W"
                     /db_xref="GeneID:4621753"
     mRNA            <386889..>387323
                     /locus_tag="AGOS_AFL028W"
                     /old_locus_tag="AFL028W"
                     /product="AFL028Wp"
                     /transcript_id="NM_210874.2"
                     /db_xref="GeneID:4621753"
     CDS             386889..387323
                     /locus_tag="AGOS_AFL028W"
                     /old_locus_tag="AFL028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL108C"
                     /codon_start=1
                     /product="AFL028Wp"
                     /protein_id="NP_985520.2"
                     /db_xref="GeneID:4621753"
                     /translation="MGLIGKKSSQRPKPKLVRVKEVKEEPPIPSIRDPKPKKAIAKRP
                     TRPPPTEREKLLLRYLNSHKEQQLQRTKTYLKKRTLQERKDMERQLTLKQREGIRTIE
                     MIQKTQDRFLVEGATWNKYLESVAAARRAEERRSRQLGVFQD"
     gene            complement(<387429..>389996)
                     /locus_tag="AGOS_AFL027C"
                     /old_locus_tag="AFL027C"
                     /db_xref="GeneID:4621754"
     mRNA            complement(<387429..>389996)
                     /locus_tag="AGOS_AFL027C"
                     /old_locus_tag="AFL027C"
                     /product="AFL027Cp"
                     /transcript_id="NM_210875.2"
                     /db_xref="GeneID:4621754"
     CDS             complement(387429..389996)
                     /locus_tag="AGOS_AFL027C"
                     /old_locus_tag="AFL027C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR237W (PRP5)"
                     /codon_start=1
                     /product="AFL027Cp"
                     /protein_id="NP_985521.2"
                     /db_xref="GeneID:4621754"
                     /translation="MEPNTPAIDPKKERLARWKQKKQQQDMLRQKSGASSKSSHDQAE
                     DGDAARSTQPFEGLDKMAERRKRLELWKKKKKEQDEQKWKGDDAGQESATDIPVKGKA
                     APAEDAKAVPRGRKSRKGADPEKRQIWDDSDDELEAPKLKLFKPGSTIQTETPPDEDP
                     EDTLDTYMNTIQEKNEVQLLAPREVFDQEDDETTAFDYNRTDNGTGSEFMRLAKLKAK
                     KQLKPVIYSADELKPFIKNFYQEPEEISKLSEEEVADLRLSLDNVQVRGRDCPRPILK
                     WSQLGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPL
                     LRQIKAQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELK
                     RQINDIKRGVEIVIATPGRFIDLLSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVN
                     QIMKCIRPDKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSN
                     EEDKFKSLIHWLALTQQNLNDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYT
                     ERAWNLKCFKETANGILICTEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGS
                     NKGTALTLLMNTELAASYILMKSMRDEELNKHHDATVSTLKQMSEKFNKGLKTGEYRL
                     VKGFGGKGLDHLGKVYEEKHTEERNQLALEAGLAATEVSVSAPDGGLGDESTSVSIPK
                     LDYTVKKRSNPDGTSTYFAHVQVNDLPQIVRWEATKYTTLSSIKHETGCSITNKGRYY
                     PSGQGPQGPSDEPRLYLLVESATDQDISLAIDLLESKVRDGVRKSNMQEIRSNKYTI"
     gene            <390191..>391483
                     /locus_tag="AGOS_AFL026W"
                     /old_locus_tag="AFL026W"
                     /db_xref="GeneID:4621755"
     mRNA            <390191..>391483
                     /locus_tag="AGOS_AFL026W"
                     /old_locus_tag="AFL026W"
                     /product="AFL026Wp"
                     /transcript_id="NM_210876.1"
                     /db_xref="GeneID:4621755"
     CDS             390191..391483
                     /locus_tag="AGOS_AFL026W"
                     /old_locus_tag="AFL026W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR236C (ABD1)"
                     /codon_start=1
                     /product="AFL026Wp"
                     /protein_id="NP_985522.1"
                     /db_xref="GeneID:4621755"
                     /translation="MALRPEKPVWMSQEQYDRQYGKLEEPKPPREESKPGDQAKPSAE
                     PKSGSEEKTEGSSSSTGQGEERPHFKIQKRRHQNYDLEERKKKQQLNKLREEQLKQHD
                     IEMAANKVVNVDQIVREHYNERTFHAKRYNRNYSPIIKLRNFNNAIKYMLIDKYTRPR
                     DVVLELGCGKGGDLRKYGACEISQFIGIDISNESIREAQRRYLNMRDLDYQVILITGD
                     CFGESLGVAVQPFPECRFPCDVVSTQFCLHYAFETEEKARRAILNVSKSLKVGGFFFG
                     TIPDAEFIRYKLNKFSKEVERPSWGNSIYKVVFANNSYQLNDYEFETPYGNMYTYWLE
                     DAIDNVPEYVIPFETLRNLCDEYGMELEMQKPFNKFFVEEIPQWMNKFSPRLREGLQR
                     SDGKYGVEGDEKEAASYFYTVFAFRKVKDYVENAPAHA"
     gene            complement(<391581..>394901)
                     /locus_tag="AGOS_AFL025C"
                     /old_locus_tag="AFL025C"
                     /db_xref="GeneID:4621756"
     mRNA            complement(<391581..>394901)
                     /locus_tag="AGOS_AFL025C"
                     /old_locus_tag="AFL025C"
                     /product="AFL025Cp"
                     /transcript_id="NM_210877.1"
                     /db_xref="GeneID:4621756"
     CDS             complement(391581..394901)
                     /locus_tag="AGOS_AFL025C"
                     /old_locus_tag="AFL025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR235W"
                     /codon_start=1
                     /product="AFL025Cp"
                     /protein_id="NP_985523.1"
                     /db_xref="GeneID:4621756"
                     /translation="MSKLYTNPDESRPHDDPESERSQLLGQRQAYHAYYTYRETPVQR
                     KTSSKHDPENPHRNKLGTFDGVFIPTTLNVLSILMFLRFGFILGQIGILGTLLLLVLS
                     YCVDLLTTLSISAISTNGTVRGGGAYYMISRCLGPEFGGSIGLIFFLGQILNSGMNAV
                     GLIEPLLYSFGLPEGDTVPSVVGLLPRGRVYEFIYSTLILLLCLGISMVGSGTISRAG
                     NVLFWLLLISTISIPFSALVVAPFERGNIVYTGPSWETFYGNLYPKFTEGAAGSVRSG
                     KETFNSLFGVFFPATAGIFAGAGMSSELRKPSTSIPKGTLWGLLLTFSCYMLVIISLG
                     ATVPRQSLHQDLQIVQTISISQVIIFIGEVSTSLFSILVGIVGAAYVLQAISNDKIIP
                     GLSIFAKNPSYSLLFSWFLTQVCLLSDVNRIATFITMAFLITFIVVNLACFLLEISSA
                     PNFRPSFKWFDRYTAFTGCVVSILVMLIVDPISATVVMLSCAFLLVLIHYTCPAKPWG
                     YVSQSLIYHQVRKYLLRLRQDNVKYWRPQVLLLVDNPRTSWNLIRFCNHLKKGGLYIL
                     GHVTVSNNFQSQFNELRKQTRAWDKIRDMANIKAFVHIGTGPTLPWGVRNVYLGSGLG
                     GMKPNITVLGFFDLTSYYNTLKKKPCSPLSPGDVCRMASYSPKKDGFTDCLGENVGSL
                     PTDDCKNEKKIQIQQWVQIIEDLSLMQSTIAVAHGFKNLILPSKCDSDEVRFIDLYPI
                     QMAARMVNASSEAIVTTNFDTYTLILQLGAILVTVPDWKRTHKLRVIVFVEHENERCN
                     EKRRISNLLSILRIEAETLVLSLDQFRVYKTIVEGDVHHMDYVNSVLKEDEWWKEISD
                     ARRTHKWNRRFTMSGNQVTVLESAASKTDYNVSKLQRLGVSLTMNPNIPVPEDVANFF
                     LYDGSDDDELSEFMDTSNSFRSYDHEEMNGSAKRVLRRTRSKTRFRDDRSIRSLLPVF
                     SSDSLPKTKIIEDSTGEQPSLVPVIDKPAECATRRKEWHCLSSSHTNESSPEDAVELT
                     FNSIPSRAQHLVLNDIMTQVSSSSHLIFSTLPIPPLGTHNDKSASVQYVQDLDLWLDG
                     LPPTMLVNSQTMTVTTAL"
     gene            <395358..>397154
                     /locus_tag="AGOS_AFL024W"
                     /old_locus_tag="AFL024W"
                     /db_xref="GeneID:4621757"
     mRNA            <395358..>397154
                     /locus_tag="AGOS_AFL024W"
                     /old_locus_tag="AFL024W"
                     /product="AFL024Wp"
                     /transcript_id="NM_210878.1"
                     /db_xref="GeneID:4621757"
     CDS             395358..397154
                     /locus_tag="AGOS_AFL024W"
                     /old_locus_tag="AFL024W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL110C (CUE3)"
                     /codon_start=1
                     /product="AFL024Wp"
                     /protein_id="NP_985524.1"
                     /db_xref="GeneID:4621757"
                     /translation="MSRQPRILEFGAEEKVSLPIVKFPPFGLRAALVEKDPVVWVQLL
                     ETYVTHLQYLMAQGRIDKIDGTTHERLVVFVQAYLHEMAEEDGKVLSLGMNMEVQRQL
                     AALRRMVLVVVRSCGLLHLQIFSDAMWNLVRVYVREYPDTVRSLIEGSLQPVINTQKA
                     SLNRVYQVQQYVQQRVEANRFTRGDLKALEDLLAARSRAANTFVLSFVNVQWVNILEG
                     MYQNESNARLRTWARNLGVLSYLSASETRLEELLRELDVVSLQTLAVFPLLGSLLISA
                     AFRERMPRLYIKVPFLALVDYDGVEEESPPVDPVAADKAALATVHELFPQVTEYQVAQ
                     LLLTHENNVELVINDLFEDPTLLDRIPAEEPTKPPLKVANNRSKKKELRLRDRIVRKQ
                     LAYSSNVPDEVRNKTLTQALRLLYENDGDERDDTYDEAETLHPTGERVQVEAAESPET
                     SQYDRVEAHLWELLKKDKSLFTREQRGSANRRDLKQSTLWSDEQIEGWARMLERSPRR
                     AQILEEKYMFAGNVRTGKKKFTQNSGDQPAQSTEEPAASPRSDSNSAGRKQAPPSKKQ
                     FAGNERNKRSRANHNRKAARGKKVSRGSEPQP"
     gene            complement(<397232..>398539)
                     /locus_tag="AGOS_AFL023C"
                     /old_locus_tag="AFL023C"
                     /db_xref="GeneID:4621758"
     mRNA            complement(<397232..>398539)
                     /locus_tag="AGOS_AFL023C"
                     /old_locus_tag="AFL023C"
                     /product="AFL023Cp"
                     /transcript_id="NM_210879.1"
                     /db_xref="GeneID:4621758"
     CDS             complement(397232..398539)
                     /locus_tag="AGOS_AFL023C"
                     /old_locus_tag="AFL023C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL111W (NSA1)"
                     /codon_start=1
                     /product="AFL023Cp"
                     /protein_id="NP_985525.1"
                     /db_xref="GeneID:4621758"
                     /translation="MRLLIGSDDSGCIKELVANRGTNTSEQSALQPLHLEAHLERGLN
                     AKAHQMLQISDNECLLARMSGDIELVSWSREPRGGEEDKPVFEVSSFQVMATLGGLLD
                     GEKMQELHKRSQRRAASADRFVALFALPGQPQRYFAATMSGQFHFLALADGDLKLQKT
                     FSVRGPVEFAQLYDLEETEKLVFAYGGEDNLIKLVEVSRDLEQLEQIWEAKNVKNDRL
                     DLKVPIWPAALRFLQPAVSPASEGLNYQFIAVTRHSHLHFYQTTHGRKPFRSVDLLPN
                     REPTTSLEVVGDVTPLGNVKSTSFEGFSIITTDTKKSILQFEPSGHLLGKFGGSDIKG
                     FPSYIHVQGKYLVEGGLDRYVRVFELKNRNMLLKVFAGGKVSSVLLLDVSDVELPLSK
                     KEKNKRRHKRVLDEDQEREEDNELWAQLDGSSKRRKSKPRLDG"
     gene            <398785..>399900
                     /locus_tag="AGOS_AFL022W"
                     /old_locus_tag="AFL022W"
                     /db_xref="GeneID:4621759"
     mRNA            <398785..>399900
                     /locus_tag="AGOS_AFL022W"
                     /old_locus_tag="AFL022W"
                     /product="AFL022Wp"
                     /transcript_id="NM_210880.1"
                     /db_xref="GeneID:4621759"
     CDS             398785..399900
                     /locus_tag="AGOS_AFL022W"
                     /old_locus_tag="AFL022W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR234C (ARC40)"
                     /codon_start=1
                     /product="AFL022Wp"
                     /protein_id="NP_985526.1"
                     /db_xref="GeneID:4621759"
                     /translation="MSSIVANYKLVKAPIYSHCFNADRTLLAITCDTDCYVYRIGAGH
                     PKLVAILADHDKTVTAVDISIHGRIVTCSQDRNAIVWEPLSDGSYKPTLVLLRINRAA
                     TCVSWAPNGYKFAVGSSARIISVCYYEHDNDWWVSKHIKKPIKSTINALSWHENGVLL
                     AAGGTDGYLRVFSGYIKGLDQKEQVAGSPWGDKFPFGAVIREWYHGAWIHDVQWRSQQ
                     ERLAYVTHDGLLAVVDHAGEHAMVENPGGLPFKTLLWASDRSILCGGFSCHPVLFAET
                     ATGWKFAKNLDEAAPVPRSQRATPDDGDDDDDGTFGMSALKKFKELDLKGKISAQQDR
                     STHENTITRFFPFAEVAGQLSQVSSSGLDGKIVIYQL"
     gene            complement(<399936..>400193)
                     /locus_tag="AGOS_AFL021C"
                     /old_locus_tag="AFL021C"
                     /db_xref="GeneID:4621760"
     mRNA            complement(<399936..>400193)
                     /locus_tag="AGOS_AFL021C"
                     /old_locus_tag="AFL021C"
                     /product="AFL021Cp"
                     /transcript_id="NM_210881.1"
                     /db_xref="GeneID:4621760"
     CDS             complement(399936..400193)
                     /locus_tag="AGOS_AFL021C"
                     /old_locus_tag="AFL021C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR233W-A (DAD3)"
                     /codon_start=1
                     /product="AFL021Cp"
                     /protein_id="NP_985527.1"
                     /db_xref="GeneID:4621760"
                     /translation="MSDALSTLQRSVLEKYRTLADCLHELNDTLVELNTDSDTNPEQV
                     LAQMREIEVKIALVGTLLKGSVYSLVLQRNMGKQAPGGKAK"
     gene            <400368..>401882
                     /locus_tag="AGOS_AFL020W"
                     /old_locus_tag="AFL020W"
                     /db_xref="GeneID:4621761"
     mRNA            <400368..>401882
                     /locus_tag="AGOS_AFL020W"
                     /old_locus_tag="AFL020W"
                     /product="AFL020Wp"
                     /transcript_id="NM_210882.1"
                     /db_xref="GeneID:4621761"
     CDS             400368..401882
                     /locus_tag="AGOS_AFL020W"
                     /old_locus_tag="AFL020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL112C (TAF6)"
                     /codon_start=1
                     /product="AFL020Wp"
                     /protein_id="NP_985528.1"
                     /db_xref="GeneID:4621761"
                     /translation="MSQQQISPQQLSYTIWSPQDTVRDVADSLGINNVNDDVLRSLAM
                     DVEYRILEIIEQAVKFKRHSKRDVLTTDDIARALRVLNVEPLYGYEDNSTRDKEVSYS
                     KVTGQGGQTMYYVNDEEVDFDKLINEPLPHVPRLPTFTTHWLAVEGVQPAIPQNPNLN
                     ELRMTQLPLTRGAIVTALNDTSIQTSVSEEKAEHVSQVKPGQTNEVKPLVKHVLSKEL
                     QIYFDKVVGALTSKDQTLNAQHMKVAALTSLKSDTGLHQLVPYFIQFIAEQITHNLSD
                     LDLLTTMLEMIYSLLSNQSVFLDPYIHSLMPSILTLLLAKKLGGSPSSTLPEDEQDFL
                     EKTIALRDFSSTLLDHVLQKFPQVYKSLKPRVTRTLLKTFLDSNRSFGTYYGCIRGVC
                     ILGNETIRFFLGNIQNWAKLVFEESASTLEDVQLKETSKISKREVELLVDVMVNALAK
                     LNSDLPADFKPATEDITDADKAKLVSRLGVTISSVLLKRDDARLLIDAIFFGEV"
     gene            complement(<401981..>403996)
                     /locus_tag="AGOS_AFL019C"
                     /old_locus_tag="AFL019C"
                     /db_xref="GeneID:4621762"
     mRNA            complement(<401981..>403996)
                     /locus_tag="AGOS_AFL019C"
                     /old_locus_tag="AFL019C"
                     /product="AFL019Cp"
                     /transcript_id="NM_210883.1"
                     /db_xref="GeneID:4621762"
     CDS             complement(401981..403996)
                     /locus_tag="AGOS_AFL019C"
                     /old_locus_tag="AFL019C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL113W (SLD3)"
                     /codon_start=1
                     /product="AFL019Cp"
                     /protein_id="NP_985529.1"
                     /db_xref="GeneID:4621762"
                     /translation="MDLNTVCLIGSFVRVPRNLIFREEEPRIVEGAALPDTVVREISN
                     KDVTIKHLLKTGDGHAYMVERYYGETWVLWCVEAPADQTLYEKSYKRHTRACYEAKTL
                     AEWERYDVPELLGFWQEDVDSEPDLNAYEGLELDMKPPDALPAPTAIPAVSGDYADPQ
                     LYLNKKYYEALFQLRIPLAFFVKSKLARAKNLCSNVSACSYEQAVATLAQDFQEFDRR
                     HSTENFGLLRYALPQFAQELRTRCVKDEFKLNMDHLDDTSSEYAAELAQILKIRELKL
                     QLIMHIELIALRSLDGRFRDFEARYENTLTKRSLNTLRTKRIYSRKSTKEKKKAVKPL
                     ELDVCEQLDLLLDKMAIIDILLSTESSVSKNGAPSNKNETHELLAEHKRNLSRDGKEE
                     SSLGFIRYVLVPYWSRKIPNVTAFITKKIKGLNMQRCAVSSSQSSSIQEGSTTTSRRS
                     SFSSNLPISSTPSSPSIPTTSSGSSVIAPKLMKAKANSNLLEFLESESSLNKHPSTLS
                     KSNSDLALNRLQKRQLAVTDLAASATRNGSYEGIGNSSKGANRSFISAKQSFKRASKR
                     KLDQITESKVGANTGVVQITATPARTLAKPAAEKMTIVKSPFSEAKQATSLVEIAATP
                     LRNHPESSSAPVFEQHGIVKTPVNRDNDASGINKPKAKKVRRRLFAP"
     gene            complement(<404279..>405457)
                     /locus_tag="AGOS_AFL018C"
                     /old_locus_tag="AFL018C"
                     /db_xref="GeneID:4621763"
     mRNA            complement(<404279..>405457)
                     /locus_tag="AGOS_AFL018C"
                     /old_locus_tag="AFL018C"
                     /product="AFL018Cp"
                     /transcript_id="NM_210884.1"
                     /db_xref="GeneID:4621763"
     CDS             complement(404279..405457)
                     /locus_tag="AGOS_AFL018C"
                     /old_locus_tag="AFL018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR233W (PBP2)"
                     /codon_start=1
                     /product="AFL018Cp"
                     /protein_id="NP_985530.1"
                     /db_xref="GeneID:4621763"
                     /translation="MSDSDVACDSPNALKRKPDDDEKALEAEIKRVALDDVLPGAARI
                     SDYIHMRMLCLVKDASMVVGHKGERISRIKLETGTRINVSENIKNVPERVVFLRGSCE
                     NVAKAFGKISRAINDEDDRESNDRSLPLTVNLLVPHHLMGYVIGKQGSRLREIEDLSA
                     ARLVAGPQQLPLSNDRVLCITGVADAIHIATYYVGQTILSCEPKYRARKTIFYQPSAM
                     HSVLVNNYGIAIQHQQHHQYHPGDKAKRSRSRMSPALPPTPNEVVFHSYLPLGAPVPG
                     SLAVANNLALPHVRIVEGINPQTRITSVVQEIFIEELMVGNVIGRGGKNITQIKESTG
                     CSIQIADPVPGKDERKLTIIGTPIGNQTAVMMINNKIDIDKRNQHNRHSQQHNGHMKT
                     "
     gene            <405643..>406503
                     /locus_tag="AGOS_AFL017W"
                     /old_locus_tag="AFL017W"
                     /db_xref="GeneID:4621764"
     mRNA            <405643..>406503
                     /locus_tag="AGOS_AFL017W"
                     /old_locus_tag="AFL017W"
                     /product="AFL017Wp"
                     /transcript_id="NM_210885.1"
                     /db_xref="GeneID:4621764"
     CDS             405643..406503
                     /locus_tag="AGOS_AFL017W"
                     /old_locus_tag="AFL017W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBR231C (SWC5)"
                     /codon_start=1
                     /product="AFL017Wp"
                     /protein_id="NP_985531.1"
                     /db_xref="GeneID:4621764"
                     /translation="MIAPTEPTEGNSRASVLEFDEEGYVESEDEDFDPSKPADDDKEE
                     ELSDKSDGDYQEADEEAEKYDYSHIESSEGGLVSTRNARRLQHEREQREKYEHFEMQG
                     VSSRAGELWAQLQEESQARLHDTSSVMHAGGEAGKDRMQEEQIMIERAYWFAGEMVRE
                     KKMVLKSSAEAQEYLNSLKFKPKELVPSTMQEMDGGSKLRRPLKRPPILEQIIAGALK
                     PKLTTLEKSKLDWATYVDKEGINEELQLFNKDGYLAKQDFLRKVDGIQNEQYKELRRQ
                     ELQKNGAQGM"
     gene            complement(<406542..>408656)
                     /locus_tag="AGOS_AFL016C"
                     /old_locus_tag="AFL016C"
                     /db_xref="GeneID:4621765"
     mRNA            complement(<406542..>408656)
                     /locus_tag="AGOS_AFL016C"
                     /old_locus_tag="AFL016C"
                     /product="AFL016Cp"
                     /transcript_id="NM_210886.2"
                     /db_xref="GeneID:4621765"
     CDS             complement(406542..408656)
                     /locus_tag="AGOS_AFL016C"
                     /old_locus_tag="AFL016C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL114W"
                     /codon_start=1
                     /product="AFL016Cp"
                     /protein_id="NP_985532.1"
                     /db_xref="GeneID:4621765"
                     /translation="MLTAVSWADKPALKQVTVRATLVGLFIGSLVLISNFQFGLQTGW
                     VSMMSLPSALLACGIFRHIWPLLFAEYPPFSDVENVYVQSIAVAVGTGPLAYGFVGVL
                     PAIEKFMTREESGGLRDPGDPFTLRQLLLWSLGLAFFGIFLAVPLRKQVIIREKLAFP
                     SGSSTALLISVLNSSEILQEVTPQELVQMRRYRLARQEDEQPLVASAASVSPVGSVLS
                     PNYMERREEAPPRPGQYASNVSILLRTFAVSSAYTLLSYFVPYIKAIPLFGRHLSETY
                     LWNVQFSPAYIGQGMIMGFNTVFFIMIGCVLGWGILAPLARHMGWVPPDADINDWEKG
                     VQGWVLWSSLAVMVADSVVGFIVLTVKATVKFLLIDNKADALNSFLDDSIESMLLEEQ
                     RELDVKGEGSIPVKLVNADQEHEVDSKYLVRCTTVISGWIVSSLICVISMIYLFGKDC
                     IPIYSLLLALLIAIFLSILGVRALGETDLNPVSGIGKLAQIIFALVVPRDHKAAVLIN
                     LVAGSIAEAGAQQAGDLMQDLKTGHLIGASPRAQFTAQIIGASWSIVLSSVMYIFYNK
                     VYEIPSQQFRIPTAFVWIDCARLVMGMALPPYALECSIILGSIFAVISLVKNCIDKDK
                     YRWAQWLPSGVALGVGMYNSPSFSIARFIGGMLSYYWLRTRRGDAGAKTNMIIFSSGM
                     ILGEGVCSIVSMTLASIGTPHM"
     gene            complement(<408908..>409915)
                     /locus_tag="AGOS_AFL015C"
                     /old_locus_tag="AFL015C"
                     /db_xref="GeneID:4621766"
     mRNA            complement(<408908..>409915)
                     /locus_tag="AGOS_AFL015C"
                     /old_locus_tag="AFL015C"
                     /product="AFL015Cp"
                     /transcript_id="NM_210887.1"
                     /db_xref="GeneID:4621766"
     CDS             complement(408908..409915)
                     /locus_tag="AGOS_AFL015C"
                     /old_locus_tag="AFL015C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL115W (SNF4)"
                     /codon_start=1
                     /product="AFL015Cp"
                     /protein_id="NP_985533.1"
                     /db_xref="GeneID:4621766"
                     /translation="MSAFMARKSNIGPEQSASVEKNNVELEQKVAIQSIRMFLKSKTS
                     YDVLPVSYRLIVLDTSLLVKKSLNILLQNNIVSAPLWDSGTSKFAGLLTSLDFINVIQ
                     YYFSNPDKFELVDKLQLNGLKEIEKAIGVEPPDRGSIHPFKPLYEACCKMIESRARRI
                     PLIDQDEDTHREIVVSVLTQYRILKFVALNCREIRYLKRPLHELNIITSTKMLSCSMS
                     TPVIDVIQLLTTGGVSSIPIVDEQGKLINVYEAVDVLGLIKGGIYNDLSLSVGEALMR
                     RSDDFEGVYTCTMGDKLSTILDTIRKSRVHRFFIVDENGLLTGVLTLNDILKYILYAE
                     N"
     gene            410319..410913
                     /locus_tag="AGOS_AgSNR20"
                     /old_locus_tag="AgSNR20"
                     /db_xref="GeneID:4621767"
     ncRNA           410319..410913
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR20"
                     /old_locus_tag="AgSNR20"
                     /product="AgSNR20"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR20 (LSR1). U2 SnRNA, LSR1; start and end
                     coordinates are approximate; in synteny"
                     /transcript_id="NR_149370.1"
                     /db_xref="GeneID:4621767"
     gene            complement(<410922..>412595)
                     /locus_tag="AGOS_AFL014C"
                     /old_locus_tag="AFL014C"
                     /db_xref="GeneID:4621768"
     mRNA            complement(<410922..>412595)
                     /locus_tag="AGOS_AFL014C"
                     /old_locus_tag="AFL014C"
                     /product="AFL014Cp"
                     /transcript_id="NM_210888.1"
                     /db_xref="GeneID:4621768"
     CDS             complement(410922..412595)
                     /locus_tag="AGOS_AFL014C"
                     /old_locus_tag="AFL014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL116W (CDC20)"
                     /codon_start=1
                     /product="AFL014Cp"
                     /protein_id="NP_985534.1"
                     /db_xref="GeneID:4621768"
                     /translation="MVDTKEPRLSASRSMLLLSSPSRLNVVSSDWSKVEKHNKVMKPR
                     AAHGSLSNVTNVAHSAGGGMQRTKLTQAVPPLLRKSSSYFKEEAVKEAAAEEHGSQTY
                     ASSDRFIPVRNKGTGARCDEEAEDQDVSPPPNASPSTHLKARTKIVFKQNIAEACGLD
                     MSQRILQYLPQPPQASVKRTIYSIGSRAERYSAGAQPLSKFTRLRKINTNPERILDAP
                     GFQDDFYLNLLSWSKKNVLAIALDQSIYLWNGETGEVSLLTEFETETITSVVWSNDDC
                     HISIGKDDGNTEIWDVETMSHVRTMRSSLGVRICSQDWLDTVVCIGAKSGEIQVNDVR
                     VKDHIVSTWEKHTSEVCGIKFRQDGLQLASGGNDNTVMIWDTRQDEPLWVKRNHNAAV
                     KAITWHPDVVNLLATGGGSLDRHIHFWNTTTGARIGSINTGSQVSSLHWGQSYEDSHM
                     NREIVATGGSPDNSISIYNYDSKVKVAEITQAHESRIVSSQLSPDGTTIATVGGDENL
                     KFYRVFDAKRKKSRDHEAESFLEIMGVGKKGDEDSSASLSPKKSSFLIR"
     gene            complement(<413068..>413718)
                     /locus_tag="AGOS_AFL013C"
                     /db_xref="GeneID:9487582"
     mRNA            complement(<413068..>413718)
                     /locus_tag="AGOS_AFL013C"
                     /product="AFL013Cp"
                     /transcript_id="NM_001355334.1"
                     /db_xref="GeneID:9487582"
     CDS             complement(413068..413718)
                     /locus_tag="AGOS_AFL013C"
                     /note="NOHBY671; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0B00495g"
                     /codon_start=1
                     /product="AFL013Cp"
                     /protein_id="NP_001342277.1"
                     /db_xref="GeneID:9487582"
                     /translation="MRGRNPISPDNQRLLNKIVHQLATSLQRQMVEFVDILLDGLTAA
                     STNKRNLVASLVRGTEIPIFDEDDRMVYRDLGFNDLVGIVHLRNLVLELRGPAKPDAP
                     DPAYVPRVLRQLDLVRDYFVYLLECLGSYLELPTCTGTYRATLVELLPCFELFFADMR
                     SFKRIAAQLLHDARETGASDSSTFAVEDSVLLEIEALERRKLQFRGLVAGLDVRPC"
     gene            414649..414748
                     /locus_tag="AGOS_t0133"
                     /db_xref="GeneID:4621770"
     tRNA            join(414649..414684,414713..414748)
                     /locus_tag="AGOS_t0133"
                     /product="tRNA-Trp"
                     /codon_recognized="UGG"
                     /db_xref="GeneID:4621770"
     gene            complement(414835..414906)
                     /locus_tag="AGOS_t0134"
                     /db_xref="GeneID:4621771"
     tRNA            complement(414835..414906)
                     /locus_tag="AGOS_t0134"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4621771"
     gene            complement(414911..414992)
                     /locus_tag="AGOS_t0135"
                     /db_xref="GeneID:4621772"
     tRNA            complement(414911..414992)
                     /locus_tag="AGOS_t0135"
                     /product="tRNA-Ser"
                     /codon_recognized="UCU"
                     /db_xref="GeneID:4621772"
     gene            complement(<415195..>416073)
                     /locus_tag="AGOS_AFL012C"
                     /old_locus_tag="AFL012C"
                     /db_xref="GeneID:4621773"
     mRNA            complement(<415195..>416073)
                     /locus_tag="AGOS_AFL012C"
                     /old_locus_tag="AFL012C"
                     /product="AFL012Cp"
                     /transcript_id="NM_210890.2"
                     /db_xref="GeneID:4621773"
     CDS             complement(415195..416073)
                     /locus_tag="AGOS_AFL012C"
                     /old_locus_tag="AFL012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAR008W (SEN34)"
                     /codon_start=1
                     /product="AFL012Cp"
                     /protein_id="NP_985536.2"
                     /db_xref="GeneID:4621773"
                     /translation="MPHTKVAISLNSKTGVPLVFDLDDVRRIRGLGVLGTLCGSLPTA
                     AQQNLFLTVPLRLMLEDAVWLVLSGHAYFSFDDKLLVQAAGSLTAAEVCRWRQDTERG
                     LEQQRELRRREQQLKLAALHRTADETDTQRRLLEQSLFLETENCSKMIAAAEPAGLQL
                     AILREMVAQHLDLGNYLIYRYLREEQYFLSAGGRFGARYVAYPGDPLRYHSHMAVQPA
                     MDYYNESLDLLHVVGGGRLGTGVKKLWVVGGVRYREAEAAATAEEQIPPPDTLDRLLA
                     TSPPVSVFSIEWSGFG"
     gene            <416691..>420419
                     /locus_tag="AGOS_AFL011W"
                     /old_locus_tag="AFL011W"
                     /db_xref="GeneID:4621774"
     mRNA            <416691..>420419
                     /locus_tag="AGOS_AFL011W"
                     /old_locus_tag="AFL011W"
                     /product="AFL011Wp"
                     /transcript_id="NM_210891.1"
                     /db_xref="GeneID:4621774"
     CDS             416691..420419
                     /locus_tag="AGOS_AFL011W"
                     /old_locus_tag="AFL011W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL006W (PMC1)"
                     /codon_start=1
                     /product="AFL011Wp"
                     /protein_id="NP_985537.1"
                     /db_xref="GeneID:4621774"
                     /translation="MTTDPNPENQGPGRRSSRQLAPEFTITPTQLSELHNPKSLAAYC
                     ALFGHSENGLCDALKTDKKNGLALADEEVRETARCRRFGANRVPERTARGFLRLMWEA
                     FKDKTMIVLMVAAVISFSLGLYEAIGQPPELDDDGTPMAQVDYVEGLAIMAAVAVVVL
                     VTAANDYQKERQFARLNRKKEDTEVVVVRNGDKHVISVHDLLVGDLLSLQTGDVVPVD
                     CILVEGKCECDESGITGESDTIKKVSLAMSLQVYRTVAADNPSADIGSSDNGHSLVPD
                     PMLISGSKLLSGIGHAVVTAVGPHSVHGKMMLALKSEPETTPLQERLNTLADDISIYG
                     SVAAFLLFVVLFLRFLSYLPKGRLYHDLPSARKGSRFMDIFITAVTVIVVAVPEGLPL
                     AVTLALAFATTRMTKDGNLVRVLRACETMGSATTVCSDKTGTLTQNKMVVVKGFLGSS
                     HFDDISEDSNCAQSDALRQDMSQHTLNDILANIALNSTAFENKQVADPVITENPYHKP
                     RRSLFPWSRNNKPKYPAPKDSSVQSAEFFIGSKTEAALLSLAKGSLGLESLQALRDDP
                     HHIGIASIVQMIPFESSRKWAGLVVRLVDGNYRFFIKGASETIFKSCHYMRSSNDDVI
                     KLSPQKHGEIFGLINNLASDALRTISLAHKDFTDISSWPPAELRDASDPSTASPDLLL
                     GDEYVPTATDRPSIITNNNSGLILDGVVGIHDPLRPGVKESVKNCQQSGVTVRMITGD
                     NITTGRAIARACGILSESEYADHECAMEGPVFRKLSRRQMMDAAPKLKVLARSSPEDK
                     RIFVDILKKMNEVVAVTGDGTNDAPALTLADVGFSMGISGTGVAREASDIILMTDDFT
                     SIVNAIKWGRCVSLSIKKFIQFQLTVNITAVTLTCVTAVTSTEENPVLTAVQLLWVNL
                     IMDTLAALALATDKPDPHILERIPTGRDSPLIAVSTWKMILGQAVLQLIIAFVLHYGG
                     RKLFYPHQVPFTGRDQKRLDTLTFNTFVWLQFFKLIVTRKLDEADGISDWRKRITARN
                     LNFFQDLGRNYYFLTILLLIGICQVLIMCFGGAAFSIEPLTPGMWVTSILCGMLSIPW
                     GALIRICPDEWALKLYPKRLMHIIQHIFGLKFLRGRKKSNNEDMDSHMETSKASDLMA
                     YEAFEKARSEMLNFKESSKSGMATYLNPVNIIRKWSHESSDYQSFDDEHSLIASLTMV
                     PTLVGGAVGGFSHISTPLLQGSPTSAKSSAKTYINKDV"
     gene            complement(<420559..>421317)
                     /locus_tag="AGOS_AFL010C"
                     /old_locus_tag="AFL010C"
                     /db_xref="GeneID:4621775"
     mRNA            complement(<420559..>421317)
                     /locus_tag="AGOS_AFL010C"
                     /old_locus_tag="AFL010C"
                     /product="AFL010Cp"
                     /transcript_id="NM_210892.1"
                     /db_xref="GeneID:4621775"
     CDS             complement(420559..421317)
                     /locus_tag="AGOS_AFL010C"
                     /old_locus_tag="AFL010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL005C (COG7)"
                     /codon_start=1
                     /product="AFL010Cp"
                     /protein_id="NP_985538.1"
                     /db_xref="GeneID:4621775"
                     /translation="MDRHDEILQMFFDEEFVPQAYLDILLSSVDRPLNELQQISASLL
                     YRLEYYTGVLTKDLEDTIRRLQKPAELLNYSVTSDDIGNMKTTRLEYYMDTLANSVQS
                     LEVDVGKINTELAQLDASYETSTQSVAKITQLELVKSRLQDVLSVFQQLQIILRISVG
                     EKEGALQNVDVNEFTVALDTLRDTIIKKLEECLESETATEKNDELLSRIDSFTALKVV
                     FKGFNKFYPVYLQFANKIQKAKEHYLSQKVDENI"
     gene            complement(<421433..>422674)
                     /locus_tag="AGOS_AFL009C"
                     /old_locus_tag="AFL009C"
                     /db_xref="GeneID:4621776"
     mRNA            complement(<421433..>422674)
                     /locus_tag="AGOS_AFL009C"
                     /old_locus_tag="AFL009C"
                     /product="AFL009Cp"
                     /transcript_id="NM_210893.1"
                     /db_xref="GeneID:4621776"
     CDS             complement(421433..422674)
                     /locus_tag="AGOS_AFL009C"
                     /old_locus_tag="AFL009C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL004C (RPN14)"
                     /codon_start=1
                     /product="AFL009Cp"
                     /protein_id="NP_985539.1"
                     /db_xref="GeneID:4621776"
                     /translation="MKITTFEIQQDFGECIDDVSRGYSDHEEIYINIIPNVDTTIEKR
                     VTIVKHGESVEFDAGEGNTFRRVSSDIYEARFGRDNVTCRFKLPSKEYSGKVRSSLAT
                     ESRNLTALAVTQHPEAQYAIGDTEGRLTLHNAEFSDCRSLDGHSGHITSLHYFPSGKV
                     LLSASIDMQLKIWSAADGTNPRTLFGHTAPITGCGLIERGRNVLSSSKDGSVRLWECG
                     SGSMLRAFHRRDRHSDGVNALQVLNVQSHSHNGLGNPLEFGTEDKAFIAGHASGVLTY
                     HDVFTKQQLAELPSEFQAACTTLATTNSYFDEASPFYIYAGYENGYVAQWDLRNPIKS
                     VGHVIIDEGNPVNTLIHHDGKIYLSSGFDCHCELALGEGDSTTATFLVSRDSTVSQYL
                     SDPMAGAVWAVGSRSFCAKYS"
     gene            <422841..>424925
                     /locus_tag="AGOS_AFL008W"
                     /old_locus_tag="AFL008W"
                     /db_xref="GeneID:4621777"
     mRNA            <422841..>424925
                     /locus_tag="AGOS_AFL008W"
                     /old_locus_tag="AFL008W"
                     /product="AFL008Wp"
                     /transcript_id="NM_210894.1"
                     /db_xref="GeneID:4621777"
     CDS             422841..424925
                     /locus_tag="AGOS_AFL008W"
                     /old_locus_tag="AFL008W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAR007C (RFA1)"
                     /codon_start=1
                     /product="AFL008Wp"
                     /protein_id="NP_985540.1"
                     /db_xref="GeneID:4621777"
                     /translation="MLYNNEKSPNAKFSQLITSVAKLALRHTPWPQAKVKKFDQLSVI
                     RWMVMSTMTMNTGITTGDLATIFKDRSRYENPVGGQYQCSQTKKAEQVATSKKNLILI
                     NDGVYHMKALLRGDASQKALTHNLKRGDIFRVLTGEPAVIKEKKKFVLIIDDFEITQR
                     DASVNPHTEFIDAYFAAHANEVINFDGMGTIDRDMSPSPAIASRTTSMQQQQQQQQQQ
                     QQQQQQQQQQQQQQQQQQQQMHSAQAQQQSNQFMGSGSQKTKPIFAIEQLSPYQNMWT
                     IKARVSFKGDIKTWHNQRGEGKLFNVNFLDTSGEIRATAFNDNALKYFEILQEGKVYY
                     VSKARIQPAKPQFSNLKHPYELQLDRDTVVEECFEAADVPKMNFSFIKLDQISSMEAN
                     SNVDILGVIQTVNPPFEMIAKSGKKFNRRDIVIVDETGYSVNVGLWNEQAVDFNLPEG
                     SVIAVKSVRVTDFGGKSLSMGFSSTLHPNPDIPEAYAIKGWYSSKGTSTTFHSLKMEG
                     GDRNSMRYVADRITIGKAKDDNLGRSDKGDYFNVRGAVNFLKVDNFAYPACSTEGCQK
                     KVIEQTDGTWRCEKCQVDHPAPKWRYMLTASILDETSQIWITLFNDQAEKLLSMDANT
                     LTELKNTDPEKFQKVTQSVQMNEYDFRVRAREDTYNEETRIRYTVTNLYPLRWKVEAD
                     YLAGELTKAFLS"
     gene            complement(<425430..>427085)
                     /locus_tag="AGOS_AFL007C"
                     /old_locus_tag="AFL007C"
                     /db_xref="GeneID:4621778"
     mRNA            complement(<425430..>427085)
                     /locus_tag="AGOS_AFL007C"
                     /old_locus_tag="AFL007C"
                     /product="AFL007Cp"
                     /transcript_id="NM_210895.2"
                     /db_xref="GeneID:4621778"
     CDS             complement(425430..427085)
                     /locus_tag="AGOS_AFL007C"
                     /old_locus_tag="AFL007C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL003C (CDH1)"
                     /codon_start=1
                     /product="AFL007Cp"
                     /protein_id="NP_985541.2"
                     /db_xref="GeneID:4621778"
                     /translation="MEGTGSPFMDNTPSSSPIKKSQSANRVAKRPISGSSSASSLLSS
                     PVRRPRSSNTYTDRLMPNRTNMDLNTVLSIGCTSSLTYVSAATSDNQLEFQKERQAHQ
                     TFDTILKNELFGDRLSQDADANEDNIERIHYTASRSAEGPSTPPKSNSSDHSTSSAPT
                     TPKRLTFAGGDGLQRPMSNNVRAASLLTYRERNGTRNSTASLIHNQFLNSVSPVRPDT
                     QRLLLSPGKKLREIAKVPYRVLDAPSLADDFYYDLIDWSSTDMLAVALGKTVFLTDDN
                     SNEVVQLCETDDEYTSLSWVNSGSHLAVGLGNGLVELHDVVKQKCIRTLSGHLDRVAC
                     LSWNQHILSSGSRDHKILHRDVRMPEHYFETANTHSQEVCGLKWNVDENRLASGGNDN
                     VVYVYDGPSKKPVLKFTEHNAAVKAMAWSPHRRATLATGGGTADRRLKIWNVNSGVRL
                     NDVDTGSQVCNMVWSKNTDEIVTSHGYSKFNLTLWDCPTLEPLAVLKGHSFRVLHLTL
                     STDGTTIVSGAGDETLRYWKLFGKSKFGNQSDSVLTSAFSKLR"
     gene            complement(<427351..>428652)
                     /locus_tag="AGOS_AFL006C"
                     /old_locus_tag="AFL006C"
                     /db_xref="GeneID:4621779"
     mRNA            complement(<427351..>428652)
                     /locus_tag="AGOS_AFL006C"
                     /old_locus_tag="AFL006C"
                     /product="AFL006Cp"
                     /transcript_id="NM_210896.1"
                     /db_xref="GeneID:4621779"
     CDS             complement(427351..428652)
                     /locus_tag="AGOS_AFL006C"
                     /old_locus_tag="AFL006C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAR003W (SWD1)"
                     /codon_start=1
                     /product="AFL006Cp"
                     /protein_id="NP_985542.1"
                     /db_xref="GeneID:4621779"
                     /translation="MANRLLQDPFSVLKEYPETLTYTFEIPLQCDCLEFSPGGDYLAV
                     GCSNGSLVIYDMDTKKPISVLGNHGGGHVRAVQSVAWSQCGRYLWSSSRDWRVKMWDL
                     AAVGRQNQEYMFDGPVWMCRVLAGPQPRCIATVVEERWALLVDFSAGAADVREVRDPA
                     EDAAEDRGNTLVTCLHPRAQDVVITGTSKGWVVIYRLLADGGFHALHSEFISNCNIKN
                     IEVAPYGERMAINCSDRTIRQYALVLHDTSASLQLEHKYQDVINKLQWNSVAFSNHAG
                     EYLVASAHGSSAHDLYVWETASGTLVRVLEGPEEELLDIDWNYYNMSIASNGLESGNV
                     YVWSIVIPPKWSALAPDFEEVEENIEYREKEDEFDQLDELGHQLEQDEAEEVHIDLRT
                     RDRFDVRGNDLAVQRFIIPTDYESILLINRMQEDHADRQST"
     gene            <428819..>429475
                     /locus_tag="AGOS_AFL005W"
                     /old_locus_tag="AFL005W"
                     /db_xref="GeneID:4621780"
     mRNA            <428819..>429475
                     /locus_tag="AGOS_AFL005W"
                     /old_locus_tag="AFL005W"
                     /product="AFL005Wp"
                     /transcript_id="NM_210897.1"
                     /db_xref="GeneID:4621780"
     CDS             428819..429475
                     /locus_tag="AGOS_AFL005W"
                     /old_locus_tag="AFL005W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAR002C-A (ERP1) and YGL002W (ERP6)"
                     /codon_start=1
                     /product="AFL005Wp"
                     /protein_id="NP_985543.1"
                     /db_xref="GeneID:4621780"
                     /translation="MNLKTFLQVLVLGMLPLQVSGFYFYVNGGDRKCFHSELMKDAVL
                     NLKYNVQSYDSQSGTYRDMRDGELMMMIDIEEVFDDNHRVMHQKLPAYGTTTFNAVDS
                     GEHKVCVQPQFQGWMARTKTKITLDFEIGSDLLLDPKKKDKLQYLHSRVLQLGEKVKA
                     IRNEQRLVREREAQFRDASESANSWVVWCAVMTLFVLGGTCFWQVNHLRTFFMKQKVL
                     "
     gene            complement(<430215..>431904)
                     /locus_tag="AGOS_AFL004C"
                     /old_locus_tag="AFL004C"
                     /db_xref="GeneID:4621781"
     mRNA            complement(join(<430215..431729,431791..>431904))
                     /locus_tag="AGOS_AFL004C"
                     /old_locus_tag="AFL004C"
                     /product="AFL004Cp"
                     /transcript_id="NM_210898.2"
                     /db_xref="GeneID:4621781"
     CDS             complement(join(430215..431729,431791..431904))
                     /locus_tag="AGOS_AFL004C"
                     /old_locus_tag="AFL004C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAR002W (NUP60); 1-intron"
                     /codon_start=1
                     /product="AFL004Cp"
                     /protein_id="NP_985544.1"
                     /db_xref="GeneID:4621781"
                     /translation="MQKMYSRKRTSSAVEHSAPYRKPVIAPSVGNASTSTQKGASLLQ
                     RVKSFFHGDERLSHLSRSDDASSDQKLYHVPGGFYDVDARNPVVKLPSALAVGTAESS
                     GNFKATLSDGEEDEPNISNAKLAQFFREKGDAPLTEIEYEGVMSLIKRSQSVASTPDG
                     KNILPKEVSELRVLRSTSDTTYTPLRAPSYTPKYGNIALHNTNSAGTSTPPTRRRVFD
                     YSRLPSPYRTTVYKYSAAKVPSQGTTTRKTSENAVSKPVKSTHAPKKLSHTASALISL
                     LDGEGKADISESSAYASLSNPYSSHISHMHRGRPSSAAKTIEPSTKPVNTETTPITST
                     ALEELSNAKQAVPPHATQPVSGFKPSRPSSLRVEVTVEKSPEKSPRQPVPQSSKFNFS
                     FQKPKDHNVDTLSEKPHTIPDATSTFSFQPLAKVEESNTHGATLNGPMENNISGSSLQ
                     SNGSFNFSNGIQKVSQVHKSEDKHNTTSRTPFAFSFSKPDLPKDDSSFAENTAASAEA
                     VPFHFDFGTLPVSGIDPSSVDEEKVKRLKSTFTF"
     gene            complement(432047..432158)
                     /locus_tag="AGOS_t0136"
                     /db_xref="GeneID:4621782"
     tRNA            complement(join(432047..432082,432123..432158))
                     /locus_tag="AGOS_t0136"
                     /product="tRNA-Pro"
                     /codon_recognized="CCA"
                     /db_xref="GeneID:4621782"
     gene            complement(<432400..>433347)
                     /locus_tag="AGOS_AFL003C"
                     /old_locus_tag="AFL003C"
                     /db_xref="GeneID:4621783"
     mRNA            complement(<432400..>433347)
                     /locus_tag="AGOS_AFL003C"
                     /old_locus_tag="AFL003C"
                     /product="AFL003Cp"
                     /transcript_id="NM_210899.1"
                     /db_xref="GeneID:4621783"
     CDS             complement(432400..433347)
                     /locus_tag="AGOS_AFL003C"
                     /old_locus_tag="AFL003C"
                     /note="NOHBY601; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0H22528g"
                     /codon_start=1
                     /product="AFL003Cp"
                     /protein_id="NP_985545.1"
                     /db_xref="GeneID:4621783"
                     /translation="MRFALILFATGLVQCALGISLHWGHKDVSPDTKNYEIASVIWDR
                     LERLNSSSLTKEQVLFIKTAAIVGSLSPKEISQHSFPWQTATSHNIKENSKRLKEQIG
                     QGLSLAYLNVKDMADIEYLKEQVYQMEMMWDELTGIIHHALKVTIRNRHKELNWLVNT
                     YLKFYIFSAEKINKKLAVDKGEPKKMVGSLMSIQLEAHKLMNQYIKMLQRKKTNVEEK
                     PQWRSFDSPQPLPESEPMQVEKLDLDHLAKDVPLDKDNTLALLLKFKVLSAYQIFPTV
                     PFCAVANIIFVAGNLCGKLFAGVTSRQAEILRELSKRMA"
     gene            complement(<433755..>437273)
                     /locus_tag="AGOS_AFL002C"
                     /old_locus_tag="AFL002C"
                     /db_xref="GeneID:4621784"
     mRNA            complement(join(<433755..437146,437210..>437273))
                     /locus_tag="AGOS_AFL002C"
                     /old_locus_tag="AFL002C"
                     /product="AFL002Cp"
                     /transcript_id="NM_210900.2"
                     /db_xref="GeneID:4621784"
     CDS             complement(join(433755..437146,437210..437273))
                     /locus_tag="AGOS_AFL002C"
                     /old_locus_tag="AFL002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL001C (TFC3); 1-intron"
                     /codon_start=1
                     /product="AFL002Cp"
                     /protein_id="NP_985546.2"
                     /db_xref="GeneID:4621784"
                     /translation="MVLAPDEIVQRLCEEIAYNKGRISFKGLWELANPFVELKTERIK
                     KFVYDSLLASSDVVLLHNGKSVAPLTYDDAVAEEPSLELAITEDKLWTVLTGYNKKES
                     AIGGLAFELLMEVAKRREHGVNTMDLATITKQDPRSITGRIKKLGNLVTGVQIIYKGH
                     VVKLIKFYKFADEKPRRLYVNMRQYLPNIVETVKKSKNGVRQVVDLKRELKFDKDKRL
                     NKAFIAAIAWLDEKKYLKKVLVVSPSNPETKIRCVQYLRDYITEERDGADFENDSTDD
                     GEEEDDDAIEGFDNGNATGLLQETNLLIQDNTISAKEFSMNRFFPLQNQTYALAEKRG
                     TQGVSTMECVNTIVGSDYRRSFTKNSEYYLQTIGKSIPKNAHNLGFNLVRVYDFEGKK
                     KFYRLFTEHNFRLFSGSTDQAPTITIPHIHGQKSSLSKLSEANFMPLNATLRFTNKDD
                     QEVFFWHGELDIPATSTTTARGRKRKSLQQANVRTPKKKKPSVEANLIDLESTNTTAE
                     HAVIEEGAGEHEKLVCIGGFTANSLKSIQRQKAILDIVRKYGGVTYVRDQLYEDVSKY
                     LGTKMILDKKTLRGDVELLVAANKLKVNVKPNGRRVLYLPSMDGEQIERYLNSVRDTK
                     VAFSKDIIKNTDIYFFDQTEHNRFHRGTKSAERVKAFQNKSKRADKKSTTGAVKNTIN
                     TKPRRVRTKKRPASTGPVAKNGMKPEPTEKNALPKKRSSKSTSKSAETFNVSTKEGNR
                     VLIMAAVITKSIKGQTLWPEIAHLFPNNSVEHLKKQCTLRRVKMGHSGWRALMEKWRK
                     IMVNAVRNERATLEDAEQLNLVKLVHLWMAEDDVGDRQPLKLYKDYEENHRRYTLIKN
                     NQRASVHVSLAMSSMIQRESYLLKKTYTYSAQKSGYYNPVEEEIRSVVRSILISNSSI
                     ETDDIGILKAFNSEQVDKVILDMARERHISFVGSSKLQLTDVVLDLLNMKGKYWELQK
                     AARFKNKVLQLLNSEKALAIGEEPSNHSMPVLLDMLECGVIDMTTVPLAVKENSMYYA
                     TRKYEVTALTPPLIFFAKKKLVEPKLPFDAVPRGQPCSRLWVDPQGKINEQVWKQLVF
                     MTIHEILFNPGITLATLTKRFRKLVSHREMEDIVQWLKNLALLDETSFDGFIIKSDWY
                     LALGS"
     gene            <437499..>438245
                     /locus_tag="AGOS_AFL001W"
                     /old_locus_tag="AFL001W"
                     /db_xref="GeneID:4621785"
     mRNA            <437499..>438245
                     /locus_tag="AGOS_AFL001W"
                     /old_locus_tag="AFL001W"
                     /product="AFL001Wp"
                     /transcript_id="NM_210901.1"
                     /db_xref="GeneID:4621785"
     CDS             437499..438245
                     /locus_tag="AGOS_AFL001W"
                     /old_locus_tag="AFL001W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR001C"
                     /codon_start=1
                     /product="AFL001Wp"
                     /protein_id="NP_985547.1"
                     /db_xref="GeneID:4621785"
                     /translation="MSDSDSDLELQLSSHALAALQEFRQEEEERQKEFERMYNNADEE
                     FQTKKRQQGMELFKEDWQLSQFWYNEETANTLAKALLDGADEDTCIAVVSAPSVYAAI
                     LKLNDDEIPTKHIYLLEFDKRFELLAGTDKFLFYDYSKPLDFDSKLKGKVDRLLIDPP
                     FLNEHCQTNSSITAKALLAPKTDTKTKCGVLKHRLISCTGERMRAIIKKNYPDTEITT
                     FLPEHMNGLSNEFRCYANFEWDGWSFSKKD"
     centromere      438382..438573
                     /note="Chromosome VI centromere"
     centromere      438382..438389
                     /note="Chromosome VI centromere CDE I element"
     centromere      438390..438555
                     /note="Chromosome VI centromere CDE II element"
     centromere      438556..438573
                     /note="Chromosome VI centromere CDE III element"
     gene            <438759..>439811
                     /locus_tag="AGOS_AFR001W"
                     /old_locus_tag="AFR001W"
                     /db_xref="GeneID:4621786"
     mRNA            <438759..>439811
                     /locus_tag="AGOS_AFR001W"
                     /old_locus_tag="AFR001W"
                     /product="AFR001Wp"
                     /transcript_id="NM_210902.1"
                     /db_xref="GeneID:4621786"
     CDS             438759..439811
                     /locus_tag="AGOS_AFR001W"
                     /old_locus_tag="AFR001W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL001C (ERG26)"
                     /codon_start=1
                     /product="AFR001Wp"
                     /protein_id="NP_985548.1"
                     /db_xref="GeneID:4621786"
                     /translation="MPALESVLLVGGSGFLGLHLIEQYWNLTPRPDIYVFDIRPLPEK
                     ISTQFTFDPTKITCYQGDLTSAKDVEHAIKSSGVRVLVHSASPMHGNSQEIYEMVNVE
                     GTKNLLDVAKKCGITAFIYTSSAGVIFNGQDIHNADETWPIPDIPMDGYNETKAIAEK
                     MVLTANDPQNGFLTIALRPAGIFGPGDRQLVPGLRQVAKLGQSKYQLGNNNNLFDWTY
                     AGNVADAHVLAAKKLLDPANASSVSGETFFITNDAPTYFWALARAVWKADGHIDDKVV
                     VLNRPVALVVGYLSQFFTNLLGKESGLTPFRVRVVCATRYHNISKAKKLLGYKPCVDL
                     EEGIKRTLLWMDEDAS"
     gene            complement(<439929..>443621)
                     /locus_tag="AGOS_AFR002C"
                     /old_locus_tag="AFR002C"
                     /db_xref="GeneID:4621787"
     mRNA            complement(<439929..>443621)
                     /locus_tag="AGOS_AFR002C"
                     /old_locus_tag="AFR002C"
                     /product="AFR002Cp"
                     /transcript_id="NM_210903.1"
                     /db_xref="GeneID:4621787"
     CDS             complement(439929..443621)
                     /locus_tag="AGOS_AFR002C"
                     /old_locus_tag="AFR002C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL002W (VPS8)"
                     /codon_start=1
                     /product="AFR002Cp"
                     /protein_id="NP_985549.1"
                     /db_xref="GeneID:4621787"
                     /translation="MGSQERTPTSFLEDSECSDKPCAPISCSPQGERSAARPYEMKML
                     GQYSPFDDQKTSAVNWASLQQIYPALSFYGGPSSIFSTPLYLLVGTEKGPVLIFNHKQ
                     FLQVTLVPQATAFQSCVSLIRISDDGTYIAVAYSSGDVFIWDLNRGPEYPSNHIISIL
                     HINHHQGYTINGLGFLPERHTGVVISDTRGQVWLHRGSRGKLWQLTCKSKSLLNINSM
                     KSQLLASEPSPRLSEYPELQLVAVLCHDSLTIISVNPILATQWFHSLRLNETVSSGFV
                     AWSPGASSLAYALGSKVHTVNIEGFTRDRVIVSKEEPWSWNTTETVAMVQWLALNTLC
                     VLSSGGMMTVLNTTMAAPVLMSVDLSVQGFASPSQRSLTCLDKQIFFLTKYLVKHGKF
                     LSWTDLLLQYVQTGNYCGAHKAIGYLVTHGAGIAALVQLSDDSEERKSQLTQPFRNLS
                     LASVKFLINQESVEYAKFYDLLSLIIEVGSLFEKSLTQILEDIFELLDHTHSDAFYDA
                     LSNQILEGTPFSLPPFLLKEVLQYYAETKNLKMIELLIVTLNQSSLDIDMAVKICRKF
                     NLYGVLMHLWNNIFDDYLTPLVDFICKLTKQDEKCAILDKDDPNPMFDIYDYLSCILL
                     GLQYPVRTIISADTSLRAKHQIYSFLCSGTALKWPTDSKDKLFTTDNPELEPAYPYLQ
                     VLLKHDPKKCLSMFYKVFDDPFLNEDRVEDSDAHAHHLQISRQFLVDVLLELLKTSND
                     VYRKVLIAVFITRAVPKFPQFLTVSHATLDELVSIMCTSNINELKNECEQSLECLFAS
                     YKPSNMDELIIYLKDSGYDRVLFYFYKNIPRPADYLRLRIESQDLQQSKFTILDVMSE
                     SISLTMSGTSERSDVIKVIRENINTILILEQVDAIAEVLVSLDGGVEDIINQIISGEY
                     KKRFLEKIFELNRTEVMDPEFQHLYIQLCCEQCDFKALRKWLRRIDFCKLDVCGVIKI
                     LEEFRDRESIIFIYMKLGSFVEALNVSDSAFVDAIAEHDFKQAETFVQLGIDICENST
                     DAATECWTKLLVSIIKNYSFIAEGGKHTERDLLQHVILRLSLWETTNPGRNESPFGDI
                     LVNVLSKQDITGTKIHLIREVIIDLLKAHIVDEHIQQLIMKIVDNSAGTVINEYIEKL
                     ESGWSISNYECEVCGRRIWGVGIATQEFLDWKSSELSRGTELERVSTATGLIIFRCRH
                     GFHERCLRNMGQSQDSYSCLACYEDK"
     gene            complement(<443802..>444679)
                     /locus_tag="AGOS_AFR003C"
                     /old_locus_tag="AFR003C"
                     /db_xref="GeneID:4621788"
     mRNA            complement(join(<443802..444342,444600..>444679))
                     /locus_tag="AGOS_AFR003C"
                     /old_locus_tag="AFR003C"
                     /product="AFR003Cp"
                     /transcript_id="NM_210904.1"
                     /db_xref="GeneID:4621788"
     CDS             complement(join(443802..444342,444600..444679))
                     /locus_tag="AGOS_AFR003C"
                     /old_locus_tag="AFR003C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YAL003W (EFB1); 1-intron"
                     /codon_start=1
                     /product="AFR003Cp"
                     /protein_id="NP_985550.1"
                     /db_xref="GeneID:4621788"
                     /translation="MSFSNFSKIETVQELNSFLADKSYIEGTSATQADVAAFKAFQET
                     YPEFSRWFNHIASKQEEFESLPAASKAAAAEEEEDEDDVDLFGSDDEVDEEAEKLKAQ
                     RLAEYNARKAAKPKPAAKSIVTMDVKPWDDETDLEEMLANVKSIEMDGLSWGAHQWIA
                     IGFGIKKLQINLVVEDAKVSLDDLQQLIEEDEDHVQSTDIAAMQKL"
     gene            complement(444397..444489)
                     /locus_tag="AGOS_AgSNR18"
                     /old_locus_tag="AgSNR18"
                     /db_xref="GeneID:4621789"
     ncRNA           complement(444397..444489)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR18"
                     /old_locus_tag="AgSNR18"
                     /product="AgSNR18"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR18; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149365.1"
                     /db_xref="GeneID:4621789"
     gene            <445060..>446211
                     /locus_tag="AGOS_AFR004W"
                     /old_locus_tag="AFR004W"
                     /db_xref="GeneID:4621790"
     mRNA            <445060..>446211
                     /locus_tag="AGOS_AFR004W"
                     /old_locus_tag="AFR004W"
                     /product="AFR004Wp"
                     /transcript_id="NM_210905.1"
                     /db_xref="GeneID:4621790"
     CDS             445060..446211
                     /locus_tag="AGOS_AFR004W"
                     /old_locus_tag="AFR004W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR321C (SFH1)"
                     /codon_start=1
                     /product="AFR004Wp"
                     /protein_id="NP_985551.1"
                     /db_xref="GeneID:4621790"
                     /translation="MSQLLPQAYLTNFHNRIRNEDVPLFITAAPTRNHKRAKVVNYSE
                     YDNDLLLDDFIEQDQNDDDEKVHSDNGKGEGEEVGHEDAVASNNNLPDLEQQDDPTGI
                     LRYPRIRETFLQSKIAVRYEQVLEAGVGGSGEAVGIAEDEGAGAYSSSSQPVVIPIRL
                     NLEHNGHKIIDFFTWNLNDHSLTLEQFAQIYCQDLDFAHNLSLQNQIVAAINDQLQEY
                     ETLASVVVPDLHVIINLTCNLDSKLYEDNFEWNLNDQTLSPEQFAELVVQDLGLTREF
                     MPAIAHALYESILKIKKDWLEGHLNPEHVANGAAFGCLSGIRLDIDTLGSNWCPKVEV
                     LSQWEIEKREIEKERNMRRLKRESAKVDDRLARRRGKRRMDDLETTMRI"
     gene            complement(<446479..>448620)
                     /locus_tag="AGOS_AFR005C"
                     /old_locus_tag="AFR005C"
                     /db_xref="GeneID:4621791"
     mRNA            complement(<446479..>448620)
                     /locus_tag="AGOS_AFR005C"
                     /old_locus_tag="AFR005C"
                     /product="AFR005Cp"
                     /transcript_id="NM_210906.1"
                     /db_xref="GeneID:4621791"
     CDS             complement(446479..448620)
                     /locus_tag="AGOS_AFR005C"
                     /old_locus_tag="AFR005C"
                     /note="NOHBY618; No homolog in Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="AFR005Cp"
                     /protein_id="NP_985552.1"
                     /db_xref="GeneID:4621791"
                     /translation="MANNSMRNGSSQLGPDTALSLSASMCPEHGSASYNQITLKEKLR
                     EHFRMPAGFRQTFKQTYYEKLRRAQLNLVHASESYHDACEGARFKFYRALADTRQVLH
                     EMRDAIDNIRVEAQLWRYDHINAPKLDSLFRYESLKSRSIIHRIGPGSGDEQRFHSGE
                     VQKDKSRAVCQAPHPSPKSSNRTDTSDNTISLTTDEDAFEGNDIICSAPLKLPHTDIK
                     NVDVLHRSASAPVELINDSDIYLSRCPTVNDSANSTYADTGLHSRVLDSETQIETVRK
                     ITDIMIRMFDEYMNDNNLDTDQRIPSLAMHESRPVTFSSHPTDLVSSNDSNTVAMPLP
                     RPRSSVCNEIDRLNSMIESAISIYNRYSEEGLQSSIYNITDANDQNTNQSLRYSALEN
                     SNSGFSTEKSNSLSLRHYPNEAMGTMKDILDRVVNQLNQFEGSETSLCLPDSENSAGK
                     AETVGSQFLDPTLKSVLAPVVLQRVPEGVEVPLWCTVRHTKQDLLQIEEADEDQEATN
                     SLEYNSEQSVLFDLSDTPLICTLGKPSLEAANCGTMKTIDEDRIYDDIYAFERTMFSQ
                     MPLSLKLLFNEYPPYIYEKRLLRPLPPSLKVLFQDPEHEYEWKNTDELLLKPHHATID
                     SNWEFPNMYPFLVKGQATQPAAGLFFGKCWFCGHHIITKLHNCRRENLKKHLQHTADN
                     VKFHLVDFCEDIKLEIDWVLYKFKYELFAES"
     gene            complement(<449035..>449763)
                     /locus_tag="AGOS_AFR006C"
                     /old_locus_tag="AFR006C"
                     /db_xref="GeneID:4621792"
     mRNA            complement(<449035..>449763)
                     /locus_tag="AGOS_AFR006C"
                     /old_locus_tag="AFR006C"
                     /product="AFR006Cp"
                     /transcript_id="NM_210907.1"
                     /db_xref="GeneID:4621792"
     CDS             complement(449035..449763)
                     /locus_tag="AGOS_AFR006C"
                     /old_locus_tag="AFR006C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL020C (GET1)"
                     /codon_start=1
                     /product="AFR006Cp"
                     /protein_id="NP_985553.1"
                     /db_xref="GeneID:4621792"
                     /translation="MHTEVCLPSVRLKAQLRTEIRLLLRSSKTSDKACTAKMDYWILL
                     VLAFLVADKSWHLTGLLATKLTSPERLQQLIRERQELHQQQQSLSAQDHYAKWTKNNR
                     RLDVLDRDIARVRKNYLESVEATKARLAKLKLLVVTVPFTALKFYKGKLPVYALPKGM
                     FPRFIEGTLEHGWLYMALAPLNMKQFSEGASVAVSLGIWLFALLRVLGAIEFVLETLR
                     EQNPQVATETAKVHARTAQAASAN"
     gene            <450058..>452616
                     /locus_tag="AGOS_AFR007W"
                     /old_locus_tag="AFR007W"
                     /db_xref="GeneID:4621793"
     mRNA            <450058..>452616
                     /locus_tag="AGOS_AFR007W"
                     /old_locus_tag="AFR007W"
                     /product="AFR007Wp"
                     /transcript_id="NM_210908.2"
                     /db_xref="GeneID:4621793"
     CDS             450058..452616
                     /locus_tag="AGOS_AFR007W"
                     /old_locus_tag="AFR007W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR069C (DOA4) and YER144C (UBP5)"
                     /codon_start=1
                     /product="AFR007Wp"
                     /protein_id="NP_985554.2"
                     /db_xref="GeneID:4621793"
                     /translation="MPHIQESRVWCRSISQLSHLAEQFVTENGTESTDMKLLLQQCVD
                     TLSNYQDECKKIKSVSKPVPSKELYDLYETAYVYFKIVSLIVLNKIPKLEEYARAKSD
                     AVDRTGKQLLEIYNMLVNRLVKDDRIAEIKRFVKENSRRDPEAKNEQIGVESGKSIPA
                     TLLRNLLMGPSASGTVLLVDVRPRLDFMRCHIKSSSIICIEPVSFKESYTDIDLGKKS
                     MITSPDAEIALFQDRDKFDYIVVYTQDSEKNKHNVQQQQLLVDLLINRSFEKALDRTK
                     VFILAGGFSEWSNAHPDFCVSSQGDSVYLNGDTSGLSLQLMPQTTPQKQYNNMFQTML
                     SGPTDVHGIIRNPHNFPTQQKSKLKRVPSFRDYFRSSSSSSNINERPGSVPPQLSNGS
                     TIYPETPKLMTNDEYMKSLPQLSPITARAITSPSRALSAVGVSKSSASNSISSLLANS
                     GSASPMKPPDTPLPFTDSIKTLGQQNLTVAVSNLNFSVGLVNCGNSCYMSCIIQCLLG
                     TQELCTMFLNNSYQNHINLNSRLGSKGLLARYFSQLIHQMYQYGKDIRKKMGNEKTAV
                     IPTQFKIACGSINSSFKDNTQQDCQEFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKM
                     REMMPMRLASAIEWERYLTTDFSVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVP
                     VPSTRTCTLTDCFTEFTKIETLEQEEQWSCPSCKKRQPSTKKITITRLPRNLIIHLKR
                     FDNMLNKNNVFVSYPSVLDLTAFWANDYDKKVTNNNVELPSRGQVPPFNYQLYGIACH
                     DGTLRAGHYTAYVNKGAVLGWCYYDDTNWRQIRSAREYITQNAYVLFYHRIHST"
     gene            complement(<452689..>453561)
                     /locus_tag="AGOS_AFR008C"
                     /old_locus_tag="AFR008C"
                     /db_xref="GeneID:4621794"
     mRNA            complement(<452689..>453561)
                     /locus_tag="AGOS_AFR008C"
                     /old_locus_tag="AFR008C"
                     /product="AFR008Cp"
                     /transcript_id="NM_210909.1"
                     /db_xref="GeneID:4621794"
     CDS             complement(452689..453561)
                     /locus_tag="AGOS_AFR008C"
                     /old_locus_tag="AFR008C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR068W (DOS2)"
                     /codon_start=1
                     /product="AFR008Cp"
                     /protein_id="NP_985555.1"
                     /db_xref="GeneID:4621794"
                     /translation="MEFAYEEAAIAQQEQNDAANPHDERTEQVFHTLERQVEKQYQRT
                     ADAIKNLMNDDEYVELQLPLDANLTEKAQSVLNSLDKNLHTVEETAQSYWNQVSQKSF
                     WSSMTGTISGKLNNVVRFVEGGSDDVSTTNKSTARDAGSRTAAQLWQLATDQNLYLAY
                     KDPVPEINIEERTEEIADLLKQDEALRKLMNTIVPTRIKYATFWAIYFSKRDKLLSIE
                     ENRRSVLEGYDMKSNLKEELTWDDDDEDYEEVVEITNTKGEVETRIGTVSRTKPLPKD
                     NSESAAESDDDEWE"
     gene            <453738..>454364
                     /locus_tag="AGOS_AFR009W"
                     /old_locus_tag="AFR009W"
                     /db_xref="GeneID:4621795"
     mRNA            <453738..>454364
                     /locus_tag="AGOS_AFR009W"
                     /old_locus_tag="AFR009W"
                     /product="AFR009Wp"
                     /transcript_id="NM_210910.1"
                     /db_xref="GeneID:4621795"
     CDS             453738..454364
                     /locus_tag="AGOS_AFR009W"
                     /old_locus_tag="AFR009W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR067C (OCA6)"
                     /codon_start=1
                     /product="AFR009Wp"
                     /protein_id="NP_985556.1"
                     /db_xref="GeneID:4621795"
                     /translation="MSDKNITSMQLVSPLNFSCVQPKLYRGSYPRPINLPFLRTLQLE
                     YIVSLTPEPITNDPILKNFCEAQGIEVFHIPCNIDKVSKGKPKIKRKKKQVPIEYDVV
                     VKCAQFLINKNHYPCYIHCSNGQLVTSLVIACLRKLSYWSTVSIFNEYLTYMSSINIH
                     EREFIESFNSEIEISGLDMTEKVPWILASNMKSNSENDLLPSLRFHSI"
     gene            complement(<454393..>455811)
                     /locus_tag="AGOS_AFR010C"
                     /old_locus_tag="AFR010C"
                     /db_xref="GeneID:4621796"
     mRNA            complement(<454393..>455811)
                     /locus_tag="AGOS_AFR010C"
                     /old_locus_tag="AFR010C"
                     /product="AFR010Cp"
                     /transcript_id="NM_210911.1"
                     /db_xref="GeneID:4621796"
     CDS             complement(454393..455811)
                     /locus_tag="AGOS_AFR010C"
                     /old_locus_tag="AFR010C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER143W (DDI1)"
                     /codon_start=1
                     /product="AFR010Cp"
                     /protein_id="NP_985557.1"
                     /db_xref="GeneID:4621796"
                     /translation="MNVTVSNEVTDELLGPFELSDDITLMDFMALIDFDENEQALWHN
                     MRQLKSVDREKTLMQLGIVGESLVVVKAIKKKATEGSTTRASKASAKAAKAAAKAAAV
                     ARDTPAEQATTVSPVAQVPVAVSPAVTAAVPTQPTSPSGGPAAANDIITPEDEYIETF
                     RKSLLNSPSLASNIPIPGVNQLIQDSQLFKQLIGPVLLHRRAQQQAANQMGTAQSEYV
                     KLMSNPDDPSNQARISELINQQEIDEQLHKAMEYTPEVFASVNMLYINMEINGHPVKA
                     FVDSGAQSTIMSTALAERTGLGRLVDKRFRGIARGVGKGEIIGRVHAAQVKIETQFIP
                     CSFIVLDTNVDLLLGLDMLRRYQACVDLKENVLKIAGIVTPFLPEAEIPKHFDMDPSA
                     EATNLPSTSPLGNQKAAPEARDAGVGSALLNRSTPATAERTHAEEDVRRLMDLGFSRA
                     EVLKALDHSQGNAEYAAAFLFQ"
     gene            <455988..>456845
                     /locus_tag="AGOS_AFR011W"
                     /old_locus_tag="AFR011W"
                     /db_xref="GeneID:4621797"
     mRNA            <455988..>456845
                     /locus_tag="AGOS_AFR011W"
                     /old_locus_tag="AFR011W"
                     /product="AFR011Wp"
                     /transcript_id="NM_210912.1"
                     /db_xref="GeneID:4621797"
     CDS             455988..456845
                     /locus_tag="AGOS_AFR011W"
                     /old_locus_tag="AFR011W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER142C (MAG1)"
                     /codon_start=1
                     /product="AFR011Wp"
                     /protein_id="NP_985558.1"
                     /db_xref="GeneID:4621797"
                     /translation="MKRAREDVGNIPIEYLSRHSDAFEKAVQYILSVDSSLLEVIVAK
                     EFPQYLIATERQLTLQSHFKHLASGIITQQISGAAARSIKSRVEQLFGGTFPNYVELQ
                     SKFAAGDSASLRKCGLSARKVSYVESLTAYFNQNEMRLKHLFNSGSDAEIVDDLVRNV
                     KGIGPWSAKMFLVTSLHRQDVFAADDLGIARGCSRYLTARPEVLKKLMVSRTTVKRSK
                     IKHKNSNWRIYDEDIVESCGQLFKPHRTLFMFILWRLSSTNIDALLNTNPQLSVKPLI
                     ESNQTHSIH"
     gene            complement(<457711..>459162)
                     /locus_tag="AGOS_AFR012C"
                     /old_locus_tag="AFR012C"
                     /db_xref="GeneID:4621798"
     mRNA            complement(<457711..>459162)
                     /locus_tag="AGOS_AFR012C"
                     /old_locus_tag="AFR012C"
                     /product="AFR012Cp"
                     /transcript_id="NM_210913.1"
                     /db_xref="GeneID:4621798"
     CDS             complement(457711..459162)
                     /locus_tag="AGOS_AFR012C"
                     /old_locus_tag="AFR012C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER141W (COX15)"
                     /codon_start=1
                     /product="AFR012Cp"
                     /protein_id="NP_985559.1"
                     /db_xref="GeneID:4621798"
                     /translation="MFRSILSRNATLHGCRFMSSSSTAGFGKYLASRGSQLPPPFRKQ
                     TSSLNFVTGRTGLLRPYSASRILQEAASVKGPRKLLNSSKTVGYWLVGTSGLVFGIVV
                     LGGLTRLTESGLSITEWRPVTGTLPPMNENDWQEEFRKYQQSPEFQQLNSHISLEEFK
                     FIYFMEWVHRLWGRAIGAVFVLPAVYFAATRKTSPRVNRRLFLLSLVLGFQGFIGWWM
                     VRSGLDQGQLDERKSKPTVSQYRLTAHLGTAFVLYMGMLWTGIEILRETKWVKSPAKA
                     MELFQKLDSPALAPVRRMALALTALTFLTAMSGGLVAGLDAGLIYNTFPHMGDNWLPK
                     QRELMDDTFARKEDKSDKFWRNMFENPTTVQLNHRIFATTTFCSVLAFHLYCNRRKAL
                     IPKSANRTMHAMMGLVTLQFSLGVATLLYLVPVPLASAHQAGALALLTSALVFAAQLR
                     KPRAPMRLLVNSLHAQQKRASGQIMSEVSRLAK"
     gene            complement(<459486..>462662)
                     /locus_tag="AGOS_AFR013C"
                     /old_locus_tag="AFR013C"
                     /db_xref="GeneID:4621799"
     mRNA            complement(<459486..>462662)
                     /locus_tag="AGOS_AFR013C"
                     /old_locus_tag="AFR013C"
                     /product="AFR013Cp"
                     /transcript_id="NM_210914.2"
                     /db_xref="GeneID:4621799"
     CDS             complement(459486..462662)
                     /locus_tag="AGOS_AFR013C"
                     /old_locus_tag="AFR013C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL022C (PIM1)"
                     /codon_start=1
                     /product="AFR013Cp"
                     /protein_id="NP_985560.2"
                     /db_xref="GeneID:4621799"
                     /translation="MLTRIRNAGVGGNAARRVRLLAGYTGARMAHAAALNSTTGAGGA
                     ARAAGAGRRAHSDVHVWALRQQSGIHRGGQCILKQDREPDQSDDKKVPPRAEEGRDEE
                     AVRDEEAERQPREEQANRSSEASSSRGSGGSASSAGGGGRSNPPSEGEVPRKYEELMV
                     LPMSNRPLFPGYYKSVTVYDPAVIEAICGLLRRNIPYLGAFLLKDRSMDKDSIDSIEE
                     VHRVGVFAQITSVHHGVDVDGRKAMSMVLYPHRRVQLDELVSTPKLVAEAKEKATDDG
                     LVQAKKEKFRDMSEGGEEEENPTEFLLETGVTVGNFSDHLDLPVDHSSVMLNALTSET
                     LNTFKHLSSINATVKQQLIALSSITTSLKPNIFESPSLLADFAAAISVGDPNELQDVL
                     ETRDVEQRLEKALVFIKKEVYVAELQQKIEKETDAKVQKRYKDQVLTEQMRGIKKEMG
                     VEDAKDKAIATFRERAEKLKFPEHVKKIFDEELARLSGLESAMSEYSVTKNYLDWITS
                     LPWGIASTDQYSILSARKVLDNDHYGMQDVKDRILEFIAVGKLKGQIDGKIICLVGPP
                     GVGKTSIGQSISRALNRTFFRFSVGGMSDVSEIKGHRRTYIGALPGRLIHALKRCQTE
                     NPLILIDEIDKLGRTGHQGDPASALLELLDPEQNKTFLDTYLDFPVDMSKVLFVCTAN
                     TLDTIPRPLLDRMEVIELSGYVADEKVKIAERHLIPAAKKSTGLGSANINLTSDSIVA
                     LLKNYCRESGVRSLKKHIEKIYRKAALKIVQQLSIDDTPKSAPAETNIEPENGKPDAS
                     AKPLTNNLPAPEPLNIPDSVKIDITPETLVEYLGPPVFTADRIYEKTPAGVVMGLAYT
                     YLGGCTMYVESVLGQPLSKDSNPSLEHTGQLGDVMKESSRLAYSFSKMFMSRRFPNNR
                     FFEKAAIHLHCPEGATPKDGPSAGITMASSLLSLAMNKPLDPTIAMTGELTLTGKVLR
                     IGGIKEKTVAAKRSGAKTIIFPKDNMADWEDLPAHVKEGLIPVAAEWYDDVFNVLFGS
                     VTEEEGNNVWKDQFDLIERSKATASSSN"
     gene            complement(<462878..>463408)
                     /locus_tag="AGOS_AFR014C"
                     /old_locus_tag="AFR014C"
                     /db_xref="GeneID:4621800"
     mRNA            complement(<462878..>463408)
                     /locus_tag="AGOS_AFR014C"
                     /old_locus_tag="AFR014C"
                     /product="AFR014Cp"
                     /transcript_id="NM_210915.1"
                     /db_xref="GeneID:4621800"
     CDS             complement(462878..463408)
                     /locus_tag="AGOS_AFR014C"
                     /old_locus_tag="AFR014C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL021C (HAP3)"
                     /codon_start=1
                     /product="AFR014Cp"
                     /protein_id="NP_985561.1"
                     /db_xref="GeneID:4621800"
                     /translation="MDANSDQRDKHNQYIAELREQDRWLPINNVARLMKNTLPVTTKV
                     SKDAKECMQECVSEFISFVTSEASDRCASDKRKTINGEDVLISLHALGFENYAEVLKI
                     YLAKYRQQQALKNQMIFQRREDGADGLDGAADDGSDDAGEEEGEHGAGAAAGAPGAGA
                     LPEQDQFINQDGSLYI"
     gene            <463560..>465218
                     /locus_tag="AGOS_AFR015W"
                     /old_locus_tag="AFR015W"
                     /db_xref="GeneID:4621801"
     mRNA            <463560..>465218
                     /locus_tag="AGOS_AFR015W"
                     /old_locus_tag="AFR015W"
                     /product="AFR015Wp"
                     /transcript_id="NM_210916.2"
                     /db_xref="GeneID:4621801"
     CDS             463560..465218
                     /locus_tag="AGOS_AFR015W"
                     /old_locus_tag="AFR015W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL020W (RFT1)"
                     /codon_start=1
                     /product="AFR015Wp"
                     /protein_id="NP_985562.1"
                     /db_xref="GeneID:4621801"
                     /translation="MCSTGEEILAKSTQGATFLMMGQLFGKLVTFVLHNVLVRFLSPR
                     IFGITSFLDFLSSTVLFFSREAIRLATLRIKTGGDGGRGGEMSAELQTAVNFANIPMC
                     IGAPLAVVLAVWQYSNLNSYFTQLPFFSWSIYLVLLSILAELASEPLYVVNQFMLNYR
                     KRSQFEGAAVAASCLVNFAVIYWYENWVNGRGETVHDSYKQEGIAVLAFALGKVARAM
                     TLLALYYVDYVRHLAHEKLFSLSLTKVRVPGSVYTAYFDSDVLQHFKKVYFQLCFKHL
                     LTEGDKLIINSLCTVEEQGIYSLLSNYGSLITRMVFAPIEESLLLFLTRLLSDKTQQN
                     LHICMRVLVNLVKFYLYLALVIVIFGPTNSSFLLKFLIGSKWSSTSVLETIRVYCFYL
                     PFLSMNGILEAFFASVASGDEILRHSYLMMLLSGVFLLNCWVFLAHFNLSLEGLIFSN
                     IINMTLRIIYCSNYIRGFYKRLFADSKQTSLSSSFAGLKKILLLCIVVAYVDWSIIGY
                     VQNIRQLLVNILLSVTLVLAMAYNERKLLLEFIKKSKPVPVKEN"
     gene            <465277..>466953
                     /locus_tag="AGOS_AFR016W"
                     /old_locus_tag="AFR016W"
                     /db_xref="GeneID:4621802"
     mRNA            <465277..>466953
                     /locus_tag="AGOS_AFR016W"
                     /old_locus_tag="AFR016W"
                     /product="AFR016Wp"
                     /transcript_id="NM_210917.1"
                     /db_xref="GeneID:4621802"
     CDS             465277..466953
                     /locus_tag="AGOS_AFR016W"
                     /old_locus_tag="AFR016W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL019W (APN2)"
                     /codon_start=1
                     /product="AFR016Wp"
                     /protein_id="NP_985563.1"
                     /db_xref="GeneID:4621802"
                     /translation="MSLSVVINKIWFHNEDSRKNSIHEPSSAMGIDDIDNKDTRCLRF
                     VTFNVNGLRTLFGHYPFSRMSNSLAQVFEYFKSDVITFQELKTDKLAIPRWGMVDGYY
                     SFITIPSKKKGYSGVGCWIRIPEAADPLRLSLQVLKAEEGITGRLKIKKDGALVAYCE
                     DPTIGIGGYDGLPYGSDANAQELDSEGRCLLVELACKVVVISVYCPANSMNTEEGEVF
                     RLRFLKTLFKRVRNIENLGKRVVLMGDLNVCRDLIDHASCITRNNIKINPDCDGAVLE
                     RIYQEEAREFIYEPLRIGRRLLNEMLIDSIIPDLAEKGVLIDSTRYAQGRKRLKMYTV
                     WDTYRNSRPANYGSRVDYILVSKALKEGVKKADIWAKVMGSDHCPVFTDLQIEEEDTV
                     ALEETTKIPRFEVRFNYDLNHNIFDAFRKKSIIKCKSATKPLNQGKVQKKATKSSESQ
                     IEKKPDKLLLGASSSNIAASGKCHEEEQGQSIECAPLELNKAPEQRPSAVEKPFFAPS
                     NAPLCKHGDRSVLKTSKTSTNFGKQFWTCKRPRGAPEDIKASCGFFQWKS"
     gene            complement(<466992..>467459)
                     /locus_tag="AGOS_AFR017C"
                     /old_locus_tag="AFR017C"
                     /db_xref="GeneID:4621803"
     mRNA            complement(join(<466992..467346,467407..>467459))
                     /locus_tag="AGOS_AFR017C"
                     /old_locus_tag="AFR017C"
                     /product="AFR017Cp"
                     /transcript_id="NM_210918.1"
                     /db_xref="GeneID:4621803"
     CDS             complement(join(466992..467346,467407..467459))
                     /locus_tag="AGOS_AFR017C"
                     /old_locus_tag="AFR017C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL018C (POP8); 1-intron"
                     /codon_start=1
                     /product="AFR017Cp"
                     /protein_id="NP_985564.1"
                     /db_xref="GeneID:4621803"
                     /translation="MTACKKLGPDWHYFALLLSSQDEKQDSELLIDEMTWRQVIINAL
                     KRSHGIFGEGIEFDFLSVQGNRAFVKVGYEDRAQFSSALSTYISSEELIGVPLVVHIL
                     QECTKLERMKVGEDDELWFKRSLEEEVADSSCN"
     gene            complement(<467650..>472176)
                     /locus_tag="AGOS_AFR018C"
                     /old_locus_tag="AFR018C"
                     /db_xref="GeneID:4621804"
     mRNA            complement(<467650..>472176)
                     /locus_tag="AGOS_AFR018C"
                     /old_locus_tag="AFR018C"
                     /product="AFR018Cp"
                     /transcript_id="NM_210919.2"
                     /db_xref="GeneID:4621804"
     CDS             complement(467650..472176)
                     /locus_tag="AGOS_AFR018C"
                     /old_locus_tag="AFR018C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL017C (PEP1)"
                     /codon_start=1
                     /product="AFR018Cp"
                     /protein_id="NP_985565.2"
                     /db_xref="GeneID:4621804"
                     /translation="MVGMLFVWQTFLFVWACAAAVEVGEKPRPVIDIVRDVDNLGSIW
                     QFKGTNTLIRHQGREILVRHGGDQWSTVKKFDQGVNTVEVDPYYPERRAFAWLENNEL
                     YKTDDCGKTWARVMHVEAEPGENLQRYSVYSNPDNYKYLMVTSHFERKDSSPVLAESY
                     EKQWVSQDGGKTIAPLGHPDPGVYRLCHFLRQARNHDVAKDSTILCIEHDAQKHTAVL
                     YRTDDFGKSKQALDSFDDEIVSSVGLLGKYILVTTTEDAYNKHAVQHVWVSRDGDKFQ
                     KIIFPTHIRDNFFRAVTTSTGNQIIFSIPAGKHSHSRKNALYANYISDSSGIQFHAVA
                     DSLDERYKELGPVMALDANGTLSMVARKSSTEDQVTLLSYDYGYSWQPMHLAEGEDHK
                     ALGCSKGGKECELPVQLSQLVSSSGLVGHGESATSGILMGIVLKKRGSRGPRKHKYLS
                     VISRDYGLTWSVAFEYPVLSFAGNYGNILLACPYNPGDDGDPEEEIYYSLDQGHTWEE
                     HHIEGKYEFVRVHSAISDGSSTAFSFLAVGDDQNTIVVDCIFTDIHNGKECTDGDMEE
                     YKLRNGNCLNGARYTINKRKSEAACLLKNDPSVINPLVKPCDCTNADYECSLGFLGLP
                     DKGCTADLGMLRSAGACKDNPRELMPMHKIKGNECTKDLNIEPVKVDCSAVQNRPDIE
                     VTAHVFKTQFETYQYFNSAEDDSLMVLTKDKRALISHDSGKTFKMLDTLGSGAELITF
                     NRYFGDLAYIFASDDVLYITDDRGYHFYAVDLPEVRHLFLPLAFHAKDNQTFIYFGGK
                     DCEKLGPKCHSTAYITTDGGRNFREMLTGAVSCEFVGSIYSHPANKDMIMCEIENKKE
                     RRNILLRSTDEFRTSDKVFDSIIGFHTTGDFTAIAVSEGRQQVSSYLTIDGVHFNESR
                     FPPDFVAPEKQQSYSVLSAHEGAIFLHMSKSLVKHKEYGTLVKSDSNGIDFVVLKDGV
                     NSNAEGLVDFETPEGLDGVILINVVENLDQVQKGKAKAKHLKTAISFNDGVDWKYLSP
                     PGKDSSGKKYPCHGKNRAKCSLNLHGYTERKDLRDTYSSGSAIGYMLGVGNVGEHLLP
                     YEQCSTFLTTDGGVTWTEVKSTPHQWEFGDRGSIIVLVPDGVKTNSITYSVDAGRSWQ
                     DFKFADEEVIIDDIITVPYDTSMRFLLISKEHLRGKSKTYAISFAHIFKRQCEFHPGG
                     GRHNGDFEYTSIKHPDYKCLFGKEVEFLKRIKYDCFIGNASYTKDYRTSRICPCTRQD
                     FECDYNYIRTSDGTCKLPSGVKPEAPSAVCERNRDLVEYFQPTGYRKIPLSKCEGGLK
                     LQRTDSPHPCPGKEKEFYEKYPSSTNASSVVFWWLLLTMVLLVPLWVIYDRGIRRNGG
                     FSRFGEIRLDDDDLIEENGLDRAINKVVKVGAYGVAGLFGFLLLLKSKAGARIRRFRE
                     SVSSRRGPSYSSLISDQFLDDANDLLVGHDNDANNLNAFLDEDGQHFDVDDEIEGADQ
                     ASYHDDVDLGRTSE"
     gene            <472913..>473992
                     /locus_tag="AGOS_AFR019W"
                     /old_locus_tag="AFR019W"
                     /db_xref="GeneID:4621805"
     mRNA            <472913..>473992
                     /locus_tag="AGOS_AFR019W"
                     /old_locus_tag="AFR019W"
                     /product="AFR019Wp"
                     /transcript_id="NM_210920.1"
                     /db_xref="GeneID:4621805"
     CDS             472913..473992
                     /locus_tag="AGOS_AFR019W"
                     /old_locus_tag="AFR019W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL016W (FUS3)"
                     /codon_start=1
                     /product="AFR019Wp"
                     /protein_id="NP_985566.1"
                     /db_xref="GeneID:4621805"
                     /translation="MGKKIVFNISSEFQLKALLGEGAYGIVCSAVHKPSGEVVAIKKI
                     EPFERTLFSLRTLREIKILKHFQHENIISIYDIQKPASFDTFNEVYIIQELMQTDLHR
                     VIATQPLSDDHIQYFIYQTLRGLKALHGSGIIHRDLKPSNLLLNANCDLKICDFGLAR
                     IEHGGAADLEHPQAGMTEYVATRWYRAPEVMLTAAQYTKAIDIWSSGCILAELFMKRP
                     LFAGKDYKHQLMLIFELLGTPQGDDLAAVKSRRAREYIATLPRYRRASLRAVIPHANP
                     LGLDLLQRMLVFDPRRRITAADALRHPYLATYHDPRDEPDGTPIPASFFDFDHHKDKL
                     TTRDLKRMLWDEVFRDTHAPVRPDA"
     gene            <474366..>475937
                     /locus_tag="AGOS_AFR020W"
                     /old_locus_tag="AFR020W"
                     /db_xref="GeneID:4621806"
     mRNA            <474366..>475937
                     /locus_tag="AGOS_AFR020W"
                     /old_locus_tag="AFR020W"
                     /product="AFR020Wp"
                     /transcript_id="NM_210921.2"
                     /db_xref="GeneID:4621806"
     CDS             474366..475937
                     /locus_tag="AGOS_AFR020W"
                     /old_locus_tag="AFR020W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL015W (ACH1)"
                     /codon_start=1
                     /product="AFR020Wp"
                     /protein_id="NP_985567.2"
                     /db_xref="GeneID:4621806"
                     /translation="MTVSQLLKQRVRYAPYLSKVRRAEELLPLFKHGQYIGWSGFTGV
                     GAPKVIPTALADHVEKNGLQGQLAFNLFVGASAGPEENRWADLDMILRRAPHQVGKPI
                     ARAINDGRIKFFDKHLSMFPQDLTYGYYTRERTDGKILDYAIVEATAIKEDGSIVLGP
                     SVGGSPEFMSAADKLIVEVNTATPSFEGLHDIDMPVLPPHRVPYPYTRVDERSGLDAV
                     PVDPARVVALVESTERDKVGPNTPSDEGSRAIAGHLVEFFENEVRHGRLPANLLPLQS
                     GIGNIANAVIEGLAGASFRNLTVWTEVLQDSFLDLFENGSLEFATATSIRLTEAGFEK
                     FFANWDEYSSKLCLRSQVVSNSPEMIRRLGVIAMNTPVEVDIYAHANSTNVSGSRMLN
                     GLGGSADFLRNAKLSIMHAPSARPSKTDPTGISTIVPMASHVDQTEHDLDVLVTDQGL
                     ADLRGLCPRERAREIIRQCAHPDYKPILTDYLDRAEHYAQRSRSMHEPHILQQALRFH
                     THLAEKGTMKVPSWD"
     gene            477330..477441
                     /locus_tag="AGOS_t0137"
                     /db_xref="GeneID:4621807"
     tRNA            join(477330..477365,477406..477441)
                     /locus_tag="AGOS_t0137"
                     /product="tRNA-Pro"
                     /codon_recognized="CCA"
                     /db_xref="GeneID:4621807"
     gene            <477646..>482655
                     /locus_tag="AGOS_AFR021W"
                     /old_locus_tag="AFR021W"
                     /db_xref="GeneID:4621808"
     mRNA            <477646..>482655
                     /locus_tag="AGOS_AFR021W"
                     /old_locus_tag="AFR021W"
                     /product="AFR021Wp"
                     /transcript_id="NM_210922.2"
                     /db_xref="GeneID:4621808"
     CDS             477646..482655
                     /locus_tag="AGOS_AFR021W"
                     /old_locus_tag="AFR021W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL172W (APC1)"
                     /codon_start=1
                     /product="AFR021Wp"
                     /protein_id="NP_985568.1"
                     /db_xref="GeneID:4621808"
                     /translation="MKPISQEDSHVLYHSAELGQVWLTNGREVEWYRENTCFRRFKFE
                     ERVLLAGFTRWESNQQSLVIVLRDYVQIYFLDDGDSHSIKLPFPVRGAHFYINGVLFE
                     VQQDADHIGAETTSHKFITLSDPLMPFGSVSLASPQSDIDHYTMLHFPEQEVYGIAVL
                     YNETKQVISFYSAEILNTKAMAAMPDPPIIFNKRKKSYGSLIPNDTMPMSSSAPRKRT
                     AETHTCSPTTSSSSATNNNNSGYGGLTSTLMRRLTMNRRTASATGSAEQANSTNTPRA
                     STHGTGVNAKVTHLRSSSATLDRMVISDASYNLPGQLGISSLSQDAVPQSVTSKDGLL
                     TKITSSPVPCAFSEKVKVVSAKMDDRVTIVIYDRDRDWGRLWIFNLNSPLVGSMKFKA
                     FGYSPMSLIKTVDIKQMLLLDICAYDSSYLPGVFALLLRDGITLFNPVLDAMSPTFPL
                     GKGHNYKNIYAISPTNLFLEKGSYNIPPMTYPRSQTVRKYFEAIRYLVPPSVFPYVLS
                     IWQFTRMLVKTRACKNHDILAFEYALASFLVTEDSPLYDETFRQIHSDPIFVRDSGIW
                     EWLPKIVMCLHLLREELQLNVLQIQNVRRLDKLLSRLVTLMGWPVMWLDYYNCEREPI
                     KPLDFEFTHPLDEPPSIFKSLYSVTKSSMMDVVPFITFSRLAEQETTAIDSLVTPRTH
                     KLLKLFESLQAQPRVSTNILEQLNDLNIGQGEFETYPIGVYAPLRRFLHELEPTINKV
                     DPHMNVSLITRSDLSNCIALMRGQPPKDRRESHGLQSNLKGRFKIKDIAELTGSILEL
                     RRGTETSLSSRSLDIFDRKENVFFDPGLFDEVLSMFTYSTPHKAYFPTLSGEYTKILK
                     LKKHAAMISAYRAFTSGLGKAAFFYCAEEAINSKKTQRDELNLNFKFPMDGSKLSLSK
                     DKFPEDFLKWAEFHRGVARGLSISKSVTNVTSSWINYNRPPWLDAQYGGFLLGLGLNG
                     HLKVLEEWQLYNFLSPKHTHISIGLLLGICASMKSTMDLTLTKVLSVHIVALLPPGSS
                     NLNIHHRVQTSGLIGVGLLYQSSQHRRMSDLLYSQITSFVTINDEQVPDEGYRLAAGI
                     ALGLVNMGTGNKGISSRDDMEGDEQMMDYEVDDPVASIPETFNVKNASGYIDPDIVEG
                     LLKLVTTVHDVEESWMPDNSQLGATVSLLLMFLKSNCAVVAEKLSATGDDTKRGETWY
                     IKPELFMYREWASNMVMWDNIQGNINWVIAVLDDAGRAPREIDSDMLPTYYIIAGRVL
                     SVGIKFASTNDIELRDGLFAILDQFLPFYQYALGNTVDEQLMYKGISMLINVLIISLS
                     LIMCGSGDVETFKRIRYLHNIVHGKGSYIYEIHKQNSSTGDEIDSGISAEQSGRVIDP
                     LLQVEEITNPTNNATLDEGSESDGANSTHHLRDNENHYGKYMATSLSLGFLFLGLGRY
                     AIKTTDLDSLSYLIISVLPTFMPPYYLQETKYLWCMSVDTRVLILKNSDTEELCEDVS
                     LEIIVKSSKKDRNSGVVVHSCVSPCLLPPLDTIQSIKIDDPAYYPLVLSFDDECKAEN
                     YFSKECIIYVKERDEIDENVDPTTDPLEYMNNVKKELSKNLSIRDNIDPIVNPRQEEF
                     LAQRLLSKLGLHDMTRIEFEDTVANQTGASEDNNYNLDMLCTSEDTDYRLELWRRRNG
                     L"
     gene            complement(<482819..>484363)
                     /locus_tag="AGOS_AFR022C"
                     /old_locus_tag="AFR022C"
                     /db_xref="GeneID:4621809"
     mRNA            complement(<482819..>484363)
                     /locus_tag="AGOS_AFR022C"
                     /old_locus_tag="AFR022C"
                     /product="AFR022Cp"
                     /transcript_id="NM_210923.1"
                     /db_xref="GeneID:4621809"
     CDS             complement(482819..484363)
                     /locus_tag="AGOS_AFR022C"
                     /old_locus_tag="AFR022C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL169C (PSD1)"
                     /codon_start=1
                     /product="AFR022Cp"
                     /protein_id="NP_985569.1"
                     /db_xref="GeneID:4621809"
                     /translation="MLGFGGNKLVHRSRGMRLNMNITSNSLLVARRGLDAGLRLKRKT
                     NEFIWNSKSYYSTAKEHSKQHRAGAMRFAAASGGRNFMKTKWVVMTGVTLVLGSLILS
                     QKRHSERDEDKQADAKQKPKIRIFNNNWFFFCYSTLPLNAMSRMWGQVNSVALPVWLR
                     PWGYKLYSVIFGVKLDEMDDPDLTHYQNLSQFFYRMIKPECRPIDERENVVVCPSDGT
                     VLQLGIIDSESGDIEQIKGLTYSVKEFLGTHSHPMITRSSSSDSLCQNEHDDTKHREF
                     ARINNIPYSLQDIIGDTPGTQGEDAHIQLIQYESEGDKVLNNSNIPPSKVVKLLSELS
                     THYVGKLAANDPSHTQLYFAVIYLSPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQ
                     RNFPNLFILNERVALLGHWKHGFFSMTPVGATNVGSIKLNFDKELVTNSRSNRHLKPH
                     TCYEATYETASKILGGVPLVKGEEMGGFMLGSTVVLCFEAPSNFKFDIHVGDAVKMGQ
                     SLGQIN"
     gene            <484617..>485519
                     /locus_tag="AGOS_AFR023W"
                     /old_locus_tag="AFR023W"
                     /db_xref="GeneID:4621810"
     mRNA            <484617..>485519
                     /locus_tag="AGOS_AFR023W"
                     /old_locus_tag="AFR023W"
                     /product="AFR023Wp"
                     /transcript_id="NM_210924.1"
                     /db_xref="GeneID:4621810"
     CDS             484617..485519
                     /locus_tag="AGOS_AFR023W"
                     /old_locus_tag="AFR023W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR144C (DCD1)"
                     /codon_start=1
                     /product="AFR023Wp"
                     /protein_id="NP_985570.1"
                     /db_xref="GeneID:4621810"
                     /translation="MLVGISATYGSPWEVLLQHFEGHGFRRLRVEDFDGSWDKLEEHA
                     TRNYEAAHVIADVNAPGVLERLEKRPFFVHVSVDAPIDVRLAGSGDADHVTFMERAAL
                     HDSEAVVRATRRAAVQLYVGPGGGLRGRLAEALDELLGGPLAASPLRPAWDVYFMQLA
                     RLAASRSNCMKRRVGCVIVRACRVIATGYNGTPRHLRNCHDGGCARCNGGGSALHTCL
                     CLHAEENALLEAGRERVGEGAVLYCDTCPCLTCSVKIVQTGITEVVYSQTYRMDSDSF
                     KVLRAGGVKVRQLQDAVPPHFLVI"
     gene            complement(<485544..>486317)
                     /locus_tag="AGOS_AFR024C"
                     /old_locus_tag="AFR024C"
                     /db_xref="GeneID:4621811"
     mRNA            complement(<485544..>486317)
                     /locus_tag="AGOS_AFR024C"
                     /old_locus_tag="AFR024C"
                     /product="AFR024Cp"
                     /transcript_id="NM_210925.1"
                     /db_xref="GeneID:4621811"
     CDS             complement(485544..486317)
                     /locus_tag="AGOS_AFR024C"
                     /old_locus_tag="AFR024C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL168C (FMP41)"
                     /codon_start=1
                     /product="AFR024Cp"
                     /protein_id="NP_985571.1"
                     /db_xref="GeneID:4621811"
                     /translation="MSYQYLKQVRKIVCIGRNYAAHIRELNNPLPDSLVYFLKPTSSL
                     VTPVDAAVPTAPEDPSHVLRADGTNPGPILVPQGVEVHHEVELALVLGKRLSNLLPSE
                     FGPEDVYGAISGVALALDLTGRNLQAESKRKGLPWTAGKGFDTFTPISAFVPREALPS
                     RDLQNSFTLRCAVNGVQRQDASTALMLTPMHQLLQQLSAVMTLEPGDIVLTGTPAGVG
                     PIIPGDHISASLLQDKKQLAAFAFDVRTRPGPYMYNSKL"
     gene            complement(<486595..>488061)
                     /locus_tag="AGOS_AFR025C"
                     /old_locus_tag="AFR025C"
                     /db_xref="GeneID:4621812"
     mRNA            complement(<486595..>488061)
                     /locus_tag="AGOS_AFR025C"
                     /old_locus_tag="AFR025C"
                     /product="AFR025Cp"
                     /transcript_id="NM_210926.2"
                     /db_xref="GeneID:4621812"
     CDS             complement(486595..488061)
                     /locus_tag="AGOS_AFR025C"
                     /old_locus_tag="AFR025C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL167C (SKO1)"
                     /codon_start=1
                     /product="AFR025Cp"
                     /protein_id="NP_985572.2"
                     /db_xref="GeneID:4621812"
                     /translation="MERNTVHQHVSSFDLEPNPFEQSFASTKKEVGGPGRPLLQQGPP
                     PGHALLGLANGGASDVSQAAAVAGPQKSPMRYHLHTHKPPMIQSPPILTPGGSHRLPA
                     MLLSPQVLQPHNAQTESLLQAPGQAHLPALSPLLPGGPHNGQTTPSFLMGLTKTGLTP
                     NESSIRTGLTPGILNGGQHTSLPLPNGGQFTPGMSSMLSSMPLTNDTRTPGGGGAASH
                     PHSLSTVLEVPTSTSNSVAEIPMGGSSNPVTGNISLELPPERVKNTLASNRKRSLSND
                     DAIHGIQNTSDGSTNSNNKKKTKKSQSAPAEDPELDERDRKRKEFLERNRLAASKFRK
                     RKKEYIKKIETDLQFYETEYNDLTSFIDSLAGLTGSAKGMGQASSDISLLKLLKQSLM
                     RQDIARAMALVNQIEQHMISTKYIQRNGRNPRLEEDQSQQKQVNVVNGNAATAGVGSN
                     VSEVRTPSSTIGTQPYNSGSTTGLTNATYASMIKHDGI"
     gene            complement(<488510..>488722)
                     /locus_tag="AGOS_AFR026C"
                     /old_locus_tag="AFR026C"
                     /db_xref="GeneID:4621813"
     mRNA            complement(<488510..>488722)
                     /locus_tag="AGOS_AFR026C"
                     /old_locus_tag="AFR026C"
                     /product="AFR026Cp"
                     /transcript_id="NM_210927.1"
                     /db_xref="GeneID:4621813"
     CDS             complement(488510..488722)
                     /locus_tag="AGOS_AFR026C"
                     /old_locus_tag="AFR026C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR143W-A (RPC10)"
                     /codon_start=1
                     /product="AFR026Cp"
                     /protein_id="NP_985573.1"
                     /db_xref="GeneID:4621813"
                     /translation="MSREGFQIPTNLDAAAAGTAQARTATLKYICAECSGKLSLSRTD
                     PVRCKNCGHRILLKARTKRMVQFEAR"
     gene            complement(<488860..>489780)
                     /locus_tag="AGOS_AFR027C"
                     /old_locus_tag="AFR027C"
                     /db_xref="GeneID:4621814"
     mRNA            complement(<488860..>489780)
                     /locus_tag="AGOS_AFR027C"
                     /old_locus_tag="AFR027C"
                     /product="AFR027Cp"
                     /transcript_id="NM_210928.2"
                     /db_xref="GeneID:4621814"
     CDS             complement(488860..489780)
                     /locus_tag="AGOS_AFR027C"
                     /old_locus_tag="AFR027C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL166C (BNI5)"
                     /codon_start=1
                     /product="AFR027Cp"
                     /protein_id="NP_985574.2"
                     /db_xref="GeneID:4621814"
                     /translation="MMVQEKLSVKIARLEKELEALHRGVSADLRPAEDAEESESSAGE
                     RYSTDKSSYASSVQAVLRARTASAASADTAMSSSTAASDSAGGAKMDAADADDATRSL
                     ELRLAALATQDPAVDSADTASGASPASPAAPPSPPPSAATEGSDEAAAPLEVPKQRGD
                     AGTAAGGEPVRRRPTNPFRVISVGGSSTFKRAAGADGQASRTSSAGDKAAPVSADEQS
                     MLKLQRKHDYLTMKCVKLSKEIKYLTNLKKTGSLSVEDTRKMNDALDKLQEYLDRKSK
                     EKYEIGVLLSRRIRKHINNGSNGQFWLSGK"
     gene            <489947..>490936
                     /locus_tag="AGOS_AFR028W"
                     /old_locus_tag="AFR028W"
                     /db_xref="GeneID:4621815"
     mRNA            <489947..>490936
                     /locus_tag="AGOS_AFR028W"
                     /old_locus_tag="AFR028W"
                     /product="AFR028Wp"
                     /transcript_id="NM_210929.1"
                     /db_xref="GeneID:4621815"
     CDS             489947..490936
                     /locus_tag="AGOS_AFR028W"
                     /old_locus_tag="AFR028W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL165W"
                     /codon_start=1
                     /product="AFR028Wp"
                     /protein_id="NP_985575.1"
                     /db_xref="GeneID:4621815"
                     /translation="MARPEHPKSRDQQASRISRSETCDDKAAFHKPVDESDQQDQGAP
                     VAQRAVPLAELLLDYRLYAFSSEDSYQNFKKNGRDAYHSLLLASEGREILGYPLFRAE
                     SGRTFLNFFRRDAPVLQIYKHVVLPFSAEPPGPEARLVALAGDRSLYRVPFCSVFSQQ
                     RFLSAISEYTLVFQRGGEPTYVRMRRKWTSQIYDTVFDGMHMRWHHRRLFSLLGGLSR
                     KLVVLREDMPSLFAEMDDQCFSSHLSEKEISELSVLAEYTAKSARLLPSRVARVGELV
                     VADTSTVQPSDFNQVPWNLEVIICMNLLITFLEKQKLADSRRRARNNSIHTMF"
     gene            complement(<491025..>491501)
                     /locus_tag="AGOS_AFR029C"
                     /old_locus_tag="AFR029C"
                     /db_xref="GeneID:4621816"
     mRNA            complement(<491025..>491501)
                     /locus_tag="AGOS_AFR029C"
                     /old_locus_tag="AFR029C"
                     /product="AFR029Cp"
                     /transcript_id="NM_210930.2"
                     /db_xref="GeneID:4621816"
     CDS             complement(491025..491501)
                     /locus_tag="AGOS_AFR029C"
                     /old_locus_tag="AFR029C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR143W (DSE2)"
                     /codon_start=1
                     /product="AFR029Cp"
                     /protein_id="NP_985576.2"
                     /db_xref="GeneID:4621816"
                     /translation="MVSISGYFGCNCSLLTLFLAALGLVLCAPAHEAFTSNGVVYRYH
                     VRTTTVKPPVTIVRTVFFTAWASAPPGGQDSQETHTLEGPSATTSSESSPSALATAAP
                     PPADPVMPTSGPGSCVASYDDTEPFSTIYLTAGKEDVGAYTTLTRTRTVIVSVATV"
     gene            complement(<492216..>493250)
                     /locus_tag="AGOS_AFR030C"
                     /old_locus_tag="AFR030C"
                     /db_xref="GeneID:4621817"
     mRNA            complement(<492216..>493250)
                     /locus_tag="AGOS_AFR030C"
                     /old_locus_tag="AFR030C"
                     /product="AFR030Cp"
                     /transcript_id="NM_210931.1"
                     /db_xref="GeneID:4621817"
     CDS             complement(492216..493250)
                     /locus_tag="AGOS_AFR030C"
                     /old_locus_tag="AFR030C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL164C (IBD2)"
                     /codon_start=1
                     /product="AFR030Cp"
                     /protein_id="NP_985577.1"
                     /db_xref="GeneID:4621817"
                     /translation="MSEPERASIEFVSESDSIDFGIMMKKGVKALTDILANHLQHDPE
                     WKNERSMKFVFKNQNGELQPVLNRTARLEDEGVGPSPDDGQVVDGEETASEQDKLAEA
                     NCSDGSSTGDLQLDDPESEVLFDYSLDHLPNISYTPDPTIGKHVMEMIESLLPKGAPY
                     REKVLNTMKNNVQGAGMSTAGTAAVETIQHTAGSTISEPAMSYECDRDLGIAESDDWE
                     HQQFAQPHHGTLEADTVAEGHHRCQSRSSESQHAGHQRAGQEYLYECKPKARPDFHAL
                     TMFDPLEQPLCMFCEYYLVFGEPPRQMIKWYNKYGSSSGGPSAGSQQGNKGWNGNKKK
                     KKKKGKKGKR"
     gene            complement(<493539..>496832)
                     /locus_tag="AGOS_AFR031C"
                     /old_locus_tag="AFR031C"
                     /db_xref="GeneID:4621818"
     mRNA            complement(<493539..>496832)
                     /locus_tag="AGOS_AFR031C"
                     /old_locus_tag="AFR031C"
                     /product="AFR031Cp"
                     /transcript_id="NM_210932.2"
                     /db_xref="GeneID:4621818"
     CDS             complement(493539..496832)
                     /locus_tag="AGOS_AFR031C"
                     /old_locus_tag="AFR031C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL163C (RIA1)"
                     /codon_start=1
                     /product="AFR031Cp"
                     /protein_id="NP_985578.2"
                     /db_xref="GeneID:4621818"
                     /translation="MVRISSDVPKRLQRDGACVRNICILAHVDHGKTSLSDSLLASNG
                     IISQRLAGKVRFLDSRPDEQLRGITMESSAISLYFRVLHKQEGSSEPLVNEHLINLID
                     SPGHIDFSSEVSAASRLCDGAIVLVDVVEGVCSQTITVLRQCWTEKLRPILVLNKIDR
                     LITELQLTPQEAYVHLSKTIEQVNSVLGSFFAGERLLDDLSWREKLEQDAQAEYVERD
                     DADIYFDPSRNNVIFASAADGWGFNVSLFAKFYEQKLGAKRENLQKVLWGDYYMDPKT
                     KKIINQKALKGRNLKPLFVSLILDNIWKIYENVLTTHDSAILEKITKTLDIKVLARDL
                     RSKDYKNLLRVIMGQWMPVSTAVLLTAVTELPSPKASQDQKIASILATAPGGEDIDPA
                     LSSTLKKCDSSGPVCAYVSKMLSIPKDELPQLSDEASGAAAVIAQSKRIREEAQRAAE
                     LAESMAKLKTKTEDDLYVRANDTVFTPVVDDIDALPKPKKKLAINDNIQVVNELAPAL
                     NFDIGYVSDNASVSDHEDAGHGMGTFVPTDIDPNDPLASMFEYEDEDPFAVPGEEPLP
                     VSVGEEVEEEEEDEVLIGFSRIYSGTLKVGQEVSVVNPNYDPAEPDNNITTTTITSLY
                     LFMGKELVPLEECPAGNIVGIGGLAGKLLKNGTLLEKGTQGINLANSTTHSTPIVRVA
                     LEPTDPTHMHQLVRGLNLLNQADPCVETYVEESGEHILCTAGELHLERCLKDLRERFA
                     GIEITASEPVIPYRETFLRTQEMNPPKKPTLGRGRIELLLGTLKLQFRAFPLPTEVIE
                     FLSTHEDLMSGNSSRGSASLTPKALLEHLAKIIPEGPENAELRGLVEQTCAFGPKRCG
                     PNILFSNNGLLSTYGEPEDGSFIYGESVINGFQLAMSGGPLAGEPVQGMAVILEDAGE
                     LTEAECEAIDDPAYVRDLPDLAGRLITTARDTIHQACLDWSPRLMWAVYTCEIQTSID
                     VLGKVYAVVLQRRGRIISEELKEGTPFFHVVARIPVVEAFGFSEDIRKKTSGAAQPQL
                     VFSGYEAIDMDPFWVPTTEEELEELGDIADRENIARRYMNNIRRRKGLFVHEKIVEKA
                     EKQRTLKRN"
     gene            <497157..>497390
                     /locus_tag="AGOS_AFR032W"
                     /old_locus_tag="AFR032W"
                     /db_xref="GeneID:4621819"
     mRNA            <497157..>497390
                     /locus_tag="AGOS_AFR032W"
                     /old_locus_tag="AFR032W"
                     /product="AFR032Wp"
                     /transcript_id="NM_210933.1"
                     /db_xref="GeneID:4621819"
     CDS             497157..497390
                     /locus_tag="AGOS_AFR032W"
                     /old_locus_tag="AFR032W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL162W-A"
                     /codon_start=1
                     /product="AFR032Wp"
                     /protein_id="NP_985579.1"
                     /db_xref="GeneID:4621819"
                     /translation="MSKSVARCPQCHTELRKCLIQQNYSIVICPNEQCMYPFNEAEVI
                     QHLVQTSDKEILEAAKVRLKNDNITGSGGALME"
     gene            complement(<497463..>498482)
                     /locus_tag="AGOS_AFR033C"
                     /old_locus_tag="AFR033C"
                     /db_xref="GeneID:4621820"
     mRNA            complement(<497463..>498482)
                     /locus_tag="AGOS_AFR033C"
                     /old_locus_tag="AFR033C"
                     /product="AFR033Cp"
                     /transcript_id="NM_210934.1"
                     /db_xref="GeneID:4621820"
     CDS             complement(497463..498482)
                     /locus_tag="AGOS_AFR033C"
                     /old_locus_tag="AFR033C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR142W (CHS7)"
                     /codon_start=1
                     /product="AFR033Cp"
                     /protein_id="NP_985580.1"
                     /db_xref="GeneID:4621820"
                     /translation="MSSKEAPMRAWLKMAGLAMSNKSWLSLGDFAGICAKTPLPMCFV
                     VQTSSLPGGSVGATHYDRTHMNIGMVPRCYSRTVDIANTAIFQLGNAFVNILALCVIL
                     IISYNIRFKYTAIGRSEYGYFFQLCFMLICMTLVVDCGVSPPGTLAYPYLAALQIGLA
                     GACSWALAVMGFLGFRLWEDGTRKSMLIVRGVSMVGFLLGSLVSAITFTNWIQHHPDM
                     KTNTTALFVVMYGLNGLALLMYSVCQLVVSIFVLSNFWMTGSTILGVIFITTGQVLMY
                     TISYEICEGVKHYLDGLFIGSICNVFALMMIYKTWDISTDEDLEFSVSISVDGDIMYN
                     SNLKL"
     gene            <499125..>499578
                     /locus_tag="AGOS_AFR034W"
                     /old_locus_tag="AFR034W"
                     /db_xref="GeneID:4621821"
     mRNA            join(<499125..499128,499262..>499578)
                     /locus_tag="AGOS_AFR034W"
                     /old_locus_tag="AFR034W"
                     /product="60S ribosomal protein L42"
                     /transcript_id="NM_210935.1"
                     /db_xref="GeneID:4621821"
     CDS             join(499125..499128,499262..499578)
                     /locus_tag="AGOS_AFR034W"
                     /old_locus_tag="AFR034W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR141C (RPL42B) and YNL162W (RPL42A); 1-intron"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="NP_985581.1"
                     /db_xref="GeneID:4621821"
                     /translation="MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYD
                     RKQSGFGGQTKQIFRKKAKTTKKVVLRLECLSCKTKAQLPLKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <499953..>502112
                     /locus_tag="AGOS_AFR035W"
                     /old_locus_tag="AFR035W"
                     /db_xref="GeneID:4621822"
     mRNA            <499953..>502112
                     /locus_tag="AGOS_AFR035W"
                     /old_locus_tag="AFR035W"
                     /product="AFR035Wp"
                     /transcript_id="NM_210936.1"
                     /db_xref="GeneID:4621822"
     CDS             499953..502112
                     /locus_tag="AGOS_AFR035W"
                     /old_locus_tag="AFR035W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL161W (CBK1)"
                     /codon_start=1
                     /product="AFR035Wp"
                     /protein_id="NP_985582.1"
                     /db_xref="GeneID:4621822"
                     /translation="MFGQGYYQGNRDQDSPLQRPPAAQFSSAYMEQQGSHQSLQEHLA
                     YEQLQLQQQQQQQQQHAAAPHANGDGYGAGFTDIPTMLGSVGAPSPAFQPPMVVGMQQ
                     QPINTPPPTATSIYSQNNNSFTNVNDTTLAPGHSSPGHYSNSSDYSGQQPASSAYKQF
                     GGSESPLQPAALPGLLDGSLGDQTLVGNQSSQGAMLSRQSLQCSSVPQSPNGGQRQTS
                     GVGNYMYFERRPELLSKSTQEKAAAVKLKVENFYQSSVNHAIERNQRRVELESQLLSH
                     GWSEERKNRQLSSLGKKESQFLRLRRTRLSLEDFHTVKVIGKGAFGEVRLVQKKDTGK
                     IYAMKTLLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDAQYLYLIMEFLPG
                     GDLMTMLIRWQIFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLS
                     DFGLSTGFHKTHDSNYYKKLLQEDEQQQNGGNMGKYPASGGGGNGGGNRNTMLVDAIH
                     LTMTNRQQMQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLI
                     GWPPFCSETPQETYRKIMNFEQTLVFPDDIHISYEAEDLIRRLLSHADERLGRHGANE
                     IKNHPFFRGVDWETIRQVGAPYIPKLSSVTDTRFFPTDELENVPDSPAMAQAAKQREQ
                     MLKQGGSAANTAQAKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(502175..502283)
                     /locus_tag="AGOS_AgSNR32"
                     /old_locus_tag="AgSNR32"
                     /db_xref="GeneID:4621823"
     ncRNA           complement(502175..502283)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR32"
                     /old_locus_tag="AgSNR32"
                     /product="AgSNR32"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR32; start and end coordinates are
                     approximate. Similarity is partial. In synteny."
                     /transcript_id="NR_149375.1"
                     /db_xref="GeneID:4621823"
     gene            complement(<502516..>503190)
                     /locus_tag="AGOS_AFR036C"
                     /old_locus_tag="AFR036C"
                     /db_xref="GeneID:4621824"
     mRNA            complement(<502516..>503190)
                     /locus_tag="AGOS_AFR036C"
                     /old_locus_tag="AFR036C"
                     /product="AFR036Cp"
                     /transcript_id="NM_210937.1"
                     /db_xref="GeneID:4621824"
     CDS             complement(502516..503190)
                     /locus_tag="AGOS_AFR036C"
                     /old_locus_tag="AFR036C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR140W"
                     /codon_start=1
                     /product="AFR036Cp"
                     /protein_id="NP_985583.1"
                     /db_xref="GeneID:4621824"
                     /translation="MSVLSLIINSASLVLTSWGVSNAVKLTLPPNLQLAGQKQFLTIL
                     GASLTIVTNVIGIGYSLLGGDGGLRYVSREVFLPAALVLESVVALVYWPLRVFFVNMI
                     YHGLPEGASPEITVPVDLCIHLVPVAGLLLDYFLVQQGPFQMGRLPFWLLVTAMGVGY
                     NRWLGHIIHADLDQSYPYPFLDVAEPYRTLIFGVITTIAWGFYVLYQTLHGPAAGGGV
                     GKQKLS"
     gene            <503607..>505019
                     /locus_tag="AGOS_AFR037W"
                     /old_locus_tag="AFR037W"
                     /db_xref="GeneID:4621825"
     mRNA            <503607..>505019
                     /locus_tag="AGOS_AFR037W"
                     /old_locus_tag="AFR037W"
                     /product="AFR037Wp"
                     /transcript_id="NM_210938.2"
                     /db_xref="GeneID:4621825"
     CDS             503607..505019
                     /locus_tag="AGOS_AFR037W"
                     /old_locus_tag="AFR037W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL142W (MEP2)"
                     /codon_start=1
                     /product="AFR037Wp"
                     /protein_id="NP_985584.2"
                     /db_xref="GeneID:4621825"
                     /translation="MPGNQVGTDGAGAVDVAALANAAWVGASSVLIWMMVPGAGLLYA
                     GLSRRRHALAMLWASIMAVTVVSLQWFAWGYTLAFAPATRGNGFLGTLHYAGMYHVLD
                     AAPKRALPTAADVLFQGMFAMVAGTLMIGGSGGHARLLPMLVFLFWWVTLVYCPVACW
                     TWNADGWLARMGVLDYAGGGPVHLTSGHAALVYALILDSRRGRRARRPRKFRPHSVTM
                     VVLGTVFMWFGWFGFNGGTAGSPTALAFYGCVSSNLAAGCGAIVWLFLDYFRYGKKWT
                     VVGLCSGAISGLVAITPAAGYVPAWASVAIGAFAGFSCNFAVAIKIVLGIDDGLDVYA
                     IHGVGGAVGSAMTGLFACKYVNASGAPYVRPIEGGWLERNWAQLGYQVVAILSISAWS
                     AIVTALLLLLLDRIPYLRLRPAADEQEDVDIHGINLFDNDVHDRVAEKIGVTSHAAST
                     SRDQEAAKPRETPELDAVVS"
     gene            <505224..>505564
                     /locus_tag="AGOS_AFR038W"
                     /old_locus_tag="AFR038W"
                     /db_xref="GeneID:4621826"
     mRNA            join(<505224..505272,505323..>505564)
                     /locus_tag="AGOS_AFR038W"
                     /old_locus_tag="AFR038W"
                     /product="AFR038Wp"
                     /transcript_id="NM_210939.1"
                     /db_xref="GeneID:4621826"
     CDS             join(505224..505272,505323..505564)
                     /locus_tag="AGOS_AFR038W"
                     /old_locus_tag="AFR038W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR138C; 1-intron"
                     /codon_start=1
                     /product="AFR038Wp"
                     /protein_id="NP_985585.1"
                     /db_xref="GeneID:4621826"
                     /translation="MKLVSLLLLLPLAAAASSRYMIFFPNQDVPVKAYAGLQNSVLLA
                     GGRITAVLPLIAGFVAEIPKEEVPGLVSANEKSSYKAVFEEDGEIHTARPAQ"
     gene            complement(<505605..>506042)
                     /locus_tag="AGOS_AFR039C"
                     /old_locus_tag="AFR039C"
                     /db_xref="GeneID:4621827"
     mRNA            complement(join(<505605..505985,506034..>506042))
                     /locus_tag="AGOS_AFR039C"
                     /old_locus_tag="AFR039C"
                     /product="AFR039Cp"
                     /transcript_id="NM_210940.2"
                     /db_xref="GeneID:4621827"
     CDS             complement(join(505605..505985,506034..506042))
                     /locus_tag="AGOS_AFR039C"
                     /old_locus_tag="AFR039C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL153C (GIM3); 1-intron"
                     /codon_start=1
                     /product="AFR039Cp"
                     /protein_id="NP_985586.2"
                     /db_xref="GeneID:4621827"
                     /translation="MELLPQGKQNTVQVLYEDQQRINEFSKLVMRKDALEAELRSQRQ
                     EKEYVDDAALEIELVDEDAALQYKIGDVFVLMRQEEVAAQLERDQAAADARIRQLEEE
                     EEHVDARMRALKQVLYAKFGDSINLER"
     gene            <507026..>508669
                     /locus_tag="AGOS_AFR040W"
                     /old_locus_tag="AFR040W"
                     /db_xref="GeneID:4621828"
     mRNA            <507026..>508669
                     /locus_tag="AGOS_AFR040W"
                     /old_locus_tag="AFR040W"
                     /product="AFR040Wp"
                     /transcript_id="NM_210941.2"
                     /db_xref="GeneID:4621828"
     CDS             507026..508669
                     /locus_tag="AGOS_AFR040W"
                     /old_locus_tag="AFR040W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR135C (YCK1) and YNL154C (YCK2)"
                     /codon_start=1
                     /product="AFR040Wp"
                     /protein_id="NP_985587.1"
                     /db_xref="GeneID:4621828"
                     /translation="MNTSGAVAAASTALAVNNMANTKMNAASAAQQQASLSQSHTFSQ
                     QAGVAGSNVSTVSGRDDTTIVGLHFKIGKKIGEGSFGVLFEGTNMINGVPVAIKFEPR
                     KTEAPQLKDEYRTYKILAGTSGVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRRF
                     SVKTVVQVAVQMITLIEDLHAHDLIYRDIKPDNFLIGRPDQPDANKVHLIDFGMAKLY
                     RDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQ
                     GLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPVQFGRYLEIVRNLGFEETPDYDGYRKL
                     LLSTLEELGLEYDGEYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNEKGRRHRSKYP
                     QPSAPQQMSSPQDPRYGSSQLQLQQRLDPTSYEAYQQQTQQRYAQQQLKLQHHQPRLN
                     YQAQPLQQSSQQPQAQQQNQQTQNQQTQQQQTQYRTQQQAQYPFPSHSSQPGMHQKQG
                     LLQGQNGSVTAGTTTANGKQQDVGSVSSGKGFFSKMGCC"
     gene            complement(<509669..>510442)
                     /locus_tag="AGOS_AFR041C"
                     /old_locus_tag="AFR041C"
                     /db_xref="GeneID:4621829"
     mRNA            complement(<509669..>510442)
                     /locus_tag="AGOS_AFR041C"
                     /old_locus_tag="AFR041C"
                     /product="AFR041Cp"
                     /transcript_id="NM_210942.1"
                     /db_xref="GeneID:4621829"
     CDS             complement(509669..510442)
                     /locus_tag="AGOS_AFR041C"
                     /old_locus_tag="AFR041C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL155W"
                     /codon_start=1
                     /product="AFR041Cp"
                     /protein_id="NP_985588.1"
                     /db_xref="GeneID:4621829"
                     /translation="MPERETGMLDVGKHCQYCRQIDFLPFHCTLCNSDFCSVHRTQEA
                     HHCKALLAPGAATPASRSRSSSQAKGEREVYFKALLPDKAAVRVKQETSEKPAQGTSI
                     KDRLVQRNSTNALDKLKRFFAKYSSKRKNMNLSASNKVIQVAKIKRTAKGDDKIPHPN
                     RVYIWCYYIDESNPKEHDIFINRQWPLGRVLDYLSHHMDVKNVNLSAHAGSGEKLYLY
                     KRVKENEWKMLDPSGRVNGNIEEGDALYLIRGNDMCLLK"
     gene            <511017..>511244
                     /locus_tag="AGOS_AFR041WA"
                     /db_xref="GeneID:9487583"
     mRNA            <511017..>511244
                     /locus_tag="AGOS_AFR041WA"
                     /product="AFR041W-Ap"
                     /transcript_id="NM_001355336.1"
                     /db_xref="GeneID:9487583"
     CDS             511017..511244
                     /locus_tag="AGOS_AFR041WA"
                     /note="NOHBY672; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F27841g"
                     /codon_start=1
                     /product="AFR041W-Ap"
                     /protein_id="NP_001342278.1"
                     /db_xref="GeneID:9487583"
                     /translation="MASVTFKDNAEVIMIGEQDRRREQGMARPWITGFIDADIMWQKD
                     GPQLIVDIAKENFEQLILTFVLLLYIVVAKI"
     gene            complement(<511575..>512249)
                     /locus_tag="AGOS_AFR042C"
                     /old_locus_tag="AFR042C"
                     /db_xref="GeneID:4621830"
     mRNA            complement(<511575..>512249)
                     /locus_tag="AGOS_AFR042C"
                     /old_locus_tag="AFR042C"
                     /product="AFR042Cp"
                     /transcript_id="NM_210943.2"
                     /db_xref="GeneID:4621830"
     CDS             complement(511575..512249)
                     /locus_tag="AGOS_AFR042C"
                     /old_locus_tag="AFR042C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR134W (WSS1)"
                     /codon_start=1
                     /product="AFR042Cp"
                     /protein_id="NP_985589.2"
                     /db_xref="GeneID:4621830"
                     /translation="MARPREVNPHIAEFAVLQHKPGKERALEMLQDIARRVSYLMREE
                     GFRVGQLAEFYPRERRLLGLNVNQGARILLRLREPGDEQQFLSRETILAVMLHELTHN
                     VFGPHDARFRRKLDELVGRQWVLDQRGIVDSFLGRGRRLGGRGRRLEGRGRRLGGRSA
                     GVAARELAGLAAARRMAAIAATAQCCGQGGGTAPPRDGDLDVVVIDEEPCVVRTPVVI
                     DLTNED"
     gene            <512442..>513257
                     /locus_tag="AGOS_AFR043W"
                     /old_locus_tag="AFR043W"
                     /db_xref="GeneID:4621831"
     mRNA            <512442..>513257
                     /locus_tag="AGOS_AFR043W"
                     /old_locus_tag="AFR043W"
                     /product="AFR043Wp"
                     /transcript_id="NM_210944.1"
                     /db_xref="GeneID:4621831"
     CDS             512442..513257
                     /locus_tag="AGOS_AFR043W"
                     /old_locus_tag="AFR043W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL156C (NSG2) and YHR133C (NSG1)"
                     /codon_start=1
                     /product="AFR043Wp"
                     /protein_id="NP_985590.1"
                     /db_xref="GeneID:4621831"
                     /translation="MSKKKHEEECGERAGGKVGSPIVVAASTDSMSMLTKPQLFGIYD
                     EEIVESEDTEIYEEAKKSAGRMLDDMGSVGARSRVRTRSQKYMHLVSSLVILGISGIA
                     YHQLSRNLHDNDLLHEDFTSRPLVLGVKLCQQLSFGMLPTWAGYAVEGILFGSLLPAV
                     DYWRRISVGKVNLSGVLRSINAMLGVSFGIRRVEWSSSLQASGAWFLLDGILWLFFDG
                     SFSVFLLGFAVGLVTAVTCYEEITDFSQLLYFIDFYFLGLLFFGRLGRYLYQR"
     gene            complement(<513422..>513802)
                     /locus_tag="AGOS_AFR044C"
                     /old_locus_tag="AFR044C"
                     /db_xref="GeneID:4621832"
     mRNA            complement(<513422..>513802)
                     /locus_tag="AGOS_AFR044C"
                     /old_locus_tag="AFR044C"
                     /product="AFR044Cp"
                     /transcript_id="NM_210945.1"
                     /db_xref="GeneID:4621832"
     CDS             complement(513422..513802)
                     /locus_tag="AGOS_AFR044C"
                     /old_locus_tag="AFR044C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR132W-A (IGO2) and YNL157W (IGO1)"
                     /codon_start=1
                     /product="AFR044Cp"
                     /protein_id="NP_985591.1"
                     /db_xref="GeneID:4621832"
                     /translation="MSKSPSPTNSTLADTGDVDLSALTPQELKLYKLYGKLPGKKDLF
                     KHKLHERKYFDSGDYALSKAGVKSEDLGSAAVGSSHLPVTNPSGLRESIIRRRMSSSA
                     GGLDSQNLNRQSSISSGPPRSPNK"
     gene            <514164..>515468
                     /locus_tag="AGOS_AFR045W"
                     /old_locus_tag="AFR045W"
                     /db_xref="GeneID:4621833"
     mRNA            <514164..>515468
                     /locus_tag="AGOS_AFR045W"
                     /old_locus_tag="AFR045W"
                     /product="AFR045Wp"
                     /transcript_id="NM_210946.1"
                     /db_xref="GeneID:4621833"
     CDS             514164..515468
                     /locus_tag="AGOS_AFR045W"
                     /old_locus_tag="AFR045W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR132C (ECM14)"
                     /codon_start=1
                     /product="AFR045Wp"
                     /protein_id="NP_985592.1"
                     /db_xref="GeneID:4621833"
                     /translation="MGGCFAWLRLPMAVLGLAASAAGLQAYPETQVCRLTDVSVEWVH
                     GTMKRQGVTEYDIWGHSRGHVDVQVPRSVAEVLEGCEVMVEDVDALLQEQAARPGAAG
                     RDGAAQVPLGYAGTVGDVFFDDFQDLETIYMWLDMLEQTYPGLVTVERVGQTYEGREM
                     RAVHISAGNEQRNPDKKTVVITGGVHAREWIGVSTACFVVERLLSRYGRAPKETRYLD
                     ALDFLVIPVFNPDGYAYTWTHDRLWRKNRQPTYMPGCDGVDIDHSFDYHWTGQHAYPC
                     SGDYSGQQPFEAVEARSWNDYVNKTKAELDIYAYLDLHSYSEEILYPYAYSCDALPRD
                     LENLLELAHGLARAIRRKSGRNYDVLASCKDRGSDLSPGMGSGSALDYMYHHRARWAF
                     QFKLRDTGSRGFLLPAAHIKPVGRELYAALMYFCDFILNPEL"
     gene            complement(<515478..>516107)
                     /locus_tag="AGOS_AFR046C"
                     /old_locus_tag="AFR046C"
                     /db_xref="GeneID:4621834"
     mRNA            complement(<515478..>516107)
                     /locus_tag="AGOS_AFR046C"
                     /old_locus_tag="AFR046C"
                     /product="AFR046Cp"
                     /transcript_id="NM_210947.1"
                     /db_xref="GeneID:4621834"
     CDS             complement(515478..516107)
                     /locus_tag="AGOS_AFR046C"
                     /old_locus_tag="AFR046C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL158W (PGA1)"
                     /codon_start=1
                     /product="AFR046Cp"
                     /protein_id="NP_985593.1"
                     /db_xref="GeneID:4621834"
                     /translation="MAAAGHPSKMRRSQAGSSYVWWRYAIALVALCRVCLANTETFNI
                     YIPGDFPVSTVGAQQDGGIESGLPRMVLHNINYKMQRFDVVPGEMFYVQVDELRQNEN
                     YQVRISWTAADGVGVADMGHVVVPHGAAFRGTVDERARVAVHFRVEAEAYPALAAARV
                     PVNVAVVNIKMGIPVDLYSIALYVLAVVGAAAYVVCRWDPYRALKAEVL"
     gene            <516226..>517002
                     /locus_tag="AGOS_AFR047W"
                     /old_locus_tag="AFR047W"
                     /db_xref="GeneID:4621835"
     mRNA            <516226..>517002
                     /locus_tag="AGOS_AFR047W"
                     /old_locus_tag="AFR047W"
                     /product="AFR047Wp"
                     /transcript_id="NM_210948.1"
                     /db_xref="GeneID:4621835"
     CDS             516226..517002
                     /locus_tag="AGOS_AFR047W"
                     /old_locus_tag="AFR047W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL159C (ASI2)"
                     /codon_start=1
                     /product="AFR047Wp"
                     /protein_id="NP_985594.1"
                     /db_xref="GeneID:4621835"
                     /translation="MEPEAGAAETSRETVPEAGREPGASEIEEVELYQLFMEQSQRAA
                     RGLGDPPSLELQLLLLEALQRDQELGERLGERVLRAHTDWRPFGRPRPHLRTFLRNQI
                     VLDHILIALLFPFSLFNILRALFSEFTFSEYDFYIDILQYLRRISVVDHSGRSLLLYT
                     DSLGLLVKFHNVVVFYTRNVYYVLNAALGNLRITAHVYALFVRVNAISLYLAYGLIAS
                     SYLCLAAFFFTLCFGMTVIKRYKGVEMILNEMYQNTECLL"
     gene            <517129..>518292
                     /locus_tag="AGOS_AFR048W"
                     /old_locus_tag="AFR048W"
                     /db_xref="GeneID:4621836"
     mRNA            <517129..>518292
                     /locus_tag="AGOS_AFR048W"
                     /old_locus_tag="AFR048W"
                     /product="AFR048Wp"
                     /transcript_id="NM_210949.2"
                     /db_xref="GeneID:4621836"
     CDS             517129..518292
                     /locus_tag="AGOS_AFR048W"
                     /old_locus_tag="AFR048W"
                     /note="NOHBY619; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F27995g"
                     /codon_start=1
                     /product="AFR048Wp"
                     /protein_id="NP_985595.2"
                     /db_xref="GeneID:4621836"
                     /translation="MVHYRLAAAMLGAAACAQAAQPSPEELWGFDVGTAGIQTFAHLP
                     HERCLLQPDLEFDIGILGMPFDMSVTYRPGARFGPEAIRRGSQRQIRAHAYSPYRALN
                     PYDDWAHIVDCGDVPVVLTDNRIARDMMHRAYADVLRRSSKSDPRVPPRIIMLGGDHS
                     VLLPALRALHDVYGPISVVHFDSHIDTWQPANTSVWDTAHVPLNHGTMLWEAFQHGLL
                     SDHNVHVGLRSNLAHPDDFHRDDAAGFYRIHADEILDIGPQGVVDRILRVIPRGVPVY
                     VSVDIDVLDPSAAPATGTVEPGGWLPRELLRVLRGLQPLTLVGADIVEVAPAYDRADI
                     TAITAAQLVYELAASMVASGPVAHTLLDTRADSAAVPAQVRFRARGPSRSATA"
     gene            <518736..>520889
                     /locus_tag="AGOS_AFR049W"
                     /old_locus_tag="AFR049W"
                     /db_xref="GeneID:4621837"
     mRNA            <518736..>520889
                     /locus_tag="AGOS_AFR049W"
                     /old_locus_tag="AFR049W"
                     /product="AFR049Wp"
                     /transcript_id="NM_210950.2"
                     /db_xref="GeneID:4621837"
     CDS             518736..520889
                     /locus_tag="AGOS_AFR049W"
                     /old_locus_tag="AFR049W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL144C and YHR131C"
                     /codon_start=1
                     /product="AFR049Wp"
                     /protein_id="NP_985596.1"
                     /db_xref="GeneID:4621837"
                     /translation="MSQPEVYARLYEARGLGFKEAALPSSVSTSSVDGVTTLSYDSRS
                     HGSLPQSGEVESGELHADVLAVLQPQPARPPPYYAVNPNRRIRYPIYEREETNELPAY
                     APAVHELALVSVKQEWASPYEPAVSRSWRTLLMELNSTQLNFYHVDEGLLRGLRGRAA
                     DSTLGVACAQAVSSLSFGQVKAGTLLALGRDERQLSPAHQQHVCARAQRDPERHLCAE
                     RLYKSYSLQYATFGVPMDYTKRSFVLRLRCETEQFLVCFGTVDMLISWSVSLSVGIGV
                     SLDLDHRKMPAYRTVPRRRRRRTRHKRTDNRGRNTALLFSNKLSRRGTVLGLISPSVD
                     RRTLLKYDQPAMGAGGFSNAFIAMATRAPENREMPCDDAASLGQSSAAGELQAGFASR
                     LRTMFWSKKASRGEVQRSRTVHSDTKGLNSSVAESLLGPSASLGARGSEALRCRLSER
                     CVYQSASSSLLQVSEQRAAAHEDQMGSDSSSLESHRQPTPNRSLGSVCEQSRSPTPSG
                     IEHSPVESEEFDFVETGASSESELLPSDHLETSIYEDEGIYHSDDDDDDDDDDDDDDD
                     GAGSAAADTATQDYAARSRALDMEFRQRAHSAASSLSFAPYGYSFSREKWVPPVKEST
                     RRRFVRDSIRCIRPLCDDDTWLGALVVSPSAGPGSSSSGFPFDLGLGSKRLGSRRSLK
                     RGSQSLSGTRAARFMKAYIVGPVGLVASVNDEFNA"
     gene            <522259..>524079
                     /locus_tag="AGOS_AFR050W"
                     /old_locus_tag="AFR050W"
                     /db_xref="GeneID:4621838"
     mRNA            <522259..>524079
                     /locus_tag="AGOS_AFR050W"
                     /old_locus_tag="AFR050W"
                     /product="AFR050Wp"
                     /transcript_id="NM_210951.1"
                     /db_xref="GeneID:4621838"
     CDS             522259..524079
                     /locus_tag="AGOS_AFR050W"
                     /old_locus_tag="AFR050W"
                     /note="NOHBY620; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E23034g"
                     /codon_start=1
                     /product="AFR050Wp"
                     /protein_id="NP_985597.1"
                     /db_xref="GeneID:4621838"
                     /translation="MDKILLKRTLKEILDPDRVEEDIGSGGEDSAPSDSEQAPNDEEE
                     DGSMCVECQDMPVEVLCRDCEEQFCTVCFEMLHRSGRRRRHEFARKDDGTAAGAEAAA
                     GAAAEESGADEEAAEAAEAAGAAAKPEETRADGRLLQLLQEHARYVPMRLTHEERHLL
                     RLLEAALQVSEYTDRVDILSYKSRARRIVEQLKEMCSVLCGLVIASDLKAGQRLVEMK
                     EFSEYAEWFQEVFEIGRRYKVMNPERMRDTFGKLCYMVMDSRLPQIQEHLEFHLYKPI
                     RTVHAFLGDPRDGGKALRMLQDPLVLYATAHISPVGKTRAEINRLIRQKEHAIEQLAA
                     KYSGDVYSKEDVRQALYSFGDYNAYVNMNRKPVMRMLERLELFRQPEVAKRFPLAIRQ
                     GRDGARLTHDHDKQWHYAQQSLSLWSVIQREMIRLWYVADQDLFDGAPYKLVSTGQGL
                     NRVKASPSVYKAMMNILHECRTKCKGWVGSSVVHLGDDAVPNALFFLDKYTQVPNILI
                     PFDQVLMHIKDLVRDDPAMLEYITTQYGSVEELQLVILQDAFAHMFDGSGADNFYMSG
                     SCIDGRLTSAWNHTNEIAKKRYYNIFLMTGFIGFNGGEGF"
     gene            <524254..>525471
                     /locus_tag="AGOS_AFR051W"
                     /old_locus_tag="AFR051W"
                     /db_xref="GeneID:4621839"
     mRNA            <524254..>525471
                     /locus_tag="AGOS_AFR051W"
                     /old_locus_tag="AFR051W"
                     /product="AFR051Wp"
                     /transcript_id="NM_210952.2"
                     /db_xref="GeneID:4621839"
     CDS             524254..525471
                     /locus_tag="AGOS_AFR051W"
                     /old_locus_tag="AFR051W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR129C (ARP1)"
                     /codon_start=1
                     /product="AFR051Wp"
                     /protein_id="NP_985598.2"
                     /db_xref="GeneID:4621839"
                     /translation="MEKRAPSALLHHAHQIPPRTVDPQRRMSSQETLYNQPVVLDNGS
                     GIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRGLLKLRYPLQ
                     HGIVTNWADMEQVWGYVFNKSLQLQNVEDHPILVTEAPLNPHKNREKMCELLFESFNV
                     PALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDIAGRDITE
                     FLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSFSKFKLPDG
                     KTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGT
                     SMLPGFGDRLLKELKSLSGSRTKIKIFAPPERKYSTWIGGSILSGLSTFKKLWVTKSE
                     WEEFPDCIHSRFM"
     gene            complement(<525568..>526266)
                     /locus_tag="AGOS_AFR052C"
                     /old_locus_tag="AFR052C"
                     /db_xref="GeneID:4621840"
     mRNA            complement(<525568..>526266)
                     /locus_tag="AGOS_AFR052C"
                     /old_locus_tag="AFR052C"
                     /product="AFR052Cp"
                     /transcript_id="NM_210953.1"
                     /db_xref="GeneID:4621840"
     CDS             complement(525568..526266)
                     /locus_tag="AGOS_AFR052C"
                     /old_locus_tag="AFR052C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR128W (FUR1)"
                     /codon_start=1
                     /product="AFR052Cp"
                     /protein_id="NP_985599.1"
                     /db_xref="GeneID:4621840"
                     /translation="MKSFSARPAPRAAQHQMSATPSNNVHLLPQTNQLLGLYTIIRDR
                     RTKRPDFIFYADRIIRLLVEEGLNQLPVMPATVETHTAQKYDGVSFLGKICGVSIIRA
                     GESMEQGLRDCCRSVRIGKILIQRDEETALPKLFYEKLPEDIADRYVFLLDPMLATGG
                     SAIMATEVLIKRGVRPERISFLNLICCQEGIDAYRARFPDIKIITGAIDKGLDEQKYL
                     VPGLGDFGDRYYCI"
     gene            complement(<526403..>526810)
                     /locus_tag="AGOS_AFR053C"
                     /old_locus_tag="AFR053C"
                     /db_xref="GeneID:4621841"
     mRNA            complement(join(<526403..526738,526799..>526810))
                     /locus_tag="AGOS_AFR053C"
                     /old_locus_tag="AFR053C"
                     /product="AFR053Cp"
                     /transcript_id="NM_210954.2"
                     /db_xref="GeneID:4621841"
     CDS             complement(join(526403..526738,526799..526810))
                     /locus_tag="AGOS_AFR053C"
                     /old_locus_tag="AFR053C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL147W (LSM7); 1-intron"
                     /codon_start=1
                     /product="AFR053Cp"
                     /protein_id="NP_985600.2"
                     /db_xref="GeneID:4621841"
                     /translation="MNDSEKPRHDQHGQQPKRKFEGPKREAILDLAKYQDTQVRVKLM
                     GGRLVTGVLKGYDQLMNLVLDETVEYLRDEEDASVVTQRTRPLGLIVIRGTILLSLSP
                     AAGGAVVPGPAAE"
     gene            <526957..>527703
                     /locus_tag="AGOS_AFR054W"
                     /old_locus_tag="AFR054W"
                     /db_xref="GeneID:4621842"
     mRNA            <526957..>527703
                     /locus_tag="AGOS_AFR054W"
                     /old_locus_tag="AFR054W"
                     /product="AFR054Wp"
                     /transcript_id="NM_210955.2"
                     /db_xref="GeneID:4621842"
     CDS             526957..527703
                     /locus_tag="AGOS_AFR054W"
                     /old_locus_tag="AFR054W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL148C (ALF1)"
                     /codon_start=1
                     /product="AFR054Wp"
                     /protein_id="NP_985601.2"
                     /db_xref="GeneID:4621842"
                     /translation="MVELEIESELCALRREVALGVGWAQFAEKLHEWTGVDPRDMRLV
                     VTTADGKEQEVDGDVRQRAGTVEQAFPGGVRRVQVQDTNEGSVVHALRREMEGDGGEE
                     AAFRLSDEAYAGRADSVLAWKREQQLGAFDPEVRTRLAQERETQALAAAALPVGARCA
                     VRTRGAPERRGWLRYVGPVDELGAENTWCGVEFDEPVGRNDGTFNGRAYFGPVHSNHG
                     AFVKPTAVAVGPQFAPLADDELRLSDDDEL"
     gene            <527800..>528174
                     /locus_tag="AGOS_AFR055W"
                     /old_locus_tag="AFR055W"
                     /db_xref="GeneID:4621843"
     mRNA            <527800..>528174
                     /locus_tag="AGOS_AFR055W"
                     /old_locus_tag="AFR055W"
                     /product="AFR055Wp"
                     /transcript_id="NM_210956.1"
                     /db_xref="GeneID:4621843"
     CDS             527800..528174
                     /locus_tag="AGOS_AFR055W"
                     /old_locus_tag="AFR055W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL149C (PGA2)"
                     /codon_start=1
                     /product="AFR055Wp"
                     /protein_id="NP_985602.1"
                     /db_xref="GeneID:4621843"
                     /translation="MEYIENFKYNLKESFHLDLHQGFRLLIIVAGYMLLRTQLQKILA
                     NRELKRKLAQDQAEEKRKRERLVEDPNQAPEAESTPFGWGEKARLRARRQEQLLQERA
                     EQLQHEQAGADEDKDIEDLLEE"
     gene            <528349..>529053
                     /locus_tag="AGOS_AFR056W"
                     /old_locus_tag="AFR056W"
                     /db_xref="GeneID:4621844"
     mRNA            <528349..>529053
                     /locus_tag="AGOS_AFR056W"
                     /old_locus_tag="AFR056W"
                     /product="AFR056Wp"
                     /transcript_id="NM_210957.1"
                     /db_xref="GeneID:4621844"
     CDS             528349..529053
                     /locus_tag="AGOS_AFR056W"
                     /old_locus_tag="AFR056W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL151C (RPC31)"
                     /codon_start=1
                     /product="AFR056Wp"
                     /protein_id="NP_985603.1"
                     /db_xref="GeneID:4621844"
                     /translation="MSFRRGGKTSTFSNLPFGLSYSAVGNNESTEKPTIPLPVNNPIN
                     GSERGIAIKYINFLESVRDGPFYTGSMSLSMDETEDSKKRKVKTLVDGGGINDGIERY
                     SDRYVKKRRIGTSVDEHPFSLEFFPKELYQVMGINKRKLLALSKFNKVDDIFTGTEQD
                     DASVIPLMEKLKELAENEDEGDEFKDKNANEFEEELDDDFDDDDDDDYNAEKYFDDGD
                     DDYGGGDDDYGDEPAF"
     gene            complement(<529456..>530610)
                     /locus_tag="AGOS_AFR057C"
                     /old_locus_tag="AFR057C"
                     /db_xref="GeneID:4621845"
     mRNA            complement(<529456..>530610)
                     /locus_tag="AGOS_AFR057C"
                     /old_locus_tag="AFR057C"
                     /product="AFR057Cp"
                     /transcript_id="NM_210958.2"
                     /db_xref="GeneID:4621845"
     CDS             complement(529456..530610)
                     /locus_tag="AGOS_AFR057C"
                     /old_locus_tag="AFR057C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL152W (INN1)"
                     /codon_start=1
                     /product="AFR057Cp"
                     /protein_id="NP_985604.2"
                     /db_xref="GeneID:4621845"
                     /translation="MYMDDRIIGGPEGYLEVFVRKAKDLPNMRKMDKQDPFVRLRIAH
                     LTEVSGTVFRGGQRPVFDFHTVFELTPAMKHLMYVELFDDQKSAPRIIGRCEVDLKPA
                     LYSDHEDGYDRWYQLSLGPDDAGKIYIELTFKQHTIRRKSQIQPEPSPPPMTKTLKTK
                     RSPPLPSEIPYVPFPKDQLQGSISQSGFTYTHGGGMSQPLPALRRSPDTLQYIPRNPA
                     LPQVEQLKLPEFVLSVDTLENFDAHTSQQSEGTGITAKLKQLKEKWNNFKQGSPEQND
                     AARANVDLEELQKVVGVKPDFPKQHGRMRSRHSISSGLQPALPPLPQPSDERTKLPGR
                     RPSPHPDFVPRSPSPGGQMRQSRNLVPLPPLPHEMRNTRSLSPVRRPPVF"
     gene            complement(<530829..>535610)
                     /locus_tag="AGOS_AFR058C"
                     /old_locus_tag="AFR058C"
                     /db_xref="GeneID:4621846"
     mRNA            complement(<530829..>535610)
                     /locus_tag="AGOS_AFR058C"
                     /old_locus_tag="AFR058C"
                     /product="AFR058Cp"
                     /transcript_id="NM_210959.2"
                     /db_xref="GeneID:4621846"
     CDS             complement(530829..535610)
                     /locus_tag="AGOS_AFR058C"
                     /old_locus_tag="AFR058C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL139C (THO2)"
                     /codon_start=1
                     /product="AFR058Cp"
                     /protein_id="NP_985605.2"
                     /db_xref="GeneID:4621846"
                     /translation="MLAVDELNALAREHVPHAREVFTDEFLKDWATNADRLIAEYRTL
                     AKASEQVDFVYRVFAEGLLFTQGALRGLVGDYGPLASLLAALCENSSANARILANLIN
                     CFPRHGGDEANMVELLQQLTGMDFEFSASLVEKLLLHRWAKEQTSLYKRSLISEKYHL
                     KKYNLLFESPLGFSQICMLLHVAYADKDRFQSADYYWRQIQFVAGKYTLDPIRVLDVI
                     LRVSSVHVHHHHEFLVLLLQRSDYWPLQRSDPFAWETLNVGGSAVAAQLIAHKLKNEK
                     FDHRYMDMVCVLIREGFVSYLSIFDSLGPDDETLAKYVDEYYADLCKQSQEGSLNPLA
                     MAAALPDEDDGPPGATDSKGEDKAAQAALSEQKERDEQKQERERKNRQYKVKRTGKWR
                     LVTSCLNHGLLIPALYSIRTNEKTALSIDILVESVLRLFEHMIRPLHEKAINAPSYQP
                     TPRVKMKMTHSGLPSKQGRLIYECLSPNVKEKYLLNTRYVFYYSCWADRLPVIGDVDG
                     LFYHSHEILGLVGSKLSASPTLISMLSSIGVHDILSSENSELVTEKWINYFRKFIFPA
                     LGGLEEDFIANINAYNLLKLFPFEKRYFLYHEMYSKISDSDIFVRLTFNKVQRKVRGL
                     LKSLSIDHIDDKVNEVSRLVSSNPLAALEPIVNQIENYDKVSELVVIAAKGFPDFAYD
                     VLQYVLLLKLTSGRDILQIDGINQHTWIQRLSVFIAGLANSCPKMDLTNILIFTVKNL
                     HKDYNASLPVLKELVSKVGGIQSLNHISWKQLQMLNSGPSLQKTARSRILDTRQENFE
                     AARSITQTFIKIGAISELLVMLCNLNVVSQSPDIHYKILSTKCDDSNSLLWTLIEMFK
                     FTLTREEFLHNVLPFDELVNDYNVPTEWSFFIWRDYIDEMRHEGDSSIKQIDYILEKT
                     EFRHVSFEHLDKPLFTSFWKLTLYDVNFNKELYDETTKALNTKLDRTKLQRDKNAILN
                     EVQEVMSNCLAHQKAFKNVQEMFQDKRSVWFPELTPERVQAYIQFCILPRTLFSSSDA
                     TYSALFTIALLGVHDSIAVFEKMVESHVLGGLLFSCTVSESTNVGFFYGMIIRTFEQA
                     RSEEAFDNSKLSRLHHLYSVLLYDLRLLLSETNYMSIRNTIEFLNQISPIFPVVDEQI
                     REACRSLESKLSDETREDIKLPCNALIGHLKSRMKTACKKQDFYELPKEEQIEIDNFE
                     KEQAKINEYEVAVAKETERKKLEEVKPRKEAAKAVSSTSEKKGTSYSSSSDSKEYEKS
                     QTSEDVRPISYQGTQILENIDSICKLLNSEGVDDLPQYIRVLYFKDEMRKELSNYKGN
                     LDVFRKKLAAILTDYFYSMVKWPNSNPLFAQKAAELEASCMQCGPPTSKATKMKVMAD
                     DLYGDDIPFNTSNTKTAKPQRESRFSDVKVPAAAASEAKPADSKPQLDRFNKNSVKEN
                     PRAQSRFKESAPKQPSPAPKKDEKPSGSRFHNSKPAAPKIPPPKPEPKSVNLRDRVGS
                     RFEGRQDPASRFSGAHSESTRYPQSSARQLEPSPESRFRNVAKDSPRKRPTTDYRYNV
                     DTKRPRKEDEHRRKPNSDRRPDAQPVLPTGPKGSGTFSRFR"
     gene            <535802..>536105
                     /locus_tag="AGOS_AFR059W"
                     /old_locus_tag="AFR059W"
                     /db_xref="GeneID:4621847"
     mRNA            join(<535802..535804,535854..>536105)
                     /locus_tag="AGOS_AFR059W"
                     /old_locus_tag="AFR059W"
                     /product="AFR059Wp"
                     /transcript_id="NM_210960.1"
                     /db_xref="GeneID:4621847"
     CDS             join(535802..535804,535854..536105)
                     /locus_tag="AGOS_AFR059W"
                     /old_locus_tag="AFR059W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL138W-A ((YSF3); 1-intron"
                     /codon_start=1
                     /product="AFR059Wp"
                     /protein_id="NP_985606.1"
                     /db_xref="GeneID:4621847"
                     /translation="MSDKIREERLFQAMKQKHIGLGTDDTSRDEWLTQVHRDTYNSLL
                     GHSALLQYAALSGPTRNKAETRLAMVSRMCGGPATRRAPA"
     gene            complement(<536123..>536731)
                     /locus_tag="AGOS_AFR060C"
                     /old_locus_tag="AFR060C"
                     /db_xref="GeneID:4621848"
     mRNA            complement(<536123..>536731)
                     /locus_tag="AGOS_AFR060C"
                     /old_locus_tag="AFR060C"
                     /product="AFR060Cp"
                     /transcript_id="NM_210961.1"
                     /db_xref="GeneID:4621848"
     CDS             complement(536123..536731)
                     /locus_tag="AGOS_AFR060C"
                     /old_locus_tag="AFR060C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR127W"
                     /codon_start=1
                     /product="AFR060Cp"
                     /protein_id="NP_985607.1"
                     /db_xref="GeneID:4621848"
                     /translation="MVDTHRNLARKRARGGAAEAGGAAGGSLFGRVGQQQRSAGPVGA
                     AGLRVINGKLVRADDVGAQLREFNRAHAGTGRRARRARRVPRETRAVFSSSNYDDGAG
                     RRRLVVSLRSGAQFLTIRNLPIGSRPERLKQVIEAQGLGRVAHLQTLDLASGSAVAEV
                     HVAGADGVRTLQQLVQRFHGAEIDGRRVTAEISSISELQPQP"
     gene            <536984..>538495
                     /locus_tag="AGOS_AFR061W"
                     /old_locus_tag="AFR061W"
                     /db_xref="GeneID:4621849"
     mRNA            <536984..>538495
                     /locus_tag="AGOS_AFR061W"
                     /old_locus_tag="AFR061W"
                     /product="AFR061Wp"
                     /transcript_id="NM_210962.2"
                     /db_xref="GeneID:4621849"
     CDS             536984..538495
                     /locus_tag="AGOS_AFR061W"
                     /old_locus_tag="AFR061W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL138W (SRV2)"
                     /codon_start=1
                     /product="AFR061Wp"
                     /protein_id="NP_985608.2"
                     /db_xref="GeneID:4621849"
                     /translation="MLEANFSIQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKMGS
                     AAGQTSMGSQVSAEGGAAAEAPAHMQEYEQLVDEWVRPLVGAGQQIDAAVGEASQQLL
                     EGFAAQGTLLRAAALARKPEMGSEGFMRALGPLNERIMTLGALKDAQRQSPYFAYLSA
                     VAEGAPAFGWIASETPVSLIGDFKDAAQFWTNRVLKEFREKDANAAEWVRLFLGTFDA
                     LRGYVKAHHATGPTYKSDGVDFMEAFEQVSGVVAAEPAAAAGAPPPPPPPPASVFQAP
                     ADGGSQGINAVFAELNQGENITRSLRKVDRSQQTHKNPELRAASSVPSSAGSRTPPPK
                     PRKPTTLKTRKPPRKELVGSKWFVENYDGEADPIIIETNKDESVFIGRCNNIFIQLKG
                     KVNAVTISESQHCNLLLDSSISGVDVIKSERFAIQVAQQIPQITIDKSDTGVIYLSKD
                     SLQTELFTSSSTSINVNIPTGDDGDFEEHPIPEQLKHTFSNGRLNSAIFEHVA"
     gene            complement(<538633..>540054)
                     /locus_tag="AGOS_AFR062C"
                     /old_locus_tag="AFR062C"
                     /db_xref="GeneID:4621850"
     mRNA            complement(<538633..>540054)
                     /locus_tag="AGOS_AFR062C"
                     /old_locus_tag="AFR062C"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="NM_210963.1"
                     /db_xref="GeneID:4621850"
     CDS             complement(538633..540054)
                     /locus_tag="AGOS_AFR062C"
                     /old_locus_tag="AFR062C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL137C (NAM9)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="NP_985609.1"
                     /db_xref="GeneID:4621850"
                     /translation="MPRKALLLKSLSRGKVRASFNKYNLFNLYKKSQIDLRTKTLYQQ
                     KWSSKQETRAYHGEHLTESRWQSTFSPRLTSVAQLDASLKGGDVAPTPILMQTYAVLE
                     KRLEFALFRAMFASSVRQARQFILHGNVYVNGVTMKHPGYPLKAGDMFSVRPDKVLEA
                     LGARKPSLEQALAIDKQQIRMWNKYVTEARNNPREAWQGKIKQLQSMQASHPERQVFV
                     ELINHNNKQLDEKKLAVLKSTDKESLLCKVLAAAREHDGEKSISAATFRTASYGDAEL
                     AKALFEIYKTLEKSEALKILQDKTAEEQAKIILDSAAPEVSDAMKKKLRTTTSELGAL
                     MQQHDAAIRAFYDGKKGDPATLEMPYDSEWVESLRLHPQLKTKELLEDPAAAQKAVNL
                     PWQKWPYGRQNPNKPYFTPWKPRPFLAPFAILPHHIEVSFKACHAIYLRDPVARPGHS
                     EVISPFPLPVHERAYMYYLRKGQ"
     gene            <540312..>541013
                     /locus_tag="AGOS_AFR063W"
                     /old_locus_tag="AFR063W"
                     /db_xref="GeneID:4621851"
     mRNA            <540312..>541013
                     /locus_tag="AGOS_AFR063W"
                     /old_locus_tag="AFR063W"
                     /product="AFR063Wp"
                     /transcript_id="NM_210964.1"
                     /db_xref="GeneID:4621851"
     CDS             540312..541013
                     /locus_tag="AGOS_AFR063W"
                     /old_locus_tag="AFR063W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL136W (EAF7)"
                     /codon_start=1
                     /product="AFR063Wp"
                     /protein_id="NP_985610.1"
                     /db_xref="GeneID:4621851"
                     /translation="MGVKWSTVDEIRLFKWVAQFKPAGIHKHFHMRCILERLNNPDDY
                     PVTLLQSDEPRKTFSAQDVWEKLAEYYDLQQADLVEGMQVGEDAADDGAPPGGFSLPW
                     GEYGELMLHNARADGAGDDEAEPDAGAARDDADERPRSSAGSTGARTRRQTRQTRSQQ
                     AGSDDEKPSAPPSAPDDAPDDEPDEDGDLPPSKKPRTRAHDDAPGSSASDSPAARTRR
                     KAVNPPVQRRLRTRR"
     gene            complement(<541054..>541398)
                     /locus_tag="AGOS_AFR064C"
                     /old_locus_tag="AFR064C"
                     /db_xref="GeneID:4621852"
     mRNA            complement(<541054..>541398)
                     /locus_tag="AGOS_AFR064C"
                     /old_locus_tag="AFR064C"
                     /product="AFR064Cp"
                     /transcript_id="NM_210965.1"
                     /db_xref="GeneID:4621852"
     CDS             complement(541054..541398)
                     /locus_tag="AGOS_AFR064C"
                     /old_locus_tag="AFR064C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL135C (FPR1)"
                     /codon_start=1
                     /product="AFR064Cp"
                     /protein_id="NP_985611.1"
                     /db_xref="GeneID:4621852"
                     /translation="MSEVIEGNVKIDRLSPGDGKTFPKTGDLVTIHYTGTLENEQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDVAIPKLSVGEKARLTIPGAYAYGPRGFPGLIPPNA
                     TLIFEVELLKVN"
     gene            <542050..>542541
                     /locus_tag="AGOS_AFR065W"
                     /old_locus_tag="AFR065W"
                     /db_xref="GeneID:4621853"
     mRNA            <542050..>542541
                     /locus_tag="AGOS_AFR065W"
                     /old_locus_tag="AFR065W"
                     /product="AFR065Wp"
                     /transcript_id="NM_210966.2"
                     /db_xref="GeneID:4621853"
     CDS             542050..542541
                     /locus_tag="AGOS_AFR065W"
                     /old_locus_tag="AFR065W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR126C (ANS1)"
                     /codon_start=1
                     /product="AFR065Wp"
                     /protein_id="NP_985612.2"
                     /db_xref="GeneID:4621853"
                     /translation="MKFASTVAVFAAASVVYAQHPISQIGDGQIQANTDTAPPTKVPP
                     TTAAPPPASSAPPAAPPAAPPAAPPAPPAQPPKQEPPKSEPPKASSSAPPASSSAPPK
                     PSSSAPPKASSSAPPKVTSAPPAPTTSAPPAIETQSTNAAGNLAASGFFAAGVMAAGA
                     LLI"
     gene            complement(<542945..>544057)
                     /locus_tag="AGOS_AFR066C"
                     /old_locus_tag="AFR066C"
                     /db_xref="GeneID:4621854"
     mRNA            complement(<542945..>544057)
                     /locus_tag="AGOS_AFR066C"
                     /old_locus_tag="AFR066C"
                     /product="AFR066Cp"
                     /transcript_id="NM_210967.2"
                     /db_xref="GeneID:4621854"
     CDS             complement(542945..544057)
                     /locus_tag="AGOS_AFR066C"
                     /old_locus_tag="AFR066C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YNL134C and Non-syntenic homolog of Saccharomyces
                     cerevisiae YCR102C"
                     /codon_start=1
                     /product="AFR066Cp"
                     /protein_id="NP_985613.2"
                     /db_xref="GeneID:4621854"
                     /translation="MSIPATMKAVVIHSDQCIVKDDLPVPKLGMNMALIKTKAVAGNP
                     TDWKHIEFKLGPQGSVLGCDVAGEIVQLGPNSDSKWAVGDTLFTVVHGASVRNPENGA
                     FAEYVRVDLPVCIKLPLGPADKEVLQEGRVETFEGAATMPVTLLTAAQVLCLNFGNKL
                     DWEPAHVQHDHPILIWGGATGCGQYLIQLCRKLNAYSRVIVVASKKHEARLRKFGADE
                     IYDYHDEDVVAQIARDHPNLYHLVDAVSVPETLRLVYKLAPTSAPVKLVQLTHMSAKG
                     TIPEDELKSNVEVGNTMLYQISGEDATIGKITHPASPAYRKQAISFVDFITPKIADGS
                     ILHIPVKVSQGLESVPSIIRDIKQGKTDGHKLVAKL"
     gene            complement(544573..544684)
                     /locus_tag="AGOS_t0138"
                     /db_xref="GeneID:4621855"
     tRNA            complement(join(544573..544616,544647..544684))
                     /locus_tag="AGOS_t0138"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4621855"
     gene            <544975..>546621
                     /locus_tag="AGOS_AFR067W"
                     /old_locus_tag="AFR067W"
                     /db_xref="GeneID:4621856"
     mRNA            <544975..>546621
                     /locus_tag="AGOS_AFR067W"
                     /old_locus_tag="AFR067W"
                     /product="AFR067Wp"
                     /transcript_id="NM_210968.1"
                     /db_xref="GeneID:4621856"
     CDS             544975..546621
                     /locus_tag="AGOS_AFR067W"
                     /old_locus_tag="AFR067W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL111W (CCT7)"
                     /codon_start=1
                     /product="AFR067Wp"
                     /protein_id="NP_985614.1"
                     /db_xref="GeneID:4621856"
                     /translation="MNFGNQAPTIVVLKEGTDASQGRGQIISNINACLAIQDTLKPTL
                     GPLGSDILIVSSDGRTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     IIAGELMKEAKPFLEEGISSHTIMKGYRKAVQLAVKRIKELAVDISGDKVSRDLLERC
                     ARTAMSSKLIHQNADFFVKMCVDAVLSLDQEDLDEKLIGIKKIPGGAMDDSVFVNGVA
                     FQKTFSYAGFEQQPKRFQDPKILCLNIELELKAEKDNAEVRVEHVDDYQSVVDAEWQI
                     ILDKLKQIEDTGANIVLSRLPIGDLATQYFADRDIFCAGRVSTEDLNRVIQATGGAIQ
                     STTSDIRVEHLGTCATFEEMQIGSERYNLFQGCPEAKTCTLLLRGGAEQVIAEVERSL
                     HDAIMIVKRALQNKLVVAGGGAIEMEISKYLRDYSKTIAGKQQLIINAFAKALEVIPR
                     QLCENAGFDAIEILNRLRLAHSKDEKWYGVDFETENIGDNFAKFVWEPALVKINALSS
                     AAEAANLILSVDETIKNKESEGANAGMTGPGARGRGIPMH"
     gene            complement(<546698..>547312)
                     /locus_tag="AGOS_AFR068C"
                     /old_locus_tag="AFR068C"
                     /db_xref="GeneID:4621857"
     mRNA            complement(<546698..>547312)
                     /locus_tag="AGOS_AFR068C"
                     /old_locus_tag="AFR068C"
                     /product="AFR068Cp"
                     /transcript_id="NM_210969.1"
                     /db_xref="GeneID:4621857"
     CDS             complement(546698..547312)
                     /locus_tag="AGOS_AFR068C"
                     /old_locus_tag="AFR068C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR035W-A (DID2)"
                     /codon_start=1
                     /product="AFR068Cp"
                     /protein_id="NP_985615.1"
                     /db_xref="GeneID:4621857"
                     /translation="MARNPAAGLENTLFQLKFTAKQLTRQAAKAAKEEKQETNKLKKI
                     IGESEEIARLYASNAIRKRNERVQLLKLASRVDAVVSKVQTAVTMRQVSGSMAQVCKG
                     MDRALQSMNLQQITMIMDKFEQQFEDLDTSVNVYEEMGQNVDAVVVDNDKVDELISQA
                     ADEKGLELKQSAQLGELPRVQNAPAEVTEDKEDKLAQRLRMLRG"
     gene            complement(<547567..>548493)
                     /locus_tag="AGOS_AFR069C"
                     /old_locus_tag="AFR069C"
                     /db_xref="GeneID:4621858"
     mRNA            complement(<547567..>548493)
                     /locus_tag="AGOS_AFR069C"
                     /old_locus_tag="AFR069C"
                     /product="AFR069Cp"
                     /transcript_id="NM_210970.2"
                     /db_xref="GeneID:4621858"
     CDS             complement(547567..548493)
                     /locus_tag="AGOS_AFR069C"
                     /old_locus_tag="AFR069C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR034W (DAL80) and YJL110C (GZF3)"
                     /codon_start=1
                     /product="AFR069Cp"
                     /protein_id="NP_985616.2"
                     /db_xref="GeneID:4621858"
                     /translation="MLSTSASGGAGGEVITGGAEVRDGDAESRGDGRGAGAGCPVCQN
                     CHTSTTPLWRRDEHGAVLCNACGLFLKLHGRPRPISLKTDVIKSRNRKAGHEEKRRRE
                     GGEGSGPAERKRGRAEPGALPQLAQLLNGVPEAEPPTDARPGSALHGPGPARGPAYKS
                     PINMLLNDKPQDAGFQPAASPAASVLRAPSLTPVPAAPAYHAFSPRSQPPSQDHTAYL
                     HAGLLHPQGLRDGAPFAPADIASYSSSAQIIKPAPDTATPLSQVLHSQEEVIRLKTRI
                     NELELINDLYKRHIFELNDRCKMLEMKHQLQK"
     gene            <548779..>549189
                     /locus_tag="AGOS_AFR070W"
                     /old_locus_tag="AFR070W"
                     /db_xref="GeneID:4621859"
     mRNA            <548779..>549189
                     /locus_tag="AGOS_AFR070W"
                     /old_locus_tag="AFR070W"
                     /product="AFR070Wp"
                     /transcript_id="NM_210971.1"
                     /db_xref="GeneID:4621859"
     CDS             548779..549189
                     /locus_tag="AGOS_AFR070W"
                     /old_locus_tag="AFR070W"
                     /note="NOHBY622; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0D04950g"
                     /codon_start=1
                     /product="AFR070Wp"
                     /protein_id="NP_985617.1"
                     /db_xref="GeneID:4621859"
                     /translation="MTDTRDRAPFPYGIKSFDFHTYIPLADPAPALRFRDAVCSEFQD
                     ALRSGAANAYEPHMGSIGPHVEAGLGMFEFDVCDADVFTRMLHFFQLNHGPLSVLIHP
                     RTERGELWDHTEGALWLGAQVALDLGALADEAHL"
     gene            <549254..>553987
                     /locus_tag="AGOS_AFR071W"
                     /old_locus_tag="AFR071W"
                     /db_xref="GeneID:4621860"
     mRNA            <549254..>553987
                     /locus_tag="AGOS_AFR071W"
                     /old_locus_tag="AFR071W"
                     /product="AFR071Wp"
                     /transcript_id="NM_210972.2"
                     /db_xref="GeneID:4621860"
     CDS             549254..553987
                     /locus_tag="AGOS_AFR071W"
                     /old_locus_tag="AFR071W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR031C (SPO14)"
                     /codon_start=1
                     /product="AFR071Wp"
                     /protein_id="NP_985618.2"
                     /db_xref="GeneID:4621860"
                     /translation="MGSDDGESAHSVQYFGSATQLAGERPTQKASVIPGIYAEAEELG
                     GEGGGEDVGEAEHECPLLGARGEEVEDQEAEYKNLVFQGVPNSTITTMERGFTRRGSA
                     GKRRSGSVGENTPTWLAKMNPQDSFTGWKKEFGQAFKKISKLTSRRSASRGAGRAKTD
                     HESVASAGITEEEMIIQNMASDLIATLLAGCPGALFAGSGFLRDEHGVRRAPLLLAML
                     SVRVSPVTNSDTLLSLQRVSSATTSTTNASSVSHVEKQDGGIAIVDQGYHTKYKLELE
                     YGVGDNRLKWIILRSYKDLASLHGKLKLVSFQQNTLNKLYIDHNRYQRIHLPHFPRFD
                     DYMKKAKKGPASVPSPQDHPRTSESSSNTPRSSLNFEAKRFHMKHIQDLIDETDDVKK
                     PMHKRIEKYLRLLNLSLSLRPQANRLFQFYELSPISNLLSYESGFQGKQGYLIIRSSA
                     KAQGWRVSHFRFNDWRAMIERHTNKWFLVRHSYIMYVSDMCSTTPLDVFLVDSKFKVT
                     CSGNFLEDNNLYEEDPLEDKQKKISTKLLITLENSERKLQMIAKSEYMLKIWVSSIIQ
                     MQKNTIWANHQRFGSFAPVRRNCFCHFLVDGRDYFWALSEALTMARDVIFIHDWWLSP
                     ELYMRRPVQSNQQYRIDRVLKERAEAGVKIFIVVYRNVGSTVGTDSLWTKHSMLSLHP
                     NIHLIRSPNQWLQNTYFWAHHEKMCVIDHTIAFMGGIDLCYGRYDSPEHVLRDDASDL
                     QQQNFPGKDYSNARICDFHDLDKPFESMYDREVIPRMPWHDVHMMTVGEAARDMSRHF
                     VQRWNYLLRQKRPSRPTPLLTPPSDFTPEELENSEFFRNLNSRSTCEVQILRSAGNWS
                     LGLQETEKSIQAAYLKLIETSKHYIYLENQFFVTASNWDGVFIENKVGDAIVDRIIKA
                     NSEGKLWKAFILIPLMPGFDSEVDQPEGSSIRVIMQCQYQSIARGETSIFAKLRRLNI
                     DPLQYIQFYSLRKWSTLGQYDKLVTEQLYVHAKVMIVDDRSCIIGSANVNERSMLGNR
                     DSEVAAIIRDTELVKSKMNGEDYYAGRFALELRQRLMREHLGCDVDLVEIIERKFSRL
                     EHVALANVETLNLLSREGAAHSNKELKIQSAMLEIGFREVMNEQCSDMWLEKYGSGQV
                     KNFGIEVDHNIYMDSDNVPEQFLYNNSNHKKTPLPSKKGRQHGRRRYNSKPKYHSFNN
                     RAGEANVGIRDKKPISTDSRLVGNETHMKDVEGLGPDGWKNVTRKFKENVTQQLMDWA
                     TEVMNIQSIDGKKENQNNTNISFLPDKEDVMQYLQDSGIPDINKWNMLKRICYLQHLS
                     YKKETKLTEHKKLSKDTADTIQRTLDFLGEEEMDDDAVDIMLAQMVPPIGGENKQPFA
                     NLHFMDPYAFEDPIVDSFYEDMWFAVALRNTLIYRMVFHCQPDNSVQTWRDYKDFQKL
                     SQGFDELQRKMIEMEYGEKVTILDDISENMSNISLEKGTKIKSVPPDIADSLSMDADL
                     PPHHQQAVKTGAVRAPTHTKMKLSSSLLYGINQKIFDRHTARRLLERINGHLVIFPTD
                     WLAKEVESKNWFYNADRLPPIDIYD"
     gene            <554618..>556216
                     /locus_tag="AGOS_AFR072W"
                     /old_locus_tag="AFR072W"
                     /db_xref="GeneID:4621861"
     mRNA            <554618..>556216
                     /locus_tag="AGOS_AFR072W"
                     /old_locus_tag="AFR072W"
                     /product="AFR072Wp"
                     /transcript_id="NM_210973.2"
                     /db_xref="GeneID:4621861"
     CDS             554618..556216
                     /locus_tag="AGOS_AFR072W"
                     /old_locus_tag="AFR072W"
                     /note="NOHBY623; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F21252g"
                     /codon_start=1
                     /product="AFR072Wp"
                     /protein_id="NP_985619.2"
                     /db_xref="GeneID:4621861"
                     /translation="MQNRPSIVVCEHHRSTRGERTGSHGRPGINRVNSSAPPSKLRGN
                     GEVTGTVELYPVLENQEESATTRSSACTGPTPRKQVKEFRIPNKLNAERIVNGKLLQK
                     RLKPSLLDTETRRGYSAFEHTNPRGMHAPLNIYFNGHGKATPATNAAMYREQPRAGTW
                     KYRPGYLGPPSAARALPTDRKNFFRIGIDTSPLTERNGHYSSVLPGGASTDVECDDDV
                     PAACKIELTINDDIQSPGVLDENEIGTNTRDSSTAHMSQLNRTPDSPSSQVDPHLENK
                     PILDYFSGMIATFRDGSLQAKNKANALKSRFASYTEAAKLSQTVLPDKLNSTDFTKSP
                     SPEGDAAGQSPLQRSDFMASTPRTLQKLYVEFENLNSKRDDLADGPIELKFWLKQDFS
                     TRLLQDQLNNELRMIQRFSSSGQTIMVNQVTSFLKRQGSRDITDDEYQSLTIQSSPKV
                     SKEGSNCSPSYNFEDLISGKKWPPERPGKSSVFHQIKDDRLRYNLEETYAIAENLWKK
                     AEIGQLEMVSNKVHLSRHTGCVSR"
     gene            complement(<556329..>557063)
                     /locus_tag="AGOS_AFR073C"
                     /old_locus_tag="AFR073C"
                     /db_xref="GeneID:4621862"
     mRNA            complement(<556329..>557063)
                     /locus_tag="AGOS_AFR073C"
                     /old_locus_tag="AFR073C"
                     /product="AFR073Cp"
                     /transcript_id="NM_210974.1"
                     /db_xref="GeneID:4621862"
     CDS             complement(556329..557063)
                     /locus_tag="AGOS_AFR073C"
                     /old_locus_tag="AFR073C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR030W (GMH1)"
                     /codon_start=1
                     /product="AFR073Cp"
                     /protein_id="NP_985620.1"
                     /db_xref="GeneID:4621862"
                     /translation="MSSLPRSMQDLREVQSKPRVPLVIRRLFKSPRNLDFEAAMWEMV
                     HLIFKPRKAFRSAYYQRQIKHRLSRDDPSFFILQVILLIATSLTWSIGYGHTFSGFLK
                     MMINMILVDFFLLGFTMATFFWVLLNRPQLKFRSAQDSTVEWAYCFDIHCDAFLIIWV
                     LLYFLQFLLLPVINLHRWIGLFVGNTLYCAAIGYYFVLTFYGYSQLSFLKNVNFILLP
                     SLFCVILYLVSLFGIDLSNYLSFSRY"
     gene            complement(<557299..>562623)
                     /locus_tag="AGOS_AFR074C"
                     /old_locus_tag="AFR074C"
                     /db_xref="GeneID:4621863"
     mRNA            complement(<557299..>562623)
                     /locus_tag="AGOS_AFR074C"
                     /old_locus_tag="AFR074C"
                     /product="AFR074Cp"
                     /transcript_id="NM_210975.2"
                     /db_xref="GeneID:4621863"
     CDS             complement(557299..562623)
                     /locus_tag="AGOS_AFR074C"
                     /old_locus_tag="AFR074C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL109C (UTP10)"
                     /codon_start=1
                     /product="AFR074Cp"
                     /protein_id="NP_985621.1"
                     /db_xref="GeneID:4621863"
                     /translation="MSSLKEQLAQVAASNATVALDRKRRQKLHSASLIYNPKTAATQD
                     YDFIFDNATSALEELVEIDVRFKVFSRSLFSASSVNIDRNTQTKEQVRTLDQAVNAYL
                     MLASAWWHLTPTLHATEWLVRRFQIHVHNAEMLLLSTLNYYQSPVFKRILNIVKLPPL
                     FSSLANFAKAESVPSNLTIVKLFNDMDFLTLYTSYVGKVVKQKVTYTNQLLFNSCAFI
                     NLVAFNSNSEEKLERLVPILLEVCAKLLASPSDDCQMAAHTVLVVLVTALPLKKQILL
                     AATETILANLADSASTKRCAFVTVCKLFQTLKGHGNVDQLPANIYTLFDSKISNDCLI
                     DFLSKKETPADKFVTSYVRSIARYDHGKLNSIVSILKQVKLEKFEVRLIITDLIHLSE
                     LLEDKSQLIQLFEFFISIDEDMVLRCLHSLNLTGELFEIRLTTSLFSAERIEPVNGED
                     VVKGLEASKVAGLAGGAQPFTEFLNKNSAYICTKNISLLVEDDEQASKLLSLFVESVG
                     KKYQPGLFLSSFFTTLESRITFLLRIIVSPGAPVALRLISVSNLSKLIHTIGNDTNVF
                     TLVPVLIVALTDISKNVRAAVKKVLHQISKRPFTKRYFLNDKIYGEGQSVPMLNPKES
                     ESWLKTFLDGYLVENYDISQLLIPKKNEKMYLLFWANQALYMPLPQPKLVLMRFLARH
                     ESFSSTYSQLWENFLSSYLEQRPQWELKCSKNKTNFCEFESVLVLLLSKKEKNPAAIE
                     FLLGALKSPFEQLASIMAKRLIEIYPTLKQPVQCQIVQDIIESTASADLSYDSIETLQ
                     SLALSADVVVSVIKQNMINVDETSNIIKKRRRRSSASNKAALQKEEVSRIAEIHLRKL
                     TILLEALDKIKVQGSEALLTSLFDILADLDTLDNDGGLPVLYAQETLASCMLHTIDSL
                     RATGATPKLRSVRTDILVAAIRASSSPQVQNKLLLVISALALLNPELVLHSIMPIFTF
                     MGAHSLRQDDEFSTMVVEKTVKTVVPALLESGSSSMTDEIEFLLMSFSTAFSHVPKHR
                     RVRLFTTLIKTLQPSSSIAPFLFLLSQQFSAKVENFEIAESKSILEFSRSFMSKFAVL
                     DQLTGIAGLFELVKLLSEPDLKDKTSPRTLLSNGILNYTPSEMFNYKRNTFDFMDKIL
                     AEDNQGGNKGENNLKLKLLSALLDPQTEEQVKSDVKDQFAKVLQHNLVFINNVEELCS
                     TQDLTEQGKSDGDESGSEPDNDNPVADMTEILFSLLGHILDLLPISTFVESILPLLGK
                     DTEDIIRKHLTLVIGTKFESEPNSSATYANMTASSLLAIVTDEAEAPGVVQAALNTTS
                     TLVSKFGDRLDASTLTECLKIGVQKLNSSSTDIVVSALAVLTNTVHVLGVKSIGFYAK
                     IVPRALAIFDSVQDTKSDLRKEVQLSVVLLFAAMMKRIPSFLQSNLKDVMRAIFFADE
                     VQNSISLYVISLLVQQLDLKEVLKTLYRIWTTDISKTGNSVAVSLFLTTLESTVEAID
                     KKSATSQSPTFFKLLLAMFEYRSVSTFDNNTISRIEASVHQIANIYVLKLNDKIFRPL
                     FALTVRWAFDGESVSNLQITKVERLTAFFKFFNKLQESLKSIITSYFTYLLEPTNALL
                     NDFHSGAVSDTNLRRLTLTALTASFKYDRDEYWKSTARFELLAESLVNQLANIEDSIG
                     KYLVKAIAALASNNAGVDEHSKLLHRALVEHMKASCATSQKLWAVKATKLIYAKVGEH
                     WLVLLPQLVPVIAELLEDDDEEVEQEVRTGLVKVVETVLGEPFDRYLT"
     gene            complement(<562944..>565166)
                     /locus_tag="AGOS_AFR075C"
                     /old_locus_tag="AFR075C"
                     /db_xref="GeneID:4621864"
     mRNA            complement(<562944..>565166)
                     /locus_tag="AGOS_AFR075C"
                     /old_locus_tag="AFR075C"
                     /product="AFR075Cp"
                     /transcript_id="NM_210976.1"
                     /db_xref="GeneID:4621864"
     CDS             complement(562944..565166)
                     /locus_tag="AGOS_AFR075C"
                     /old_locus_tag="AFR075C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL108C (PRM10) and YJL107C; YJL108C and YJL107C represent
                     one ORF in this genome"
                     /codon_start=1
                     /product="AFR075Cp"
                     /protein_id="NP_985622.1"
                     /db_xref="GeneID:4621864"
                     /translation="MGKNKKQAAEGEEARRGSESSGSSAEPSGAVAELPSFKKTAGGA
                     RSGLIEQDAVDTIREQTAVKFADEDEVVEQDEAAQKTEAVASESSSLADKEECDESKL
                     DHFRKFFRRTSSRSSDEGEGGGMMERFINMTGGGMVPVVTEAPEEDEEAGPDPTAEAE
                     AAAREIMKAHHLSSGQSVDMMSMSSSGESGFFMPVAEHYDDEYNPEQEEEQRDDMSEA
                     TYVPPPQHVRGGVLGSLLRLYQNQPGGQAPQRPGLRKSAQTLSSETLPTGESYEMPKF
                     KAKRPRGSKIPNPIKLKRKSAMSEARITVHIADLLQRHRFILRLCKAFMMYGAPTHRL
                     EEYMVMTSRVLEIDSQFLYLPGCMVVSFGDTITRTSEVQLVRCSQGLNLWKLHQVHSI
                     YKQVVHDIISVEDASRTIETIMAEKNLYPAWMCVLLYGFCASMVTPFAFGGDWINLVV
                     SFGIGCCVGLLQFIVAQRSHVYSNVFEITASIVVSFCARALGSIPNSNICFGSTVQGS
                     LALILPGYIILCGSLELQSRSLVAGSVRMFYAIIYSLFLGFGITLGAALFGWIYRDAT
                     NETVCEKELSPWFRFIFVPGFALGLSLINQARWSQIPVMVCIACSGYVVTYWSGQHFT
                     ASTEFTASIGAFVIGIMGNLYSRIWKGLAMTAMLPGIFVQVPSGIASKSTLLSSVQSA
                     NNMVSNGTNAAVNSVDGRTSISFGITMIQVCIGISVGLFASTLVVYPFGKKRTGLFTL
                     "
     gene            <565674..>568136
                     /locus_tag="AGOS_AFR076W"
                     /old_locus_tag="AFR076W"
                     /db_xref="GeneID:4621865"
     mRNA            <565674..>568136
                     /locus_tag="AGOS_AFR076W"
                     /old_locus_tag="AFR076W"
                     /product="AFR076Wp"
                     /transcript_id="NM_210977.1"
                     /db_xref="GeneID:4621865"
     CDS             565674..568136
                     /locus_tag="AGOS_AFR076W"
                     /old_locus_tag="AFR076W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL106W (IME2)"
                     /codon_start=1
                     /product="AFR076Wp"
                     /protein_id="NP_985623.1"
                     /db_xref="GeneID:4621865"
                     /translation="MKYYSKKGHREQAEAMGVPPDVNNPPFYIPLKPVEGRYKLIQEL
                     GNGSFGSVTLAKAQFEISQINGKEGTLMDQSIIPTIREENWNNKNKGLVAIKTMMTRL
                     PTLNDYTRVREIKFILQIPAHAHLVQIYELFIDDSLYQLHIVMECMEQNIYQLMKCRK
                     RRVFSLPTLRSILSQILSGIRHIHAHNFYHRDIKPENILISPANRYYSKEWISAGHYP
                     DNYVVKIADYGLARHVTNKSPYTAYVSTRWYRSPEILLRQGSYSRPLDIWAFGCVAVE
                     VATFKPLFPGADEMDQIWKILELLGTPHPCHESKISGYVPHGGAWLQAEHLASRLNLK
                     FPYVEGKDISWVMCNPQLESLCDVVRACLVWNPDDRATVEDLSQMPYFAGTIVQETKQ
                     PPLSTAQSALMFAGLLPSSGLQHRRLIFNDNANNHNSNNSNGSNNATTTTTTTMTTNM
                     TAATTKKTTRTGGPVNRKRETNDENDVESLAHPIPIKRTLANLLSFNKEEPQLSFREF
                     LKETSADKAKPNASNSNSGNCAANQLGHSNHNINNYLNRNNNSGTQHGPSYNNYGQNL
                     NQQSGSSNHSGNGRNPTNNTHAVNTAITQTNTNKTNPTNNNTNNNNNTPTPTTTTTTT
                     TTTPTPATTTTTITNHNGQHDDNDNDKSNFRNVGDGRAASDSTLSGPEELTKEISANI
                     ELYQEPPPLAEEQPLYDDIFGTTENIELDEDGDDDDPEDEDVSFILMYKNAVNQGGAG
                     ATQRENIEPLARNYIHESTHQNCHAIDEMSIDDASTDSHSQIPRDFIMEPTTIPQHDI
                     LPPAQVRHEPTPNHSFEDGLSF"
     gene            <568932..>571310
                     /locus_tag="AGOS_AFR077W"
                     /old_locus_tag="AFR077W"
                     /db_xref="GeneID:4621866"
     mRNA            <568932..>571310
                     /locus_tag="AGOS_AFR077W"
                     /old_locus_tag="AFR077W"
                     /product="AFR077Wp"
                     /transcript_id="NM_210978.2"
                     /db_xref="GeneID:4621866"
     CDS             568932..571310
                     /locus_tag="AGOS_AFR077W"
                     /old_locus_tag="AFR077W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR029C (SET3) and YJL105W (SET4)"
                     /codon_start=1
                     /product="AFR077Wp"
                     /protein_id="NP_985624.2"
                     /db_xref="GeneID:4621866"
                     /translation="MRPSTNSDSAAYHPEEQSLLEDASTLLMFSKSNHGGGRATRAAG
                     AEQQRQAAGSTREGSGEPPASADAPLKSPGPALVALLEPEPASAAGDSSRRHSRTSST
                     SSSASNKGKVAAAALAAAAEVPFPVKRTRDEAQRPDRQRQSSLSSVKPESRGSWSARE
                     EWPVSDSYIVDPDEGIITCVCGYNDDDGFTIQCDHCYRWQHATCYGIEDESAAPDDFL
                     CKVCSPRNIDVKAAKRKQQERIKNNRRRRRGASAEDKPVKEHSAGAIDTPASEGNDVS
                     NTTPVSHSPSVAAAELSNKQPFMNAKEAYPAVYLPLDTYDIKDKYVVMFLDRHSDDDW
                     VTPYNKRTFKPLPLEIRAYSEPSHSRVFHGFPKLGVYSQQPCAKDTLIAEFLGEVDFQ
                     RKYLEDPRNNYRLLGIPNPKVLFHPHWPIYIDARLCGNLTRYLRRSCYPNVELVTIKM
                     PADDRQASDVKTNKSVKFVLKALRDLERGEELHIKWDWDLRHPIWRVINGAAVESIAE
                     PEKYLLIHSVDTVLSICDCACGSNNRDCHLLKVKKFSQTLYRSVKSKMNNRYKLNEIL
                     QKGKVQNRRQTPILSSLAHEAITNSARAHEVLVKLNATKLNFLSSRGKGERNTSFMVT
                     KPPSSLKPETVDSGHKPLNGNAKDAQPYKWRLLGKYLEQRASSVLSGSPIKLLSSPAN
                     YSETNITDLQALAIPVEVQISASAPKPAPSVDLPRPSSERSDTPVANVPTSVEATAHH
                     VPVSVSPLAEAVSVGAVVNAVAGPAAANAGSGVQNSKKKLSFADYKKKVKPT"
     gene            <571599..>572009
                     /locus_tag="AGOS_AFR078W"
                     /old_locus_tag="AFR078W"
                     /db_xref="GeneID:4621867"
     mRNA            <571599..>572009
                     /locus_tag="AGOS_AFR078W"
                     /old_locus_tag="AFR078W"
                     /product="AFR078Wp"
                     /transcript_id="NM_210979.2"
                     /db_xref="GeneID:4621867"
     CDS             571599..572009
                     /locus_tag="AGOS_AFR078W"
                     /old_locus_tag="AFR078W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL104W (PAM16)"
                     /codon_start=1
                     /product="AFR078Wp"
                     /protein_id="NP_985625.2"
                     /db_xref="GeneID:4621867"
                     /translation="MAHRVLVQVIFTGARVFGRAFTEAYKQTAAQMAKQGTSSAARSQ
                     GGMTNEYGGITLDESCKILNIEENGPEMNLDKVEQRFKYLFDINDKEKGGSFYLQSKI
                     YRAAERLKWELAQREQADKGASAHPQDQQPGPQN"
     gene            complement(572250..572490)
                     /locus_tag="AGOS_AgSNR37"
                     /old_locus_tag="AgSNR37"
                     /db_xref="GeneID:4621868"
     ncRNA           complement(572250..572490)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR37"
                     /old_locus_tag="AgSNR37"
                     /product="AgSNR37"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR37; start and end coordinates are
                     approximate. Similarity is partial. In synteny"
                     /transcript_id="NR_149380.1"
                     /db_xref="GeneID:4621868"
     gene            complement(<572660..>574009)
                     /locus_tag="AGOS_AFR079C"
                     /old_locus_tag="AFR079C"
                     /db_xref="GeneID:4621869"
     mRNA            complement(<572660..>574009)
                     /locus_tag="AGOS_AFR079C"
                     /old_locus_tag="AFR079C"
                     /product="AFR079Cp"
                     /transcript_id="NM_210980.1"
                     /db_xref="GeneID:4621869"
     CDS             complement(572660..574009)
                     /locus_tag="AGOS_AFR079C"
                     /old_locus_tag="AFR079C"
                     /note="NOHBY624; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Saccharomyces kluyveri SAKL0D05192g"
                     /codon_start=1
                     /product="AFR079Cp"
                     /protein_id="NP_985626.1"
                     /db_xref="GeneID:4621869"
                     /translation="MQAEAGDLLEDLIEYAKQVSYYVENHADMVPRQTPSPNLECDRS
                     RKGPATPNAHQQPKVDEDRDLQLAKCSLVTSPGEIGDPEWPRHNWEHLQKHPENDLCV
                     IASPGGAKRVFSIEHSGLILRPVSGSRSELSDFRRPGALSEILFQQWKLWEGRLTHYA
                     QAEPLAPTIAWNGLAYRWQDGSYTATGVPDSYKAYYAQYCKYYSRLGYCSNKPCRYVH
                     DRRNRGLCRSVAAGHTCATGRQCPLLHEPNEYIAEDCPAFHAGSCPHTHGAVDTFDRQ
                     RANPLLRAGLCHRVHRAPPAAADHLCRPFAYTSFCFRGLQCPFLHLKLCPDFYSTGTC
                     FILGCQLYHELPEPYCRPASLAALEPAMYLLPPWGQSATTPLPSVWYGLRSLQQSLDE
                     AGAAQALARLGAVALQASGNSHREEACSTDVSTDYSSADSLHINSDVECNNEDFVRL"
     gene            <574181..>575698
                     /locus_tag="AGOS_AFR080W"
                     /old_locus_tag="AFR080W"
                     /db_xref="GeneID:4621870"
     mRNA            <574181..>575698
                     /locus_tag="AGOS_AFR080W"
                     /old_locus_tag="AFR080W"
                     /product="AFR080Wp"
                     /transcript_id="NM_210981.2"
                     /db_xref="GeneID:4621870"
     CDS             574181..575698
                     /locus_tag="AGOS_AFR080W"
                     /old_locus_tag="AFR080W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR023W"
                     /codon_start=1
                     /product="AFR080Wp"
                     /protein_id="NP_985627.1"
                     /db_xref="GeneID:4621870"
                     /translation="MNEAAATRYAVERIPMLVPLDEVSIKELCSSILTRANGNLEIVA
                     EELLEILGHTSEAYEFVFRFNEALSGATGSTAGQSEADEKANRNASGRKLPIIMLNDT
                     DITEDVVPDCPPEYDQEEAAEIAVSERLASHKTQGSKLHTLQEIDEALKALELRGSGS
                     DGNASYKCNCQATMHPLFELAPNCLNCGKIICCREGLHMDSCSYCGTLLIPKQQQRDI
                     EKVLQRERELVKAKRQETGSTGKKKEKVFKISNAKGRNMFSEQERLFDKLDRQREREM
                     KRNQVLGAEDMSQEEDSILKAEEVDPELRAAQARLENLLHFQDTSEERTKIIDTASDY
                     SMSNDAGIWGSAYEKAMALKRQQHNLRQWEKSERERNGRRDKIKLDLVLEKDGKVRFE
                     ESRVPGTRRGLTEDDIDELSDPDEREELQDIKELRKRINAEKQAEKESLLGNTWDFEK
                     DKSRFRKPVYVGPGPADDDDSKQDLDSEETLQQHSRVQLDSADDKSVEESILAFL"
     gene            complement(<575785..>577233)
                     /locus_tag="AGOS_AFR081C"
                     /old_locus_tag="AFR081C"
                     /db_xref="GeneID:4621871"
     mRNA            complement(<575785..>577233)
                     /locus_tag="AGOS_AFR081C"
                     /old_locus_tag="AFR081C"
                     /product="AFR081Cp"
                     /transcript_id="NM_210982.2"
                     /db_xref="GeneID:4621871"
     CDS             complement(575785..577233)
                     /locus_tag="AGOS_AFR081C"
                     /old_locus_tag="AFR081C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL103C (GSM1)"
                     /codon_start=1
                     /product="AFR081Cp"
                     /protein_id="NP_985628.1"
                     /db_xref="GeneID:4621871"
                     /translation="MTKRISAEEKLNRKPISRACVFCHEKHLQCDVGRPCQNCEKRNI
                     GESCRDNVRKVRKTRGRTPRSGVMNLRRARREHEDELAIATKSRGAGEPGSTGLPQVP
                     SLSTLFDANVDPVIDEELLPATYVDPLGPSDVELPTSGAESFGSVWASSEYTKLNEIL
                     GSPGIERPRKHVPSKYEPFAVPATAEHSPSPSTPIELLQDHAGLLFRNTLRRHISLDT
                     AQSSYQASTQDTQASTVASSVSCEGAQFPASEAEYTSPYSFRQLVRSPEDLYRHQNSI
                     FPHNYRQAYLELLNILRARFLSAQDEIAREEGPKQLHSIAQSIKTYYAPIFVTLTSNL
                     IESDLKMHELILQRTLLEYENMSKMVNCIPMCIWRRSGEICYVSNEFISLTGFSRREL
                     LMRRRFIMEFFDNHGIVDYFKLFNEYLAFSSKEGFSSTSDGQAVFSECNLLMANNSFL
                     KCACIWTVKRDSFNIPMLVMGQFLPIFDMDHT"
     gene            complement(<577594..>579726)
                     /locus_tag="AGOS_AFR082C"
                     /old_locus_tag="AFR082C"
                     /db_xref="GeneID:4621872"
     mRNA            complement(<577594..>579726)
                     /locus_tag="AGOS_AFR082C"
                     /old_locus_tag="AFR082C"
                     /product="AFR082Cp"
                     /transcript_id="NM_210983.1"
                     /db_xref="GeneID:4621872"
     CDS             complement(577594..579726)
                     /locus_tag="AGOS_AFR082C"
                     /old_locus_tag="AFR082C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR024C (DBP7)"
                     /codon_start=1
                     /product="AFR082Cp"
                     /protein_id="NP_985629.1"
                     /db_xref="GeneID:4621872"
                     /translation="MSDNDGLMLMNFTTESGPDNASSHRRVKVTGGKWKERRKLKMKL
                     EGRPLRPKRPAAAVEEAPAAAVPEGSAIEPAAKRPRGRNERAPKDVPPQPANAQVVSS
                     LFTSTRAITTSVNDHERASNDVAPSNAPLLQDTFEALGVRGTLLEHLTGKMKIQKPTK
                     IQKMAIPEVLNGKADLFLHAQTGSGKTLAFLLPVLQTLLSLEQRIDRHSGCFAMIVTP
                     TRELAAQIYGVISTLAQCCHYLVPCLLVGGERKKSEKARLRKGANFIVGTPGRMLDHL
                     QNTKVAREQLPHSLRYLILDEGDKLMELGFEETLKSILEIVHSVACDNTRFPRLPQRI
                     VHVLCSATRQGTVSKLGDIALTDPKVIAASDSTTDVSTVPDQLLQKIAIVPPKLRLVT
                     LCAAISELSRKAPTETTTRTIVFISCADSVDFHYDVFSGLGGSHRDLVPGTVRELAAG
                     SRALPCFSADSPPNTVFYKLHGSLPQAVRVATLRHFSSDAAATRGKHLVLFCTDVASR
                     GLDLPRVSTVIEMDPPFAVEDHLHRIGRTARAGVAGESLLFLLPGEEEGYMEHIRAHH
                     PRGWELLRYDRDLLAPAFAAPVARSDRPTTATDAAWDSNATTWHLNVERRVLEDPSAK
                     DLAIKGYTSHIRAYATHISQEKRFFNVRCLHLGHLAKAFGLRERPKGMAAHRGKPATP
                     KPKQDDARTKMLRMARQAVAQSNSEFNY"
     gene            <579951..>580724
                     /locus_tag="AGOS_AFR083W"
                     /old_locus_tag="AFR083W"
                     /db_xref="GeneID:4621873"
     mRNA            <579951..>580724
                     /locus_tag="AGOS_AFR083W"
                     /old_locus_tag="AFR083W"
                     /product="AFR083Wp"
                     /transcript_id="NM_210984.1"
                     /db_xref="GeneID:4621873"
     CDS             579951..580724
                     /locus_tag="AGOS_AFR083W"
                     /old_locus_tag="AFR083W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR025W (RPC37)"
                     /codon_start=1
                     /product="AFR083Wp"
                     /protein_id="NP_985630.1"
                     /db_xref="GeneID:4621873"
                     /translation="MEKNLFVIEDEGDALLDDAPLTQVKEELVEVPSAKQDEEDPIVQ
                     EIPINLTRGPCPIYILQYLNKSQKLGKRIEDHPSVAEVRYREKSNVLELDMPLNTDVF
                     FNQDRAKEQWDGVQVQTLRGVGVENAGQYVGLMHDGQMYLMPVERVAQLKPYFKYIDQ
                     EQQKQRKQDDAITQGGGAGSNPRAQVVTMSAKSSSEANQNRLGGSLLAHKIAEEEPIR
                     TLAWKEDTFENFLAEVTSDEARETLVSEEDAATYLAKLL"
     gene            complement(<580770..>581684)
                     /locus_tag="AGOS_AFR084C"
                     /old_locus_tag="AFR084C"
                     /db_xref="GeneID:4621874"
     mRNA            complement(<580770..>581684)
                     /locus_tag="AGOS_AFR084C"
                     /old_locus_tag="AFR084C"
                     /product="AFR084Cp"
                     /transcript_id="NM_210985.2"
                     /db_xref="GeneID:4621874"
     CDS             complement(580770..581684)
                     /locus_tag="AGOS_AFR084C"
                     /old_locus_tag="AFR084C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR026C (GCN3)"
                     /codon_start=1
                     /product="AFR084Cp"
                     /protein_id="NP_985631.2"
                     /db_xref="GeneID:4621874"
                     /translation="MTAEFNITKTYLKFLDDDNEMTMPIAAIEALVTMLKVKNPSTSA
                     EMINAVKSSTLELTTSIPNSISLQAGCDIFMRFVLRNTHLYGDWESCKQHLVENGQLF
                     VSRAKRSRDKIAKIGVDFITDDDIILVHGFSRAVFSLLSYTAEKLIRFRCVVTEARPS
                     GQGKQLYDLLHAKGIPVTMIVDSAVGSIIHKIDKVLVGAEGVAESGGIINLVGTYTVG
                     VLAKNARKPFYVVSESHKFVRMFPLSPDDLPMERDPLDFSRSDESEQLLSPSIDYTSH
                     EHITALITDLGVLTPSAVSEELIKMWYD"
     gene            <581737..>584244
                     /locus_tag="AGOS_AFR085W"
                     /old_locus_tag="AFR085W"
                     /db_xref="GeneID:4621875"
     mRNA            <581737..>584244
                     /locus_tag="AGOS_AFR085W"
                     /old_locus_tag="AFR085W"
                     /product="AFR085Wp"
                     /transcript_id="NM_210986.1"
                     /db_xref="GeneID:4621875"
     CDS             581737..584244
                     /locus_tag="AGOS_AFR085W"
                     /old_locus_tag="AFR085W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL102W (MEF2)"
                     /codon_start=1
                     /product="AFR085Wp"
                     /protein_id="NP_985632.1"
                     /db_xref="GeneID:4621875"
                     /translation="MPWCNTRLRTCGASPKIFLRRVRCPVLLHNWTIGRVSSVSKMIL
                     RFLRSYSKRVDITRVRNIGIIAHIDAGKTTTTERMLYYSGKIKRIGDVDHGDTITDFL
                     PQERSRGITIQSAAISFNWRDNYTVNLIDTPGHADFTFEVIRSLRVLDGCVTILDAVA
                     GVEAQTEKVWKQAAEIPKVCFINKMDRVGAGYSRAVKELIVKLKTRVLLLNTPLFAAR
                     DSSADPVFVGVLDAVNGQLLEWDPEDPDKISAKAVDKECAHYEELVSAREALVETLSE
                     VDEKLVEYFLGEADGDYMKVPVEVLNESIRRATLSQYAVPVLCGASFKNIGVQPLLDA
                     VVDYLPSPAEARLPELSNKDLPVQHHLKNGLLVNKNANLCLALAFKVTTDPIRGAMVF
                     IRVYSGVLNSGHTVYNSSTGVKFKLGKLIKMHANVAEDIKSLHPGDIGVLAGANVADH
                     VRTGDTIVAHCTSKDGIRSFKKAELALRIHPIDIPPPVFSAAVEPRTLGNKKAMDESL
                     TQLTREDPSLVIVRDEETGQTVMNGMGELHLEIAADRLLNEFKAPVRVGKVAVSYKET
                     INTATETKHSETDDGYSFELEVRQYNEEDKVLFSNGWYPLGSDNNYLVIDPNPRFNED
                     NWPFPLKYEAFVNSIISCCIVALQRGGKTAGFPLHSCVIHVKRWRLPLDCAAAASILL
                     TVRPLIISALTSLPTSAFSILEPIMNVEVTVQQQDLGSVVQDLTGARKANILSIDDEH
                     HWADAAVTDKDVHLFHDIAEKQYLPPDSTVFQAKLNKEGQTGKIVKAHVPLKEMVSYM
                     NKLRMLTKGRGSFHMSYLGMERASSDRVDGILEDADL"
     gene            complement(<584485..>586470)
                     /locus_tag="AGOS_AFR086C"
                     /old_locus_tag="AFR086C"
                     /db_xref="GeneID:4621876"
     mRNA            complement(<584485..>586470)
                     /locus_tag="AGOS_AFR086C"
                     /old_locus_tag="AFR086C"
                     /product="AFR086Cp"
                     /transcript_id="NM_210987.2"
                     /db_xref="GeneID:4621876"
     CDS             complement(584485..586470)
                     /locus_tag="AGOS_AFR086C"
                     /old_locus_tag="AFR086C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL101C (GSH1)"
                     /codon_start=1
                     /product="AFR086Cp"
                     /protein_id="NP_985633.1"
                     /db_xref="GeneID:4621876"
                     /translation="MGLLTVGTPLPWEDSRPHIEHVKRNGVEQLLHVLRAAYERNGDP
                     LMWGDEIEYMLYRFRKAQNDVVLSVEHDGVIEELEEKYGATCAECNVSFHPEYGRYMV
                     EATPRRPYRGLAVAEVERNMAARRHLLGMALAQTEVVPLSTTVFARMGCEDFVDLPEP
                     WAHKNSVSRSLYLPDEIINRHTRFPTLTANIRLRRGEKVCINVPMFKDEHTPAHDDTV
                     YERAWFSQEDRESLPASRPGHIYMDSMGFGMGCSCLQLTFSAPNVTMARYIYDSMVPL
                     SPIMLALSAASPFFKGWLAEHDVRWNVIAGAVDDRTPYERNAVPLLPDGSLYGGIESG
                     KTSETQRLIKSRYSVVDLYLGGNKFFSPELNNVPVAINNTVYNRLLENEIFPVDENLA
                     RHFAHLFVRDPLVIFNESLDQYNDSDMGHFENIQSTNWQTVRFKPPTQDATPGNMSVP
                     GWRVEFRPMEVQLNDFENAAFANFVYLLVECMVEFKDDINAYVPMNLVWENMDIAHQR
                     DSVNRRLFYWKNGFSSDIEYDTELYTMDEIFHNKENGLFPQFIDRILRRKGYVKKHWN
                     ELINSSGDLPDRRRLYYYLKLVSDRAKGELPTSASYLRHFVVTHPEYARDSRISKRIA
                     HDLMQSSLRITNLDNSADDIIRYFGLEIGSYLLENGL"
     gene            <587028..>588668
                     /locus_tag="AGOS_AFR087W"
                     /old_locus_tag="AFR087W"
                     /db_xref="GeneID:4621877"
     mRNA            <587028..>588668
                     /locus_tag="AGOS_AFR087W"
                     /old_locus_tag="AFR087W"
                     /product="AFR087Wp"
                     /transcript_id="NM_210988.2"
                     /db_xref="GeneID:4621877"
     CDS             587028..588668
                     /locus_tag="AGOS_AFR087W"
                     /old_locus_tag="AFR087W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL100W (LSB6)"
                     /codon_start=1
                     /product="AFR087Wp"
                     /protein_id="NP_985634.2"
                     /db_xref="GeneID:4621877"
                     /translation="METAQADHLGVRNGLVTECSYDWLRFQDEEQERLVSAQARSRQP
                     SFLSMDTWSRKSLIGRLWNDGMGLLHGARERATPRYEIEYSVFQPASAGAAAEGADEA
                     CGLEHFRCVVSECVEAIKDAGIDLQRIASGSSGSYFAYGTDGSVLGVFKPKDEEPYGP
                     LSPKWTKWLHRTFFPCFFGRSCLIPNLGYLCEAAASLLDRRLRTNLVPWTDTVVLESM
                     NFYDSRDKWFCGWNRRAQRKIGSFQLFLDGYVGADVFLQRYPLPGTYTYSLSAARSGA
                     DGGGFSWTDSTLHQLRVQLEKLIILDYIMRNTDRGLDNWMIKVCEVDGAWQLRLAAID
                     NGLSFPWKHPDEWRSYPYGWLYLPLDIINQPFTRETREHFLPILRSVGWWETSYLEFH
                     GLFSRDTEFKERMWKKQWAVLKGQAFNVLETLKHPGQGPLELVRRTRCLVFDDILHVP
                     AQNPPLNIIRSAINDELPVASSPMILSSVPEGSILVDFAQFPDRKAQDDHERQSIQED
                     PSQVLLPDMPSSRYIATKQVIVERLQLCNSKPPTFTWC"
     gene            <588861..>591029
                     /locus_tag="AGOS_AFR088W"
                     /old_locus_tag="AFR088W"
                     /db_xref="GeneID:4621878"
     mRNA            <588861..>591029
                     /locus_tag="AGOS_AFR088W"
                     /old_locus_tag="AFR088W"
                     /product="AFR088Wp"
                     /transcript_id="NM_210989.1"
                     /db_xref="GeneID:4621878"
     CDS             588861..591029
                     /locus_tag="AGOS_AFR088W"
                     /old_locus_tag="AFR088W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL099W (CHS6) and YKR027W (BCH2)"
                     /codon_start=1
                     /product="AFR088Wp"
                     /protein_id="NP_985635.1"
                     /db_xref="GeneID:4621878"
                     /translation="MSIWQWRSTSAHSASMGSQVSLHDSSVDRSHSGTPEAGRRYNTL
                     EHPRIIERHFGEAVRARWKLLRKLSGSGQLDVGPPDLVHVTGYDRYHQVQIGEHHYIT
                     GLDVSSEAMPIAYMNTLRLGRKHTEDEDDLVCTFCTVNLFSKVDVRIRFESERAFQVY
                     AVDCGSDEQVQMSDGLWEETFVSGCIRSMVINSDRRRKVPGLIEYPIGAENGRSYSEN
                     VVFLLCKYLPRAKDTGVDLTVHTSVTSLQNYLADALLKFLSINPGLFTYAIECLQQLI
                     EGDPANDFIYRLMQAKVAICSNSNELKAVQFLNSTVTRFLPNIAALHNRDLQNAIDLL
                     NVQVGFLLQKEDYEFALPLAQKATSLVHDNFLSWEQLATCYIGLGQYDEALLAINCMP
                     RLAQGTPGYAASMIDLIDSNYYKRPMSLGPTSDLYSVETNYISHSVPHSNHLALQTMI
                     YGRTVMSRPSTAAGCIEEIWNGPCMKLGPIYGPDSFNLLAFVSPSENNAIKDRGVLQR
                     NSSSTRLSGGDERVYSLLMDIVARIGWNRFLDIRARIFVMRSEHSTSPTVVPELKQKR
                     LCEKWLDELFLNLYEDLRVSANSPLHTQDLQNSGLEWQLLGLTLLRTRYMDEAVACLR
                     TSILVRFDVISAHKLLHLFLDGSLTTLDTDVILRLVVANAAYAARFYDWCQTLTILVL
                     RRFCEVHPKDVIRSRIHGLYPPDTGILPLIDRFLDRLDFI"
     gene            <591557..>594652
                     /locus_tag="AGOS_AFR089W"
                     /old_locus_tag="AFR089W"
                     /db_xref="GeneID:4621879"
     mRNA            <591557..>594652
                     /locus_tag="AGOS_AFR089W"
                     /old_locus_tag="AFR089W"
                     /product="AFR089Wp"
                     /transcript_id="NM_210990.2"
                     /db_xref="GeneID:4621879"
     CDS             591557..594652
                     /locus_tag="AGOS_AFR089W"
                     /old_locus_tag="AFR089W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR028W (SAP190) and YJL098W (SAP185)"
                     /codon_start=1
                     /product="AFR089Wp"
                     /protein_id="NP_985636.2"
                     /db_xref="GeneID:4621879"
                     /translation="MSGSFWKFSQEYSTESSLTKLLNRAFIRVEERSRAETEQENEAK
                     RSKEEKRFDVIESEHEEEEEGEEGEQRGSRAQRPLEGGELPETESEYKNYRPNLEVLN
                     ELLDDEELYTELMCSNFKLMIFFKYPAVLDVLVDYVTNERILEETLDLSEEEDNDDEH
                     VDLEPLLESTEDKEAEQLHGGEVAELGHDESDSSNTGTQPQETDEQVQSRRARMAAEI
                     LSADVWPISSAFIEHDELLYKLWSILDHPAPLSIVASTYFMKINERLLDMDIASMIRF
                     ILNQDNLVDRYLTHIDNPPLMDFLLKVISTDKPDTPTHVIGLLKYQKLISKLLDHLSP
                     EWSSSVQSAAGDFLKALITISANSNNEIASAIGPNELTRELVSPAMASKLGDIMLNGG
                     TSLSNGVGIVIELIRKNNSDYDFFQVMYTTLKTHPPNDRDPVYLGHLVKSFANKLPEF
                     NAMLLDTKLPPLETPFGTIEPLGFERFKICELIAELLHCSNMGLLNEPKGEEIVNERD
                     IDRECVLRLEGYGIPKNCHDEERSVSVSPIEEEDLAKKIRDLQLVTDKRPSSDNSVES
                     LNSDSQQATTPIHQLGTEIHSEDSSDAELSEQALREKPVVGDQLKIALQDNKIITTIL
                     GMFFKYPWNNFLHNVVFDIVQQIFNGPLKTGYNRFLLADLFASAHITEAIIEGDRKCH
                     EYERETGLRLGYMGHLTLVAEEVAKFASYIDEMKISFSNPVISESLNDQRWREYTELV
                     LAETRGKYSTVLGDLAEEEGRNVGKGANEEDNARYYNSDEIYHGSYAEHDDENYAEYS
                     DVDGNRYYEYEDGSGHTTRIHLNQLDNDNIDDIEEASNADTDNKFRNYMSHQLANDYN
                     TTSFSPDNEDEGQWASVSGSNRPGEASSNYQSEIQIESSAMSKQSIFHHQQFDLQDHE
                     DGDDYMDPNDDGQSYAKPNHPLYSNMLPSQPENVYRKTSEVAEEGDSDESDEEMIVVE
                     GTPGFDESTELDQSGTEYALCRTSSKDEKMWTSPEQHSTRIIGMNNNMFNRSKDLHKD
                     E"
     gene            <594940..>595593
                     /locus_tag="AGOS_AFR090W"
                     /old_locus_tag="AFR090W"
                     /db_xref="GeneID:4621880"
     mRNA            <594940..>595593
                     /locus_tag="AGOS_AFR090W"
                     /old_locus_tag="AFR090W"
                     /product="AFR090Wp"
                     /transcript_id="NM_210991.2"
                     /db_xref="GeneID:4621880"
     CDS             594940..595593
                     /locus_tag="AGOS_AFR090W"
                     /old_locus_tag="AFR090W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL097W (PHS1)"
                     /codon_start=1
                     /product="AFR090Wp"
                     /protein_id="NP_985637.1"
                     /db_xref="GeneID:4621880"
                     /translation="MATKTSFGTLALYNLFSALSWAYVLANVALVYPRIGQPRFYAAT
                     RGLVTVVQCGMLIEVFNAATGIVKTPVSTTVAQVLSRVLVVVCIFRYIPEAPNASDWP
                     YITLLLAWSITEIVRYSYYFCNLVRSAGTPKWLTILRYNLFWVLYPLGVMSELLIIYS
                     ALPHAEARYGAWARLALVAAMLVYIPGFPMLYLHVIAQRRKVMKALRSTAAGAKKTT"
     gene            <595762..>596241
                     /locus_tag="AGOS_AFR091W"
                     /old_locus_tag="AFR091W"
                     /db_xref="GeneID:4621881"
     mRNA            <595762..>596241
                     /locus_tag="AGOS_AFR091W"
                     /old_locus_tag="AFR091W"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="NM_210992.1"
                     /db_xref="GeneID:4621881"
     CDS             595762..596241
                     /locus_tag="AGOS_AFR091W"
                     /old_locus_tag="AFR091W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL096W (MRPL49)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="NP_985638.1"
                     /db_xref="GeneID:4621881"
                     /translation="MLPVLRQTLLRAAAPRWPLAGPAAACRLFSLGPVLHQQAAPADL
                     GPLRLANDLYAVFRIHNRPYLVTKGDQVILPFKLKQADVGDVLHLNDVTTIGSRNYKL
                     VDHPIDPSLYSLQATVIEKTKRPLRVREVTKRRNRRVRHALNKADLTILRISELRLN"
     gene            <596512..>600783
                     /locus_tag="AGOS_AFR092W"
                     /old_locus_tag="AFR092W"
                     /db_xref="GeneID:4621882"
     mRNA            <596512..>600783
                     /locus_tag="AGOS_AFR092W"
                     /old_locus_tag="AFR092W"
                     /product="AFR092Wp"
                     /transcript_id="NM_210993.1"
                     /db_xref="GeneID:4621882"
     CDS             596512..600783
                     /locus_tag="AGOS_AFR092W"
                     /old_locus_tag="AFR092W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL095W (BCK1)"
                     /codon_start=1
                     /product="AFR092Wp"
                     /protein_id="NP_985639.1"
                     /db_xref="GeneID:4621882"
                     /translation="MAFLKRLNVSSHSRSSSGSSGRTPQNTSGGSKATAVKPLPQIPV
                     EMGGIESEVIKNGEGGQSVVILCDDVGSGSYTSVLLSPSDPHMFSADGQRLSVEEQAE
                     KTLYSWDVTDPEQWTMQRVMSWFKAHDFDEQWILFFKRNHISGKKFLQLLAHDNFNKY
                     ESFLSATKNSSYNRFQHLLKRTLEENVSNSHRRQRSNKSNDSKGSADCSLRYRRRRSV
                     ASEQRTLTAAEGVTPRKTVEVADDRAGSSKNHRKAKSASVLYRRSFISLRSSSSSNIK
                     NDVDDDCKTLPAMKISIPPRPFSSIERSTSSSPASTLKSQSSPLSPGNHNMFRKDHKS
                     SSSDSSLFNNLFGSADEITKAVGGTAPQGEQIAVKKYNDTLPSPMRVSPRHIDDKSTI
                     WDKLKKRALPSTEQYTPSRIKQLTSGRNSSYIQTLQESPDECSANNEDPPATATLEAP
                     IIDDLVLEEKHYPSQKQDSSAQYVLVTKDNRIFLPLNIAPYKTTQELKDGMTAFLGIS
                     SKAYTIHLTDLGCDPGVSLSDDVIAAIGQRKLNTRHLKFYVKDATRMHLRLKNDSFTS
                     DHNITTEMSRSKGSLRSAASSFISSNDDTNSFSDITSIDEHGNITGRRVYPQTPSHYY
                     DQSAATHSPEVDYWNIKERLSEGTSPMNISLLRSTTKAASLPSSIDEIKKSSFKVIRK
                     ASVTDIDFNKGRESPYIRPKLAPKREAPRPPRTSSQVSLASSSSIQSSLVEQKSISNS
                     PTKPQRQHAGTYVKNKTRPPPPPSIGSTMTVDTKVMTSVSDSPVSNEPPNRPYGPFST
                     QKLVPQGFKGVGVHPGTRKVEEQMHTNPVTQYIQKQRSRNSISKMGNNPSLYSPPRLK
                     KRISTRRMVSSTSAADIFDENEISFADAPDLSDYDSENSESSDDIIWSTTNTTSLDAS
                     KISVSDSTTGDDSNFSVASSVELQSSIKNDAKTSEDSIVDSIKEEGDSVCNLVGRKMT
                     LRPTTEVVYQNLEMFFPGTDLDKPILEGLTPPASPDSEANKMPDQDLTPLSKVSTISS
                     ESSMRQSTPRLLITKKSDSPQPMPVRNLKPPKRTKTIRSIAREASEARKKSLYNNLKR
                     QNTKMWGTRVVEVTDKRMVSINKSKNSKGEYREFAWIKGEMIGKGSFGAVYLGLNVTT
                     GEMMAVKQVEVPKFGSQDETTVNNAEALISEVSTLKDLDHLNIVQYLGFENKNCIYSL
                     FLEYVAGGSVGSLIRLYGHFDEQLIRFLTTQVLEGLAYLHLRGILHRDMKADNLLLDN
                     DGVCKISDFGISRKSNNIYSNSEMTMRGTVFWMAPEMVDTTQGYSAKVDIWSLGCVVL
                     EMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPEDTLPHISQDGRAFLDDCFMIDPEERP
                     TADTLLSHPFCQVPKEFNFRDTDLYNFIKQNDKLNNSKLTRNSQR"
     gene            <601121..>604516
                     /locus_tag="AGOS_AFR093W"
                     /old_locus_tag="AFR093W"
                     /db_xref="GeneID:4621883"
     mRNA            <601121..>604516
                     /locus_tag="AGOS_AFR093W"
                     /old_locus_tag="AFR093W"
                     /product="AFR093Wp"
                     /transcript_id="NM_210994.2"
                     /db_xref="GeneID:4621883"
     CDS             601121..604516
                     /locus_tag="AGOS_AFR093W"
                     /old_locus_tag="AFR093W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL092W (SRS2)"
                     /codon_start=1
                     /product="AFR093Wp"
                     /protein_id="NP_985640.2"
                     /db_xref="GeneID:4621883"
                     /translation="MEFELFNGLNQRQYEAVTFDPTKALQIVAGPGTGKTKVLTTRYA
                     YLVAIKKINPLSIIMTTFTKKAADEIKARVEPILQRCGFDTSKLLIGTFHSICANLLH
                     QHGELIGLPSSWRVFSPAETDPIIKKLVADCPDQIRDYALSYRANKVNLCLPNRNGEW
                     ALADKAIRKNISRLKAEALSPEAYKELDTHDEALYHFYRSYQEELLRQGGLDYDDLLF
                     YSFKLLSTNRCWSHIKHVMVDEFQDTNSIQLELMYLLSRGRHQSCEGVTVVGDPDQSI
                     YAFRSALARNFEEMIQKCPIEYGHVVLEENYRSTQNILDTSEHVIKQQSDGRTFRLPL
                     KAQFSYDLKPVYMKFPDRFLEGPTICKEILYLKAIPGLFSYDDFAILVRQRRQIEPLE
                     RALIDHRIPYKIVKSVSFWERKETKAILDLIKIVCSDVDRYAIIRSLKYPSKGLGDVA
                     ISQFEKAFDEEPNRPPLEILRLFSNTAKGDKLSSKGRLAVRQFIALMDKAREICDENP
                     TLSTREQLFDYLYDASGLKNEFLFEDDKGDRKTKGLGDSDPNNENKRHRNIQLVRSHF
                     LAFIPEDMDPKYTIHLNPKTHEPCAVDTPVIKKDHKTQWATNARASSCENTNSNSEKD
                     KEDNKSLPEDTKIDIYNLLRRFINFINLYTTTEAIDPKGLTKAQQQANELRAKNGVVT
                     ITTIHGSKGLEWPIVFIPGCVEGIIPCVYANSKDEESDDDDENGEGHETEEIPNNDAN
                     SPKKNKSKANEGLDEERRMFFVALTRAKYLLYISATENTERYPIVPSQFLTPEVLVTL
                     TSAQQLFDNVGFIDAFYKALNRTRPNTLTFKLEKLLDDYRTFVTGNREFLIWKNERVM
                     HVSNVDFTENVGKAALPLGFTTASMHLHSLDYKNNVVNSAKSANRNLAPRPQPTNNAT
                     GRKFAPSKVPSAKGNAPAVKQFAPKSGERVSLSPTRTASKAPKPHENISLSPTRRPLN
                     APKSEFDQPMSIPQSPKRETAIKQEESEAPEARSIKERTRSLAVVPTNNQHRIIAHAI
                     KLEDFSDDEETTKVKIKCDDEITAAQLLHNPDDLRVDNRPILTNAKVLADASRDEAAK
                     RAGSRRKVKKGTDECQPGEDILSRLKRARKSSPSINDEVIVLD"
     gene            complement(<604539..>605981)
                     /locus_tag="AGOS_AFR094C"
                     /old_locus_tag="AFR094C"
                     /db_xref="GeneID:4621884"
     mRNA            complement(<604539..>605981)
                     /locus_tag="AGOS_AFR094C"
                     /old_locus_tag="AFR094C"
                     /product="AFR094Cp"
                     /transcript_id="NM_210995.1"
                     /db_xref="GeneID:4621884"
     CDS             complement(604539..605981)
                     /locus_tag="AGOS_AFR094C"
                     /old_locus_tag="AFR094C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL091C (GWT1)"
                     /codon_start=1
                     /product="AFR094Cp"
                     /protein_id="NP_985641.1"
                     /db_xref="GeneID:4621884"
                     /translation="MNALKERKEAFVSGLEGGSIAEINLVTTVALTAYFGWQLLNRRL
                     DSVPLVVDFLLNWAGLLLSITVYANDPVLLNLLIAVPCIVQLQILGRSSQRKTQPQKG
                     KESARLGLDRKPFITAYRGGMLIITCLAILAVDFPVFPRRFAKVETWGTSLMDLGVGS
                     FVFSNGLVAASALLKQEISGQRPPLWSRLVSSVRSAGILLALGVARLVSVKGLEYQEH
                     VTEYGTSWNFFFTLALVPLAMILVDPICTYVPRVFIALLLSVFSEYLLQKEGFLQFMI
                     MSKRDNFFNSNREGILSFLGYCAIFLLGQNTGFYVLGNRPTVNNLYRPSGQSWQQNRR
                     QRLSAWDKWTSVTPLAGLLAWFFITVALFQLTMAYHPYTVSRRFANLPYVLWVAAYNL
                     GFLSMYCMVDSLFNLSQHSNNVPVTLDAVNSNGLFVFLLANCLTGLINMNMNTLDSTL
                     TVQIAALFGYATVIASVAIIMYKCRIFIKL"
     gene            complement(<606107..>608119)
                     /locus_tag="AGOS_AFR095C"
                     /old_locus_tag="AFR095C"
                     /db_xref="GeneID:4621885"
     mRNA            complement(<606107..>608119)
                     /locus_tag="AGOS_AFR095C"
                     /old_locus_tag="AFR095C"
                     /product="AFR095Cp"
                     /transcript_id="NM_210996.2"
                     /db_xref="GeneID:4621885"
     CDS             complement(606107..608119)
                     /locus_tag="AGOS_AFR095C"
                     /old_locus_tag="AFR095C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL090C (DPB11)"
                     /codon_start=1
                     /product="AFR095Cp"
                     /protein_id="NP_985642.2"
                     /db_xref="GeneID:4621885"
                     /translation="MSKPFQGITFCPTGVADSELAELHRRVVQLGGAFSRDLTAEVHV
                     LVVGNQQSAKYRYVVRQRADVVLVEPQGVEEVYARWLAGEEALGPEGEGGREQALRAL
                     RRRFQPGPFGGFYVFIGRVAGGRVSAAELQQLCESGGARRVVTSHFVRDTASSARSVF
                     VTDCAEGARAAAAREQGVAVVHPKWVTDCVRRGAVVEMEEYELARWAGAAWEEVGRDA
                     CACWAALEAAAARSAEREARPARLSGRMRRSGTELWARRVEGGGSARPAAADAPAAAR
                     EAGATARGLFGGYGFSLFGFSARQRAVLERVLGLHDGASCEYPGVCEGARAVYLCPSE
                     LAVDRLPAGVEWTTEFYVERCLHYRELLPADPWARPFYTAFRAQPAAALLRGHAQLTV
                     HMTGFQGVELLHMNKLLGHLERMGVQNTPTLTPKTDVLLVNLAQLNSIPEEHTLRQNK
                     YAAMFAMRREHNQVFRDVMKRKIEFANRHSIPLVTPGFLLELFGRAARAKRDRTSGKL
                     YLNDSNWCIVSPRGAREDYLITLDVSEPALPSPSRAHVDVAAIKLLKGDGKTPAKESG
                     RKAMRQATARPRLAPPSPTPAETHPAKRQKLADLEPLKRSASWGSIMAADSAEPERSA
                     SSPERASATDDEENYTQVTYGTSDTKSEHEKPAGRRKTRQSYKDLL"
     gene            <608413..>610971
                     /locus_tag="AGOS_AFR096W"
                     /old_locus_tag="AFR096W"
                     /db_xref="GeneID:4621886"
     mRNA            <608413..>610971
                     /locus_tag="AGOS_AFR096W"
                     /old_locus_tag="AFR096W"
                     /product="AFR096Wp"
                     /transcript_id="NM_210997.2"
                     /db_xref="GeneID:4621886"
     CDS             608413..610971
                     /locus_tag="AGOS_AFR096W"
                     /old_locus_tag="AFR096W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL089W (SIP4)"
                     /codon_start=1
                     /product="AFR096Wp"
                     /protein_id="NP_985643.2"
                     /db_xref="GeneID:4621886"
                     /translation="MGKRKYGSLSAHDGQTIELSNMKRSSQACDRCRLKKIKCDGLRP
                     SCTSCKKIGYQCKTSDKLTRRGFPRGYTEMLEREVIKLQRLHGGEGMAPAPAQTSPLP
                     FINDSFHYYVNYTDGETYLGNATWQAVLNGGLEAAVVPSDDASLAQYLDRTFQIDGTG
                     LPAVLARLHGNDIAAARAAARARVSAFVKEHVLVPLLHGNNWKARLKGALAAGRGREE
                     DPTAILAAMYVLQWNYSLFSPEALFNVTKVVVVLSRDGLSALQMLLLATYYFMSLPKQ
                     LTTRQTPATAWTIQLVHLAFSQVTAQGLFINYKKLLPVGAADEKGAAARDSAELYETR
                     LLTFWSFQLLSALWSLLQGLPKTNFLADEFHPPSVSSLNIPSLRPFEILLEHILQLDG
                     CNVLQVMQAQNPRYTYVVESFRHTLNHWKLYHNLQDHDLNEITVNNNDRIEIQLTLSY
                     LLPRWLTEQDSPDSHHLSWEILSLYYLLIANEQGSAATASQPPVLKLIHFLPWDNWNL
                     ISACFQNLTKAPQDIDRYTYEKYRDLVTNWTHLWYEDDFAYKNAMERFDVKDSERFGK
                     PVNLPQLIRSMRSGPAQNTSNRPLLRPLRSSSNLSTEDPFNMFSSVPPVENLPSQWFL
                     MSPGIDVVSNYTSSANTNAVSVGQTNNSYAAVPPYNYGTVAAVGLNSLITTETFPSLA
                     EDEDGYVEDDENEDDDEGGPITFGMHRRSNPHTLQQAENQALFSHSIPTRKVVARDQV
                     LIGGKAHLGRKNISTDRVSACSPAKDSKLSHARYGLVPDSLGSEATSQGNQLDNPRIQ
                     KKTPPNTAPHVNSPSTATPRSLVDLLILPMTTEKTSGDGITTPKEEDTVVRSKA"
     gene            <611340..>612173
                     /locus_tag="AGOS_AFR097W"
                     /old_locus_tag="AFR097W"
                     /db_xref="GeneID:4621887"
     mRNA            <611340..>612173
                     /locus_tag="AGOS_AFR097W"
                     /old_locus_tag="AFR097W"
                     /product="AFR097Wp"
                     /transcript_id="NM_210998.1"
                     /db_xref="GeneID:4621887"
     CDS             611340..612173
                     /locus_tag="AGOS_AFR097W"
                     /old_locus_tag="AFR097W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR022C (NTR2)"
                     /codon_start=1
                     /product="AFR097Wp"
                     /protein_id="NP_985644.1"
                     /db_xref="GeneID:4621887"
                     /translation="MLDAEEDDGDEETAVLDTRLRTRKIKPLRLNPLPAAQESDSDAG
                     ESAGYADLLQAPGRSPKAVPQALRTMNLEDLSDDDDDDAYPVFSKQEILDIKKLRAER
                     QQEAAAGSAVDQQFSEKSYVRMLDREDKEDLQELLGRPLHKGLSEDEGPQEAEPEMIS
                     DGRLALSKSELSAEALRRKISIEDALNADLGGGVWESTQLNKHSRTAETRFYKPILSS
                     AVSKYDDLSSAQLAVNLLGDGKTSQKMSLLHKQLAMVHSEISALTERQNKLLEEARSL
                     L"
     gene            <612461..>613510
                     /locus_tag="AGOS_AFR098W"
                     /old_locus_tag="AFR098W"
                     /db_xref="GeneID:4621888"
     mRNA            <612461..>613510
                     /locus_tag="AGOS_AFR098W"
                     /old_locus_tag="AFR098W"
                     /product="AFR098Wp"
                     /transcript_id="NM_210999.1"
                     /db_xref="GeneID:4621888"
     CDS             612461..613510
                     /locus_tag="AGOS_AFR098W"
                     /old_locus_tag="AFR098W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL088W (ARG3)"
                     /codon_start=1
                     /product="AFR098Wp"
                     /protein_id="NP_985645.1"
                     /db_xref="GeneID:4621888"
                     /translation="MWFSLEQGSRILKHHTSFQYRRMTATPGSPKHLVSIKDLADHEF
                     AELVSRAEYFKGLFKAQDKAECQKSHQELMGKTIALIFSKRSTRTRISTEGAAAFFGA
                     QPMFLGKDDIQLGVNESLYDTIKVISSMVACIFARVGKHSEIQEFVKHSKVPVINSLC
                     DKFHPLQAICDMLTIKEHFNYQEKKLKLAWIGDANNVINDMAIAALKLGIDVVVATPQ
                     GIELDADIVDAAKEVCKRTGTTIQLTHDSVAAAKDAHVLVTDTFVSMGEEYMYEAKMR
                     QFKGFQINAELCKHAAPDYKFMHCLPRHQEEVTDDIFYGDHSIVFQEAENRLYAAMAA
                     IDIFVNKNGDFSGLN"
     gene            complement(<613546..>616008)
                     /locus_tag="AGOS_AFR099C"
                     /old_locus_tag="AFR099C"
                     /db_xref="GeneID:4621889"
     mRNA            complement(<613546..>616008)
                     /locus_tag="AGOS_AFR099C"
                     /old_locus_tag="AFR099C"
                     /product="AFR099Cp"
                     /transcript_id="NM_211000.2"
                     /db_xref="GeneID:4621889"
     CDS             complement(613546..616008)
                     /locus_tag="AGOS_AFR099C"
                     /old_locus_tag="AFR099C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL087C (TRL1)"
                     /codon_start=1
                     /product="AFR099Cp"
                     /protein_id="NP_985646.2"
                     /db_xref="GeneID:4621889"
                     /translation="MEGPLAENMTVNDVKQLVTELETASQLTKRGKASKVLCTLKYSG
                     IKVNSWRFNEWDYGKNNISMPCNARGLFIIDDPEKPEIVARGYDKFFNVEEIAATAWK
                     ELERTTEGPYEVSLKENGCIIFIAGRPDGELVVCSKHSTGPRDDTDRNHAEAGEQFLR
                     KLLEEAGASVETLARELYAMNCTAVAEYCDDAFEEHIIPYARDRAGLYLHGLNKNTRE
                     FQTLPMPEVKSFAEKYHLKIVDYFVKPDIETLRSFLQQCSIKGSYNDQEVEGFVIRCR
                     KRDGHAFLFKYKFEEPYLLYRQWREATKDYINSRMRTYNFKKHRFITNKYLDFVIPLL
                     DQDPDLCKEYIQGKGIIKLRKMFLEDFGMSGLDIMNSKTIKELEEQYASELDKVDENT
                     KFIFIPVATVGCGKTTVALALKNIFGESWGHIQNDNIVTKDKSKLMRDALEFLQKDTS
                     RAVIVDRNNHMPFERKQLFEWLEKMKENYIPYNSAVKVVCLSFLTYKDVESVREITKS
                     RVAERGDNHQSIKALSEPEKAIMILDGFLKRFRAVNDQRSPDNMFDKIIQLKVLEENS
                     SLTNIRTILEELHASYPTLVPELPSDSVIEESFKNTLSYKPTFTKIIKSSPRNTKYKP
                     TYWGAELSDPKLFINQVSDLIVRKRPEYLRGVLDIVEEAMIQKSFHVTLIHCSAKRGN
                     KEEKDMWAEYNKRYANHLVKPEKAPCQPPKYIETTDFIKFSIDKLLWDDKIMTATVST
                     DKLIYDSTGEAVPILRLLNTYAHITVGTRKAGVQAVYSNELCRRFHEKHGEEEGSFSE
                     GMNCIRFPEPVQVVAAVRINIY"
     gene            <616219..>618063
                     /locus_tag="AGOS_AFR100W"
                     /old_locus_tag="AFR100W"
                     /db_xref="GeneID:4621890"
     mRNA            <616219..>618063
                     /locus_tag="AGOS_AFR100W"
                     /old_locus_tag="AFR100W"
                     /product="AFR100Wp"
                     /transcript_id="NM_211001.2"
                     /db_xref="GeneID:4621890"
     CDS             616219..618063
                     /locus_tag="AGOS_AFR100W"
                     /old_locus_tag="AFR100W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL085W (EXO70)"
                     /codon_start=1
                     /product="AFR100Wp"
                     /protein_id="NP_985647.1"
                     /db_xref="GeneID:4621890"
                     /translation="MPSIDVDEADILILSDGLKQVNELTREITGSLSKITSTTSKSSK
                     LFAPIIETNTRLNVLKRNIESSFDSVSSIKDLASDASKYEIILEQEITQVGLRKFIKT
                     LHKVDDIMDDLREKSKSTADFRGIVTHLEELTMIGEKNLQIYFANKLNQIQPFDPQVY
                     MNKKQNFPYYYDEDLNDIAAILDYFGDTEQNPVTEIFMKQQGQLVLNSLAFLEPFTKQ
                     ITSESNVPYQRGSSGFNSYTEAFITFVSGVSVLIDDVFVKLPDRRPAVFCKIVAPILH
                     NYTKILRYNIDLVKDDINNYGLFSFELSENINRVHQLFKGKPLQNNEQLLECEAELKS
                     ISESLFKDLIQYIGQKTASLAQLPTDNGVTEATVDVMSRLRKFSEYKSGCLATIQSMT
                     RESWLPNESKNVWTISMTPKNAQQLLSCFFSDAIDYLTISLERKAQKILNPNLEPEVG
                     APHKRIPQMQRIGFFVLTNITLIEQIVQRSEINTVLEDIGAARLVKLNARYVNYFASD
                     WRDLASNLLDQVFVDSSGKISSKDKDQVKEKFRKFNEGFEQLVSNYKTCRITDPAMKK
                     LLKQEIFALVAPMYERFHNRYKDSFKNPRKHIKYTPNELMNILNSLGR"
     gene            complement(<618283..>621201)
                     /locus_tag="AGOS_AFR101C"
                     /old_locus_tag="AFR101C"
                     /db_xref="GeneID:4621891"
     mRNA            complement(<618283..>621201)
                     /locus_tag="AGOS_AFR101C"
                     /old_locus_tag="AFR101C"
                     /product="AFR101Cp"
                     /transcript_id="NM_211002.2"
                     /db_xref="GeneID:4621891"
     CDS             complement(618283..621201)
                     /locus_tag="AGOS_AFR101C"
                     /old_locus_tag="AFR101C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL084C (ALY2) and YKR021W (ALY1)"
                     /codon_start=1
                     /product="AFR101Cp"
                     /protein_id="NP_985648.2"
                     /db_xref="GeneID:4621891"
                     /translation="MVALRERAASAPVFPLEKQLELPRNATPLAHVGSVQVFVQLAEP
                     VIFLQGYDTHQWHERAPSILRGSLVVRILKPTKLKSISLMFKGVCRTEWPEGIPPKKQ
                     EVVEVTDLLNHTWLFYHVDSHDKVAAQSEDLLARSDASLYRPLPAATQSNKGSSVSLQ
                     TLLSQEGGELHGLTPADEACGRRSTSTTRSLSSGKLLRRKGSPDPPRVRSGTNLFTEL
                     LSATLSNGSEGSVRSRSSHTGHAPAENFVFQPGDYIYSFEHPIPVSTQETILATFGTV
                     NYLLDVTIERIGAFKSNVHARVPIKLIRTLSPNSVEDTEPIVISRDWEKELSYEIVIA
                     SKDIVLDAFLPISLSLNPRANLVLHRVRIFLTETLEYYCKGRKVHRVEPTKKFLLVEH
                     KAPPLKGIHEGASLSRAKNLGNLLDDGAGGASKRQFTYQVFVPERLNYQQCIHPNTAS
                     PHIKSNHWLQICLRLSRKVNGSRKHYEISIDTPIHVLHRLCSHAHTLLPSYESQAVLT
                     SGSTASSSLLANQYHSSNMYFPKEALQAAKITPPAGSVENLSSYIDSPAPVHNNKNHQ
                     YLAAHRNSAKENDGNGAVKFHGVAWNIYHPAYLPFNFISPQALPISPILPLFQTRFGH
                     MGDNLNAFVHVGDIDRTELSNVGHRDNDHMPDHPPSYEEALEAVELINMCKHNGMGLT
                     ECSPTEEASHDVNHFDGPDHEDMGDSSSIRSAVRRSGPPSFTSNISALSALAINQRIT
                     QERSERGVSASVFNQPEKLKNEIPSAPRNSQDVQNCTFSDAASSTNSDHQLYRTTTSK
                     VLLDLLSKDDTAQSTSAGLEMPKYSDGCDTIPPSTGTEADDTSVDISTLYSHKSAQYW
                     SPIQCELSRLSNGTHRNPDIYDNGCLTPAEFGASDNRCHERSTDVVDEPNGLSGIEDA
                     SSSHTQLMQRDCLKSMGTPPPDASDLYDSTPTQFSVKVDDLTVQDTEVNPQQAERKYE
                     "
     gene            complement(<621310..>621726)
                     /locus_tag="AGOS_AFR102C"
                     /old_locus_tag="AFR102C"
                     /db_xref="GeneID:4621892"
     mRNA            complement(<621310..>621726)
                     /locus_tag="AGOS_AFR102C"
                     /old_locus_tag="AFR102C"
                     /product="AFR102Cp"
                     /transcript_id="NM_211003.1"
                     /db_xref="GeneID:4621892"
     CDS             complement(621310..621726)
                     /locus_tag="AGOS_AFR102C"
                     /old_locus_tag="AFR102C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR020W (VPS51)"
                     /codon_start=1
                     /product="AFR102Cp"
                     /protein_id="NP_985649.1"
                     /db_xref="GeneID:4621892"
                     /translation="MAEQITHKKGLKRLDKDKRLLLKQYYQLDDATKQTAEQSTPTSS
                     SETKDAGEAEGGAGDMAVEVPEKLAESTLDQLLQAHNLLLGRETAANNSIKNTIYDNY
                     YDLVKVNQLLREMGESTLETRVGQLADNLRRLRKDR"
     gene            <621925..>624159
                     /locus_tag="AGOS_AFR103W"
                     /old_locus_tag="AFR103W"
                     /db_xref="GeneID:4621893"
     mRNA            <621925..>624159
                     /locus_tag="AGOS_AFR103W"
                     /old_locus_tag="AFR103W"
                     /product="AFR103Wp"
                     /transcript_id="NM_211004.1"
                     /db_xref="GeneID:4621893"
     CDS             621925..624159
                     /locus_tag="AGOS_AFR103W"
                     /old_locus_tag="AFR103W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL083W (TAX4) and YKR019C (IRS4)"
                     /codon_start=1
                     /product="AFR103Wp"
                     /protein_id="NP_985650.1"
                     /db_xref="GeneID:4621893"
                     /translation="MRFRSERQSKILSASNGEAGEVHKASLKAAQATFKKHADGARVN
                     PRVPSAPGNSKGSMDGLVDPIAGLQLDVSGRRSKRGLVGRSLPPGGSANNINPRRISS
                     GVSCGEYDYKVAAAAAARAARNENESIWPPTNAQHASPLLALPPLKLAGTHTRSSSNI
                     SMSTLTSGNGSHLSLDEIIATIKVNDPNSQISLKPPTSRRSTQTGAYLSSRESPRGGV
                     DNSTESLPAGGSQYSPGRLHIPPIVINPALLGKDSQAILACSESQASPSHCSETTSPP
                     PNTDGPVLPVRPPAVSSPIQSTYSFRSFSSNRMPRRIPPPCDPLSQLTKNEQKAVPQA
                     APLLESSEYSGGDSDYDGKQYSKACISETDSALEDDDDFGSGYENFSNAEDYLSSQDD
                     FRERNDNNDNDDDDELDDDNLVESENDATMEQDSQSDDDTESAKEFTVANVSYSTLNK
                     IPMNMTYRGTLPDLIPNYQRKQSKWMKLFKRHGQTGLGPSKNHPPTSHIYTQNDNALV
                     QSKLHVRLKTTMRGILNDSSSSEPHQLSDDSEDSEEDYGSDRNSRSRSPGRRSGKKRE
                     KIRQNLRYRNSFNEDKPWKSHLDVGYVTERERKRYEGMWVSNRDTYLDLLPWWNNGNY
                     DETREVPEDGLMLNLVVTDIWSRSNLPQDTLAQIYDMVDTRRDGTLDRNSFVVGMWLV
                     DQSLYGRKLPRELDRRVWDSVDKYVINVNGSNKNPKHHHRTRKKLLKKELKLIKKESK
                     SHNV"
     gene            <624840..>626471
                     /locus_tag="AGOS_AFR104W"
                     /old_locus_tag="AFR104W"
                     /db_xref="GeneID:4621894"
     mRNA            <624840..>626471
                     /locus_tag="AGOS_AFR104W"
                     /old_locus_tag="AFR104W"
                     /product="AFR104Wp"
                     /transcript_id="NM_211005.1"
                     /db_xref="GeneID:4621894"
     CDS             624840..626471
                     /locus_tag="AGOS_AFR104W"
                     /old_locus_tag="AFR104W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR017C"
                     /codon_start=1
                     /product="AFR104Wp"
                     /protein_id="NP_985651.1"
                     /db_xref="GeneID:4621894"
                     /translation="MLESDLDDDTYELSYEYDDIDEFSLASDDGQGGITSGTSTTLVN
                     DGGYEPRRLSPGACVISCNDVWPSMGMKHQASTYNATATLEYTSLTTSDISQMMIERV
                     SHLAPILGIAETDIILLLQDYKWNEAQFIEAYMEDPAKVFESAGLRSPFEEEKDSRAY
                     LHTQADFTCQICYTYYEVSETFSLPCCHEYCIGCYRRYVTDKLNHGCVVQCMGCDIAM
                     TNEDIGMIVGKKASELLLLSSIKIFIQKHKHRYKWCPFSDCDYVIHVTDPHWLVELES
                     SNSSPYVTCKNGHSFCFNCVTDMHAPCDCVLASSWLEKSQQESKALNWILQHTKECPK
                     CETSIIRDGGCNHMKCGTCHHEFCWICEADWRLHTKDYFECNASLREMKLDKFGNGDE
                     KLLLQQYGQYCKHFNMHEESARLDVALGKKVKTKLRTLQDKLGVSSVEAQFIFGAIEK
                     LRDGRTALKWSFAMAYFANRSHNLYTIFRQTQVELSRAVEDLSELLQLEDPKLIMKRK
                     QLFYNKADYVQNRKNALFRCGEELLAKNICKDSSA"
     gene            complement(<626522..>627961)
                     /locus_tag="AGOS_AFR105C"
                     /old_locus_tag="AFR105C"
                     /db_xref="GeneID:4621895"
     mRNA            complement(<626522..>627961)
                     /locus_tag="AGOS_AFR105C"
                     /old_locus_tag="AFR105C"
                     /product="AFR105Cp"
                     /transcript_id="NM_211006.1"
                     /db_xref="GeneID:4621895"
     CDS             complement(626522..627961)
                     /locus_tag="AGOS_AFR105C"
                     /old_locus_tag="AFR105C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YJL081C (ARP4)"
                     /codon_start=1
                     /product="AFR105Cp"
                     /protein_id="NP_985652.1"
                     /db_xref="GeneID:4621895"
                     /translation="MSNSALQVYGGDEITAVVIDPGSFTTNIGYSGTDCPQAILPSCY
                     GKYTEGEKDELFSEQSIGLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETN
                     SGMPALLTEPIWNSEENRKKSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIG
                     HDVTSVCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMER
                     KFDYEIHPSLQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEEL
                     VYDSLQRLEFAEQLFTPDLSQFPEDWPISKDGVVETWHNDYVPLKRNKPGTNVKDKEG
                     TLDATPVPDENSVTSADQPNDNGKRNLEETTPDQKNEVSGLADLIYSSIMSTDVDLRT
                     TLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSGQLRERQYQGWLGGSILA
                     SLGTFHQLWVGKQEYAEVGADRLLKDRFR"
     gene            complement(<628193..>629683)
                     /locus_tag="AGOS_AFR106C"
                     /old_locus_tag="AFR106C"
                     /db_xref="GeneID:4621896"
     mRNA            complement(<628193..>629683)
                     /locus_tag="AGOS_AFR106C"
                     /old_locus_tag="AFR106C"
                     /product="AFR106Cp"
                     /transcript_id="NM_211007.2"
                     /db_xref="GeneID:4621896"
     CDS             complement(628193..629683)
                     /locus_tag="AGOS_AFR106C"
                     /old_locus_tag="AFR106C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR016W (FCJ1)"
                     /codon_start=1
                     /product="AFR106Cp"
                     /protein_id="NP_985653.2"
                     /db_xref="GeneID:4621896"
                     /translation="MLSSRAAAFTGRRLASTLPPVPRKKSHGVRRLLAKAVVATSLFY
                     AGGLTLSAYNDKANELFVEHVPFGEELVERWEDWTSLRRPGRRMIDARRVDEISRDFR
                     AAATPEATPVVVRPLVQLQLPELQMQGSSPVLEALVNNVNDVVVALNARALELPEDTA
                     SALSSVYGEIVHSIQALNASLDQEFATEVESRTGKAISSVQEQLEVEYKQRELALAEQ
                     YIQNFEVFKSQLQKATAEQLETELKAHEQALLARHRNEVAQLSIRQVEEFNKIIEKKL
                     DQERNGRLAKLSELNSAVESLAPVLDRLELRAVKNECVTQLSTLISDIQGKLSRGGDE
                     PLDLSSDLQRLTLLADILPRPKRCCSEGPALLDVAMAELQAKAQAPVASNEQLYNRWQ
                     LLQPELKTTSLLPPNAGFLGHLTAKLFSMLLFTKEGFSTTQDMDAVTARIAENLRLNK
                     LDCALEEAVNMKGWSRKSADAWVDLARRRLEVLTLLDVIEAEVKTL"
     gene            <630322..>631512
                     /locus_tag="AGOS_AFR107W"
                     /old_locus_tag="AFR107W"
                     /db_xref="GeneID:4621897"
     mRNA            <630322..>631512
                     /locus_tag="AGOS_AFR107W"
                     /old_locus_tag="AFR107W"
                     /product="AFR107Wp"
                     /transcript_id="NM_211008.1"
                     /db_xref="GeneID:4621897"
     CDS             630322..631512
                     /locus_tag="AGOS_AFR107W"
                     /old_locus_tag="AFR107W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR159C (NSR1)"
                     /codon_start=1
                     /product="AFR107Wp"
                     /protein_id="NP_985654.1"
                     /db_xref="GeneID:4621897"
                     /translation="MAKATSAKKVSKKEMKKKEEAAAAAAAASSSSSSSSSESESGSS
                     DESSDESSDSSSDNSSSSNSSSDSSSSDSSDSESSSSSDSDSSDSEEETKNSTSSSSS
                     SDSEAEEKEKSASSKSSSSSSSESSSDSESSASDNEGSKEESKKRSAESEDDAVAKKQ
                     KTDGQPATIFVGRLSWSVDDEWLKTEFDHIGGVVGARVIYERGTDKSRGYGYVDFEDV
                     SYAEKAVKEMHGKEIDGRAINCDMSTSKPASAPREDRAKKYGDTPSQPSDTLFLGNLS
                     FNADRDALFELFSKHGNVISVRIPTHPESNQPKGFGYVQYGSVEEAQAALDALQGEYI
                     DNRPVRIDFSSPRPPQQGGATRGRGGFRGGRGGGRTGSGANNAPLGKPRQSAAFKGTK
                     KTFD"
     gene            <632538..>634184
                     /locus_tag="AGOS_AFR108W"
                     /old_locus_tag="AFR108W"
                     /db_xref="GeneID:4621898"
     mRNA            <632538..>634184
                     /locus_tag="AGOS_AFR108W"
                     /old_locus_tag="AFR108W"
                     /product="AFR108Wp"
                     /transcript_id="NM_211009.1"
                     /db_xref="GeneID:4621898"
     CDS             632538..634184
                     /locus_tag="AGOS_AFR108W"
                     /old_locus_tag="AFR108W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL045W (RIM8)"
                     /codon_start=1
                     /product="AFR108Wp"
                     /protein_id="NP_985655.1"
                     /db_xref="GeneID:4621898"
                     /translation="MHMRLFSKFKLHGSSAASEEVFGGKFSYTSAVADFYIELGDAHK
                     IWKPRDVVTGEVVLTLRKPLRGVSLRMSLEGNLRVQTGSGATSRLKFQRTLFSKSSMI
                     YGVEQPEDAEQEGHGLTRGDHRFPFRMRVPSKNIYTSIAFEKGSISYAVGCVLETRSG
                     AQRLSSCSRQISVLVPVDVSLLPKLRPKTVVLQSPQLLRSAKANYPEHDTASSLTKRT
                     TASANSNSSVTTVCSSKTVTISVDLPESGYVIGDTIRIKVHIQHYKEYRNSAGLIATL
                     VRICRVHSTGTDDPMETFRKDICQCVAPLYVEPETHTCSVGMNLNVPLDAFPTLVVPN
                     QGFTFQYYIEVLANLSSKNIVYTESNRVIGGSGMADIPMPGSKLHPVKKISMLPLKLQ
                     GPLGKQDTNIDESLIFFQDMVNVDKLKRLRNVTGTSIEVVIGTHRNNSVQQARQSCPG
                     SPVGGSDSTMMSEQSAAGTSLPSSVLDIYDQLANRLSSSVGDQLLRYGMSPDSGPHSA
                     NDELPRYTPNVDYMVTEDKRELEQRKLKELESEPSVEEEQ"
     gene            <634390..>635103
                     /locus_tag="AGOS_AFR109W"
                     /old_locus_tag="AFR109W"
                     /db_xref="GeneID:4621899"
     mRNA            <634390..>635103
                     /locus_tag="AGOS_AFR109W"
                     /old_locus_tag="AFR109W"
                     /product="AFR109Wp"
                     /transcript_id="NM_211010.1"
                     /db_xref="GeneID:4621899"
     CDS             634390..635103
                     /locus_tag="AGOS_AFR109W"
                     /old_locus_tag="AFR109W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR158C (MTR3)"
                     /codon_start=1
                     /product="AFR109Wp"
                     /protein_id="NP_985656.1"
                     /db_xref="GeneID:4621899"
                     /translation="MNGQDRRRILGPSNSKALKFGDLVPAQDSKAGTGEVSGDSEASM
                     FIQDGMIVNANGSSYLEVKAETHNTLLVTTAYGPRPIRGSFTSRAAISVHFKEVTLER
                     WDSGEVTEMCNFLNTVFSAAINVERYPKSGIDIFLNLIQHSNVRDDKTLNLAEVLPDC
                     ISGITLALMDAGIELKDVVAAGRHGCNVVAFVNNAETILGFWQEDDSDVMEIVDECKK
                     GYFRQRDAIIEHVVSKNKS"
     gene            complement(<635233..>637764)
                     /locus_tag="AGOS_AFR110C"
                     /old_locus_tag="AFR110C"
                     /db_xref="GeneID:4621900"
     mRNA            complement(<635233..>637764)
                     /locus_tag="AGOS_AFR110C"
                     /old_locus_tag="AFR110C"
                     /product="AFR110Cp"
                     /transcript_id="NM_211011.1"
                     /db_xref="GeneID:4621900"
     CDS             complement(635233..637764)
                     /locus_tag="AGOS_AFR110C"
                     /old_locus_tag="AFR110C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR157W (CHO2)"
                     /codon_start=1
                     /product="AFR110Cp"
                     /protein_id="NP_985657.1"
                     /db_xref="GeneID:4621900"
                     /translation="MTETKSGKAVAPAAQDSVAGTLAVCRSSGEEFRVPKTHDMLRSL
                     FDPRLRKSFLELCITLSLVANCAFCYWSWRVMGGEWAMRMYLAQYLAWRLTYNLGIGL
                     ILHYQSHYEFLTEFAKRNGLFASGAASKSWLASFCQFEIASKMPREYDMAQYPTEFNV
                     WLLFRQFVDLVLMQDFTTYVLYVLLSFSKSQVTWSLLQHLNWTSCRVYVGTLMLLLNV
                     WVKMDAHRVVKDYAWYWGDFFFLLKDSNLIFDGVFNISPHPMYSIGYMGYYGVSLITG
                     DYRVLLVSILGHFLQFLFLKYVETPHIERIYGPDQPSSIERVDDQIIKNNRNYTRPLM
                     MTYFWFKNFDPLRPTDYFTVGTAAASISAILLNPKKETVFAITLFVKLVTSMVNFFIL
                     RRQSTDKWFTKLFLRNGYTQLYSYQMWQFIYNFNLMLSYVTLALQTWIQFQALSQHDY
                     TNVIFGFILVALHIWADGEILNALTEFGWFYGDFFLTNYIQRPKLASHGIYRYLKNPE
                     CVLGVAGAWGTVLITDFSVENIILATIWTLSNHIMVTFVESPHVAKVYGNEMLARQSG
                     VGKTLLGFTPIKHFSDWLDKFSGSLIDMLNVSTEGRDQLEDVIAAALQATTRKLSPDS
                     EFEINRDSENNSDGDFSFTIGDSIEISWKLPRELYHDEDWIGLYRVLETGEDRYRTLV
                     SSRDHWCATNTMGYPKSVKAIGAVKEFTKGDTCVQGRVVFDHNLLYFEKGVYEFRYHS
                     TSGHKVLMISPPFKITVPQLDLDTPEALYQSTVKLLEKCHCLNENGRFEHSKNKYLSE
                     RTLQKLFRNSTGADISSDYMKRVNYEIREITERIYEMKKILDSLR"
     gene            complement(<638384..>639904)
                     /locus_tag="AGOS_AFR111C"
                     /old_locus_tag="AFR111C"
                     /db_xref="GeneID:4621901"
     mRNA            complement(<638384..>639904)
                     /locus_tag="AGOS_AFR111C"
                     /old_locus_tag="AFR111C"
                     /product="AFR111Cp"
                     /transcript_id="NM_211012.2"
                     /db_xref="GeneID:4621901"
     CDS             complement(638384..639904)
                     /locus_tag="AGOS_AFR111C"
                     /old_locus_tag="AFR111C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR314C (CDC3)"
                     /codon_start=1
                     /product="AFR111Cp"
                     /protein_id="NP_985658.2"
                     /db_xref="GeneID:4621901"
                     /translation="MLPTGSQEDSANTNSATTAGGVTTSTGGALMSNGTASAKDTSSD
                     MNVKEEEMGLDLPDDKENVATALGGELAAGQVLPDQPDLRIIHRKISGYVGFANLPKQ
                     WHRKSIRRGFNLNLLCVGAKGLGKSTLINTLFNKELYTAKDDTPEQFNALKLEDGEDG
                     DESRAKDGENKVKIETVTTEIEENGVVLKLTVVDTPGFGDAIDNTDSWKPIVDEMNSR
                     FDQYLDAENKINRTTIDDNRIHACLYFIEPTGHCLKPLDLEFCRQVHDKCNLIPVIAK
                     SDILTDEEIEHFKWTIKKQLDDAKVHLFQPPQYLLDDEETQRATRQLFSKVPFAVVGS
                     THEVATSDGRTVRGRSYPWGIIEVDNEKHSDFVYLRDLLIRQYLEELRERTNNELYEK
                     YRSEKLIRMGIKQDNSVFKEFDPELRQQEEKHLHEAKLAKLEAEMKAVFQQKVSEKEK
                     KLQKSEAELFARHKEMKEKLMKQLKALEEKKHQLEMSLANQSSQSPAQPKKKGFLR"
     gene            <640372..>641127
                     /locus_tag="AGOS_AFR112W"
                     /old_locus_tag="AFR112W"
                     /db_xref="GeneID:4621902"
     mRNA            <640372..>641127
                     /locus_tag="AGOS_AFR112W"
                     /old_locus_tag="AFR112W"
                     /product="AFR112Wp"
                     /transcript_id="NM_211013.2"
                     /db_xref="GeneID:4621902"
     CDS             640372..641127
                     /locus_tag="AGOS_AFR112W"
                     /old_locus_tag="AFR112W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL022C (HIF1)"
                     /codon_start=1
                     /product="AFR112Wp"
                     /protein_id="NP_985659.2"
                     /db_xref="GeneID:4621902"
                     /translation="MADDGEIQGLLAQAAKAYASENFEAAAELYAAVNEAAEAAGHVE
                     PDFLFLYGRALWRAAAAAGDVLGGAEDEEQSDLEAAWEVLELARTLYEEALSASGDAV
                     VQQKLAETYDVLGEVSLEAENFGQAAEDLRSCLALRERSGAAERLLVEAHYKLALALE
                     YVPGGAAECCAQLQRCVDMLGARVAAGTGAPDDGELLAELQQKLADVAAQPPAAEVAP
                     DALAGLREQLASAAVNDLTSRVRRRGGAPDGGQ"
     gene            <641164..>642126
                     /locus_tag="AGOS_AFR113W"
                     /old_locus_tag="AFR113W"
                     /db_xref="GeneID:4621903"
     mRNA            <641164..>642126
                     /locus_tag="AGOS_AFR113W"
                     /old_locus_tag="AFR113W"
                     /product="AFR113Wp"
                     /transcript_id="NM_211014.1"
                     /db_xref="GeneID:4621903"
     CDS             641164..642126
                     /locus_tag="AGOS_AFR113W"
                     /old_locus_tag="AFR113W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL023C (POM33)"
                     /codon_start=1
                     /product="AFR113Wp"
                     /protein_id="NP_985660.1"
                     /db_xref="GeneID:4621903"
                     /translation="MLRERLAASRRIFRQTPVVYFSHPTQGANQYHMTSEARRNRSGA
                     SHTSAGEVGGPLQRFAGLVKTLQFAWFAGHVVVLLTASMYLLGVRGSSDFHQVVYSLL
                     YLGVLESFGIIVYQQHFNLAGKQGRGRSLQEFVHDENFLYCMLAAMWLLTPRFAATVP
                     PFAIFSSFHALTYLKGVLLPVVFRAEENNSYMRLISGFLRDNHDKSLSWSCNSELACF
                     LVVFLRALACRRRSWIVLALYSLFIKARYEKSANMRAVVRKWEVRADGVVSHPRIPAQ
                     LKRAYAKSKMQINRLGSFSVFAPFQKPSVAAGKKPMGSPASKHE"
     gene            <642461..>644386
                     /locus_tag="AGOS_AFR114W"
                     /old_locus_tag="AFR114W"
                     /db_xref="GeneID:4621904"
     mRNA            <642461..>644386
                     /locus_tag="AGOS_AFR114W"
                     /old_locus_tag="AFR114W"
                     /product="AFR114Wp"
                     /transcript_id="NM_211015.1"
                     /db_xref="GeneID:4621904"
     CDS             642461..644386
                     /locus_tag="AGOS_AFR114W"
                     /old_locus_tag="AFR114W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL024C (SSA2)"
                     /codon_start=1
                     /product="AFR114Wp"
                     /protein_id="NP_985661.1"
                     /db_xref="GeneID:4621904"
                     /translation="MSKSVGIDLGTTYSCVAHFSNDRVEILANDQGNRTTPSFVAFTD
                     SERLIGDAAKNQAAMNPANTVFDAKRLIGRNFADAEVQGDMKHFPFKVIDVSGKPQIQ
                     VEYKGETKVFTPEEISSMVLTKMKETAESYLGCKVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKDEGEKNVLIFDLGGGTFDVSLLSIEDGIFEVK
                     ATAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLTTNQRALRRLRTACERAKRTLSSSA
                     QTSIEIDSLFEGIDMYTSITRARFEELCADLFRSTLDPVEKVLRDAKLDKSQVHEIVL
                     VGGSTRIPKVQKLVSDYFNGKEPNRSINPDEAVAYGAAVQAAILTGDTSSKTQDLLLL
                     DVAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVYEGERARTKD
                     NNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSEKITITNDKGRL
                     SKEDIERMVSEAEKFKEEDEKEAARIAARNQLESMSYSIKNSLSEAGDKLEAADKETL
                     TKACDEVVEWLDHNTTATAEEYNDKLKELQEVSNPIMAKLYQQGGAAPGGAAPGGFPG
                     AGAAAPGADGPTVEEVD"
     gene            complement(644792..644903)
                     /locus_tag="AGOS_t0139"
                     /db_xref="GeneID:4621905"
     tRNA            complement(join(644792..644827,644868..644903))
                     /locus_tag="AGOS_t0139"
                     /product="tRNA-Pro"
                     /codon_recognized="CCA"
                     /db_xref="GeneID:4621905"
     gene            645373..645471
                     /locus_tag="AGOS_t0140"
                     /db_xref="GeneID:4621906"
     tRNA            join(645373..645408,645436..645471)
                     /locus_tag="AGOS_t0140"
                     /product="tRNA-Trp"
                     /codon_recognized="UGG"
                     /db_xref="GeneID:4621906"
     gene            <645630..>646160
                     /locus_tag="AGOS_AFR115W"
                     /old_locus_tag="AFR115W"
                     /db_xref="GeneID:4621907"
     mRNA            <645630..>646160
                     /locus_tag="AGOS_AFR115W"
                     /old_locus_tag="AFR115W"
                     /product="AFR115Wp"
                     /transcript_id="NM_211016.1"
                     /db_xref="GeneID:4621907"
     CDS             645630..646160
                     /locus_tag="AGOS_AFR115W"
                     /old_locus_tag="AFR115W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL069W"
                     /codon_start=1
                     /product="AFR115Wp"
                     /protein_id="NP_985662.1"
                     /db_xref="GeneID:4621907"
                     /translation="MGSSNRHHADYSNFSASDRSEALIYMIESYQALAEHQDNMVCNL
                     ANASSLLWHVYRNLNVKVNWAGFYITEKDDPNMLLLGPFQGKVACQRIQFGRGVCGTA
                     ALTQEVQVVPDVTVYPGHIACDGDTKSEMVVPILQDNRTVAIMDLDCSEHNGFTDLDK
                     KYLEKLAQEISRTCKF"
     gene            complement(646253..646326)
                     /locus_tag="AGOS_t0141"
                     /db_xref="GeneID:4621908"
     tRNA            complement(646253..646326)
                     /locus_tag="AGOS_t0141"
                     /product="tRNA-Val"
                     /codon_recognized="GUU"
                     /db_xref="GeneID:4621908"
     gene            complement(646330..646401)
                     /locus_tag="AGOS_t0142"
                     /db_xref="GeneID:4621909"
     tRNA            complement(646330..646401)
                     /locus_tag="AGOS_t0142"
                     /product="tRNA-His"
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4621909"
     gene            <646558..>648108
                     /locus_tag="AGOS_AFR116W"
                     /old_locus_tag="AFR116W"
                     /db_xref="GeneID:4621910"
     mRNA            <646558..>648108
                     /locus_tag="AGOS_AFR116W"
                     /old_locus_tag="AFR116W"
                     /product="AFR116Wp"
                     /transcript_id="NM_211017.1"
                     /db_xref="GeneID:4621910"
     CDS             646558..648108
                     /locus_tag="AGOS_AFR116W"
                     /old_locus_tag="AFR116W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YGL160W (AIM14)"
                     /codon_start=1
                     /product="AFR116Wp"
                     /protein_id="NP_985663.1"
                     /db_xref="GeneID:4621910"
                     /translation="MDGQVTVKRHGDTHFANIGYGYYTFGVSVGYILLLLLLRKRRGT
                     AVPRSRHKLFQMMIDGSPALHLPILLLFLEIAFLGHYSVIDHASVYIKRLGRLSYVLL
                     FLNIFLTLRPNYILSDYTYVQLLPMHMWLSRAISTFGVFHGLAFVIKWQLDNEVSLAS
                     KLFNLWNLLGFIVWILLIILLITSTGVIRRRSYKSFYMVHQINAFAISFIVPVHARPG
                     VALPYTITIAVLLGLHALARVSFCMSSAVVHKLSNYQKGSKLVRIKLPRNVMPEHFTP
                     GSHIRVSPYRRSNPLYWLVPSHPFTIASLPDDDHVDLILREHGHFEFEVGPRYSIVHN
                     YEGITALQLGLVNRVTIVVGGTGISLGLPLFRYFKENTDIGYLKMIWTVKSHADLHVL
                     DDFEGIDIFVTQNTTTTPIPGASESWDEIPLEEFELNSMDDLEAEEEHLGESGALLPT
                     TKRKKDPGAINIGRRLDWNVELASFVRSEGSSDQLLIVCGPESLVKDGVQFATDHNIV
                     FYKEVYSF"
     gene            complement(<648252..>651710)
                     /locus_tag="AGOS_AFR117C"
                     /old_locus_tag="AFR117C"
                     /db_xref="GeneID:4621911"
     mRNA            complement(<648252..>651710)
                     /locus_tag="AGOS_AFR117C"
                     /old_locus_tag="AFR117C"
                     /product="AFR117Cp"
                     /transcript_id="NM_211018.2"
                     /db_xref="GeneID:4621911"
     CDS             complement(648252..651710)
                     /locus_tag="AGOS_AFR117C"
                     /old_locus_tag="AFR117C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR256W (HAP1)"
                     /codon_start=1
                     /product="AFR117Cp"
                     /protein_id="NP_985664.2"
                     /db_xref="GeneID:4621911"
                     /translation="MSSPTASSKRKRNRVPLSCTICRKRKVKCDKTRPHCNQCTKTGV
                     AHLCHYMEQTWAGEAEKELSKDAELKHLRERIRLLEEALGKACNGSGSLPVSPADLAQ
                     ASPRLVEDGVRGRYDNDTLDLTRQFDMLHVRHGGILHLGATHWLAIMKGDPYLRLLWG
                     HLFSVREKMVEWHAQRRRKNQDGARPAGGAGACPVSARVTASRCPVSNQSAAGGRAPK
                     PEAPQQCPVTGATAAGHQQLPPFHDLAAKCPVLQHSVTPTPPMSSRRGTIEHTYMGSA
                     DAADRLAQMLPPKHIIMLFLDHFFKYIYPVVPILDEQSFCHEVDQILSDRQETLVIKV
                     TKPTDNCTLGILTIILRLTWLSLPLNESAVELGSQYEQFVVPSVSVSPAAHVKEVSTL
                     FEHQTPLDAVTLARKHLVRFDEISSFSNTNVNLATIQFAIFYKMFLMCCPEDASVQPQ
                     SATFTSTGQDNETHQVLLSSIVQMAFSCGLHRDPDNFPQLSSTLLKTTKDTITNTERL
                     KHTWRKMWYFILSLDIQQSLSLGSPRLLRNHKDFSDTKLPFASKIDYVQDIKELVVVK
                     NFTLFFQIDLCVVAVLNHILNVSTAKTVRKHELDSLIEALKSLANGGCNLNDLVASLV
                     GQGLLFTTEGFIDQTNDVAYSLPSMEHLLSSHTTVPEKDKKPFLPHELTTRSLLFSKH
                     ITLRLLLYLLNYILFVHYEPKGNDEPGTRSLARSYAQEAMNYAIDGYYHSLLFFNSFK
                     SDYNKHTSIFTHMQVLLAPACLDMGHRALQFMVCLILRAKCGPLTGISDFSIVGSMAP
                     SSDEDDSSGSEDRASSGKELSGALQDFTSIPYISLTAGDHLADTLMEKMALFHKLAKQ
                     LSSKYAYATKLCKSTGFFLTLLKKPSSGSHAKQARQNSLPRIQDLGIASMTGFFKNVP
                     SLVFSATGESITRCPVYQDAMDLLPPKEPRASSNMTATVSNGSDVTFLNGSLPPIRPY
                     QPITYNVNGFHKTSDIRDTSGSKRRRISANVITPTSSALPPPLPSLCSPQYQCPTSVP
                     DTGTDSIQFQEPHINGNSHTPSSRGANDGKGMGNSAFSLSSPSNAEISSGSAQYTPDF
                     EEFLMENSNFNGLIINPSGIAEAVGMDQFGHAGDINGLLGADLLPIDDNCMIEVPQSG
                     DLSAFL"
     STS             649859..650573
                     /standard_name="Rab13"
                     /db_xref="UniSTS:281110"
     gene            <654516..>655214
                     /locus_tag="AGOS_AFR118W"
                     /old_locus_tag="AFR118W"
                     /db_xref="GeneID:4621912"
     mRNA            <654516..>655214
                     /locus_tag="AGOS_AFR118W"
                     /old_locus_tag="AFR118W"
                     /product="AFR118Wp"
                     /transcript_id="NM_211019.1"
                     /db_xref="GeneID:4621912"
     CDS             654516..655214
                     /locus_tag="AGOS_AFR118W"
                     /old_locus_tag="AFR118W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR254C (NDL1)"
                     /codon_start=1
                     /product="AFR118Wp"
                     /protein_id="NP_985665.1"
                     /db_xref="GeneID:4621912"
                     /translation="MEDISTLEQAMAVIRALQEQLVDLDSTGKEYEFQLEQTIQLLRQ
                     ELEQVQQQASEKITRLEIQIDDLQEQTRVWKSKYMDECEQNGNLLQDKLILECELENV
                     KEEVARMRMDGPLALDMSSGSEKTASPTTPGSTVSGVLGPALASPLSLHRSMSATNLH
                     SGVPMKGTPVPEVGLGLLPQQHSPPSPQPIRVMFKGTSLMLQSMAAEEPKSIVPSLNQ
                     ATVVTTTNTQVPRR"
     gene            complement(<655263..>656990)
                     /locus_tag="AGOS_AFR119C"
                     /old_locus_tag="AFR119C"
                     /db_xref="GeneID:4621913"
     mRNA            complement(<655263..>656990)
                     /locus_tag="AGOS_AFR119C"
                     /old_locus_tag="AFR119C"
                     /product="AFR119Cp"
                     /transcript_id="NM_211020.2"
                     /db_xref="GeneID:4621913"
     CDS             complement(655263..656990)
                     /locus_tag="AGOS_AFR119C"
                     /old_locus_tag="AFR119C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR253W"
                     /codon_start=1
                     /product="AFR119Cp"
                     /protein_id="NP_985666.2"
                     /db_xref="GeneID:4621913"
                     /translation="MRLRLSSCRFAGTIRTGRGHPLAQLRQSSGVALNGSAPKSGEND
                     KIRAMFTWKRAAAAGLATGGLLYYTNDNFHDLVRHVGTTSKRVSVVTVATVRCCYQYK
                     RTLSQSYESEEARLEALSRCHKTCAEITLHALEKNGGIFIKLGQHIGAMTYLLPQEWT
                     STMIPLQDKCPQSTLEEIDGMFRHDLRQGLDELFETFDPHPIGVASLAQVHIATLKGS
                     HEKVAVKCQHPHLKEFVPLDVMLTQNVFNVLDVVFPEYPMTWLSDELQSSIYVELDFT
                     KEAENAINTANYFYKYRKETALRIPRVVSAAKRILVLEFVEGERLDNLRYLDTNGISR
                     SEVSSCLSHIFNNMIFTPNVGVHCDPHGGNLAIRVLPKPKAGHNFEIVLYDHGLYRMP
                     TTEMRRDYAKFWLALLDKDTEKMKLYAKKFANVKEEQFPIFAAAITGRSIDTALNYDI
                     STVRSQDEIDRMKNALLSGGLLVDIMALLSTIPRIVLLILKTNDLTRHLDECLENPLG
                     PERTFLILTQYCARTIYQETCERIDHMYRRWTFRWIFCEIKAWLEYERRKSQLIIFDV
                     ALWCKKYFV"
     gene            complement(<657302..>657850)
                     /locus_tag="AGOS_AFR120C"
                     /old_locus_tag="AFR120C"
                     /db_xref="GeneID:4621914"
     mRNA            complement(<657302..>657850)
                     /locus_tag="AGOS_AFR120C"
                     /old_locus_tag="AFR120C"
                     /product="AFR120Cp"
                     /transcript_id="NM_211021.1"
                     /db_xref="GeneID:4621914"
     CDS             complement(657302..657850)
                     /locus_tag="AGOS_AFR120C"
                     /old_locus_tag="AFR120C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR251W (SYM1)"
                     /codon_start=1
                     /product="AFR120Cp"
                     /protein_id="NP_985667.1"
                     /db_xref="GeneID:4621914"
                     /translation="MSSFFKFYKASLQSHPKRTNALTTGFLFGLGDIVAQTQFPEPGA
                     SYDPMRTLRPFLYGAVLFSLVGDKWYRFLSTVRLGRLPQAHWANVLARVACDQLIFAP
                     IGVPLYYTAMALMEGGSLEDVRIRLSEKWWSTLLANWIVWPAFQLCNFSLVPVQHRLL
                     TVNVLSIFWNTYLSYSNSTASS"
     gene            <658350..>660020
                     /locus_tag="AGOS_AFR121W"
                     /old_locus_tag="AFR121W"
                     /db_xref="GeneID:4621915"
     mRNA            <658350..>660020
                     /locus_tag="AGOS_AFR121W"
                     /old_locus_tag="AFR121W"
                     /product="AFR121Wp"
                     /transcript_id="NM_211022.2"
                     /db_xref="GeneID:4621915"
     CDS             658350..660020
                     /locus_tag="AGOS_AFR121W"
                     /old_locus_tag="AFR121W"
                     /note="NOHBY625; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F22902g"
                     /codon_start=1
                     /product="AFR121Wp"
                     /protein_id="NP_985668.2"
                     /db_xref="GeneID:4621915"
                     /translation="MFVDYSSKGANKITNRIFAEKLLDLFFLDTLDDAQVLEFVKGRI
                     LGNQFMQRLTLNDVHGNRYWLYYILGLKLSNEQMEEALDELVASRLLYQVELTFPDCS
                     FEDAYELKESDPMRKVVVDLYISSIFLKCKINSYVKEFTKLVTSDKKMMMLLSREERL
                     LAFSQYFPEERHEFDSLVVILPVKFPRTYLSLLEKDGTMRTNIRLEFKKWELADRRLL
                     YSKNVHIRDIVARDQDVQLRWIPNDEILTPRVRQSGDVEHSETSIMLRDIHKRHIERQ
                     KVMKSVNEKMASAGEYTSSEPKPEFLKIFDEINEELEQAMENDEKVINKTQEIRHRVK
                     NGSIVLPSEIEYLRDPSTHDILKPINTNQVQHSLEKLNFDSDCVFECENSREFTIDRE
                     TSYKTPVKDHVQHYPDAVMTYRNVAYVPASNNLEAPDIMLRLSCRRSNSTVRKKLAGI
                     VRSPFAKKDSAMYLDDGSMVPESFSKLSFRFFLKAKFRKIKQDWRYYKNVAKQCMDDF
                     RSPSAGIIIPPKSAALLQEPVQLLSQAHNNSKFVDQKNRSVAGTSALN"
     gene            complement(<660508..>662382)
                     /locus_tag="AGOS_AFR122C"
                     /old_locus_tag="AFR122C"
                     /db_xref="GeneID:4621916"
     mRNA            complement(<660508..>662382)
                     /locus_tag="AGOS_AFR122C"
                     /old_locus_tag="AFR122C"
                     /product="AFR122Cp"
                     /transcript_id="NM_211023.1"
                     /db_xref="GeneID:4621916"
     CDS             complement(660508..662382)
                     /locus_tag="AGOS_AFR122C"
                     /old_locus_tag="AFR122C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR173W"
                     /codon_start=1
                     /product="AFR122Cp"
                     /protein_id="NP_985669.1"
                     /db_xref="GeneID:4621916"
                     /translation="MSEREHARAIEEADERAPMLAEQAAGGTAGYGTGRTSQETLPEL
                     PASQLSIPQRFALFLLFVVLLPLSYVYTTMPAPDVLQKYVADITELEVRRVSFQGWAE
                     APPGMAGAAQGNSGKWMAFGVNVSMAVDYEKETTVPVTANQRSLLRLMGNDILGDICV
                     SLNEGAVYTHNAAGEVVPLVTVADRQPVCVSLLDGEVTDILTQVYVRPNLTNMVWLVG
                     ELQRNRKWQPQLLSNLSVSTRKLFFEDLYLPVRDFHVAGTSVDEYVDWQKLRRMLRHG
                     GAIFETITRNSTILELAVTDVPKDSALRLQASVRIPIVGQGMDQFILPEDIVFPATEW
                     MVALPGCDGNGTIGLPNATIVVDPVKALKWEQQSSIDISMTAVVAGRLPDPLLYEVCE
                     YDNGNVVTPMSLIFRKMFDPAQLVELTVKGRRALESDDLETIPVEVVTELVAATKLPL
                     AFNFTVSQSDMIEDLSIQRLKLRLRRNRHGEKVLHVAGKVRILFNPPFYNVTEDSSVS
                     ITAVKGVIDLYHHNVRFASTPLRTWLPCDTAIDGGRLEVSLELDQDEVDIIDPVQLSV
                     CLNEIIFNGQTEIYIDGKVDILTKTVLGELVLFDMPAHGKTVVKKDDDVLLINQLDTV
                     "
     gene            <662731..>663627
                     /locus_tag="AGOS_AFR123W"
                     /old_locus_tag="AFR123W"
                     /db_xref="GeneID:4621917"
     mRNA            <662731..>663627
                     /locus_tag="AGOS_AFR123W"
                     /old_locus_tag="AFR123W"
                     /product="AFR123Wp"
                     /transcript_id="NM_211024.1"
                     /db_xref="GeneID:4621917"
     CDS             662731..663627
                     /locus_tag="AGOS_AFR123W"
                     /old_locus_tag="AFR123W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR172C (DPH5)"
                     /codon_start=1
                     /product="AFR123Wp"
                     /protein_id="NP_985670.1"
                     /db_xref="GeneID:4621917"
                     /translation="MLFLVGLGLSSHEDITVRGLNAVKRCARVYLEHYTSILMTASKE
                     ELEGFYGKPVVLADREMVESGCEEILRDADKEDVAFLVVGDPFGATTHTDLVLRAKKQ
                     GIVVEVVHNASVMNAVGSCGLQLYNFGQTISMVFFTDSWRPDSWYDKVLENRRIGLHT
                     LVLLDIKVKEQSPENLARGRLIFEPPRYMSISQCCEQLLEVEEKRGQQAYTPDTPCVA
                     ISRLGAPTQHMKSGSIHELAEYDAGEPLHSLVILGRQCHELELEYLLEFSEDQERFKD
                     QVHRDQEFFKPAPWVPPPEDED"
     gene            <663810..>664280
                     /locus_tag="AGOS_AFR124W"
                     /old_locus_tag="AFR124W"
                     /db_xref="GeneID:4621918"
     mRNA            <663810..>664280
                     /locus_tag="AGOS_AFR124W"
                     /old_locus_tag="AFR124W"
                     /product="AFR124Wp"
                     /transcript_id="NM_211025.1"
                     /db_xref="GeneID:4621918"
     CDS             663810..664280
                     /locus_tag="AGOS_AFR124W"
                     /old_locus_tag="AFR124W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR170C (APS1)"
                     /codon_start=1
                     /product="AFR124Wp"
                     /protein_id="NP_985671.1"
                     /db_xref="GeneID:4621918"
                     /translation="MSKLKYLLLFSRQGKIRLIRWYRPYEQKEKALIIRELTATVLAR
                     KPKMCNIIEYQDHKVVYKRYASLFFVCGISPEEDNELLTLEIIHRFVETMDRYFGNVC
                     ELDIIFNFTRAYNILDELIMCDGSFVESSKTDVLKNMATMDSIESNDNLERALV"
     gene            complement(<664351..>664743)
                     /locus_tag="AGOS_AFR125C"
                     /old_locus_tag="AFR125C"
                     /db_xref="GeneID:4621919"
     mRNA            complement(<664351..>664743)
                     /locus_tag="AGOS_AFR125C"
                     /old_locus_tag="AFR125C"
                     /product="AFR125Cp"
                     /transcript_id="NM_211026.1"
                     /db_xref="GeneID:4621919"
     CDS             complement(664351..664743)
                     /locus_tag="AGOS_AFR125C"
                     /old_locus_tag="AFR125C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YMR252C"
                     /codon_start=1
                     /product="AFR125Cp"
                     /protein_id="NP_985672.1"
                     /db_xref="GeneID:4621919"
                     /translation="MIPRIVGKLRPFTNIAIKSKGSSLLLAQSRTFRASPLAQTFMAW
                     SELSKEAKKQFIRNYIELYKQKNPCSKSNVMYRALAGDMDVHDDAPYVFGILYNEIRA
                     VQLGISRDNQKGSGGAMGDPDFAALLYK"
     gene            complement(664854..664952)
                     /locus_tag="AGOS_t0143"
                     /db_xref="GeneID:4621920"
     tRNA            complement(join(664854..664889,664917..664952))
                     /locus_tag="AGOS_t0143"
                     /product="tRNA-Trp"
                     /codon_recognized="UGG"
                     /db_xref="GeneID:4621920"
     gene            <665254..>666522
                     /locus_tag="AGOS_AFR126W"
                     /old_locus_tag="AFR126W"
                     /db_xref="GeneID:4621921"
     mRNA            <665254..>666522
                     /locus_tag="AGOS_AFR126W"
                     /old_locus_tag="AFR126W"
                     /product="AFR126Wp"
                     /transcript_id="NM_211027.1"
                     /db_xref="GeneID:4621921"
     CDS             665254..666522
                     /locus_tag="AGOS_AFR126W"
                     /old_locus_tag="AFR126W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YBR287W"
                     /codon_start=1
                     /product="AFR126Wp"
                     /protein_id="NP_985673.1"
                     /db_xref="GeneID:4621921"
                     /translation="MVITEALSFLGLAYITFQSVLEVVIVSFAGFWCTYSGLLPKEGQ
                     KIISRLNVDVFTPCLIFSKLAKSLSIAKILEIGIIPVFYAISTGISFVSGKALAMLLH
                     LDVDETNFVVANSIFGNSNSLPVSLTLSLAYTLPGLEWDQIPNDTKDSIASRGILYLL
                     IWQQIGQVLRWTWGYNKLMRWSGERDNEVRQSLLEAQSEDAVTLAEAESELAIRSPTD
                     FDENSTSAPSITSIDRLKTTVLHGVNRVRGFMNPPLYAMVLSVIVASIHPLQHELFHA
                     DGFINNTLSEAVNELGALSIPLILVVLGSNLYPSHDVSPKSHNYKKIVFASIVGRMIF
                     PSLLLLPLIAACVKFINVSILDDPIFLVVGFILTVAPPAIQLTQITQLNEFFEAEMAG
                     VLFWCYVILALPMSILVVSGAISVLRWAEA"
     gene            666734..666845
                     /locus_tag="AGOS_t0144"
                     /db_xref="GeneID:4621922"
     tRNA            join(666734..666771,666802..666845)
                     /locus_tag="AGOS_t0144"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4621922"
     gene            666916..666987
                     /locus_tag="AGOS_t0145"
                     /db_xref="GeneID:4621923"
     tRNA            666916..666987
                     /locus_tag="AGOS_t0145"
                     /product="tRNA-Thr"
                     /codon_recognized="ACA"
                     /db_xref="GeneID:4621923"
     gene            <667099..>667761
                     /locus_tag="AGOS_AFR127W"
                     /old_locus_tag="AFR127W"
                     /db_xref="GeneID:4621924"
     mRNA            <667099..>667761
                     /locus_tag="AGOS_AFR127W"
                     /old_locus_tag="AFR127W"
                     /product="AFR127Wp"
                     /transcript_id="NM_211028.2"
                     /db_xref="GeneID:4621924"
     CDS             667099..667761
                     /locus_tag="AGOS_AFR127W"
                     /old_locus_tag="AFR127W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR181W (SVP26)"
                     /codon_start=1
                     /product="AFR127Wp"
                     /protein_id="NP_985674.2"
                     /db_xref="GeneID:4621924"
                     /translation="MFLQLLAVLGTIFGFLFLTLSIAAGLYYVSELVEEYSEPTRRFL
                     NRTIYAVIATYALLLVFDSFPFFLTCFSIASHVVYAQNLRKFPFISLSSPTFVASCVL
                     VALNHYLWLRHFNNNDVPVRFRMDPGYRAPRRTSLAEVTSFFALCVWFIPFALFVSLS
                     AGDNVLPTAMGKKDDDARDAVTRKASSLLKVLIDSVRSYFHSVARVFGIRASRHNDGL
                     AL"
     gene            <667843..>670011
                     /locus_tag="AGOS_AFR128W"
                     /old_locus_tag="AFR128W"
                     /db_xref="GeneID:4621925"
     mRNA            <667843..>670011
                     /locus_tag="AGOS_AFR128W"
                     /old_locus_tag="AFR128W"
                     /product="AFR128Wp"
                     /transcript_id="NM_211029.2"
                     /db_xref="GeneID:4621925"
     CDS             667843..670011
                     /locus_tag="AGOS_AFR128W"
                     /old_locus_tag="AFR128W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR182W"
                     /codon_start=1
                     /product="AFR128Wp"
                     /protein_id="NP_985675.2"
                     /db_xref="GeneID:4621925"
                     /translation="MCRGVDSRAPREDLFQHFKYEYMGSTCLIFLEREVERHNMNRRI
                     DLTSTFWSEDYLTGIDWLLHNIQSDISELVQFADLYDKFQESWSYAARQIAKVSTGDA
                     LEGYTKVKSYGKGTEMVARVYRNQTRQLEYLAEKLRTSSLAAVEDPIKNLLFQYREFQ
                     TDIESALKLDHGKVKRQMDALRSMHRQIKKKAAAIATLDPEDEEDLQSMETVVERQFP
                     SSLGSSLKFGCEAEWEEYLSRLKNDVPITKRKWVIPGLPNEYFSGGDLYHSLKRLDAK
                     MDTSLFNLENVGQQLLDFGVLRSYNDVLHRPGYKFTHQGFYCWVPDAPTPTGSMSPAS
                     SSGKILQDIWKRVSSGGTVEQDTTYAALEISQLNEQFVKQWFLWENEKLKLEVDLFYF
                     MKKFAKLSKHKFRTMVDVDKSIVTSFEQEWKIDGKASAVDADEAWYEVYSKNHGTIGF
                     YTPHAGLHFEMYTLQGTPVAQPWLFGTPLQDMPVLDNEQPVVLHKLLEKAQTLDPGLV
                     AKEWAAPLDLVGISNMKRDCLNEYLLDCDHAAVMEKVLKKWTIGPNIIQLLRSWLLEL
                     PDSVVPFTLIGSFKEGGLDWLDLCPSSNLQCIAALAAHFNWLGPERLKVLFEQEPSPQ
                     PFPISHHFVRARVRAPLDCLLFDATLHRFFLDDEFTASCTRAARASPSARTGRPPKNH
                     LTVADSYEFVPRPFRANSCEPSPTRNKRLSGLTILHPTSG"
     gene            <670548..>672044
                     /locus_tag="AGOS_AFR129W"
                     /old_locus_tag="AFR129W"
                     /db_xref="GeneID:4621926"
     mRNA            <670548..>672044
                     /locus_tag="AGOS_AFR129W"
                     /old_locus_tag="AFR129W"
                     /product="AFR129Wp"
                     /transcript_id="NM_211030.2"
                     /db_xref="GeneID:4621926"
     CDS             670548..672044
                     /locus_tag="AGOS_AFR129W"
                     /old_locus_tag="AFR129W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR183W (GND1) and YGR256W (GND2)"
                     /codon_start=1
                     /product="AFR129Wp"
                     /protein_id="NP_985676.2"
                     /db_xref="GeneID:4621926"
                     /translation="MRRDHILTASRGDIGLIGLAVMGQNLILNAADHGYTVVAYNRTV
                     SKVDRFLEDEAKGKSIIGAHSVEELCANLKRPRRVILLVKAGSAVDAFIEQLLPYMEQ
                     GDIIIDGGNSHFPDSNRRFEELKQKGIHFVGSGVSGGEEGARYGPSLMPGGAPEAWPH
                     IKEIFQSIAAKSEGEACCDWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGF
                     TDKEIGQVFSEWNKGILDSFLIEITRDILLYEDLDGTPLVEKILDSAGQKGTGKWTAI
                     NALDMGMPVTLIGEAVFARCLSSLKDERMRASALLSGPEIPKDAVKDRKQFVDDLEQA
                     LYASKIMSYAQGFMLMREAGKTFGWELNFPAIALMWRGGCIIRSVFLAQITKAYRENP
                     YLENLLFNKFFADAVTKAQQGWRRTIGLATTYGIPTPAFSTALAFYDGYRSKRLPANL
                     LQAQRDYFGAHTFRVLPEAASAHLPVDKDIHINWTGKGGNISASTYQA"
     gene            <672363..>674222
                     /locus_tag="AGOS_AFR130W"
                     /old_locus_tag="AFR130W"
                     /db_xref="GeneID:4621927"
     mRNA            <672363..>674222
                     /locus_tag="AGOS_AFR130W"
                     /old_locus_tag="AFR130W"
                     /product="AFR130Wp"
                     /transcript_id="NM_211031.1"
                     /db_xref="GeneID:4621927"
     CDS             672363..674222
                     /locus_tag="AGOS_AFR130W"
                     /old_locus_tag="AFR130W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR184W (SSP1)"
                     /codon_start=1
                     /product="AFR130Wp"
                     /protein_id="NP_985677.1"
                     /db_xref="GeneID:4621927"
                     /translation="MMTEEDSFLYLEEQDRIYSRDPTFESVGPKPFLQQNAVPPLPPL
                     PALPQYPTRGVDSKSLLGRVKNMLFKGPYGNGPGGFPIPGDQVPIELHTQLKKQEQLW
                     KIIKEKPFDPAVGLAATPPSRGSSGDTFLSGGADLSPRRQPPPPATRPAKAVSGLMNN
                     KENEAAAAKYYHSGALQADNEQNSTAALELLTNKILGHRKIGLKKIQDRLNEIAEKKF
                     AVNKLYGKLTQEFNIWSNDVVESEEGLRLVEELQRVLKLDMLMEKNSAQKFRDLAFGL
                     NFIKLREDQMLLAKKELNSDIRKYENVRTKKGEYHEETSYWKEIVNTKQNSLAEVTIL
                     YQQALAKTMRELFTLSCVTFYENCTEMKEACKQFFSDSMEYLAGSLGEEYVDEYLDEL
                     RKRRADKKWAKLSFEDKNNPNKLAELIGNMYNGDDSLLSNVPKKHMIKFSAEAILKEE
                     FDPVLKEKEPKLHFGTGLEEDWSQFPTEKYNGIASNKYFLERQAESIRNLDSHGNAVQ
                     NRSTDSTNKGSTRTLRGINPKYTRPAAQPLATTKEEVEAEESPKPSVVTQSSVYKTLR
                     PSSQQLKQPGTEKSYQEVVMKFGSDIARSLDLRFKEAEEELNTNKWVSARTDG"
     gene            complement(<674416..>675450)
                     /locus_tag="AGOS_AFR131C"
                     /old_locus_tag="AFR131C"
                     /db_xref="GeneID:4621928"
     mRNA            complement(<674416..>675450)
                     /locus_tag="AGOS_AFR131C"
                     /old_locus_tag="AFR131C"
                     /product="AFR131Cp"
                     /transcript_id="NM_211032.2"
                     /db_xref="GeneID:4621928"
     CDS             complement(674416..675450)
                     /locus_tag="AGOS_AFR131C"
                     /old_locus_tag="AFR131C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR257C (MTM1)"
                     /codon_start=1
                     /product="AFR131Cp"
                     /protein_id="NP_985678.2"
                     /db_xref="GeneID:4621928"
                     /translation="MSKETGKKVTLKERMVSASAGSLVTSLFLTPLDVVRVRLQQQEM
                     LPSCTCTGQLSKPAGKVFWQDECFANVGCREPAARLQGTLEGLRKIAQLEGLPTLWRG
                     LGITLVMAVPANVVYFSGYEALRDNSPLASRLPVANPLVCGAFARILAATTIAPLELL
                     RTRLQSVPRARDTERTIYLIGDLLREMRHEVSVMGYRALFKGLEITLWRDVPFSAIYW
                     GTYEFCKTQFWARHAATHNASNWDHFIGSFACGSMGGAVAALLTHPFDVGKTRMQIAI
                     ASPQQLTVGGKATKTDDSRGMFSFLNAIRKSEGIRALYTGLLPRVMKIAPSCAIMIST
                     YELSKKFFTS"
     gene            complement(<675736..>676500)
                     /locus_tag="AGOS_AFR132C"
                     /old_locus_tag="AFR132C"
                     /db_xref="GeneID:4621929"
     mRNA            complement(<675736..>676500)
                     /locus_tag="AGOS_AFR132C"
                     /old_locus_tag="AFR132C"
                     /product="AFR132Cp"
                     /transcript_id="NM_211033.1"
                     /db_xref="GeneID:4621929"
     CDS             complement(675736..676500)
                     /locus_tag="AGOS_AFR132C"
                     /old_locus_tag="AFR132C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHR185C (PFS1)"
                     /codon_start=1
                     /product="AFR132Cp"
                     /protein_id="NP_985679.1"
                     /db_xref="GeneID:4621929"
                     /translation="MHQYRKTKPLIPNIDVMNFDHDRRSSMIAGNGRKKFDTPRKDNV
                     FGKKRAQETVTETPLQQMSNVDEPSSSFMMHPIQNKEQLLDNPPIFNNSPQYFPDLNY
                     LSPWHSYSNGVGTPIPINSSMIGNPNLSNVPMTKTYDPYDVPQSSFPAYFNPRAALNM
                     PHREKVNQWIENVPIHIVHEEYLTHDCYSIDEYMNWEEDEFDMSLFQRGEKTQINMAT
                     VDELLQFQLKRITSMVLRLYEESPEVPLDNSDATSY"
     gene            complement(<676677..>679589)
                     /locus_tag="AGOS_AFR133C"
                     /old_locus_tag="AFR133C"
                     /db_xref="GeneID:4621930"
     mRNA            complement(<676677..>679589)
                     /locus_tag="AGOS_AFR133C"
                     /old_locus_tag="AFR133C"
                     /product="AFR133Cp"
                     /transcript_id="NM_211034.1"
                     /db_xref="GeneID:4621930"
     CDS             complement(676677..679589)
                     /locus_tag="AGOS_AFR133C"
                     /old_locus_tag="AFR133C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR258C (RAD2)"
                     /codon_start=1
                     /product="AFR133Cp"
                     /protein_id="NP_985680.1"
                     /db_xref="GeneID:4621930"
                     /translation="MGVHALWDILGPTARPVKLESLSNNRMAVDASIWIYQFLKAARD
                     KNGNRLKGAHIIGFFRRICKLLYFGIKPVFVFDGGVPPLKRETIRQRKERREGKRESA
                     AVTARKLLALQVQQQGDTAFKGNSRSKSEGSVTFRPSDEYELPNIPGFLYDERDERVM
                     STEEYKAVFEHLDELDGIDLESINPASKEFDELPNATQYLILSTLRLRSRLRMGYTKE
                     QLEEIFKDSMDFSRFQIEMVKKRNFYTQKLMNTTGVHDGGLSKLDLEHSRSRVAGQRQ
                     KEYTLVKTEMGWAMSLGEYDGSEASKAIPLDDAAIAPTRPVQSSWSGNDVEDSDEDNL
                     EWEDIDIAPKKEKKVADYSLKASAIPTTIVEGSSTGSQSFLDRPFRNSGKLRQPERAI
                     QFVDDNSTDSDREYLDYVEETTNMEELKKTRGNLAGVEHRVSKHNPYKTAPDNATSEE
                     SLKDLSEVEEVPRKPGTRNDAQFPLQHKGTHNIMTDKINSELNDRMIPDVHTLPSINL
                     GKGSFLFDIKTSKEESSSSGETKPEQRKINQDVPLWFNSVPTTNPHTATGFVSDKETS
                     TFTEDEKLGIFSGVAATELMRQNVSSTDLESLEKELDGDSNDLEELTQLNKEHTEPTR
                     APDIPKGYLLKDTTQRSKEESTFAYDFPEEEEEVLVEQLRKEHADYNRFKHTLDPSIA
                     TTAFIEDELYEQNTKDKRDADEVTPEMIRDIQQLLSIFGIPYLTAPMEAEAQCAELLR
                     LKLIDGIITDDSDVFLFGGSKVFKNMFQEKNYVEYYNTETISAELGLDRLKFIALAQL
                     MGSDYTNGIKGIGPVSGIEILANYNTLEEFRTWYNEGQFRKSLLDKESLFQKNLRKKL
                     TKSGVVLGDDFPSAAVSDAYLNPEVDHDTTKFVWGLPELDSLRTFLGSTLGWPTEKAD
                     EVLIPLIRELNKRRSKGTQSTLVEFFPTKFIDADKGAKLGRRIRDATVMLKKRRTK"
     gene            complement(679682..679754)
                     /locus_tag="AGOS_t0146"
                     /db_xref="GeneID:4621931"
     tRNA            complement(679682..679754)
                     /locus_tag="AGOS_t0146"
                     /product="tRNA-Val"
                     /codon_recognized="GUG"
                     /db_xref="GeneID:4621931"
     gene            complement(<680315..>681274)
                     /locus_tag="AGOS_AFR134C"
                     /old_locus_tag="AFR134C"
                     /db_xref="GeneID:4621932"
     mRNA            complement(<680315..>681274)
                     /locus_tag="AGOS_AFR134C"
                     /old_locus_tag="AFR134C"
                     /product="AFR134Cp"
                     /transcript_id="NM_211035.2"
                     /db_xref="GeneID:4621932"
     CDS             complement(680315..681274)
                     /locus_tag="AGOS_AFR134C"
                     /old_locus_tag="AFR134C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR142W (LSC1)"
                     /codon_start=1
                     /product="AFR134Cp"
                     /protein_id="NP_985681.2"
                     /db_xref="GeneID:4621932"
                     /translation="MFRHVSRRCFSRESTPYDKTIKNLLMPKGTKVIFQGFTGKQATF
                     HAKISQEYGTQVVGGTNPKKAGQVHLGQPVFASVAEAVRETGATATGIFVPPPIAAPA
                     IREAIEAEVPLAVCVTEGIPQHDMLYIAEMLRTQDKTRLVGPNCPGIINPGSNVRIGI
                     QPTKIFTPGKIGIVSKSGTLTYEAVQQTSLVGLGQSLVIGIGGDAFPGTDFIDALRLF
                     MEDGVTEGIILLGEIGGKAEIEAAEFLKAYNQTRATPMPVASFIAGTVAGQMKGVRMG
                     HSGAIVEGSGTDAESKKAALRAAGVAVVESPGRLGEALLKQFQ"
     gene            <681760..>684135
                     /locus_tag="AGOS_AFR135W"
                     /old_locus_tag="AFR135W"
                     /db_xref="GeneID:4621933"
     mRNA            <681760..>684135
                     /locus_tag="AGOS_AFR135W"
                     /old_locus_tag="AFR135W"
                     /product="AFR135Wp"
                     /transcript_id="NM_211036.1"
                     /db_xref="GeneID:4621933"
     CDS             681760..684135
                     /locus_tag="AGOS_AFR135W"
                     /old_locus_tag="AFR135W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR141C (ARP8)"
                     /codon_start=1
                     /product="AFR135Wp"
                     /protein_id="NP_985682.1"
                     /db_xref="GeneID:4621933"
                     /translation="MYLAMQYHHSSRRQWIVSMDDEREMSVEMDVSIMDPIPTTEGKV
                     SKPETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQTGLF
                     RPLPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTLLAEAGEDDLKL
                     NGDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRASQRLEPQQRY
                     DKDEDFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIPEHNDLHRIE
                     WIKDAPEGTIYYGEGAERCLPENFVIRYPFSNGAFNVECPDYSSLQELLNDVTKLITF
                     ALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQESLATC
                     YGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQSNFP
                     YPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPGAEKFEFKLFNEV
                     MISPMAYFYPQILSFLKPATSYNKYMAQQLPESRDPYTYKPDNPKSIAQESAFTGKVY
                     TDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIESVT
                     TASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVYK
                     KVSEMVKQVENEIKKNNPESEEEIAQSRKKLIKSIKIELENYWESVDPYEHVYPIAVL
                     PPPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY"
     gene            complement(<684307..>686394)
                     /locus_tag="AGOS_AFR136C"
                     /old_locus_tag="AFR136C"
                     /db_xref="GeneID:4621934"
     mRNA            complement(<684307..>686394)
                     /locus_tag="AGOS_AFR136C"
                     /old_locus_tag="AFR136C"
                     /product="AFR136Cp"
                     /transcript_id="NM_211037.1"
                     /db_xref="GeneID:4621934"
     CDS             complement(684307..686394)
                     /locus_tag="AGOS_AFR136C"
                     /old_locus_tag="AFR136C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR140W (SFL1)"
                     /codon_start=1
                     /product="AFR136Cp"
                     /protein_id="NP_985683.1"
                     /db_xref="GeneID:4621934"
                     /translation="MAQLEDPKERAGKVGESQHGQHHNTAFIHKLYSMLEDDNMKDLI
                     WWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMYGFHKVSDHKPSSAKGTSQ
                     DEDEAINLWEFRHSMGCFRKGDKESLKSIKRRSSKNQVLLSRNNSAQSLASQYNSQQD
                     LGPGGSSIAGHVHPIEPADKYYSTTVYQPPYTDAPPLHSQSQIQAYPDMRFPQEQKPH
                     TSSVITLPHLPNSAIEDLRATNLDMMKLLDLVQKAMHISSPPSANELGGSVCSTSGGS
                     GLSSNQLGSASGSANDVTSPSSFARSPTGTRERTLEYLHQEIAAFRTTILMKLQRHAE
                     LQLHMLPPTPSQRHSHPQNSYAVSAPPSTGTNFLPYNGSGSIGMPTGYDAYPTNKPAL
                     AIPGAISHGFHGSPYLMLDPYAKGSSSSISRKRHMSVLVDPLAPAPMSAPAAMQVPSL
                     AQPTSTSSSPVHAPEGNMPHANAAGANSPFHASCPVSRIDSRQDLHHHQTSNPSASED
                     KRPFSPSRKDSPPSQLLPLLTTNARGSGDGNSLLLAPQSPATLPPTASQHRLPAPTPQ
                     NNAGRGPAQVSITYKPYFPYGTIPPQPVLSSQYILPLFQSGSGSFTSGSSVTAAHAPL
                     RSTTAIPETSSCNNSEIPSFPKPTTDEQQAPATVNQSATNSHRQSIVNQDTCSSPATS
                     KSRGLYALLNHDT"
     gene            complement(<687006..>688109)
                     /locus_tag="AGOS_AFR137C"
                     /old_locus_tag="AFR137C"
                     /db_xref="GeneID:4621935"
     mRNA            complement(<687006..>688109)
                     /locus_tag="AGOS_AFR137C"
                     /old_locus_tag="AFR137C"
                     /product="AFR137Cp"
                     /transcript_id="NM_211038.1"
                     /db_xref="GeneID:4621935"
     CDS             complement(687006..688109)
                     /locus_tag="AGOS_AFR137C"
                     /old_locus_tag="AFR137C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR136W (IDH2)"
                     /codon_start=1
                     /product="AFR137Cp"
                     /protein_id="NP_985684.1"
                     /db_xref="GeneID:4621935"
                     /translation="MLRQKLFQGSRRWLASVRQPSIGRYAGKPNAAGKYTVSFIEGDG
                     VGPEISQSVKDIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLA
                     TPIGKGHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEH
                     VVSPGVVQSIKLITREASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQ
                     ELGREYPDIELQTELLDNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLG
                     LTPSANIGHQVSIFEAVHGSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKA
                     VLSTIASSRENRTADLAGTASTSSFTNAVIERL"
     gene            <688486..>690345
                     /locus_tag="AGOS_AFR138W"
                     /old_locus_tag="AFR138W"
                     /db_xref="GeneID:4621936"
     mRNA            <688486..>690345
                     /locus_tag="AGOS_AFR138W"
                     /old_locus_tag="AFR138W"
                     /product="AFR138Wp"
                     /transcript_id="NM_211039.1"
                     /db_xref="GeneID:4621936"
     CDS             688486..690345
                     /locus_tag="AGOS_AFR138W"
                     /old_locus_tag="AFR138W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR390C (UBA2)"
                     /codon_start=1
                     /product="AFR138Wp"
                     /protein_id="NP_985685.1"
                     /db_xref="GeneID:4621936"
                     /translation="MRDYSVRQIIGDGQFTRLRDMKVLLVGAGGIGCELLKNLVQMGF
                     GEVHVVDLDTIEISNLNRQFLFRQRDVKRAKAATAVAAVGYFSSGRLVAHQGNITDAT
                     VFPLAWFRGFAAVFNALDNVAARRHVNRMAQFASIPLLESGTAGFDGQVQPIVPGKTE
                     CFDCTAKETPRTYPVCTIRSTPSQPVHCVIWAKNFLFQQLFGEPAEPPATEDLGTDDP
                     AEIARIRQESGELAQLQEWARTGDTARVRAVIEKLFVVDIQKLAAIESLWHTRPQPEA
                     LEGFELGVPSNAADASALWGIQEHLNRFAASLRRLMERMPREGSIEFDKDDADALEFV
                     ATAANIRAHIFHIKMLSVFDIKQIAGNIIPAIVTTNAIIAGLSALVSLRVLNLLRVMP
                     NDPLNLPMAFTSMASKISSNRYLAAPRLSPPNPNCSVCAHYQRCALTVGAVRCKTLTL
                     GELIEAVQEKYGFSNEVSVVDTSTNRLLADFDFDDLNGNTLEKLELRTGSILTVSDDV
                     PSEEDNTVRKPIEFYLELSDSATGFELIELPHIRVIDKETASNSDSVEADGKTAEVDL
                     DLVDASGAIVIQDEEDSQPDAAKRKHSRDSESDDSTSKRARLDADSAEILILD"
     gene            complement(<690727..>693186)
                     /locus_tag="AGOS_AFR139C"
                     /old_locus_tag="AFR139C"
                     /db_xref="GeneID:4621937"
     mRNA            complement(<690727..>693186)
                     /locus_tag="AGOS_AFR139C"
                     /old_locus_tag="AFR139C"
                     /product="AFR139Cp"
                     /transcript_id="NM_211040.2"
                     /db_xref="GeneID:4621937"
     CDS             complement(690727..693186)
                     /locus_tag="AGOS_AFR139C"
                     /old_locus_tag="AFR139C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR389W (SAC7) and YOR134W (BAG7)"
                     /codon_start=1
                     /product="AFR139Cp"
                     /protein_id="NP_985686.2"
                     /db_xref="GeneID:4621937"
                     /translation="MSEQGALATSPAKSQLAAWWRQFKNSPKSISTDSISGRERPLLG
                     KPASVHAVPCAPGRDFRTYRDSFLHSRNDFKGQVFGVPLADSLALASAEVIVQGELAN
                     FGRIPIVVAKCGAFLKQRGLYTSGIFRIAGNSKRIKELVYIFSTPPHYGTKFTSWDGF
                     TVHDAASVLRRFLNNLTEPLIPLVHYETYREPLRTRVRILKHMTRPPPVRDDSGRETE
                     NALSDPKTSTSDAEEALDAEEVRRQRRHRKRLTRDIKAALHEYEVLFSELSNDSKQLI
                     VYLLDLLSLFAQQSEVNLMSARNLAAIFQPSILSHPDHDMDPKEYELSRLVIEFLIDY
                     SYRLLPHLLKITKNEQALLQKQQQRGDGLKTHVCGLEAPSDIAVPMANEINQYSNVAD
                     SPAPLLKTNKEVGSSSPQSNSNVRAPNVMNNAATKTAAAKAAGKPGERDSQYMNVPSP
                     AISIPLTPTGSVLKMYDPDLWSASDLPFVTAQQRLTSPALSPSLPNEPQALSSSLPSP
                     QILSSSFPHQQLRPEQEQLLLQQQQQQQMQQPQHEQHLQQPQQQQNLSSQQHDHATQQ
                     KQRFSRPSQSQHLAGLKQPPQQWVQQARLDSRSGSPELRRRYRYRPHSKSLSSAISPS
                     DMIAARRNNVNPRIGKYLLLGSDTEGMSEYDEDEECVGYQDIYSPGSNNSDLLVVNPA
                     FSLPATGIRQGGSEVSIDSPTATDKRYDPNIVSSRPHDYNTIGTLHPSANPIGHLSDT
                     SADVSATPTIVVSKTTHPSEQNEQQQSLATGFSQATNDNDDDATADMYYDEDSQGERV
                     ARSKKRDSWFQKLRSRSRSAT"
     gene            complement(<693462..>694628)
                     /locus_tag="AGOS_AFR140C"
                     /old_locus_tag="AFR140C"
                     /db_xref="GeneID:4621938"
     mRNA            complement(<693462..>694628)
                     /locus_tag="AGOS_AFR140C"
                     /old_locus_tag="AFR140C"
                     /product="AFR140Cp"
                     /transcript_id="NM_211041.2"
                     /db_xref="GeneID:4621938"
     CDS             complement(693462..694628)
                     /locus_tag="AGOS_AFR140C"
                     /old_locus_tag="AFR140C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR388W (RVS167)"
                     /codon_start=1
                     /product="AFR140Cp"
                     /protein_id="NP_985687.2"
                     /db_xref="GeneID:4621938"
                     /translation="MSFKGLGKAVVRAPQSIKQRFNVGEQTSDVVYADAERRFKDLET
                     ETQKLGTEAKRYFAAVNGMLQHQISFAQAMEEIFKPISGVMSDPTAVLPEDNPKGIEA
                     SEQYRSIVNELQSVLSPDLELIEDKVVQPVQDLLKIIGTVRKMATKRNHKKLDLDRRL
                     NTHRKYESKRERSPKDDEKLYKAEAELQVARQEYDYYNDLLKTELPQLFALQAEFVRP
                     LFVSFYYMQLNIFYTLHNAMQDLRIPYFDLASDIVARFEAKRGNVEEQADALTITHFR
                     VGYSRNKLELTKRRYGSEASPSPTATFRSTPLDPPAYSEPSYGSSSASPATTAAPETC
                     IALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYVALKH"
     gene            complement(<694802..>696616)
                     /locus_tag="AGOS_AFR141C"
                     /old_locus_tag="AFR141C"
                     /db_xref="GeneID:4621939"
     mRNA            complement(<694802..>696616)
                     /locus_tag="AGOS_AFR141C"
                     /old_locus_tag="AFR141C"
                     /product="AFR141Cp"
                     /transcript_id="NM_211042.1"
                     /db_xref="GeneID:4621939"
     CDS             complement(694802..696616)
                     /locus_tag="AGOS_AFR141C"
                     /old_locus_tag="AFR141C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR386W (MUS81)"
                     /codon_start=1
                     /product="AFR141Cp"
                     /protein_id="NP_985688.1"
                     /db_xref="GeneID:4621939"
                     /translation="MSAKQLGDLKPLFIEWLKDEIDACGPRQEKMAMVYFRARESLKR
                     FDQPITETAKVLKVKGIGNSIKNKLASKLAQYCQDNNIPLEDAAAPSHVVGISVTRVR
                     TATQEKDDQSPKRKKRKYVPRKRSGAYAILLGALELGCPSRGLTKEEIIDAAAKYCDV
                     SFVSNPLTREFYSAWTAIKVLIDHDLMLEQGRPRRYIVTEAGEQMAETLKHADSVIFP
                     EDCPYQRRQQAPESTAEDHTELSASLSELVRQEHLPQNHSGMCFSFEPPSSAPSDYLD
                     PGQKSANVASSPHRLRPPIGPSIDIVKARWNGTSYELWKPGSYDIELYIDHREVRAKS
                     ERDFFVNALLTRGVTVEGKALALGDMVWVARHRDSRSTCVLNFMLERKRLDDLAMSIR
                     DNRFMEQKNRLKKTGCKHIFYLVEETSGTNVAGMEGAIKTSIWMTYVYSGFHVKRTRN
                     ADDTVEWLHDMTCTVQRYYCSKSLLVLRPREIANQEDYGSLLSAFRLQFERNNTSLEC
                     CHAFDCYQEVLGKTGLMTVKELYIRTLMLNRGVSLEKALAIQSKFPTLRSLMTAFRNC
                     KSEEDGRRMLYLALLDQPASRRVGKALAATLWDTFGRR"
     gene            complement(<696874..>699402)
                     /locus_tag="AGOS_AFR142C"
                     /old_locus_tag="AFR142C"
                     /db_xref="GeneID:4621940"
     mRNA            complement(<696874..>699402)
                     /locus_tag="AGOS_AFR142C"
                     /old_locus_tag="AFR142C"
                     /product="AFR142Cp"
                     /transcript_id="NM_211043.1"
                     /db_xref="GeneID:4621940"
     CDS             complement(696874..699402)
                     /locus_tag="AGOS_AFR142C"
                     /old_locus_tag="AFR142C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR385W (EFT2) and YOR133W (EFT1)"
                     /codon_start=1
                     /product="AFR142Cp"
                     /protein_id="NP_985689.1"
                     /db_xref="GeneID:4621940"
                     /translation="MVAFTVDQIRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAG
                     IISAAKAGEARFTDTRKDEQERGITIKSTAISLFSEMSEEDVKDIKQKTEGNSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPQKGTVAFGSGLHGW
                     AFTIRQFANRYSKKFGVDREKMMERLWGDSYFNPKTKKWTNKDRDADGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEIALKSDERDLEGKALLKVVMRKFLPAADAL
                     LEMIIMHLPSPVTAQNYRAEQLYEGPSDDPACIAIKNCDPKADLMLYVSKMVPTSDKG
                     RFYAFGRVFSGTVKSGQKVRIQGPSFTVGKKEDLFIKAIQRAVLMMGRFVEPIDDCPA
                     GNIVGLVGIDQFLLKTGTLTTFESAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYMSESGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEGESSQVALSKSPNKHNRIYLKAQPIDEEVSLAIEGGKINPRDDFKARARVMADEYG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVSAFQWATKEGPIFGEQMR
                     SVRINLLDVTLHADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNRKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWATLGTDPLDPTTKAGEIVVEARKRHGLKENVPGWQEYYDKL"
     gene            complement(<699602..>701182)
                     /locus_tag="AGOS_AFR143C"
                     /old_locus_tag="AFR143C"
                     /db_xref="GeneID:4621941"
     mRNA            complement(<699602..>701182)
                     /locus_tag="AGOS_AFR143C"
                     /old_locus_tag="AFR143C"
                     /product="AFR143Cp"
                     /transcript_id="NM_211044.2"
                     /db_xref="GeneID:4621941"
     CDS             complement(699602..701182)
                     /locus_tag="AGOS_AFR143C"
                     /old_locus_tag="AFR143C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR132W (VPS17)"
                     /codon_start=1
                     /product="AFR143Cp"
                     /protein_id="NP_985690.2"
                     /db_xref="GeneID:4621941"
                     /translation="MASVMPFDPYDDDVDNNPFAEEAPQAGALVEAEASGEASREAAG
                     EASSEGAADTGDKSVVPPLADLLPERHQDKYHLVAKVTGLERVGTLAHRRECPTVLFD
                     VSTNLPTFRKSQHKGLKKTYEEFQEVFKYLSGAVPETFVPALPPPSTSYGINNPEDTH
                     KTMANFNRWLERVCADPLLVRNEELAFFMESDFNTYTPMNKSRAPASGLLRKTMKQRP
                     PPYDEVTELAEFRPLVKSIYVVAQDVQAKLLRMTKTRKQLSHEESAFGQSFHQLTVEH
                     DGHSRLYQRFGKVLTAVGDLDSIMATFDMATLYDSLEWVVRDAYVVKETLTDRHFLMR
                     DLLQAQSCTRLKQDAARRLRAKRDISPLKVDDAIQQLKLATKTEHDLSRRLQRVTANM
                     RIERSRWVDNLSNSLLAAVREYTLRKIEYERKKLSLLERVRADVRLVDTQGGLSRLGR
                     HQLVASPLPTPSQSLSHGDSWTSDRRASHCLSSSDLEPHLLQGLDSPSPGAFRDSPDI
                     SGPLDARQAATILGTSTF"
     gene            <701953..>702735
                     /locus_tag="AGOS_AFR144W"
                     /old_locus_tag="AFR144W"
                     /db_xref="GeneID:4621942"
     mRNA            <701953..>702735
                     /locus_tag="AGOS_AFR144W"
                     /old_locus_tag="AFR144W"
                     /product="AFR144Wp"
                     /transcript_id="NM_211045.1"
                     /db_xref="GeneID:4621942"
     CDS             701953..702735
                     /locus_tag="AGOS_AFR144W"
                     /old_locus_tag="AFR144W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR384C (ATO3)"
                     /codon_start=1
                     /product="AFR144Wp"
                     /protein_id="NP_985691.1"
                     /db_xref="GeneID:4621942"
                     /translation="MDTVGSQDLEKAGMREGSSCKTQECVETLEDRVTSVGLEGDYVR
                     LGTQLFRRQDLQAALGTFRAPLADPVPLGLSSFSFSCMILGLYNAEVLGVTNHQLLVG
                     VAFFLGGLAQLLAGLLSFAVGNTFGLTVFSIFGSFWFCQGAIITNSFGVLQSFEQDPE
                     MLRNATGLFQLCWFVFTFLMLLCSLKSSWSLFALLVTLDLTFLLLAIGNFSNNPVLGR
                     AAGWTGFVSSICGWYTLYAEMSNLGNTYLPLPKLHMPHSMVA"
     gene            complement(702906..702977)
                     /locus_tag="AGOS_t0147"
                     /db_xref="GeneID:4621943"
     tRNA            complement(702906..702977)
                     /locus_tag="AGOS_t0147"
                     /product="tRNA-Asp"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:4621943"
     gene            complement(<703202..>703528)
                     /locus_tag="AGOS_AFR145C"
                     /old_locus_tag="AFR145C"
                     /db_xref="GeneID:4621944"
     mRNA            complement(<703202..>703528)
                     /locus_tag="AGOS_AFR145C"
                     /old_locus_tag="AFR145C"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="NM_211046.1"
                     /db_xref="GeneID:4621944"
     CDS             complement(703202..703528)
                     /locus_tag="AGOS_AFR145C"
                     /old_locus_tag="AFR145C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR382W (RPP2B)"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="NP_985692.1"
                     /db_xref="GeneID:4621944"
                     /translation="MKYLAAYLLLLQGGNDAPSAADIKSLIESVGVEVEDAKISTLLA
                     SLEGKSIEELIAEGQKKFASVPAGGAAPAGGASAAAGASEAAAEEAKEEAKEESDDDM
                     GFGLFD"
     gene            <703820..>704665
                     /locus_tag="AGOS_AFR146W"
                     /old_locus_tag="AFR146W"
                     /db_xref="GeneID:4621945"
     mRNA            <703820..>704665
                     /locus_tag="AGOS_AFR146W"
                     /old_locus_tag="AFR146W"
                     /product="AFR146Wp"
                     /transcript_id="NM_211047.1"
                     /db_xref="GeneID:4621945"
     CDS             703820..704665
                     /locus_tag="AGOS_AFR146W"
                     /old_locus_tag="AFR146W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YOR130C (ORT1)"
                     /codon_start=1
                     /product="AFR146Wp"
                     /protein_id="NP_985693.1"
                     /db_xref="GeneID:4621945"
                     /translation="MSEDADKAYKDLLYGGVAGSLGKLVEYPFDTVKVRLQTQSAALF
                     PTTWSCVSHTYKQEGLWRGFYQGMASPVFGAFLEHAVLFVSFNRAQAVLENCYSCGPL
                     EKVVFAGAIAGACTSYVLTPVELVKCKLQVSNLTGVSGPRYTAVLPTLRAIVKQNGLG
                     GLWQGQSGTFIRESAGGAVWFTAYEVLKGWLARRRGSTENTVWELLASGAGAGAAFHA
                     SIFPADTVKSTMQTEHLGLGPAVRTVLKKHGPTGFYRGVGITLLRALPANAVIFYVYE
                     SLCGL"
     gene            complement(<704686..>705633)
                     /locus_tag="AGOS_AFR147C"
                     /old_locus_tag="AFR147C"
                     /db_xref="GeneID:4621946"
     mRNA            complement(<704686..>705633)
                     /locus_tag="AGOS_AFR147C"
                     /old_locus_tag="AFR147C"
                     /product="AFR147Cp"
                     /transcript_id="NM_211048.2"
                     /db_xref="GeneID:4621946"
     CDS             complement(704686..705633)
                     /locus_tag="AGOS_AFR147C"
                     /old_locus_tag="AFR147C"
                     /note="NOHBY626; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0E02750g"
                     /codon_start=1
                     /product="AFR147Cp"
                     /protein_id="NP_985694.2"
                     /db_xref="GeneID:4621946"
                     /translation="MTAQPSNTANPAEVDELVHAVAGAGGGALSMALTMPLVTLATRM
                     QVSEQDKEPGTRSKSKLEAVREIYRKEGVVGFYAGLESAMYGMAVNSFIYYYFYELAA
                     RATMRVRGSRRLNTSEAILSSAVAGSMTAIASNPIWVVNTRMTVAKSEQSTLAVLLDI
                     VRKDGVTALFNGLRPALMLVSNPIIQYTVFEQLKNVVLKWSGSDVLLPSWAFLLGAVG
                     KLAATGSTYPYITLKTRMHLAKGKEDADTQQSMWSLMVDIVKKEGIQGLYHGIGVKLT
                     QSILTAAFLFYFKEGFILWAVKLISTLRRYSSRRKAVSV"
     gene            <706096..>706438
                     /locus_tag="AGOS_AFR148W"
                     /old_locus_tag="AFR148W"
                     /db_xref="GeneID:4621947"
     mRNA            join(<706096..706102,706167..>706438)
                     /locus_tag="AGOS_AFR148W"
                     /old_locus_tag="AFR148W"
                     /product="AFR148Wp"
                     /transcript_id="NM_211049.1"
                     /db_xref="GeneID:4621947"
     CDS             join(706096..706102,706167..706438)
                     /locus_tag="AGOS_AFR148W"
                     /old_locus_tag="AFR148W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR381C-A; 1-intron"
                     /codon_start=1
                     /product="AFR148Wp"
                     /protein_id="NP_985695.1"
                     /db_xref="GeneID:4621947"
                     /translation="MSCYLSAGAVAMVLLTKTIIRNRKDKQFLPAARQLGDGTEVEDP
                     YGNIAAIKPGFPMQQEQRPRKSEFEGAGLSYRTRKSGDRLGFFDRRQE"
     gene            complement(<706527..>707720)
                     /locus_tag="AGOS_AFR149C"
                     /old_locus_tag="AFR149C"
                     /db_xref="GeneID:4621948"
     mRNA            complement(join(<706527..706940,707472..>707720))
                     /locus_tag="AGOS_AFR149C"
                     /old_locus_tag="AFR149C"
                     /product="AFR149Cp"
                     /transcript_id="NM_211050.1"
                     /db_xref="GeneID:4621948"
     CDS             complement(join(706527..706940,707472..707720))
                     /locus_tag="AGOS_AFR149C"
                     /old_locus_tag="AFR149C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR381W (YRA1); 1-intron"
                     /codon_start=1
                     /product="AFR149Cp"
                     /protein_id="NP_985696.1"
                     /db_xref="GeneID:4621948"
                     /translation="MSANLDKALDEIIDSQKKPVRRPNKNAPRKVAKSVTAGRRRGPA
                     AGVRKSVPVERATSMLEAAYATKVNVEGLPRDIKEDAVRDFFRSSVGGLQRVLLSYNE
                     RGNSTGMATLTFANAEKAREAVKKFNGAPIDGGKSRLRLNLIVDPTRKPLAARIAPVA
                     KGPERSLRVARPDPAVRRDTRAPTKKAVAAKAQKRKPKPQKKSLEQLDQEMADYFDEA
                     KK"
     gene            <708468..>708668
                     /locus_tag="AGOS_AFR149WA"
                     /db_xref="GeneID:9487885"
     mRNA            <708468..>708668
                     /locus_tag="AGOS_AFR149WA"
                     /product="AFR149W-Ap"
                     /transcript_id="NM_001355337.1"
                     /db_xref="GeneID:9487885"
     CDS             708468..708668
                     /locus_tag="AGOS_AFR149WA"
                     /note="NOHBY673; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of unnamed Holleya sinecauda gene."
                     /codon_start=1
                     /product="AFR149W-Ap"
                     /protein_id="NP_001342279.1"
                     /db_xref="GeneID:9487885"
                     /translation="MSKRSPNTPISGLQKKLKMSPPPSAALAGSSSAEKFRRQLLVMG
                     FELQRVRELNQFLEWERQMQVE"
     gene            complement(<708723..>709772)
                     /locus_tag="AGOS_AFR150C"
                     /old_locus_tag="AFR150C"
                     /db_xref="GeneID:4621949"
     mRNA            complement(<708723..>709772)
                     /locus_tag="AGOS_AFR150C"
                     /old_locus_tag="AFR150C"
                     /product="AFR150Cp"
                     /transcript_id="NM_211051.1"
                     /db_xref="GeneID:4621949"
     CDS             complement(708723..709772)
                     /locus_tag="AGOS_AFR150C"
                     /old_locus_tag="AFR150C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL029C (CAK1)"
                     /codon_start=1
                     /product="AFR150Cp"
                     /protein_id="NP_985697.1"
                     /db_xref="GeneID:4621949"
                     /translation="MAKHIPVKVLCTTRYARIQLLEDGSVAKSVKIESQCAPHDVETE
                     LRILQACQHSNIIPVLSATVEGGIVKICMPYVKTDLYAFMRQHYGGKHLAYLMPCLDS
                     EARGRRAQKNRLSMARTMHVCSQLADALAYLHGLGVIHRDIKPQNVLVDSNDHVYVID
                     FGVCYDTAQRGPRRYGETDDSKIPDVSTSIYKAPELMFSVRNYGLPVDVWSLAVTFSQ
                     LFQRYETPQGGIAAFVDDGAEELETGTDIRAVMSIFQQLGIPSQEQWPQVVRYGSSGF
                     VGMFGTEGDGNYIFDKPWPEQLAKVEQLFPRLAEVSQHEELARMLLGMLHFDTQKRIP
                     ASHVAATLRTFAQLQ"
     gene            complement(<710030..>711085)
                     /locus_tag="AGOS_AFR151C"
                     /old_locus_tag="AFR151C"
                     /db_xref="GeneID:4621950"
     mRNA            complement(<710030..>711085)
                     /locus_tag="AGOS_AFR151C"
                     /old_locus_tag="AFR151C"
                     /product="AFR151Cp"
                     /transcript_id="NM_211052.2"
                     /db_xref="GeneID:4621950"
     CDS             complement(710030..711085)
                     /locus_tag="AGOS_AFR151C"
                     /old_locus_tag="AFR151C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR056W (ERG3)"
                     /codon_start=1
                     /product="AFR151Cp"
                     /protein_id="NP_985698.2"
                     /db_xref="GeneID:4621950"
                     /translation="MDLVLEFCDSYFFDYVYATLLPASLSPKMGGTWQQAMIKEQMVN
                     ATRVFGRSLERPLEVYGYAPFMFEVSPHAFGSVLPRYSLLRQSLSLFLVTTVFGWLLY
                     LIVASFSYVFVFDKSVFNHPRYLKNQMSMEIKQGLGAIPYMAVMTVPWFLLELHGYSH
                     LYMGLELNVRGYVRLALEALFFILFTDFGIYLLHRWLHWPAVYKVLHKKHHKWLVCTP
                     FASHAFHPIDGYLQSLPYHLFPMLFPLHKVSYLVLFTFVNVWTVMIHDGEYLSNDPVI
                     NGAACHTVHHLYFNYNYGQFTTLWDRLGGSYREPDHELFDSNLKKDKAVWEQQIKEVD
                     EMIKNVEGPADDRVYER"
     gene            complement(<711433..>712245)
                     /locus_tag="AGOS_AFR152C"
                     /old_locus_tag="AFR152C"
                     /db_xref="GeneID:4621951"
     mRNA            complement(<711433..>712245)
                     /locus_tag="AGOS_AFR152C"
                     /old_locus_tag="AFR152C"
                     /product="AFR152Cp"
                     /transcript_id="NM_211053.1"
                     /db_xref="GeneID:4621951"
     CDS             complement(711433..712245)
                     /locus_tag="AGOS_AFR152C"
                     /old_locus_tag="AFR152C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL028C (CAF16)"
                     /codon_start=1
                     /product="AFR152Cp"
                     /protein_id="NP_985699.1"
                     /db_xref="GeneID:4621951"
                     /translation="MDTSQAVEVTGLSYKFPHAEEESLTDVNLVLPWRKRMLLCGSNG
                     AGKSTLLKLLSGKHLCRSGNIRVDGRDPFAPANTADPADVMVTAYLGTEWCHMAIVHR
                     DIGVQELLDSIGLQHFRERGTELLRILDVDLRWRMHRLSDGQKRRVQLCMGLLKPFKL
                     LLLDEVTVDLDVVARTKLLHFLRLETERRECSIIYATHIFDGLADWPDRVVHIAHGRV
                     LADLDVARDVSFAADRTDVVEAAGRVRIGHVRSLHPLALAWLARDEGKMASE"
     gene            <712587..>714317
                     /locus_tag="AGOS_AFR153W"
                     /old_locus_tag="AFR153W"
                     /db_xref="GeneID:4621952"
     mRNA            <712587..>714317
                     /locus_tag="AGOS_AFR153W"
                     /old_locus_tag="AFR153W"
                     /product="AFR153Wp"
                     /transcript_id="NM_211054.2"
                     /db_xref="GeneID:4621952"
     CDS             712587..714317
                     /locus_tag="AGOS_AFR153W"
                     /old_locus_tag="AFR153W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR055C (SPT8)"
                     /codon_start=1
                     /product="AFR153Wp"
                     /protein_id="NP_985700.2"
                     /db_xref="GeneID:4621952"
                     /translation="MDEVDDILNQNQVEEEEDDEDDLDEEIADVADPANGNDEEGQDD
                     DEEQEHNMDEDEDEDDDAEEEDMEDEDEDMEDEDEDEDEDEDGDNADLNGNSYSKVGS
                     SKTTPEVETSRTSAYDKIHMYYSELARNAVLASDYSITPTAAIPIQTHVHSITMSKGL
                     KYLFLGGQDGYIRKFDFLNTIEGKLSLTILQKHSLVESISNAGIMLSYWENEVPQAQK
                     DMKLTKNGKEYEPKVSPVHSLEVHSECLYILAGQEGGGITLQGVRYMEGQIGHYFKKH
                     TSTVNQLLLNDDETRFVSGSWDKQILDWDLHTGHCITEFKGVPAQISTLSFRPRYSTV
                     ELSSLVSTDEESKLKADSSRADDDMDSLFGEDDEEQPPKSREKALSRDASFAKEADIK
                     TSMSDARDVLSKYSLRTRMDENALLSSCISGTIQLWDRRAGSGPQLTLPRDKATPPWC
                     MSACWSHDGDRIYAGRRNATVDEYDLRYTLRASKTLKLPKISGPVSAVQALPNGKHIL
                     CASQDNIRIYDVTSSTSTPFLIVPGHHGGTISNMYVDPTCRFLISTSGNRGWQGTSTD
                     TTLIYDIDLE"
     gene            complement(<714686..>716338)
                     /locus_tag="AGOS_AFR154C"
                     /old_locus_tag="AFR154C"
                     /db_xref="GeneID:4621953"
     mRNA            complement(<714686..>716338)
                     /locus_tag="AGOS_AFR154C"
                     /old_locus_tag="AFR154C"
                     /product="AFR154Cp"
                     /transcript_id="NM_211055.1"
                     /db_xref="GeneID:4621953"
     CDS             complement(714686..716338)
                     /locus_tag="AGOS_AFR154C"
                     /old_locus_tag="AFR154C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFL027C (GYP8)"
                     /codon_start=1
                     /product="AFR154Cp"
                     /protein_id="NP_985701.1"
                     /db_xref="GeneID:4621953"
                     /translation="MIILGALSGAGRGAIRTITATVGPDSHKEARDHGYGRTMSDSLF
                     SSCDNISLTDSVFDHRSLTYFSNDEQRQLKLQIMQSCGASDQWEGRQKNLQLGVSRNG
                     FVSHSLRRHFWHCILRGRVRVCPRAGVSEHPDEHQMELDVRRSFGFVENEGQKQKLRE
                     LLQATLVRFFRKYPSLRYYQGYHDVVSVILMVYYDALESDQFSTLQGSADDLLSSSVA
                     SSMSEATVLPDESTQSTVDTMFEVVEMFSLLYLRDFMMDSLDFTIDQLQVIPQLIKIR
                     DVELFRQLHLDQVSPFFALSSILTIFSHDLKPCKNQLSPLYQIFDLVITSGNMMAPLV
                     IYMELIVEHKEDLLRECDAQSDLFENITDLVHGAMQQVMQREQTTEQWQDVLERGRLF
                     LEDHPLAATSSEVRKFRWLNPYSVLKENPGDGANYSLSELLDIVEREIAENERRKSMA
                     LASDALRNRIKNIRRICRSLVYFGSLWRWPIYIGIFALLIRVYSANFRELRPINIWYV
                     LSSVLSGDSPITGIPFSFRLPGVGTKTWFLDPLRSLLPSSAR"
     gene            <716650..>718341
                     /locus_tag="AGOS_AFR155W"
                     /old_locus_tag="AFR155W"
                     /db_xref="GeneID:4621954"
     mRNA            <716650..>718341
                     /locus_tag="AGOS_AFR155W"
                     /old_locus_tag="AFR155W"
                     /product="AFR155Wp"
                     /transcript_id="NM_211056.2"
                     /db_xref="GeneID:4621954"
     CDS             716650..718341
                     /locus_tag="AGOS_AFR155W"
                     /old_locus_tag="AFR155W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YLR259C (HSP60)"
                     /codon_start=1
                     /product="AFR155Wp"
                     /protein_id="NP_985702.2"
                     /db_xref="GeneID:4621954"
                     /translation="MLRSSGTKSVLRGLRFYSHKELKFGVEGRAALLRGVETLADAVS
                     ATLGPKGRNVLIEQQFGAPKITKDGVTVARAITLEDHFENMGAKLLQEVASKTNEAAG
                     DGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGTQAAVEKVIEFLSKNKKEITTSAEI
                     AQVATISANGDSHVGKLLASAMEKVGKEGVITIKEGRTLEDELEVTEGMRFDRGFISP
                     YFITDAKANKVEFEKPLLLLSEKKISSIQDIIPALEISNQSRRPLLIIAEDIDGEALA
                     ACILNKLRGQVQVCAVKAPGFGDNRKNTLGDIAVLTGGTVFTEELDLKPENATLQHLG
                     SADSITITKEDTVVLNGNGTKENIEARIEQIRNSIDLTTTNSYEKEKLQERLAKLSGG
                     VAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKATRVLDEVKTEN
                     FDQKLGVDIIRRAIAQPARKIIENAGEEGAVIVGKIIDDFGEDFTKGYDAAKGEYTDM
                     LAAGIIDPFKVVRSGIVDASGVASLLATTEVAIVDAPKPANAAPPAGMPGMPGMM"
     gene            <719061..>720737
                     /locus_tag="AGOS_AFR156W"
                     /old_locus_tag="AFR156W"
                     /db_xref="GeneID:4621955"
     mRNA            <719061..>720737
                     /locus_tag="AGOS_AFR156W"
                     /old_locus_tag="AFR156W"
                     /product="AFR156Wp"
                     /transcript_id="NM_211057.2"
                     /db_xref="GeneID:4621955"
     CDS             719061..720737
                     /locus_tag="AGOS_AFR156W"
                     /old_locus_tag="AFR156W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YOR348C (PUT4)"
                     /codon_start=1
                     /product="AFR156Wp"
                     /protein_id="NP_985703.2"
                     /db_xref="GeneID:4621955"
                     /translation="MADRASSASIEKADNGGYMHKVKTPHSRTSLEELETQSAGSEYN
                     TLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSL
                     AEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNP
                     VPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNH
                     DRTGFRYWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTR
                     RNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIAN
                     AGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNA
                     VIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAYIRFRRGIVFNNLQ
                     SRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYL
                     GHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKFLYWLL"
     gene            <720875..>721378
                     /locus_tag="AGOS_AFR157W"
                     /old_locus_tag="AFR157W"
                     /db_xref="GeneID:4621956"
     mRNA            join(<720875..720929,720981..>721378)
                     /locus_tag="AGOS_AFR157W"
                     /old_locus_tag="AFR157W"
                     /product="AFR157Wp"
                     /transcript_id="NM_211058.1"
                     /db_xref="GeneID:4621956"
     CDS             join(720875..720929,720981..721378)
                     /locus_tag="AGOS_AFR157W"
                     /old_locus_tag="AFR157W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL125C (HNT1); 1-intron"
                     /codon_start=1
                     /product="AFR157Wp"
                     /protein_id="NP_985704.1"
                     /db_xref="GeneID:4621956"
                     /translation="MASAVAHDAACVFCKIIKGEIPSFKLMETAHSYAFLDIQPTAEG
                     HTLIIPKYHGAKLHNVPDEYLADILPVTRKLVKALGCDNDGPTGPGYNVLQNNGRLAH
                     QEVDHVHFHLIPKRNAVSGLGVGWPAAPADMESLKHVHKTLSGRLQSL"
     gene            <721630..>724128
                     /locus_tag="AGOS_AFR158W"
                     /old_locus_tag="AFR158W"
                     /db_xref="GeneID:4621957"
     mRNA            <721630..>724128
                     /locus_tag="AGOS_AFR158W"
                     /old_locus_tag="AFR158W"
                     /product="AFR158Wp"
                     /transcript_id="NM_211059.2"
                     /db_xref="GeneID:4621957"
     CDS             721630..724128
                     /locus_tag="AGOS_AFR158W"
                     /old_locus_tag="AFR158W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL126C (CDC48)"
                     /codon_start=1
                     /product="AFR158Wp"
                     /protein_id="NP_985705.2"
                     /db_xref="GeneID:4621957"
                     /translation="MVKDEHKRLLDASGTEPRDEDATATAILKRKKKDNYLLVDDAVK
                     DDNSVIVVNSNTMDLLQLFRGDTVLVKGKMRKDTVLIVLLDDELADGVCRINRVVRNN
                     LRVRLGDLVSIHPCPDIKYAERISVLPIADTIEGLTGNLFDVYLKPYFVEAYRPVRKG
                     DHFIVRGSMRQVEFKVVDVEPEDYAVVAQDTIIHSDGEPINREDEENNINEVGYDDIG
                     GCRKQMAQIREMVELPLRHPQLFKAIGIKPPKGVLMYGPPGTGKTLMARAVANETGAF
                     FFLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERR
                     VVSQLLTLMDGMKSRSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEIL
                     NIHTKNMRLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREKMSLIDLDEDEIDA
                     EVLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDDIKRELKETVEYPV
                     LHPDQYIKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGES
                     ESNIRDIFDKARAAAPTVVFLDELDSIAKARGGSMGDAGGASDRVVNQLLTEMDGMNA
                     KKNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDEAGRMSILKAQLRKAPLEPGLD
                     LGAIAKATQGFSGADLSYIVQRAAKFAIRDSIEAQKRAEAERADKPKTEDVEMSDANV
                     ASEEEVDAVPFITREHFADAMKTAKRSVSDAELRRYEAYAQQMKASRGQFGNFSFGSE
                     ARSDSGAGAAPAGTESSGAAAFNNAADEDDDLYS"
     gene            complement(<724500..>725426)
                     /locus_tag="AGOS_AFR159C"
                     /old_locus_tag="AFR159C"
                     /db_xref="GeneID:4621958"
     mRNA            complement(<724500..>725426)
                     /locus_tag="AGOS_AFR159C"
                     /old_locus_tag="AFR159C"
                     /product="AFR159Cp"
                     /transcript_id="NM_211060.1"
                     /db_xref="GeneID:4621958"
     CDS             complement(724500..725426)
                     /locus_tag="AGOS_AFR159C"
                     /old_locus_tag="AFR159C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL127W (PCL2) and YDL179W (PCL9)"
                     /codon_start=1
                     /product="AFR159Cp"
                     /protein_id="NP_985706.1"
                     /db_xref="GeneID:4621958"
                     /translation="MSDYEALLRFNKMPVSVEMVHFLASTTASIIQVRSEGNSEHILS
                     LVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIETSRHRMFLGCLILAAKN
                     LNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISCLSHFLNPIR
                     DSFIRGEQRSHLLFHVPLTGQTKQFILQNGDVYSSSSSNMSIPSLVSSRTISTISTNG
                     SRCTARSALAAHQAVTMECIQEERLPKLHLREANITSTQCPRKGLTRPVILQPKLNTF
                     YDGAHSINGTSDGANVGAYRTLKNAGWTALFS"
     gene            complement(<726122..>727333)
                     /locus_tag="AGOS_AFR160C"
                     /old_locus_tag="AFR160C"
                     /db_xref="GeneID:4621959"
     mRNA            complement(<726122..>727333)
                     /locus_tag="AGOS_AFR160C"
                     /old_locus_tag="AFR160C"
                     /product="AFR160Cp"
                     /transcript_id="NM_211061.2"
                     /db_xref="GeneID:4621959"
     CDS             complement(726122..727333)
                     /locus_tag="AGOS_AFR160C"
                     /old_locus_tag="AFR160C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL128W (VCX1)"
                     /codon_start=1
                     /product="AFR160Cp"
                     /protein_id="NP_985707.2"
                     /db_xref="GeneID:4621959"
                     /translation="MDTQTPLLDRRRRRATGGVAARLGRDLRVVFHSSPVNYLLVFVP
                     LGLALGYAGASAGWVFSVNFLAIIPLAAILAFATEELAEHVGSTLGGLLNATLGNAVE
                     LIVSVIALRRGQVRIVQASMLGSLLSNLLLVLGFCFLFGGINGGQQKFNQTAAQTMSS
                     LLVISCASLLIPAAFKATLPSETEEQSVIIGDKLLKLSRGTSMVLLVVYVLFLCFQLL
                     THHEMFEQQEEAVVETYEPRHAQLSVRSSLGYLLASTVLVSLAADFLVDSIDDIVEST
                     GLSKTFIGLIVIPIVGNAAEHVTSVIVAMKNNMSLALSVAIGSSLQISLFVTPFMVLI
                     GWWINVPMTLNFSTFETATLFTSVFLSNYLILDGESNWLEGVMSLAMYALISLAFFYY
                     PDEEAIASVLA"
     gene            complement(<727767..>729050)
                     /locus_tag="AGOS_AFR161C"
                     /old_locus_tag="AFR161C"
                     /db_xref="GeneID:4621960"
     mRNA            complement(<727767..>729050)
                     /locus_tag="AGOS_AFR161C"
                     /old_locus_tag="AFR161C"
                     /product="AFR161Cp"
                     /transcript_id="NM_211062.1"
                     /db_xref="GeneID:4621960"
     CDS             complement(727767..729050)
                     /locus_tag="AGOS_AFR161C"
                     /old_locus_tag="AFR161C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL180W"
                     /codon_start=1
                     /product="AFR161Cp"
                     /protein_id="NP_985708.1"
                     /db_xref="GeneID:4621960"
                     /translation="MTRIGYWGAYYMPVLLDSSPYAPAAALVGAAAAIAAAGAGAGLL
                     GAAAGPFEPNAQDYFRTALLGFLPPVLVHCIKTFVLGTDGSATLVELLVDYPLSDALM
                     AALLAALAYPQVHQAASADGGWCLTPRQSYVFGLSWALNELLLAVLGSLNDYVEEPHG
                     LIIHAPDAQSEELSSLRRSISLSRCMNVRRQASRISDNIYQPPPRASHSYGSLAPARA
                     DDDLVVLAFTGDSPDADGVCPSLRHRAHPHSGAPLYFAPAASWHAFSRRLLLASLIVL
                     AHLLQAAGQALLMSLYFLYVPDSDARLARLVLYFGGHSFAFFAAVLLLPFSLANFACH
                     LLLLTWKDDRAVLLARPHSHEPDSLLPSPATDSPVGACVLSPFHARLASHRLCRRTLQ
                     SWRALASRRGASPVGALCWALAVFAAGVCAARPPT"
     gene            complement(<729371..>730453)
                     /locus_tag="AGOS_AFR162C"
                     /old_locus_tag="AFR162C"
                     /db_xref="GeneID:4621961"
     mRNA            complement(<729371..>730453)
                     /locus_tag="AGOS_AFR162C"
                     /old_locus_tag="AFR162C"
                     /product="AFR162Cp"
                     /transcript_id="NM_211063.1"
                     /db_xref="GeneID:4621961"
     CDS             complement(729371..730453)
                     /locus_tag="AGOS_AFR162C"
                     /old_locus_tag="AFR162C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL129W"
                     /codon_start=1
                     /product="AFR162Cp"
                     /protein_id="NP_985709.1"
                     /db_xref="GeneID:4621961"
                     /translation="MRAELHLAGTRKHRPSSSAPIPTTPVSRSRSSLPPDTEHISASR
                     DLLKPVRSTVTARREPVPADALTVESPPVAPGSPKAIPLLVVPSPLRTPPPLAQHSCA
                     AREGSSPPRYPPCPPSPPLRATSRKSNPPTEDMTTCHLHEQPAMGRRPVNRTSTLQAI
                     ITPEEPARLPEDADKPSGGCSKPEPPAADSLPVRLPGTPEAPAHLLGATKDLKMHIIR
                     VMDKLKAGDQQELPREELLAVLDCSLSAISHWSLQAQLAQLSQSKSVWDSRLLVENNL
                     IKKEAEFFKKRLEQAGRSAGTEPASAGRVAKRPLAQTPRKRQALLDSPQGYKLVENTK
                     PHPRMRRHMDNPSTSGFVRVFHLERL"
     gene            complement(<731139..>731511)
                     /locus_tag="AGOS_AFR163C"
                     /old_locus_tag="AFR163C"
                     /db_xref="GeneID:4621962"
     mRNA            complement(join(<731139..731342,731398..>731511))
                     /locus_tag="AGOS_AFR163C"
                     /old_locus_tag="AFR163C"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="NM_211064.1"
                     /db_xref="GeneID:4621962"
     CDS             complement(join(731139..731342,731398..731511))
                     /locus_tag="AGOS_AFR163C"
                     /old_locus_tag="AFR163C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDL130W (RPP1B); 1-intron"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="NP_985710.1"
                     /db_xref="GeneID:4621962"
                     /translation="MSDAIISYAALILADAGLDITSDNLLSLTKAAGASVDNVWAEIF
                     AKALEGKDVKEVLSGFHAAGASAGAASGAAASGAAAEAAAEEAAEEAAEESDDDMGFG
                     LFD"
     gene            complement(731674..731745)
                     /locus_tag="AGOS_t0148"
                     /db_xref="GeneID:4621963"
     tRNA            complement(731674..731745)
                     /locus_tag="AGOS_t0148"
                     /product="tRNA-Glu"
                     /codon_recognized="GAG"
                     /db_xref="GeneID:4621963"
     gene            733050..733150
                     /locus_tag="AGOS_t0149"
                     /db_xref="GeneID:4621964"
     tRNA            join(733050..733086,733106..733150)
                     /locus_tag="AGOS_t0149"
                     /product="tRNA-Ser"
                     /codon_recognized="AGC"
                     /db_xref="GeneID:4621964"
     gene            <733270..>733884
                     /locus_tag="AGOS_AFR164W"
                     /old_locus_tag="AFR164W"
                     /db_xref="GeneID:4621965"
     mRNA            <733270..>733884
                     /locus_tag="AGOS_AFR164W"
                     /old_locus_tag="AFR164W"
                     /product="AFR164Wp"
                     /transcript_id="NM_211065.1"
                     /db_xref="GeneID:4621965"
     CDS             733270..733884
                     /locus_tag="AGOS_AFR164W"
                     /old_locus_tag="AFR164W"
                     /note="NOHBY627; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0C12023g"
                     /codon_start=1
                     /product="AFR164Wp"
                     /protein_id="NP_985711.1"
                     /db_xref="GeneID:4621965"
                     /translation="MNLCFRTLPKLMARSMTTVPSGQLPYSLADIRIGKVLSVREHPE
                     SYKMYITQVSFGGLGTKQICTGLRDHVPTSEMQDSLVVVLNNIKKCKLRGEVSEAMIL
                     CAEYSPQESKPSVQLLQPAISSPEFCGARVLVGDLLGKEVAPTCRRIKPAEWEELSSR
                     LYVDNSGRVVLQSEGKELPLYVRDNIGSLHYIMASSMPTGSQVR"
     gene            complement(733975..734085)
                     /locus_tag="AGOS_t0150"
                     /db_xref="GeneID:4621966"
     tRNA            complement(join(733975..734018,734048..734085))
                     /locus_tag="AGOS_t0150"
                     /product="tRNA-Leu"
                     /codon_recognized="UUG"
                     /db_xref="GeneID:4621966"
     gene            complement(<735621..>736232)
                     /locus_tag="AGOS_AFR165C"
                     /old_locus_tag="AFR165C"
                     /db_xref="GeneID:4621967"
     mRNA            complement(<735621..>736232)
                     /locus_tag="AGOS_AFR165C"
                     /old_locus_tag="AFR165C"
                     /product="AFR165Cp"
                     /transcript_id="NM_211066.1"
                     /db_xref="GeneID:4621967"
     CDS             complement(735621..736232)
                     /locus_tag="AGOS_AFR165C"
                     /old_locus_tag="AFR165C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL200C (EMP24)"
                     /codon_start=1
                     /product="AFR165Cp"
                     /protein_id="NP_985712.1"
                     /db_xref="GeneID:4621967"
                     /translation="MRIAATFSLLFLAIFQVSWAHNVLLPPYGRRCFFEQLKGGDVLT
                     ITYQFGDRDPQSHQQLSGDLLVYGIDGRSVLDAQRASSHGELTLKAPTDGKYQYCFAN
                     DNSGYLTKDVTFNTYGVLSPDAADSSSETLEGAVRKLSMLTMEVMNEQQYIEIRERTH
                     RNTAESTNDRVKWWSIFQLAVVVAQSLFQVYYLRSFFEVTSYV"
     gene            complement(<737857..>739001)
                     /locus_tag="AGOS_AFR166C"
                     /old_locus_tag="AFR166C"
                     /db_xref="GeneID:4621968"
     mRNA            complement(join(<737857..738618,738819..>739001))
                     /locus_tag="AGOS_AFR166C"
                     /old_locus_tag="AFR166C"
                     /product="AFR166Cp"
                     /transcript_id="NM_211067.2"
                     /db_xref="GeneID:4621968"
     CDS             complement(join(737857..738618,738819..739001))
                     /locus_tag="AGOS_AFR166C"
                     /old_locus_tag="AFR166C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER133W (GLC7); 1-intron"
                     /codon_start=1
                     /product="AFR166Cp"
                     /protein_id="NP_985713.2"
                     /db_xref="GeneID:4621968"
                     /translation="MSMETPPVDIDNIIDRLLEVRGSKPGQQVDLEEHEIRYLCSKAR
                     SIFIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSL
                     ETICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCL
                     PIAAIIDEKIFCMHGGLSPDLNTMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWS
                     ENDRGVSFTFGPDVVSRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGE
                     FDNAGAMMSVDESLLCSFQILKPAVKPSAGRGQPKKKK"
     gene            739463..739497
                     /locus_tag="AGOS_AgSNR52"
                     /old_locus_tag="AgSNR52"
                     /db_xref="GeneID:4621969"
     ncRNA           739463..739497
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR52"
                     /old_locus_tag="AgSNR52"
                     /product="AgSNR52"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR52; start and end coordinates are
                     approximate. Similarity is partial. In synteny."
                     /transcript_id="NR_149397.1"
                     /db_xref="GeneID:4621969"
     gene            <739516..>740136
                     /locus_tag="AGOS_AFR167W"
                     /old_locus_tag="AFR167W"
                     /db_xref="GeneID:4621970"
     mRNA            <739516..>740136
                     /locus_tag="AGOS_AFR167W"
                     /old_locus_tag="AFR167W"
                     /product="AFR167Wp"
                     /transcript_id="NM_211068.1"
                     /db_xref="GeneID:4621970"
     CDS             739516..740136
                     /locus_tag="AGOS_AFR167W"
                     /old_locus_tag="AFR167W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL198W (YIP4)"
                     /codon_start=1
                     /product="AFR167Wp"
                     /protein_id="NP_985714.1"
                     /db_xref="GeneID:4621970"
                     /translation="MSDEIEADGSVRGAPRDTGRGTLDESAAATLVRDVRAMHARLRQ
                     AVYPALRSGWQPVADGPPETDLWAPLVFVLAQAALLARGGGHFYALFVVHWGVLALLA
                     AHLKLMRVGEKRSWLVYVSACGYCLFPLVMASLLSRLGYPTLLLFFAAGPWRVRALYC
                     LRLGGFLLSSLWAHASACAVASCVGFIECYPLALCLAGLSWLSVVV"
     gene            <740358..>745100
                     /locus_tag="AGOS_AFR168W"
                     /old_locus_tag="AFR168W"
                     /db_xref="GeneID:4621971"
     mRNA            <740358..>745100
                     /locus_tag="AGOS_AFR168W"
                     /old_locus_tag="AFR168W"
                     /product="AFR168Wp"
                     /transcript_id="NM_211069.2"
                     /db_xref="GeneID:4621971"
     CDS             740358..745100
                     /locus_tag="AGOS_AFR168W"
                     /old_locus_tag="AFR168W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL197W (MDS3) and YER132C (PMD1)"
                     /codon_start=1
                     /product="AFR168Wp"
                     /protein_id="NP_985715.2"
                     /db_xref="GeneID:4621971"
                     /translation="MPLILPSAGNCFPLRLPKLDAGQLQDLDERAQKRLLLECRTGAA
                     VALGRSSLFVYGGLTIPLNLPEVTLVQIQQELILHFARCKTANYLNLCEYISQEVFSL
                     DLLSRRWERVQLAEEEKSGGAGVSAEGPDGTVMRERIFHAMVYCGGCLYVFGGLVASS
                     HSEYELVATNELWQLDMRTKVWTLLSDDPRVQRRFNHELHVLNEFDDHDTHLIIVGGL
                     DNMDKKVHKVEVYNVTRGCWESFEDCYPADITNCNTLESACDLHVGQIHSNIDDQPAG
                     LVRGSNFGLLVDNEDHVPTLAFYSAPETNKTRDSSCWENPIVMMPLLPNARGKRTKVH
                     MPSKASIRRLKMLFDLSFVSGILFGPNIIIIGFHAGLLGSNFYAFLYSIPLGKWTHLN
                     INCPHSGMRRHRYWSLFHWESHHKALLLGTYEDDSNLPTVQKFDRMLAIRLQNAFPTV
                     KSLLSDGVGIRVKIARTHSGQGFTSQKDAFKKTEQFESYSRYIVPPSEITSIRSVFPS
                     YASVLGKDALEVYGKSLADFEFITLEGDSVSIPSLLLRKRWGRFFDHILAQDYSKLSS
                     SVDHVQFEKSVDGSNSDSSTNIANQLANPSTEGRDQHAPESQVSSENVPRLNFGLRSN
                     VATGSAMLNKKSVSLILNPTWRLSPSVSGLALNIQEQESKEEPSDPLSEETINESGAK
                     GASLTSSSGGMVFRVPFTESSESLKQRENSQPAPSIHLELADYSPQSKKSLSTSTDKR
                     RRSSYTAGSHWKQVKASGYRRASHPIGNIRDLLYGADRTTSSPLNSRRGSAVSNTSSI
                     SYVSSSSERLSNRHCKRDSEDSSSGTLTFNINLPPQQPPPTDPLPTLPLNITGEYQYS
                     NRRESEHSLVGIPRSLKSSPSSSRCSSSFNEFDTKFRQYTLAERGRESTTGPHAPPIQ
                     FNPVMESGEKLFYKETELDPKQPIARSQTTESFNKSVGDVSRLSLTPTLESYKSQSSL
                     SAALGELEPLLIPRSLYLPWPTSSVKAFSEFFYTGQVNSKWPFSPVSLDLLHMAKLYE
                     VPLLYDLTCEVFYSIIGKKMVGLIQSVSALKELFLQRVATFLDNDELKINEYTKSHHT
                     FQTLLQLEESIASVDDGYFDLKLMQKVSRAFSTSTDGSTDADHDKEFSTTSSCISSPA
                     LSPVFGDYLRDSISLPGARSHPPTSLRPPGRNQSAFRHRSISSSKKKENIIADFSKVP
                     NRSSPSEGHLMGEAPLSESGGHADHIDEDPHVVSDADIEDFDQDLPKINKHDDTGSVK
                     KDPALHECETVRRLDSFDIEMEGCPSESSSDSDEDETAELGRISNAKLAKLRARNLEE
                     AIDPLDKITTTMDNLNLRYQTPPIKTTPDVDPSPNNTLTLESLASRNAPPPMDYVVEL
                     ILDATVLNNDVLMMVRCENCLSLSKWLRSTKKRLFQDISLLDAQISEKGKVRGGSKHS
                     DSSQDHSDLSDRERPSKSPLKLVYKKSRPSTPDLKDGPTPASLQHATCSSPKSTCSTH
                     NSRDGTRPEEECRSNWSGRSSAKSSTSSAVAASGQRMSTVKRTANVAPSSLSATPSYN
                     AAALYKHKKPKEGAGNSAANFSFFNRKK"
     gene            complement(745290..745340)
                     /locus_tag="AGOS_AgSNR4"
                     /old_locus_tag="AgSNR4"
                     /db_xref="GeneID:4621972"
     ncRNA           complement(745290..745340)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR4"
                     /old_locus_tag="AgSNR4"
                     /product="AgSNR4"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR4; start and end coordinates are
                     approximate. Similarity is partial. In synteny."
                     /transcript_id="NR_149384.1"
                     /db_xref="GeneID:4621972"
     gene            <745556..>753571
                     /locus_tag="AGOS_AFR169W"
                     /old_locus_tag="AFR169W"
                     /db_xref="GeneID:4621973"
     mRNA            <745556..>753571
                     /locus_tag="AGOS_AFR169W"
                     /old_locus_tag="AFR169W"
                     /product="AFR169Wp"
                     /transcript_id="NM_211070.2"
                     /db_xref="GeneID:4621973"
     CDS             745556..753571
                     /locus_tag="AGOS_AFR169W"
                     /old_locus_tag="AFR169W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL195W (GCN1)"
                     /codon_start=1
                     /product="AFR169Wp"
                     /protein_id="NP_985716.2"
                     /db_xref="GeneID:4621973"
                     /translation="MYKWGQIEPVLDKLCYDSQLLVRTPVLKSIHEQLQGGHVKETEQ
                     LDRISNCMLKTYAIYQDAESKGAVRQILEQVLRMEPVRLDTYLKFISGEVGSKLGTKA
                     FADYMCFLEWLHMFLVFTSSSSSMFHEYARPLVQLHCSVTSGIELGLDNQERGMRAAS
                     KQNQHRRRIRKSLLQSSTKALVKVLEADEEYKYAALISETLVSQHAQLKLHPCGVVIL
                     TGALVNSIMRLVPRQPAHFNVFQGYVDKFGEYLGAEVMLGKNPPTVFCVEVALPTFLH
                     EFVDKEFMVKYFVPSMEKCNLRSPEMSFGLAAEIYKLTNPNSIDLMSVFVSSKLMSQT
                     LSAYKSTKEAVREATLNATRELLNSLTKETCDQDALQQFVAELFKSMKSNMHVDYKST
                     VARILTWVPTFSELVSNKILEGIHTYVIKESNEAALSLMLDAFLTHLGAVSVAADTYL
                     ASLGKGFQEKKLPIRKLWLVSFLSNVECLPAPIIERFEEPLLEFANEVLSKPSKMGPM
                     PLVGLLSFWYRLHELQLDHFEAKFLTAVQNATSEEFTSSCLGFTWVYTTLSRVLPAES
                     RLRAVHILEKLFPSYPKLIGNSIIEACKELFSDNSLTQVKESLSFRYSTPVFAALSQN
                     IAERDALEVVLINMLIVTQCSELPIKQTWAELVMNAKFDPSRLVEKFAKNITDEANKI
                     MLNPLLHDTKLGVAAANAVAYSAFINPEAMAPLLSDIISYGLDDMQLARLSSTDIEIW
                     RGQDDQLVVNVLEKSNNKQTISKNSKDYETLKWEESIRKKQQIKSGSTKKLTKEEQIL
                     VNQQLEKEKSIRAHVNNCRLSIKRSIQLISVLTRGAAQINNGAGTWYPIAVNKLLDIL
                     HQERFMEIVGSSGTETFLQLSTLVTNSMGTMRYMLGVATLRTCQIPLQADLQESSLSD
                     LISTVLFKAKFASDKKPFDATSLAYILPLLIRVLEEGKRVAVLRADKPIGNTEFVEED
                     KEEEHLLLALEIISSHAEAFLDPSIPRGCIVGVLLMLLAVPSKAKLAKDCFMSLCRNI
                     SMSPSKDDIKLLLENLMSSNSFVRGTILEALDDEFELHPFMDSSPELFICMHDEDTSN
                     SEVAEFIWEFNNFKVSEGMLVDLLKFFDQSDSGLRLFVAKSFTAAVLSLMQESTDLFV
                     RALNMLIDLYSTKARPAEAVLDEFGLVAVAASEQKDPWQERSTIAITFKHMAHLFSDN
                     NDILTFVKFLAESGPLGDVNDLVRQEMKEAGIEVIKLHGAKTIEDLIPIFESSLSSAS
                     DITVKQNVIILYGSLARHLNVADPRLNIIVERLLVTLDTPSEDVQHAAAVCISPLVPL
                     FQERVGTYVEALFMKLFDSTLSDSTRRGAAWGIAGLVKGYGISALSKFDIIRNLAEVS
                     EDKKDPKRRESVAYAFECLSKSLNKFFEPYVIEVLPNILKNLGDSVPEVRSATAEATK
                     SIMSHTTSYGVKKLIPVAISNLDDMSWRTKRGSVELLGNMAYLDPTQLSASLSIIVPE
                     IVGVLNDSHKEVRKAADQALKRFGEVIRNPEIQKLVPTLIKAIGDPTAHTEAALDALI
                     QTQFRHYIDGPSLALIIHVIHRGMRDRSANTKRKACKIVGNMAILVDTKDLVPYLQQL
                     IDEVEVAMVDPVPQTRATAARALGALVERLGEDQFPDLIPRLLSTLSDDSKSGDRLGS
                     AQALAEVISGLGLSKLDELLPTILNGVTSYRAYIREGFMPLLLFLPVCFGSQFAPYIN
                     QIIQPILSGLADSDENIRDVAFKAGKLIVKNYAKKAIDLLLPELERGMFDENERIRLS
                     SVQLSGDLLFQVTGISAHNEFSEEDADAEHELSGQMVEVLGEERRDRILSALFICRND
                     SSGIVRATTIDIWKALVPNTPRTIKDILPTLTSLVVVHLASSSSTLRHIAAQSLGDLV
                     RRVGGNALSQLLGSLDASLQTNSDQNSRQGVCIALRELISSSNVDSLMEFEDTIVNIL
                     RNTLVDESESVRESAALSFDKYQDAVGRVAIDKVIPYLLNILESSENSEYALLALQEI
                     ISTKSEVIFPILIPSLLAPPMDAFKARAMGSLAEVAGVALYKRLSAIINALVNAMIDP
                     EVDETAKESIINAIDKVLSSVSSEDGVHPLLQQIMALLKHANIEKRVVTLGRLPTFFK
                     NTVLDYSIYTADIVSQAILSLDADDERIVKGNFEMLSTLVKLQDKQMLERLVKPSLQA
                     LQLTGKPGEDLMAFSLPNGPNCILPIFLQGLVYGSSEDRESSALGIADIVSKTPAANL
                     RPYVTVITGPLIRVVGERSSSDIKAAILYALNVLFSKVPQFLRPFIPQLQRTFVKSLS
                     DSTNETLRLRAAKALGTLIQYQPRIDPLVVELVTGAQQATERGVRTAILKALLEVVSK
                     AGSKISEASKANIIRLVEQEMASTDSKFAVAYAKLLGALSEIMSPEEAQTILHEKVLE
                     SNFEDATGRFAVLTLNSILRDAPVHVFTADLNQYVDFLVAATDSSNPFISDNGIVAVG
                     KLLLLNGEVKSPHSKVAAEEPFTLEEEQIVKLISQLARCMLRPRSSSLDSRFLSLVVV
                     RTLCRYQYASCIAPHLTLLAASTFACLRDTVIPVKLSSEKAYLAMFRLVDEKDMDTFN
                     AWSSGTLPDPLPTAVGTTVALRSITDYTRRVGARLAKVERDRIAAGGDAETMFSDRYE
                     DESEIWAVGGVDLNTDV"
     gene            complement(<753610..>753873)
                     /locus_tag="AGOS_AFR170C"
                     /old_locus_tag="AFR170C"
                     /db_xref="GeneID:4621974"
     mRNA            complement(<753610..>753873)
                     /locus_tag="AGOS_AFR170C"
                     /old_locus_tag="AFR170C"
                     /product="AFR170Cp"
                     /transcript_id="NM_211071.1"
                     /db_xref="GeneID:4621974"
     CDS             complement(753610..753873)
                     /locus_tag="AGOS_AFR170C"
                     /old_locus_tag="AFR170C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     AFR170C"
                     /codon_start=1
                     /product="AFR170Cp"
                     /protein_id="NP_985717.1"
                     /db_xref="GeneID:4621974"
                     /translation="MKHMSKEEIVAVLKLASRILAVVLFCNVGFKLVKRHFFPYLYYW
                     LMSSSDELYGVLWWQRFSSLEQLIWRLVDYIEINYDIEMPNHV"
     gene            <754009..>755847
                     /locus_tag="AGOS_AFR171W"
                     /old_locus_tag="AFR171W"
                     /db_xref="GeneID:4621975"
     mRNA            <754009..>755847
                     /locus_tag="AGOS_AFR171W"
                     /old_locus_tag="AFR171W"
                     /product="AFR171Wp"
                     /transcript_id="NM_211072.1"
                     /db_xref="GeneID:4621975"
     CDS             754009..755847
                     /locus_tag="AGOS_AFR171W"
                     /old_locus_tag="AFR171W"
                     /note="NOHBY629; No homolog in Saccharomyces cerevisiae;
                     Non-syntenic homolog of Kluyveromyces lactis KLLA0D05038g"
                     /codon_start=1
                     /product="AFR171Wp"
                     /protein_id="NP_985718.1"
                     /db_xref="GeneID:4621975"
                     /translation="MDVPEAGRKGVARRSKYSKNGCSECKRRKVKCDETKPACWQCSH
                     LGKRCVYMVNNSKIRFKEINVLSLRGRERVTDKKACARNGTGSSDPARVTMREVDNRM
                     DLGGMDDPLQTTESQLRVPNYEFHGNWVVQARAGWDAVAQRLYMVPEEELGYLRVFYY
                     KSSWWLLPLAVSAETNICNNVLFEQLARINIAEQVTTSYLQSALISVAAKFLYNTTRL
                     VKHREVRQTHLRLVFEQLHREFSRLPEVNIAQGKIESLMLCVLILTLDSSSFDGKSWR
                     IHFSGAKNLFSKYGIYCNRLPMEPSQRYLVVLVKSWLAAIEATASLLNSGTLQTDQEI
                     DEIFSLGSTDDSAPILREMGLLTNGGYNIFLGYSREALMLLKAVKKFLRDPSADRYND
                     QFLLITDLLQASRKYAVIPNNFGLVNNTACTEMFSIKASAIVRHRGQVYSILDTIQQV
                     QVESLFITFLLKGFHFSQNCMLIQNSANRIWRNIEWMFEESHLSAGEIHSIMAKIADG
                     SVKTYEDFRTLNINLAPLYIIKPLLSDFRCMMVHTGIVICSSVLTHRMDIDMIRCKLI
                     AYFQYIVDVLGAESGKTSLQYLFSIWRQPSYCSATCLREDVPLPFS"
     gene            complement(<755890..>757239)
                     /locus_tag="AGOS_AFR172C"
                     /old_locus_tag="AFR172C"
                     /db_xref="GeneID:4621976"
     mRNA            complement(<755890..>757239)
                     /locus_tag="AGOS_AFR172C"
                     /old_locus_tag="AFR172C"
                     /product="AFR172Cp"
                     /transcript_id="NM_211073.1"
                     /db_xref="GeneID:4621976"
     CDS             complement(755890..757239)
                     /locus_tag="AGOS_AFR172C"
                     /old_locus_tag="AFR172C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL194C (HOS2)"
                     /codon_start=1
                     /product="AFR172Cp"
                     /protein_id="NP_985719.1"
                     /db_xref="GeneID:4621976"
                     /translation="MSQTFSYDAKTVNEQPLFEFGASYTPRVSYHYNSRVSQYHYGVR
                     HPMKPFRLMLTDHLVSRYGLHKVMDLYETRAATKEEVLAFHAQDYVDFLSHVAPENLN
                     KLPRGSLEKFNIGDDCPIFQGLFEYSMLYAGASLDASRKLINGQSEIAINWSGGLHHA
                     KKSNPSGFCYVNDIVLAILNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHK
                     YNGEFFPGTGDLDEIGCSRGKHFSLNVPLNDGIDDDSYINLFKSIIDPLVTSYKPTVI
                     IQQCGADSLGHDRLGCFNLNIRAHGECVKFVKSFGIPMLCVGGGGYTPRNVSRLWTYE
                     TGILNDVLLPSDIPEDIPFREWFGPDYSLHPVLDDLYENKNSKKYLENIRIRCLENIK
                     YLQGAPSVRMDAELIPTQDLPGLTEEEEDLIRELNQEDDSYRLEQIEKDNVRRGELL"
     gene            <757680..>759359
                     /locus_tag="AGOS_AFR173W"
                     /old_locus_tag="AFR173W"
                     /db_xref="GeneID:4621977"
     mRNA            <757680..>759359
                     /locus_tag="AGOS_AFR173W"
                     /old_locus_tag="AFR173W"
                     /product="AFR173Wp"
                     /transcript_id="NM_211074.1"
                     /db_xref="GeneID:4621977"
     CDS             757680..759359
                     /locus_tag="AGOS_AFR173W"
                     /old_locus_tag="AFR173W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL192W (IME4)"
                     /codon_start=1
                     /product="AFR173Wp"
                     /protein_id="NP_985720.1"
                     /db_xref="GeneID:4621977"
                     /translation="MAVNLELVKYLIENHVTILAHPVDGRLKDLYALFCMYLQQWADK
                     DQETPSYGEFHEDLVLIAQVVQGAIGVVCDSIFPEGEQLDYVHVTPLKYLVNRFHPGY
                     YNLREQAAAEEAECAPATLLERLTNALETRIETPSTQALNRLEELLACKLASFRLARE
                     RVKRTVPHAPYIPTCKDLQHSSILSTVAYISNNKIVSLQKEKLFKADKEYPGLVQCIQ
                     THIHFIPNLKPQTDLSLGDCSYLDTCHKLNSCRYVHYLQYIPERLMQSVEQSVNQLNE
                     TQEKNRRIGFYTHGDCCSSVVKSILPSQWIKCDVRKFDFTILGKFSAVIADPAWNIHM
                     NLPYGTCNDNELLLLPLDILQDEGLLFLWVTGRAIELGKESLMNWGYKVINEISWIKT
                     NQLGRTIVTGRTGHWLNHSKEHLLVGLKGDPEWLNKQIDIDLIISSTRETSRKPDELY
                     GMVERIVGTHARKLEIFGRDHNVRPGWFTIGNQLTGTCIHELDVKRKYENFIATSRRQ
                     NEGRAFDYRDDIPQKGQYNKQVYLQQQQHHSKQMPAMKAAQYVTTTYRSTI"
     gene            <759857..>760951
                     /locus_tag="AGOS_AFR174W"
                     /old_locus_tag="AFR174W"
                     /db_xref="GeneID:4621978"
     mRNA            <759857..>760951
                     /locus_tag="AGOS_AFR174W"
                     /old_locus_tag="AFR174W"
                     /product="AFR174Wp"
                     /transcript_id="NM_211075.1"
                     /db_xref="GeneID:4621978"
     CDS             759857..760951
                     /locus_tag="AGOS_AFR174W"
                     /old_locus_tag="AFR174W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YDR065W (RRG1)"
                     /codon_start=1
                     /product="AFR174Wp"
                     /protein_id="NP_985721.1"
                     /db_xref="GeneID:4621978"
                     /translation="MSSLYEKASDFDTATLQTRMVQPFTRYAAHRHLVLSWYRYTLRI
                     TNYVPISNLLRRQTREVVRETILKHRGTQSSWKVLQLLEDMKQLNSHLAVAKAVGAWQ
                     IIQKYAAKPTPQEERLPMPAKHYNDPSKDKEAHYYWRYHRDLTRKHLLPAVIPNDYME
                     KLIAPLARHASDLRTLGIVQRNIQRSPKAYLSYTMVGSDRLWFVRSAVNRKKRQSRRL
                     TAMIVALRRAAQRSLDMSNRLKEEVIWATHEAKWEQLLATGTLPPDGAKSDWKPGRAW
                     LEPYEAAFRNQLANRKRTSQKLKRYSAQISKVHLPYYIKCSAAMHTRRAKRFECFQKE
                     LHTVNPFVPGRDLGSLLSKWRMVNGKNYYR"
     gene            complement(<760971..>761597)
                     /locus_tag="AGOS_AFR175C"
                     /old_locus_tag="AFR175C"
                     /db_xref="GeneID:4621979"
     mRNA            complement(<760971..>761597)
                     /locus_tag="AGOS_AFR175C"
                     /old_locus_tag="AFR175C"
                     /product="AFR175Cp"
                     /transcript_id="NM_211076.1"
                     /db_xref="GeneID:4621979"
     CDS             complement(760971..761597)
                     /locus_tag="AGOS_AFR175C"
                     /old_locus_tag="AFR175C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER139C (RTR1) and YDR066C (RTR2)"
                     /codon_start=1
                     /product="AFR175Cp"
                     /protein_id="NP_985722.1"
                     /db_xref="GeneID:4621979"
                     /translation="MATIEDIQKQVLVAYQQHRQLSLKEADLLTVELLELLSQTECTP
                     ETLKYVGRFFTKTTYSDLIDERNLNKLCGYPLCGQSQGRIRDPYENRRVSNFLTQNNP
                     YKYLTSFCSKLHFRCSQFYQVQLSDEALFARVGVHLDDYEAGRVLLLEEAMAEERDLR
                     TMIRGMNGLSLGENGAGDELQKDLSEWLSEVRIVENERPPLLGDLMKE"
     gene            <761787..>763283
                     /locus_tag="AGOS_AFR176W"
                     /old_locus_tag="AFR176W"
                     /db_xref="GeneID:4621980"
     mRNA            <761787..>763283
                     /locus_tag="AGOS_AFR176W"
                     /old_locus_tag="AFR176W"
                     /product="AFR176Wp"
                     /transcript_id="NM_211077.2"
                     /db_xref="GeneID:4621980"
     CDS             761787..763283
                     /locus_tag="AGOS_AFR176W"
                     /old_locus_tag="AFR176W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER140W"
                     /codon_start=1
                     /product="AFR176Wp"
                     /protein_id="NP_985723.2"
                     /db_xref="GeneID:4621980"
                     /translation="MRRREKLTKPWENIRAWDIVGLLGNARRVLLNSLEPLAARIASQ
                     TEAVATDAEVAGEVEQIINMVMLPMTLERFFLFALLGCLDCFIYYFTIVPLRLAGGLV
                     RRDTSAKATRDLLMLSMIVVASAILLRVDTSRVYHRIKGQSAVKLYMMFQVLDMCDKM
                     LASLGQNLLSTLTVSRAWRTRDTALVVAATGYLVAHAFVLIYQTIALNVAVNSYSNSL
                     LTLLLSMQFAELKASVFKRMDKEGVFQLAIADIVERFQLLTFLTSIAFRNVVATGHSI
                     SRVLPNSWQLASTSSVLLGVLYGPMVMVIGSELLVDWVKHGYVTKFNRLRPHLYDRFL
                     HILCNDHQNNLHKFQARIGLPVPALVVLFIVLVGPAVLQMLDPTNTSRLNIITVLALV
                     FICMVLAKFILQALLMKWAKTLQQQHAPAPQGIYVPGALSPGLGKVDDQMRASIHSKP
                     FPSSSDSNEETRKTVPPSLNELRNKKDTKNTHSLEAVERFKMVSKRIW"
     gene            complement(<763362..>764453)
                     /locus_tag="AGOS_AFR177C"
                     /old_locus_tag="AFR177C"
                     /db_xref="GeneID:4621981"
     mRNA            complement(<763362..>764453)
                     /locus_tag="AGOS_AFR177C"
                     /old_locus_tag="AFR177C"
                     /product="AFR177Cp"
                     /transcript_id="NM_211078.1"
                     /db_xref="GeneID:4621981"
     CDS             complement(763362..764453)
                     /locus_tag="AGOS_AFR177C"
                     /old_locus_tag="AFR177C"
                     /note="NOHBY630; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F12606g"
                     /codon_start=1
                     /product="AFR177Cp"
                     /protein_id="NP_985724.1"
                     /db_xref="GeneID:4621981"
                     /translation="MSEVSVKEYISQQEALERQAREAMPGDPTKCTYSMGPLRQPIFA
                     CRTCGDIGVCYSCSIQCHTECDLVELFEKRQFSCDCGTERQKSAEKTCKLRENSTADI
                     PDYSNRYGQNFKGLFCWCAREYSPEKDAVMVQCLLGLECNEDWYHDHCIMGVRDDPDS
                     ADAERELPGFPALDTFAAFICWNCVHKYEMQFKRLLAHELADQLIADTVDWIPTDTPA
                     ERAALSDADRAMPGAAGSKRKAADQIYSIFLKEGYSAVLERVRDSLPPGDKLRIFLTD
                     IAPFLIHEDPVYEPPEDSDPVSSYEAASRALDMVSHERALNGILAYQAFKTKLSEFLQ
                     PFADTGKVVKEEDIKSFFQAQKEPPEDSS"
     gene            <765049..>767706
                     /locus_tag="AGOS_AFR178W"
                     /old_locus_tag="AFR178W"
                     /db_xref="GeneID:4621982"
     mRNA            <765049..>767706
                     /locus_tag="AGOS_AFR178W"
                     /old_locus_tag="AFR178W"
                     /product="AFR178Wp"
                     /transcript_id="NM_211079.1"
                     /db_xref="GeneID:4621982"
     CDS             765049..767706
                     /locus_tag="AGOS_AFR178W"
                     /old_locus_tag="AFR178W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL023C (MCM2)"
                     /codon_start=1
                     /product="AFR178Wp"
                     /protein_id="NP_985725.1"
                     /db_xref="GeneID:4621982"
                     /translation="MASHNGMEGSHGRRRARDENDTEQRSSDSRSQSYEHPPSSPQVG
                     SGRGSRMGNNSPLGSPDEIDFENPDNDGDERIEFADDLDDAEERIDEVDLVGDDMYAD
                     YTANRNKDFYENEGVDDAEHEELSLADRRRIDAQLNARDRMLHDSQVFLDDEMDADDK
                     MQVDAMGMPVQRRRRRNQYDEADYDDLLSDMDVDPLMEELTLESLSDVKSSSYSEWIT
                     QPNVARTIARELKSFLLEYTDEYGKSVYGARIRTLGELNSESLEVNYRHLAESKAILA
                     LFLARCPEEMLKIFDTVAMEATQLHYPEYTRIHSEIHVRISDFPTIHNLRELREANLN
                     SLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPYYQDSNEEIKISFCTNCRSKGPF
                     RTNMEKTLYRNYQRLTLQESPGTVPAGRLPRHREVILLWDLVDVAKPGEEVEVTGIYK
                     NTYDGNLNARNGFPVFATVLEANSIKRREGGLHSGDDAGDEGLDVFGWTEEEEREFRK
                     MSRDRGIIDKIISSIAPSIYGHRDIKTAVACSLFGGVPKNVNGKHSIRGDINVLLLGD
                     PGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKG
                     VCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNST
                     LPLSQNVDLTEPILSRFDILCVVRDLVDEESDERLATFVVDSHIRSHPESDIHQEPAD
                     EDMEEADAGTAALSNRQKKLKRHRDKEGEISPIPQEVLMKYIHYARTKVNPKLHQMDM
                     GKVSKVYADLRRESITTGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVT
                     VDSFVGAQKISVRRQLQRSFAIYTMSRGD"
     gene            complement(<767878..>769980)
                     /locus_tag="AGOS_AFR179C"
                     /old_locus_tag="AFR179C"
                     /db_xref="GeneID:4621983"
     mRNA            complement(<767878..>769980)
                     /locus_tag="AGOS_AFR179C"
                     /old_locus_tag="AFR179C"
                     /product="AFR179Cp"
                     /transcript_id="NM_211080.2"
                     /db_xref="GeneID:4621983"
     CDS             complement(767878..769980)
                     /locus_tag="AGOS_AFR179C"
                     /old_locus_tag="AFR179C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL024W (NCL1)"
                     /codon_start=1
                     /product="AFR179Cp"
                     /protein_id="NP_985726.2"
                     /db_xref="GeneID:4621983"
                     /translation="MARKKHSRGKGAKKTFGARNDSNAQKDWTELVKENEKWENYYKQ
                     LGVVPEAEWEDFKKTCQTQLPLTFRITGSRKHAQEVLELFENEHLPKLTNVVWDGEKV
                     EAPKALPWYGDNMAWQLDVSKSVIRKNEEFSKMQRFLVVENAVGNISRQEAVSMIPPI
                     VLGVEPHHSVLDMCAAPGSKTAQLVEALHANGPEPSGFVVANDADYRRSHMLVHQLKR
                     LNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSGDGTMRKNINVWKDWGT
                     GSGLGLHTVQLNILNRGLTLLKNGGRLVYSTCSLNPIENEAVVAAALRKWGAKIKLVN
                     CDDQLLGLVRSTGISSWPVLDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVY
                     PHQQNTGGFFISVFEKINTEPVETAQDEKSEEPEQKKQKHEPAPKKERLPRDANEEPF
                     VFVSPTHPELANCWSFYGVDDAFDRNTCLVRNAAGEPTRVIYHVATPLKYLIEANEDR
                     LKIVYSGIKLFVSQRSDVGCSWRIQSEALPIMQHHMNDARVVDTNLEMLKKLLLEAFP
                     RFEDMQEAHIDDDFIAKMSSLSSGCAFIRVTRGQDKEGLFLPLWNGNKCVNLMVCKED
                     THELLYRVFGIETTSKQNPKAEAQAKAQEEKAAALADKDSPQESAEDVQVDVSESAAE
                     KETPLTAVHTEADASEQV"
     gene            complement(<770113..>770517)
                     /locus_tag="AGOS_AFR180C"
                     /old_locus_tag="AFR180C"
                     /db_xref="GeneID:4621984"
     mRNA            complement(<770113..>770517)
                     /locus_tag="AGOS_AFR180C"
                     /old_locus_tag="AFR180C"
                     /product="AFR180Cp"
                     /transcript_id="NM_211081.1"
                     /db_xref="GeneID:4621984"
     CDS             complement(770113..770517)
                     /locus_tag="AGOS_AFR180C"
                     /old_locus_tag="AFR180C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL025W (RRN10)"
                     /codon_start=1
                     /product="AFR180Cp"
                     /protein_id="NP_985727.1"
                     /db_xref="GeneID:4621984"
                     /translation="MDRNVYEACSDLIRSHHGVASADEVLGEKIGHQVPVPVPAAEEV
                     ELAAKAELEAGDNVLPHMDLKVLHYFMTQLVVQKYEHLVGCFDETALVTLGLIVEEWV
                     REYLRAAGGSAGPGPALVVSKETNYRHSPADI"
     gene            complement(770665..770855)
                     /locus_tag="AGOS_AgSNRSCR1"
                     /old_locus_tag="AgSNRSCR1"
                     /db_xref="GeneID:4621985"
     ncRNA           complement(770665..770855)
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNRSCR1"
                     /old_locus_tag="AgSNRSCR1"
                     /product="AgSNRSCR1"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNRSCR1; start and end coordinates are
                     approximates. Not in synteny."
                     /transcript_id="NR_149438.1"
                     /db_xref="GeneID:4621985"
     gene            <771176..>771568
                     /locus_tag="AGOS_AFR181W"
                     /old_locus_tag="AFR181W"
                     /db_xref="GeneID:4621986"
     mRNA            <771176..>771568
                     /locus_tag="AGOS_AFR181W"
                     /old_locus_tag="AFR181W"
                     /product="AFR181Wp"
                     /transcript_id="NM_211082.1"
                     /db_xref="GeneID:4621986"
     CDS             771176..771568
                     /locus_tag="AGOS_AFR181W"
                     /old_locus_tag="AFR181W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER137C"
                     /codon_start=1
                     /product="AFR181Wp"
                     /protein_id="NP_985728.1"
                     /db_xref="GeneID:4621986"
                     /translation="MQNTADRPDLGVLTRLLADRNASKEQYERKLAQLTTLLDSLLTM
                     QQRVGDAGGAMALDGNALEQMLAEPLEVIEKDGQQYALVPLCGAGAGAAEPPKQRRKR
                     TQLTCSYCHEVGHTRARCERRLLGRDAD"
     gene            complement(<771642..>772002)
                     /locus_tag="AGOS_AFR182C"
                     /old_locus_tag="AFR182C"
                     /db_xref="GeneID:4621987"
     mRNA            complement(join(<771642..771875,771949..>772002))
                     /locus_tag="AGOS_AFR182C"
                     /old_locus_tag="AFR182C"
                     /product="AFR182Cp"
                     /transcript_id="NM_211083.1"
                     /db_xref="GeneID:4621987"
     CDS             complement(join(771642..771875,771949..772002))
                     /locus_tag="AGOS_AFR182C"
                     /old_locus_tag="AFR182C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YBL026W (LSM2); 1-intron"
                     /codon_start=1
                     /product="AFR182Cp"
                     /protein_id="NP_985729.1"
                     /db_xref="GeneID:4621987"
                     /translation="MLFFSFFKTLVDQEVTVELKNDIELKGTLKSVDQFLNLKLDNIS
                     CNNEAKYPHLSSVRNIFIRGSTVRYVYLKKGMVDTNLLQDAARREAMSERK"
     gene            complement(<772272..>773612)
                     /locus_tag="AGOS_AFR183C"
                     /old_locus_tag="AFR183C"
                     /db_xref="GeneID:4621988"
     mRNA            complement(<772272..>773612)
                     /locus_tag="AGOS_AFR183C"
                     /old_locus_tag="AFR183C"
                     /product="AFR183Cp"
                     /transcript_id="NM_211084.1"
                     /db_xref="GeneID:4621988"
     CDS             complement(772272..773612)
                     /locus_tag="AGOS_AFR183C"
                     /old_locus_tag="AFR183C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER136W (GDI1)"
                     /codon_start=1
                     /product="AFR183Cp"
                     /protein_id="NP_985730.1"
                     /db_xref="GeneID:4621988"
                     /translation="MDEDYDVIVLGTGLTECILSGVLSVEGKKVLHIDRQDHYGGESA
                     SVTLSQLYAKFKQNPLTKEDIEQKFGRDRDWNVDLIPKFLMANGELTNILVHTDVTRY
                     VEFKQVSGSYVYSKGKVYKVPANEMEAISSPFMGIFEKRRMKKFLEWIGDYKEDDPKT
                     HLGLDLDNNTMEEVYYKFGLGSSTKDFIGHAMALWTNDDYLQQPARPTFERIVLYVQS
                     VARYGKSPYLYPLYGLGELPQGFTRLSAVFGGTYMLNTPVDKVLYTEDGKFKGIVTKE
                     GTARAPLVIADPTYFPDKCQSTGQKVIRAICILDHPVPNTANADSCQIIIPQSQVGRK
                     NDIYIAVVSDTHHVASKGYYLAIVSTIIETDKPHIELEPAFKILGNIEERFMGIAEIF
                     EPKEDGSKDNIYLSKSYDASSHFESMTDDVKDIYFRVTGQPLVLKKREDAEPEQ"
     gene            complement(<773972..>774628)
                     /locus_tag="AGOS_AFR184C"
                     /old_locus_tag="AFR184C"
                     /db_xref="GeneID:4621989"
     mRNA            complement(<773972..>774628)
                     /locus_tag="AGOS_AFR184C"
                     /old_locus_tag="AFR184C"
                     /product="AFR184Cp"
                     /transcript_id="NM_211085.1"
                     /db_xref="GeneID:4621989"
     CDS             complement(773972..774628)
                     /locus_tag="AGOS_AFR184C"
                     /old_locus_tag="AFR184C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YER163C"
                     /codon_start=1
                     /product="AFR184Cp"
                     /protein_id="NP_985731.1"
                     /db_xref="GeneID:4621989"
                     /translation="MNPVHGGAWVVGYGSLIYKPPPHYSQRVIGVVHGFRRRFWQSSS
                     DHRGTPELPGRVATLVPAADARLLVVAYFIPAAHVAAVTAYLDVREQDGYLPQTVPVH
                     LVAPPQPPHELRDALDALPCDSVSGLPVVQSVIYIGIPDAATFVGPEELQRTAAVIAH
                     NHGPSGPNYEYLKLLHSALHSIAETFGARLCELEDHYLDELLEAVDRLRAQACAAVGA
                     "
     gene            complement(<774725..>775579)
                     /locus_tag="AGOS_AFR185C"
                     /old_locus_tag="AFR185C"
                     /db_xref="GeneID:4621990"
     mRNA            complement(<774725..>775579)
                     /locus_tag="AGOS_AFR185C"
                     /old_locus_tag="AFR185C"
                     /product="AFR185Cp"
                     /transcript_id="NM_211086.2"
                     /db_xref="GeneID:4621990"
     CDS             complement(774725..775579)
                     /locus_tag="AGOS_AFR185C"
                     /old_locus_tag="AFR185C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL025W (SNF6)"
                     /codon_start=1
                     /product="AFR185Cp"
                     /protein_id="NP_985732.2"
                     /db_xref="GeneID:4621990"
                     /translation="MAKRGRKPLNRGWRVQQQGGHGHMHGMHGMQQQKFERHRSQRLN
                     PEQIGTSVHDESDTISFRNHLLANYILTAGWMDALTTQAVPVSRIGRTPLYSELLRLD
                     DLRARKAAAADEVAALEARLDSWAPDSAFQEAYTELEKSPLHQEAVERALARYEHHFR
                     RTARMQQSVVFRSCGGRPQPAAGCAPDNYWSEIYPRLREQRARRLLEERKRRREEEKL
                     KEQAGAEQMQLQLPADAAAAASTAHQAQTAEPPSAQMLDTMFNDIDQEPFNNGFDDAF
                     GELDSAFF"
     gene            <776662..>778815
                     /locus_tag="AGOS_AFR186W"
                     /old_locus_tag="AFR186W"
                     /db_xref="GeneID:4621991"
     mRNA            <776662..>778815
                     /locus_tag="AGOS_AFR186W"
                     /old_locus_tag="AFR186W"
                     /product="AFR186Wp"
                     /transcript_id="NM_211087.1"
                     /db_xref="GeneID:4621991"
     CDS             776662..778815
                     /locus_tag="AGOS_AFR186W"
                     /old_locus_tag="AFR186W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL032C"
                     /codon_start=1
                     /product="AFR186Wp"
                     /protein_id="NP_985733.1"
                     /db_xref="GeneID:4621991"
                     /translation="MRMEQYVPVRTKVFRKPSQAVFCTQNNWKPFDEAGEAIFRLPQS
                     EQCVAKREISKDNIIEYHYLLRWSGAAAWGGGSISGICIPVNTEMTGELERELGELFS
                     SAELRGVDFVLSQTKIYPIKASEQRPAYYGYLIGEKGALNAAHVQLAVLLHLHDGNVV
                     ECLELQSVSFIPMVAGVQSLNLKNISTSFQTKVFLPNLSNAGTETVPHVYLAGPVHSM
                     VLQAKEVLTSMIRSIDSEIYYAKLQNVSQVKLRYICSERSKELNHLMMKYQTFIHLNM
                     EKEEVEFQSSSTHLLELVRKEFTMEILSQVSELQLLFHDGEYNSIEKAIPGPLLALCI
                     KYSVTLLAEPDHWNFVLVGDQGKLEKVLEWVSKNMLNTPLQVKYFVELDPSYKDFVSG
                     KKNGKISRIMDSTDVVINLDLQNGHGNMILTMFANDIKNAILGQKLVSDELPSERSFF
                     IPEAYHRPVIGTGGSVIQTIMRKHNVFIQFSNSFQLPQNKLAHIRYDNVVIRCPSKNR
                     GEIIPAKEELNQLAQEYSEMQPNVQLRLSPGQYRYLLHHNEKDKLSLVDNIGTIERRT
                     STYVMFPFQEPKEGFLLEIRGNDNQATIAARKLSESFGEELEITITSPIVDTVDFCNS
                     IVVPFLAMGLIVTTADCLIRFTYQEGNKSVTYALDILREYLRKINVTIMDKSFIRSWI
                     VEAPKHPVPQPVTEKKHHAHHGAYIQQYSYGYATL"
     gene            complement(<778810..>779451)
                     /locus_tag="AGOS_AFR187C"
                     /old_locus_tag="AFR187C"
                     /db_xref="GeneID:4621992"
     mRNA            complement(<778810..>779451)
                     /locus_tag="AGOS_AFR187C"
                     /old_locus_tag="AFR187C"
                     /product="AFR187Cp"
                     /transcript_id="NM_211088.1"
                     /db_xref="GeneID:4621992"
     CDS             complement(778810..779451)
                     /locus_tag="AGOS_AFR187C"
                     /old_locus_tag="AFR187C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL033W (IRC19)"
                     /codon_start=1
                     /product="AFR187Cp"
                     /protein_id="NP_985734.1"
                     /db_xref="GeneID:4621992"
                     /translation="MLPLAIPPNNIVRAMSSPNATGPLMRTSKAIITSNYTLLTDKTP
                     YLLPVCFNESCRAEQVRMLYRRFFRLRPLVAQRAMIKESYTNYIRVKFSEDYALKRRQ
                     ALPQNTCPVLDAIEAGRRSLTFILKAVSEIEDADSNPELAYDNYICRKILKNVLTLEY
                     QRERLEFKNPKRKQILRQNYEYLDAKYHDPKYTSLRNADVSIIHFNETLGTRL"
     gene            <779748..>782231
                     /locus_tag="AGOS_AFR188W"
                     /old_locus_tag="AFR188W"
                     /db_xref="GeneID:4621993"
     mRNA            <779748..>782231
                     /locus_tag="AGOS_AFR188W"
                     /old_locus_tag="AFR188W"
                     /product="AFR188Wp"
                     /transcript_id="NM_211089.2"
                     /db_xref="GeneID:4621993"
     CDS             779748..782231
                     /locus_tag="AGOS_AFR188W"
                     /old_locus_tag="AFR188W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL034C (RIX7)"
                     /codon_start=1
                     /product="AFR188Wp"
                     /protein_id="NP_985735.2"
                     /db_xref="GeneID:4621993"
                     /translation="MAKPRNAAKKGSLSQSLDNKIADLIYRMLDEKSLEKQRARAQLA
                     QEGGDTDSESMDDLKNDFADIYLAQDLKLMDVIAYVQTRDLSLQRVKKVLLEKTVERV
                     LKQVIEDEKDGLDLTPQPETITEEEMSKQNLMVIQDKNEMNRSITGQWNFSPVPPPTP
                     KSAEDGMAVESDSKKGNKKRPTKDAIIKPKRQKVQDRTPPSADLSSLGGMDDVIAQLM
                     ELVALPILHPEIFASTGVEPPRGILLHGPPGCGKTSIANALAGELQVPFISISAPSVV
                     SGMSGESEKKIRDLFEEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQLLTSM
                     DELSFEKTNGKPVIIIGATNRPDSLDSALRRAGRFDREISLNVPNELSRMHILKKMTS
                     NLKVDGEIDFLKLAKLTPGFVGADLKALATAAGTCAIKRIFQNYASVAASDGAMEIDS
                     DNNQSSLKNTADVIEPLPLSTIQVFLKNYTEPLNEQQLSTLSITYEDFLKALPTIQPT
                     AKREGFATVPDVTWSSVGALSNIRVELNMAIVQPIKRPELYEKVGISAPAGVLLWGPP
                     GCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDE
                     LDALVPRRDTSLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRL
                     DKTLFIELPNADEKLDIMHTLVKSNGTPLAPDVDLSAVVNDERCRNFSGADLAALLRE
                     SSVLALKRNFFHSGEIQSVLDNNLDREFGDLSAGTPMNEIIVTVTDFENALRKIKPSV
                     SDKDRMKYNKLNKKMGWNDEAGVQVEEEA"
     gene            complement(<782332..>784233)
                     /locus_tag="AGOS_AFR189C"
                     /old_locus_tag="AFR189C"
                     /db_xref="GeneID:4621994"
     mRNA            complement(<782332..>784233)
                     /locus_tag="AGOS_AFR189C"
                     /old_locus_tag="AFR189C"
                     /product="AFR189Cp"
                     /transcript_id="NM_211090.1"
                     /db_xref="GeneID:4621994"
     CDS             complement(782332..784233)
                     /locus_tag="AGOS_AFR189C"
                     /old_locus_tag="AFR189C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLL035W (GRC3)"
                     /codon_start=1
                     /product="AFR189Cp"
                     /protein_id="NP_985736.1"
                     /db_xref="GeneID:4621994"
                     /translation="MSDDFVVPTYEVGGSDSGSDQDISDIEEGSFNGISATPLPTADV
                     EYVSEASPMDATASLGYLSGAEGANLYVAREGANYFNDAANKAVVLCLHSYEQLAISG
                     VFKLQVMKGGITYNSIHYNCGLHTYDFWHPLSESIPPIAASFAADWEEHSYGLSPWLP
                     ADIKEEYECILRISEGSNIGDVGRLMAELGQLWTRHTGCTFSILRPEDYARPLILNKD
                     WDNLQAELMIHHMNSEHDMRVMCIGGKNSGKSTLLRLLLQKFLHGNKSTTKATGVSHE
                     ADVVNYLDMDPGQPEYSAPDSISWSKLTSETLSLGQHLAQGHREMIQTTYIGSSTPQT
                     WPEMYLTAMEHIIHKWEMEGQMNTALLNLPGWIKGFGITIINKAMELFKPTHIIFLTH
                     GGKLISKELVVPNMFETMQKGKYKPMIYNLQAFTQHNIPGLPAQDPRYHAANIRSFRL
                     LAHLHRLSEQSYYPGPLLSSPPLQVSFGSQGIMAFRFLQDPSSGYHQDDISAALQGCV
                     VCLYHSKMPPDIDMCGVFPMLKHSADYTSMDFVTLALIHSIDVERKFMNIYIPGHVSG
                     RVHSLKNNFVLVRGATDLPLCELYPQKLLSSSYRNREIPYVSFSKRKKYEYVWKIRKN
                     VRRRGHYNK"
     gene            complement(<784526..>785824)
                     /locus_tag="AGOS_AFR190C"
                     /old_locus_tag="AFR190C"
                     /db_xref="GeneID:4621995"
     mRNA            complement(<784526..>785824)
                     /locus_tag="AGOS_AFR190C"
                     /old_locus_tag="AFR190C"
                     /product="AFR190Cp"
                     /transcript_id="NM_211091.1"
                     /db_xref="GeneID:4621995"
     CDS             complement(784526..785824)
                     /locus_tag="AGOS_AFR190C"
                     /old_locus_tag="AFR190C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL027W (RIM101)"
                     /codon_start=1
                     /product="AFR190Cp"
                     /protein_id="NP_985737.1"
                     /db_xref="GeneID:4621995"
                     /translation="MSHINHLLNSDEAIPSTALRSCAQRSPMSSDDELVGTAGYRENQ
                     PVPGSTLPTSPSDVSTDTENDEHQRLLCQWDACGSEFSQPELLYHHLCQDHVGRKSQR
                     NLQLNCHWGSCTTKTVKRDHITSHLRVHVPLKPFSCSTCSRKFKRPQDLKKHLKVHME
                     DTMKERSRAAPGSRGVRKTGVNKGSALQEKARTLPNLTVESFVSQEMQNYYPYYKSRQ
                     HLDETLSHIILPPPAALGGTLASEPPSYTRKAVSFFTTLSQDMSRRLPSLAPCNSPGP
                     AGKMVMLPRPEQQYARVPRYPAMPELPPLVTSPGAESHALPRGHNFRPAPLIPGSMLP
                     SLSRFSHDKSQFVARNSYSLNQKASLNEELCENELDIALENLALDDTDALRAELQTVN
                     IIKDYLTCLLLEDVYTESFELPASVEKSHSTLRKYPQIKV"
     gene            complement(<786342..>787850)
                     /locus_tag="AGOS_AFR191C"
                     /old_locus_tag="AFR191C"
                     /db_xref="GeneID:4621996"
     mRNA            complement(<786342..>787850)
                     /locus_tag="AGOS_AFR191C"
                     /old_locus_tag="AFR191C"
                     /product="AFR191Cp"
                     /transcript_id="NM_211092.2"
                     /db_xref="GeneID:4621996"
     CDS             complement(786342..787850)
                     /locus_tag="AGOS_AFR191C"
                     /old_locus_tag="AFR191C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL028W (WSC4)"
                     /codon_start=1
                     /product="AFR191Cp"
                     /protein_id="NP_985738.2"
                     /db_xref="GeneID:4621996"
                     /translation="MGGILAVSKLKTIWLTLALLLRAVNAGVSLTYCFRSNLGTTDPI
                     FSNYMSNGLCMDHCRSNHEWAIVSGKQCWCSDNMPSRGLEMSDCSTPCWGISSEMCAD
                     PDKNTYGYIYMGEGSPPSIEVGSEENTQSSAQSSTATTSSTSSSSISVSSQDPETSTT
                     PSSTTSPLTSSDNGETKTKSTVTSLLKTTDEQHETRTTSTDSSSSAASPASTPESVTS
                     TSSTSSSTSSSTSSSTSSSTSSSTSSTSSSSTSSSSSTTAAPTPVVPVLVRTTTTVPT
                     PVTSYQAITSVIYSVFTTTAAFSENGSQGSSSIVSVATVISTAVYYSTLTPVNSETVP
                     ATSAAPIAKVNSFWDSKAKVIGTFLPVALLLFLLLLLLIWILIRLRKKRNGYQDDELQ
                     HFHSDVSSAGSILGGHGATSFVYTDEKGILPSPDSNGARVSALASQATMGGGTLCSNS
                     LPASRESKADALVFDQRLDPSHVMSQWENGGSRVSLADDVDYTRKVLRVINE"
     gene            <788840..>790522
                     /locus_tag="AGOS_AFR192W"
                     /old_locus_tag="AFR192W"
                     /db_xref="GeneID:4621997"
     mRNA            <788840..>790522
                     /locus_tag="AGOS_AFR192W"
                     /old_locus_tag="AFR192W"
                     /product="AFR192Wp"
                     /transcript_id="NM_211093.2"
                     /db_xref="GeneID:4621997"
     CDS             788840..790522
                     /locus_tag="AGOS_AFR192W"
                     /old_locus_tag="AFR192W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YHL029C (OCA5)"
                     /codon_start=1
                     /product="AFR192Wp"
                     /protein_id="NP_985739.2"
                     /db_xref="GeneID:4621997"
                     /translation="MALQRNSKQNQQQWYRELVNKVIQLLQQNDHDSLALIARNCGVP
                     PQLRHLVWPVLLKYHPFVISPSILSNTLIFDKTEDKWVYECENRARRDVEQAVMHDLQ
                     KFFVNKRSDQHMPLPDIEQHMRFLRDTIMRFLDKWERVFKYEVALAWIAIGLAEWVPI
                     DGWGESAPGGGGVCSEDMALPKGRSTDVPVLQGKRHHITIRSLYKEYPLPRELSSRLT
                     KRCFNFYDTFERLVLVILHCPDVTRTKMKVANGRNYPFISGGDVLFQTQLFFKIFQMT
                     LPELYQPFTDEESLQSSRKADWIYWWFKACGAKVMHKQDRAHLWDVLLGWRPHPSTLN
                     FYLDYNNKSFAHLYNTKLNLDPQFFHKVCKHGNDHFWFPDLDTLPLGSPGLETDCQVV
                     NELIRHNSYESKDTGAPGTPSKTSQAGNNYRSPIRPSQKHQKDIPFSLIDPHVQLIFI
                     YIAILQQNEFKLLEFEEAEITEFLTKVPLLSKTDDYSYKRLYDEESTSLSSTDTEDSQ
                     NSSSRPSTSSHMMIEVGNDDKIANTFDDLSQLAGDIWRKWMWFEFEESQDSV"
     gene            <791123..>791757
                     /locus_tag="AGOS_AFR193W"
                     /old_locus_tag="AFR193W"
                     /db_xref="GeneID:4621998"
     mRNA            join(<791123..791132,791295..>791757)
                     /locus_tag="AGOS_AFR193W"
                     /old_locus_tag="AFR193W"
                     /product="AFR193Wp"
                     /note="5'UTR intron"
                     /transcript_id="NM_211094.2"
                     /db_xref="GeneID:4621998"
     CDS             791296..791757
                     /locus_tag="AGOS_AFR193W"
                     /old_locus_tag="AFR193W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL187C (COX4); 1-intron"
                     /codon_start=1
                     /product="AFR193Wp"
                     /protein_id="NP_985740.1"
                     /db_xref="GeneID:4621998"
                     /translation="MFSLRQSVRLVAPATRAFSTSRAIFQKQLKTASNLAEVEGPESL
                     IGKGAAEGQIPTELEQATGLARLEFLGKLEGVEIFDTQPLDSSRRGTMKDPILVDSYD
                     DYRYVGCTGSPAGSHSTMWLKPSVEKVARCWECGSVYKLNPVGVPTEDHHH"
     gene            <792035..>792456
                     /locus_tag="AGOS_AFR194W"
                     /old_locus_tag="AFR194W"
                     /db_xref="GeneID:4621999"
     mRNA            join(<792035..792044,792096..>792456)
                     /locus_tag="AGOS_AFR194W"
                     /old_locus_tag="AFR194W"
                     /product="40S ribosomal protein S26"
                     /note="5'UTR intron"
                     /transcript_id="NM_211095.2"
                     /db_xref="GeneID:4621999"
     CDS             792097..792456
                     /locus_tag="AGOS_AFR194W"
                     /old_locus_tag="AFR194W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL189C (RPS26A) and YER131W (RPS26B); 1-intron"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="NP_985741.1"
                     /db_xref="GeneID:4621999"
                     /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKCVPKDKAIKRMTIRNI
                     VEAAAIRDLSEASVYAEYALPKTYNKLHYCVSCAIHARIVRVRSREDRRIRTPPQRQR
                     FNRENRVNPADAAKKAL"
     gene            <793484..>794848
                     /locus_tag="AGOS_AFR195W"
                     /old_locus_tag="AFR195W"
                     /db_xref="GeneID:4622000"
     mRNA            <793484..>794848
                     /locus_tag="AGOS_AFR195W"
                     /old_locus_tag="AFR195W"
                     /product="AFR195Wp"
                     /transcript_id="NM_211096.1"
                     /db_xref="GeneID:4622000"
     CDS             793484..794848
                     /locus_tag="AGOS_AFR195W"
                     /old_locus_tag="AFR195W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL190C (CDC55)"
                     /codon_start=1
                     /product="AFR195Wp"
                     /protein_id="NP_985742.1"
                     /db_xref="GeneID:4622000"
                     /translation="MPQQQNSFDFKFSQCFGDKADIVVTEADIITATEFDHTGNFLAT
                     GDRGGRVVLFEKNNSKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWCRPTNQSH
                     FLLSTNDKTIKLWKIYEKNIKLVSENNLSEGVFNQRVAGSGSGSAKAVLSLQALRLPR
                     LSLHDKIIAATPKKVYSNAHTYHINSISVNSDQETFISADDLRINLWNFDIPDQSFNI
                     VDIKPANMEELTEVITSAEFHPTHCNLLMYSSSKGTIKLADMRQNALCDFRAKTFEEY
                     MDPIHHNFFTEITSSISDVKFSPDGRYIAARDYLTVKLWDVNMDSKPLRTINIHDQLK
                     ERLSDAYENDSIFDKFEVCFSGDSSSIMTGSYNNNFMLYPNVVKTGDYATSTSLDEIV
                     LQADKSAFKTKRLGSIMQQSARNKEWGDDIDFKKSILHFSWHPRENSVAIAATNNLFI
                     FSAL"
     gene            complement(<795284..>795664)
                     /locus_tag="AGOS_AFR196C"
                     /old_locus_tag="AFR196C"
                     /db_xref="GeneID:4622001"
     mRNA            complement(<795284..>795664)
                     /locus_tag="AGOS_AFR196C"
                     /old_locus_tag="AFR196C"
                     /product="AFR196Cp"
                     /transcript_id="NM_211097.1"
                     /db_xref="GeneID:4622001"
     CDS             complement(795284..795664)
                     /locus_tag="AGOS_AFR196C"
                     /old_locus_tag="AFR196C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL191W (COX13)"
                     /codon_start=1
                     /product="AFR196Cp"
                     /protein_id="NP_985743.1"
                     /db_xref="GeneID:4622001"
                     /translation="MLRQAIRRASSLPPHALKPAYPNANAAAGKAFLESMNATKEHAK
                     HTTKLWIKIWYVVGIPAIVLTAINTYFVEMEHAEHRKHLAHVPDEEWPAQYDFMNMRL
                     KPFFWGNGDRTLFWNPVVNRNVKD"
     gene            796218..796289
                     /locus_tag="AGOS_t0151"
                     /db_xref="GeneID:4622002"
     tRNA            796218..796289
                     /locus_tag="AGOS_t0151"
                     /product="tRNA-His"
                     /codon_recognized="CAC"
                     /db_xref="GeneID:4622002"
     gene            797083..797194
                     /locus_tag="AGOS_t0152"
                     /db_xref="GeneID:4622003"
     tRNA            join(797083..797118,797159..797194)
                     /locus_tag="AGOS_t0152"
                     /product="tRNA-Pro"
                     /codon_recognized="CCA"
                     /db_xref="GeneID:4622003"
     gene            <797299..>798723
                     /locus_tag="AGOS_AFR197W"
                     /old_locus_tag="AFR197W"
                     /db_xref="GeneID:4622004"
     mRNA            <797299..>798723
                     /locus_tag="AGOS_AFR197W"
                     /old_locus_tag="AFR197W"
                     /product="AFR197Wp"
                     /transcript_id="NM_211098.1"
                     /db_xref="GeneID:4622004"
     CDS             797299..798723
                     /locus_tag="AGOS_AFR197W"
                     /old_locus_tag="AFR197W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR115W (MGR3) and YKL133C"
                     /codon_start=1
                     /product="AFR197Wp"
                     /protein_id="NP_985744.1"
                     /db_xref="GeneID:4622004"
                     /translation="MLRPILRASIKSWPVRRAHVPRMTLAPTRAYNTVSQQRSNRWKS
                     AVLAAGGLSILSLGLWWFYWPHHSFPRPVAKLLRKALWAESDKKGHNFQEALGFYIDA
                     LEECEHLDIDRISDEYTGIQLKIAEMYEKLNMFKEAQSIYLEMLHQYYEALITNGRVP
                     EWQRPHYIQKDLRVLIKALEMNQDLQLGKRLLLTHLMLPQEEVLMRSPELKKFFDRRK
                     EEARNAGDRDHSQPQRWRDFKPHVNEENIKLDDKGNMILDLQKDSSAWQPFKEEFFTA
                     RDLYTVYCLSTDDLPSALSCKMTTVEWMVMADMPPGQILLSQANLGSLLYLEAERTEA
                     LLYKLERQLVDKAKSEKDIIMMRSLNSKRSLLLDMATTSYESIITFAKRNNKLRFHAK
                     ELMDPSASQAVALSTYGLGVINLHRGILPKAERLLKDSISIAKDTDFRDLLKEANQEL
                     QKLERAKQSNPSTVFMEPKGTETP"
     gene            <798903..>801233
                     /locus_tag="AGOS_AFR198W"
                     /old_locus_tag="AFR198W"
                     /db_xref="GeneID:4622005"
     mRNA            <798903..>801233
                     /locus_tag="AGOS_AFR198W"
                     /old_locus_tag="AFR198W"
                     /product="AFR198Wp"
                     /transcript_id="NM_211099.1"
                     /db_xref="GeneID:4622005"
     CDS             798903..801233
                     /locus_tag="AGOS_AFR198W"
                     /old_locus_tag="AFR198W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL134C (OCT1)"
                     /codon_start=1
                     /product="AFR198Wp"
                     /protein_id="NP_985745.1"
                     /db_xref="GeneID:4622005"
                     /translation="MFVRFYKRLDRQYIQSQRRWILSSNKCLLQGNKNATISPLRRAF
                     DDQDHWEESQAQNTSSEQDNKGKNSSYFWSRSKATAPQVAHTGLFQNPYLNSPEGLRK
                     FANKSLTEATALVRNLREDSSQEGLVRYIIRLDQLSDILCRVIDLCEFLRAAHPDEQF
                     VAAAQECHEQMFEIMNILNTDVVLCKRLKQVLSDENISSKLSSEEIRVGHILLEDFEK
                     AGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSYIKIPCKDLESSGTSHLVLRQ
                     LTKDTMGNNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSEKQVKRLKSLLQLRR
                     KLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGELEELAKLKRNVEN
                     LSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLFRDI
                     YGISLKPVVAQAGETWAPDVRKLQVISETEGIIGLIYCDLLERPGKTTSPSHFTVCCS
                     RQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGKNKSLCLLELSDVETLF
                     HEMGHALHSMLGRTQLQNLSGTRCVTDFVELPSILMEHFAKDRRVLLRISSNYATGEP
                     IPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQDDIIAVYHGLEREMEVLV
                     DDQTNWCGRFGHLFGYGASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKW
                     GGSRDAWQCIADALDEPRLVKGDDWAMRFIGEVEDM"
     gene            complement(<801328..>802526)
                     /locus_tag="AGOS_AFR199C"
                     /old_locus_tag="AFR199C"
                     /db_xref="GeneID:4622006"
     mRNA            complement(join(<801328..801750,801945..>802526))
                     /locus_tag="AGOS_AFR199C"
                     /old_locus_tag="AFR199C"
                     /product="AFR199Cp"
                     /transcript_id="NM_211100.1"
                     /db_xref="GeneID:4622006"
     CDS             complement(join(801328..801750,801945..802526))
                     /locus_tag="AGOS_AFR199C"
                     /old_locus_tag="AFR199C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR116C (ASC1); 1-intron"
                     /codon_start=1
                     /product="AFR199Cp"
                     /protein_id="NP_985746.1"
                     /db_xref="GeneID:4622006"
                     /translation="MLELTIHVKERTIELIMSTDEILVLRGTLEGHNGWVTSLSTSPA
                     QPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDCTVTHDGKYALSASWD
                     KTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTL
                     LGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVT
                     PSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFAVAFSPNRYWLTAATASGIK
                     IFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQVMTAS
                     "
     gene            801813..801895
                     /locus_tag="AGOS_AgSNR24"
                     /old_locus_tag="AgSNR24"
                     /db_xref="GeneID:4622007"
     ncRNA           801813..801895
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR24"
                     /old_locus_tag="AgSNR24"
                     /product="AgSNR24"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR24; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149371.1"
                     /db_xref="GeneID:4622007"
     gene            <802970..>805054
                     /locus_tag="AGOS_AFR200W"
                     /old_locus_tag="AFR200W"
                     /db_xref="GeneID:4622008"
     mRNA            <802970..>805054
                     /locus_tag="AGOS_AFR200W"
                     /old_locus_tag="AFR200W"
                     /product="AFR200Wp"
                     /transcript_id="NM_211101.2"
                     /db_xref="GeneID:4622008"
     CDS             802970..805054
                     /locus_tag="AGOS_AFR200W"
                     /old_locus_tag="AFR200W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL135C (APL2)"
                     /codon_start=1
                     /product="AFR200Wp"
                     /protein_id="NP_985747.2"
                     /db_xref="GeneID:4622008"
                     /translation="MDKKIKRFLKDAVRVAPKISNKGELFELKNGLVSKYPQTRKDAI
                     KKTIQQMTLGKDVSSLFPDVLKNIATSDIEQKKLVYLYVINYAQTHPELCILAVNTFV
                     TDAQDPNPLIRCMAIRTMSMIRVDKILEHVEIPLRKTLQDDNPYVRKTAVICVAKLFQ
                     LNRELCMELDVLTDLMSALDDSNPMVVANSIAALTEIYELDRSAVPLPLLIQSHVTQF
                     LNALNECTEWARITILGALAQYEAKDAMEAQDTIVRVTPHLQHVNAAVVLASVKVIVK
                     NLDFLPREMQKQPSEKISTALVSLMSTPPEMQYVALKTIRILLQKYPTLLEKELRIFY
                     VKFNDPMYVKLEKLDIMVRLVTTSNLKQCSTLLLELREYALEFEPEFVSKAILAISQL
                     AIKFAHGADAVNASKFIAKAIDILSTLIQDRNTFQDECLISICDLLRYDPQLSGMPLS
                     IISSWTDAESRLVTDQGKCNYIWLLGQYQFPNAEEKLMQFVDTYPQQGQSTQMSILVT
                     VVKLSQQLPGHVLQRVLELATTQAQDIDIRDMAMLYWRCLSLPNPESLINELCNTKLP
                     QLTNTLDYFSPELLHTLLNELSTLSSIYYKPLSQFKYRAPQQSEVQSKALDELTSLAH
                     AEIAKNMNNETLLNMDDAQAAPKPGNTLAELSDLFGNTGGSLLDKPMQDMSLHADSRT
                     VQGASKDLLDLF"
     gene            complement(<805091..>805420)
                     /locus_tag="AGOS_AFR201C"
                     /old_locus_tag="AFR201C"
                     /db_xref="GeneID:4622009"
     mRNA            complement(<805091..>805420)
                     /locus_tag="AGOS_AFR201C"
                     /old_locus_tag="AFR201C"
                     /product="AFR201Cp"
                     /transcript_id="NM_211102.1"
                     /db_xref="GeneID:4622009"
     CDS             complement(805091..805420)
                     /locus_tag="AGOS_AFR201C"
                     /old_locus_tag="AFR201C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL137W (CMC1)"
                     /codon_start=1
                     /product="AFR201Cp"
                     /protein_id="NP_985748.1"
                     /db_xref="GeneID:4622009"
                     /translation="MSKEQGQAEQHGRRLPVWMLSPAEEKEARKNLKTMAYEKCSEYV
                     RAMAECSKAHGLNVFPACDGPKRQMGECLLFYQKDEFLDAEWDRIVERKLDALEQQVR
                     ARKAGEQ"
     gene            <805613..>806014
                     /locus_tag="AGOS_AFR202W"
                     /old_locus_tag="AFR202W"
                     /db_xref="GeneID:4622010"
     mRNA            <805613..>806014
                     /locus_tag="AGOS_AFR202W"
                     /old_locus_tag="AFR202W"
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /transcript_id="NM_211103.2"
                     /db_xref="GeneID:4622010"
     CDS             805613..806014
                     /locus_tag="AGOS_AFR202W"
                     /old_locus_tag="AFR202W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL138C (MRPL31)"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /protein_id="NP_985749.2"
                     /db_xref="GeneID:4622010"
                     /translation="MFGPFKSSQPLLGGLLWKIPWRMSAPQKQRQRRRLQAVDDVLKQ
                     LNLGLQIRKKLQSLPDLPFDALKQERVKKCVDIKQLRLLNDPAVFPAEHQMSPKDKYT
                     VFNKSSRGYRKGAHKVPKWTKVSNRRNPANF"
     gene            complement(<806031..>806645)
                     /locus_tag="AGOS_AFR203C"
                     /old_locus_tag="AFR203C"
                     /db_xref="GeneID:4622011"
     mRNA            complement(<806031..>806645)
                     /locus_tag="AGOS_AFR203C"
                     /old_locus_tag="AFR203C"
                     /product="AFR203Cp"
                     /transcript_id="NM_211104.1"
                     /db_xref="GeneID:4622011"
     CDS             complement(806031..806645)
                     /locus_tag="AGOS_AFR203C"
                     /old_locus_tag="AFR203C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR117C (SPC24)"
                     /codon_start=1
                     /product="AFR203Cp"
                     /protein_id="NP_985750.1"
                     /db_xref="GeneID:4622011"
                     /translation="MPSQAPGPDVLENPADLLRQTRENFSIAHDLQLLNATEENLRRL
                     MQRTQQLEAKGAQELSELQAQQTERAQAAEAMRAEKETQAQHLQALTHSQDLVRLANE
                     LEELEQQLVSLRAELDEGMTQLLQTSEPTAAFQGDAEHEQQSPEVQTNLLKLQLYSSL
                     GVTLDTEHNQALIERGDAAGIDLIALEDDSLSPFFRTKYVWDRL"
     gene            <806759..>806965
                     /locus_tag="AGOS_AFR204W"
                     /old_locus_tag="AFR204W"
                     /db_xref="GeneID:4622012"
     mRNA            <806759..>806965
                     /locus_tag="AGOS_AFR204W"
                     /old_locus_tag="AFR204W"
                     /product="AFR204Wp"
                     /transcript_id="NM_211105.1"
                     /db_xref="GeneID:4622012"
     CDS             806759..806965
                     /locus_tag="AGOS_AFR204W"
                     /old_locus_tag="AFR204W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL138C-A (HSK3)"
                     /codon_start=1
                     /product="AFR204Wp"
                     /protein_id="NP_985751.1"
                     /db_xref="GeneID:4622012"
                     /translation="MDQTKRRHYSQLSQQLQLLQKNLEATTQHVETMSVQCNEHLVNK
                     LGKIQASWFIGGNRCFEQELLGKR"
     gene            complement(<807034..>808407)
                     /locus_tag="AGOS_AFR205C"
                     /old_locus_tag="AFR205C"
                     /db_xref="GeneID:4622013"
     mRNA            complement(<807034..>808407)
                     /locus_tag="AGOS_AFR205C"
                     /old_locus_tag="AFR205C"
                     /product="AFR205Cp"
                     /transcript_id="NM_211106.1"
                     /db_xref="GeneID:4622013"
     CDS             complement(807034..808407)
                     /locus_tag="AGOS_AFR205C"
                     /old_locus_tag="AFR205C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL139W (CTK1)"
                     /codon_start=1
                     /product="AFR205Cp"
                     /protein_id="NP_985752.1"
                     /db_xref="GeneID:4622013"
                     /translation="MSYNNKKRNGSFKRRNGGDYYFPNKRPHHHHQPTGTTSRYNNQV
                     RPPTEPEPAAPAPADVATSAAVAATRQSRFQPHRALPKAPRQVSRYNNGNLPAPPAGP
                     ASLRVPATIITHTHSVESSYQRITQVGEGTYGKVYKCRNIYTNKLVALKKLRLETERD
                     GFPITSIREIKLLQHCQHENVSTIAEIMCEAQKTVYMIFEYADNDLSGLLMNKEIHFS
                     DANCKHLFRQLLKGMEYLHECRILHRDIKGSNILIDNRGNLKITDFGLARKMKQEPDY
                     TNRVITLWYRPPELLLGTTRYGTEVDMWGCGCLLVELFLKAAFFQGTNELEQLRCIFQ
                     VLGTPTIEQWPGLFDMPWWFMMIPQQKENYPSRFDEKVSGVLPTQSCRDLARGLLLYD
                     QKKRFSASEALKSAYFYELPRPEPLNLGDFDGCHEFEARRQRRKEREETKKAAAASAS
                     SASKKSA"
     gene            complement(<808632..>809960)
                     /locus_tag="AGOS_AFR206C"
                     /old_locus_tag="AFR206C"
                     /db_xref="GeneID:4622014"
     mRNA            complement(<808632..>809960)
                     /locus_tag="AGOS_AFR206C"
                     /old_locus_tag="AFR206C"
                     /product="AFR206Cp"
                     /transcript_id="NM_211107.1"
                     /db_xref="GeneID:4622014"
     CDS             complement(808632..809960)
                     /locus_tag="AGOS_AFR206C"
                     /old_locus_tag="AFR206C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKL140W (TGL1)"
                     /codon_start=1
                     /product="AFR206Cp"
                     /protein_id="NP_985753.1"
                     /db_xref="GeneID:4622014"
                     /translation="MQKQTEAAETRSRPQGARQLLGYAVGLTALAEVLLWQLFRLILA
                     VFWKREPKHGRPDAGRVLEAELAAARDIYDMCRLFGVSLRTHMVRTEDDYLLAVHHIP
                     ASEAGAPVVYLHHGLMMSSDIWCCRLDRQDSLPFVLAASGYDVWMGNNRGNRYSTKHL
                     RCAPHDERFWDFSLDEFALFDIPNTVDYILAATGARTLTCIGFSQGSAQLFAALSVHA
                     GLNCKVSRLVAIAPAMTPPGMHHRLLDSLIKFTPNLTYLLFGRKALLSSTVLWQRLLP
                     HGVFDALIDRALCLLFGWRSANIAPEQKHVSYSKLYSTTSVKCIVHWFQILRAQQFQF
                     FHPSDCLFHSVARPYAVAHFPTNTSITVPTMLIYGTSDSLVGINVLLKNLPGQRLDIV
                     AVPGYEHLDLLWGRKVRELVIKPLLALLDHDSRTRAEDKASSCQTAGHQV"
     gene            complement(<810103..>810603)
                     /locus_tag="AGOS_AFR207C"
                     /old_locus_tag="AFR207C"
                     /db_xref="GeneID:4622015"
     mRNA            complement(<810103..>810603)
                     /locus_tag="AGOS_AFR207C"
                     /old_locus_tag="AFR207C"
                     /product="AFR207Cp"
                     /transcript_id="NM_211108.1"
                     /db_xref="GeneID:4622015"
     CDS             complement(810103..810603)
                     /locus_tag="AGOS_AFR207C"
                     /old_locus_tag="AFR207C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR118C and YKL141W (SDH3)"
                     /codon_start=1
                     /product="AFR207Cp"
                     /protein_id="NP_985754.1"
                     /db_xref="GeneID:4622015"
                     /translation="MFASQFKFFIRPSTTGAARRALSTIKTSTKESQELLVAQRKNRP
                     VSPHLTIYQPQLTWYLSSVHRISGVLLGGAFYAVTISFGVSALLGLGLNAENLATWYH
                     SHMPTWGDLTVKGGAAYLFAFHFGNGIRHLIWDMGRELSLKGVYRTGYAVLGLMAVGG
                     TYLLTL"
     gene            complement(<810769..>811329)
                     /locus_tag="AGOS_AFR208C"
                     /old_locus_tag="AFR208C"
                     /db_xref="GeneID:4622016"
     mRNA            complement(<810769..>811329)
                     /locus_tag="AGOS_AFR208C"
                     /old_locus_tag="AFR208C"
                     /product="AFR208Cp"
                     /transcript_id="NM_211109.1"
                     /db_xref="GeneID:4622016"
     CDS             complement(810769..811329)
                     /locus_tag="AGOS_AFR208C"
                     /old_locus_tag="AFR208C"
                     /note="NOHBY631; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0F17842g"
                     /codon_start=1
                     /product="AFR208Cp"
                     /protein_id="NP_985755.1"
                     /db_xref="GeneID:4622016"
                     /translation="MNDSPTHRSSRQHEFALNSDKLRQQQPAALQTPGLPTPKRPSPI
                     QQASRAPRRDSEDVLQLEYNSVKQENDKLKNIITKLKQEIDVYSRLLQRQTGAPRPPP
                     PHPCGIPLIESILVNSSKRRKRATTVVARAVPQTHSTSRVLKDASKDVMLGPASQALA
                     PPAAEDLAPEDLLLMNRLTDLLKRMD"
     gene            <811835..>812548
                     /locus_tag="AGOS_AFR209W"
                     /old_locus_tag="AFR209W"
                     /db_xref="GeneID:4622017"
     mRNA            <811835..>812548
                     /locus_tag="AGOS_AFR209W"
                     /old_locus_tag="AFR209W"
                     /product="AFR209Wp"
                     /transcript_id="NM_211110.1"
                     /db_xref="GeneID:4622017"
     CDS             811835..812548
                     /locus_tag="AGOS_AFR209W"
                     /old_locus_tag="AFR209W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR025W (SNF7)"
                     /codon_start=1
                     /product="AFR209Wp"
                     /protein_id="NP_985756.1"
                     /db_xref="GeneID:4622017"
                     /translation="MWSYLFGSGNAKQKKELPKKAILELREHIQLLSKKQAHLQTQMT
                     SQEESARHFLSKGNKNMAKAALKRKKVFESQLLKIDKQVDSLEQQLYSIENANLNLET
                     MKAMKQGASAMKHIHEGLDVERVDETMDEIREQVELGEEISEAISRPLYTGVNEIDED
                     ELDEELDMLAQEEVARKVMEPGAAVPAAAPATKVSLPSVPSSDMPQQDRGQPVTLGMD
                     QEEDEDERALRELQAEMGL"
     gene            complement(<812722..>813711)
                     /locus_tag="AGOS_AFR210C"
                     /old_locus_tag="AFR210C"
                     /db_xref="GeneID:4622018"
     mRNA            complement(<812722..>813711)
                     /locus_tag="AGOS_AFR210C"
                     /old_locus_tag="AFR210C"
                     /product="AFR210Cp"
                     /transcript_id="NM_211111.2"
                     /db_xref="GeneID:4622018"
     CDS             complement(812722..813711)
                     /locus_tag="AGOS_AFR210C"
                     /old_locus_tag="AFR210C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR026C (SED5)"
                     /codon_start=1
                     /product="AFR210Cp"
                     /protein_id="NP_985757.2"
                     /db_xref="GeneID:4622018"
                     /translation="MMDIKDRTIEFQRSVTSYSRRNAKQGAGGPGEGADRQSLRKSEF
                     QQRASRISHEIANLAQMLSKLAQLAKRKPMFNDNPVEIAEMTYLIKHKIYSVEQEMME
                     LSRHMPNNGGGVADGGAQTRLHTKNVVNLLNTKMKNISGDFKSVLEARQKLELANRDR
                     WEKISADRNSAAAASLQDGLPMGGMGVSSGSAAAYNSANPFMSSLLAEDDASGQPNGQ
                     LSLPNEESVLLLEEQQTANQQYLQERGRAVETIESTIQEVGNLFQQLAHMVQEQGETI
                     QRIDANVEDIDINIAGAQRELLKYFDRISSNRWMAVKIFAILFAFFLVWVIVN"
     gene            complement(<814128..>815387)
                     /locus_tag="AGOS_AFR211C"
                     /old_locus_tag="AFR211C"
                     /db_xref="GeneID:4622019"
     mRNA            complement(<814128..>815387)
                     /locus_tag="AGOS_AFR211C"
                     /old_locus_tag="AFR211C"
                     /product="AFR211Cp"
                     /transcript_id="NM_211112.1"
                     /db_xref="GeneID:4622019"
     CDS             complement(814128..815387)
                     /locus_tag="AGOS_AFR211C"
                     /old_locus_tag="AFR211C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR027C (AAT2)"
                     /codon_start=1
                     /product="AFR211Cp"
                     /protein_id="NP_985758.1"
                     /db_xref="GeneID:4622019"
                     /translation="MSLTAFNQLEILPPDALFDVKKRLTQDTRSFKVDLGLGAYRDEN
                     GKPWVLPCVREAEKQLMADPGYNHEYLGIAGLEEFRAAAARVLLGEDSEALAEGRVVS
                     VQSISGTGALHVAAKLLAKTVPDATVYMSDPTWGNHFAVFETQGLRTATYPYWDAATR
                     SLDMEGVLGALGAAPRGSVFVLHACAHNPTGLDPNEEQWVQILDAVAAREHTVLFDSA
                     YQGFASGSLARDAYALRAGLRRLAEVTPVLVCQSFAKNIGMYGERVGALHVVLPRQPA
                     ESLAHVKAAVLSQLSHITRSELSNPPAYGAKIVTKVLTTPELAAQWKKDMITMSSRIA
                     RMRRVLRDRLVELGTPGNWDHIVQQCGMFSYTGLTKEMVARMEKDFAIYMVSSGRISI
                     AGLNDSNVGHVANAIDNAVRHFSTPKL"
     gene            <815797..>817677
                     /locus_tag="AGOS_AFR212W"
                     /old_locus_tag="AFR212W"
                     /db_xref="GeneID:4622020"
     mRNA            <815797..>817677
                     /locus_tag="AGOS_AFR212W"
                     /old_locus_tag="AFR212W"
                     /product="AFR212Wp"
                     /transcript_id="NM_211113.2"
                     /db_xref="GeneID:4622020"
     CDS             815797..817677
                     /locus_tag="AGOS_AFR212W"
                     /old_locus_tag="AFR212W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR119W (ASI1) and Non-syntenic homolog of Saccharomyces
                     cerevisiae YNL008C (ASI3)"
                     /codon_start=1
                     /product="AFR212Wp"
                     /protein_id="NP_985759.2"
                     /db_xref="GeneID:4622020"
                     /translation="MNSSVLERLDYLNQSSHFLVSDSTPLASLVNTPYRIYKAFYDAV
                     VTQYLASLNNPETLPFNSETFMSSVGYFFSSYAVGCFFIAVILSRLSAMAGLRSNTVR
                     TSIPNWSRVTLHAVAIAALVYGLCGVAIQYQVGWLRRWPTLEVGAFLSRTYVVFTLSH
                     CIETFLSITTNGKPLEESDYTIFELSAQFYGMTKGGATAHEYGPDCIMALSGRLIIHL
                     VELFRKRRWRLACSTLLNTGFISYLLLEVRSNGLGSLSLFTKCKHFPKFFSVFIIGIS
                     MACYLLACLVRLNPTRDEGTSAVEDLQFHSFVSNWFKNLNLTGEEEFSITVMRLAVLL
                     CNPSQNKEHGLHRELPHLKAAASLHKSYMISGYMNKLSKIPEAVTGSRADPAPKPRSV
                     AIRRVLWLGSMLKGIFSRIRGSLAPPKAATPVRNTHQKSANFNDYINENNYTHFMTME
                     NDETFSPLLPEEDGSADYESDSPDENDDVCDSDLDLEEPQDILQEVVSPQAMLELAHS
                     SPQDLTWYLSMWTILNCESAPGKRLTRSQYAHINENGILKEVLLQRNMETCTSPSKLQ
                     DEDADMSCVVCKTNLRNIVLWPCRCFALCEECRVSLGLRGFKACVCCRADVHGYSRLN
                     AV"
     gene            818269..818365
                     /locus_tag="AGOS_AgSNR30"
                     /old_locus_tag="AgSNR30"
                     /db_xref="GeneID:4622021"
     ncRNA           818269..818365
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR30"
                     /old_locus_tag="AgSNR30"
                     /product="AgSNR30"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR30; start and end coordinates are
                     approximate. Similarity is partial. In synteny."
                     /transcript_id="NR_149373.1"
                     /db_xref="GeneID:4622021"
     gene            complement(<818582..>820354)
                     /locus_tag="AGOS_AFR213C"
                     /old_locus_tag="AFR213C"
                     /db_xref="GeneID:4622022"
     mRNA            complement(<818582..>820354)
                     /locus_tag="AGOS_AFR213C"
                     /old_locus_tag="AFR213C"
                     /product="AFR213Cp"
                     /transcript_id="NM_211114.2"
                     /db_xref="GeneID:4622022"
     CDS             complement(818582..820354)
                     /locus_tag="AGOS_AFR213C"
                     /old_locus_tag="AFR213C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR120C (ADE17) and YLR028C (ADE16)"
                     /codon_start=1
                     /product="AFR213Cp"
                     /protein_id="NP_985760.2"
                     /db_xref="GeneID:4622022"
                     /translation="MVYSKTAILSVYDKTGLLDLAKGLAENNVRILASGGTARMVREA
                     GFPVEDVSSITNAPEMLGGRVKTLHPAVHGGILARNLESDEKDLKEQGIEKVDFVVCN
                     LYAFKETVAKVGVTVEEAVEEIDIGGVTLLRAAAKNHSRVTILSDPRDYSQFLSELSK
                     GEIPEDMRNKLALKAFEHTADYDAAIADFFRKKYSEGKSQLTLRYGANPHQKPAQAFA
                     ALHDELPFKVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGLP
                     LSDVEKHVYFVAEIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTAQIISKEV
                     SDGVVAPGYEPEALEILKKKKSGKYCILQIDPNYTPEPLESRQVFGVTLQQKRNDAII
                     NKSSFKEIVSANKDLPESAIVDLTVATIALKYTQSNSVCYAKNGMVVGLGAGQQSRIH
                     CTRLAGDKADNWWLRQHPRVLAFKWAKGVKRPERSNAIDLFVTNQVPTEEPEKSEYES
                     KFEEVPTPLSEQEREEWLSKLNNVALSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVMD
                     KAVFAAADSFELVYVENPIRLFHH"
     gene            complement(<820874..>821488)
                     /locus_tag="AGOS_AFR214C"
                     /old_locus_tag="AFR214C"
                     /db_xref="GeneID:4622023"
     mRNA            complement(<820874..>821488)
                     /locus_tag="AGOS_AFR214C"
                     /old_locus_tag="AFR214C"
                     /product="60S ribosomal protein L15"
                     /transcript_id="NM_211115.1"
                     /db_xref="GeneID:4622023"
     CDS             complement(820874..821488)
                     /locus_tag="AGOS_AFR214C"
                     /old_locus_tag="AFR214C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR121C (RPL15B) and YLR029C (RPL15A)"
                     /codon_start=1
                     /product="60S ribosomal protein L15"
                     /protein_id="NP_985761.1"
                     /db_xref="GeneID:4622023"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRIRVWEYRQKTVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNQLKYQRALRATA
                     EERVGRRAANLRVLNSYWINQDSTYKYFEVILVDPSHKAIRRDARINWIANPVHKHRE
                     ARGLTATGKKSRGINKGHRFHNTQAGRRKTWKRQNTLSLWRYRK"
     gene            <823087..>823326
                     /locus_tag="AGOS_AFR215W"
                     /old_locus_tag="AFR215W"
                     /db_xref="GeneID:4622024"
     mRNA            <823087..>823326
                     /locus_tag="AGOS_AFR215W"
                     /old_locus_tag="AFR215W"
                     /product="AFR215Wp"
                     /transcript_id="NM_211116.1"
                     /db_xref="GeneID:4622024"
     CDS             823087..823326
                     /locus_tag="AGOS_AFR215W"
                     /old_locus_tag="AFR215W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR122W-A"
                     /codon_start=1
                     /product="AFR215Wp"
                     /protein_id="NP_985762.1"
                     /db_xref="GeneID:4622024"
                     /translation="MAQIVSVSLVPQAAVSPAPSNNSTTVTSASAKSSGSSSSASSAS
                     SSGAAAIGAVANPVSWKYGAALGVAMIGSFALGAL"
     gene            <823457..>823759
                     /locus_tag="AGOS_AFR216W"
                     /old_locus_tag="AFR216W"
                     /db_xref="GeneID:4622025"
     mRNA            <823457..>823759
                     /locus_tag="AGOS_AFR216W"
                     /old_locus_tag="AFR216W"
                     /product="AFR216Wp"
                     /transcript_id="NM_211117.1"
                     /db_xref="GeneID:4622025"
     CDS             823457..823759
                     /locus_tag="AGOS_AFR216W"
                     /old_locus_tag="AFR216W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR123W (PKR1)"
                     /codon_start=1
                     /product="AFR216Wp"
                     /protein_id="NP_985763.1"
                     /db_xref="GeneID:4622025"
                     /translation="MSFFEALWDSVFQPGVPPVLVGATHVSFTLLLALLLALLWTTRN
                     LHFMALSVIAAFLWATVSWFVRELARAEAKAAPTAAADEAVATGSWAAPRTAARLR"
     gene            <824050..>827265
                     /locus_tag="AGOS_AFR217W"
                     /old_locus_tag="AFR217W"
                     /db_xref="GeneID:4622026"
     mRNA            <824050..>827265
                     /locus_tag="AGOS_AFR217W"
                     /old_locus_tag="AFR217W"
                     /product="AFR217Wp"
                     /transcript_id="NM_211118.2"
                     /db_xref="GeneID:4622026"
     CDS             824050..827265
                     /locus_tag="AGOS_AFR217W"
                     /old_locus_tag="AFR217W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR124W and YLR031W"
                     /codon_start=1
                     /product="AFR217Wp"
                     /protein_id="NP_985764.1"
                     /db_xref="GeneID:4622026"
                     /translation="MEAGLATMNGKRGGATGSAQAQLRNQLLSGQVGDAEAAVAHGAD
                     AGYGGRGASRAASLTSSVTTFFKGRRRGAGKEDDDDEDVFLGDHDMGNLSMNDLSSLR
                     NNGGHKYGYGGGVDDMTVIPTLMPTEAKGGAGQMNNTDYRKRLTAQKKMAFNTMARQN
                     RQPPMQGYGPPAVAGRAMSLQSYNRRPQFGPAPYGKLPQGAGVPQSPVPPQGPMQPQG
                     PGVLPGNGWGSPMTAPPAAVNRFRGGPMAMSGPVGPRTMSLGGRGGPPKVGPPVTQPV
                     VSGGYHGPPQRAMQPRMIGPMYAPVHQPPLGGPRSMSLQSHSRQAYSNLDALRHPRQT
                     PAGGMPMEHAYNAPQYPNEATGRFNTTPDVSFISEHETLYETEVPEGAFAAEPDPSVG
                     KMNVLKVSDPKKQDLQTYLEREQALLVEKEQSLKEKEEELKKLELDLAEKREQQKAED
                     HGHPTIEPEEKRDLSASPLPSSSADDSVIDLKPSSLLIDSLRTLDTDDDFSSAFPWMR
                     DVPSADELEDIGSDTLESTEGSGNVASSPNQKGESDSSESNLKDKNSLFCAVARDDTY
                     RTEDVSGYEDSSRGSPPIPNSQTPAQEASPAQSARLHKNEWQAGQQEPPSTQQTSQPQ
                     SPELTPARVTSQRQLQELSPTRETLRSQSQDPPSESDIGACRREVYSQPQPHLVSESH
                     PLQALSESARPDTPSTDPCLHSPRSATASSQGGSSNDSHKEKKGGFAKAKSLLRKISS
                     RKNSITSRPGSPLSNRVDTAVSSPKLSRRQSISNSVRSLQSTDPDATTTSAKEPAGRN
                     CADTSTTLDSHGASPINKQKSYHSIFASSSLAHLPQVKENNIGFSQSQGNRNRANSHF
                     IDRTEYMMGNGSSTISSPSQRVPPRRGSVPNNRKSVISEEIVVPNTNGKLTAPYVPLF
                     SSGLDELEPAVMVEAVTGKKIFKTVMVSTEQLAILNANKNLMNELHIVSQELVESVAR
                     ETRLEQQLLLQHKNDDSRYLSLQDFEVELRKKSAKIVELIQGLNDERLKRFIAEEQVL
                     LSEKGVRPSNLELVYKIDQLEKKLQQRNNEIASLKERLPIR"
     gene            <827563..>830396
                     /locus_tag="AGOS_AFR218W"
                     /old_locus_tag="AFR218W"
                     /db_xref="GeneID:4622027"
     mRNA            join(<827563..827587,827839..>830396)
                     /locus_tag="AGOS_AFR218W"
                     /old_locus_tag="AFR218W"
                     /product="AFR218Wp"
                     /transcript_id="NM_211119.2"
                     /db_xref="GeneID:4622027"
     CDS             join(827563..827587,827839..830396)
                     /locus_tag="AGOS_AFR218W"
                     /old_locus_tag="AFR218W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR125W (STO1); 1-intron"
                     /codon_start=1
                     /product="AFR218Wp"
                     /protein_id="NP_985765.2"
                     /db_xref="GeneID:4622027"
                     /translation="MSGMKRRYDYEEEDGYRDFRPRYSKRQRLPPVVQLCKDMLPDIR
                     TIGESVKAFEEDIKFLSEAIINEFGNDEYFNNALLSTFNALILEQPHKQPAIALLTIV
                     VNSGNPAAGKSVINYFYEKLQHLLDMTVVDDFEVTSNETGPWNKIKLTLRFLSLLSPV
                     ITLTELTNVYQRLFELAVQLNRSSDANTRNPLSEAIYTNTLLNIPYLFFFNKEDETLR
                     TNVEDLIQYAESNYEVKTVDLSLTKEYNKNLPYEPVQWVQIVLSNVKNALANDMEELK
                     NLFPDYQNLLPTSIEQQMFNDPLTIPEFEKLLPFSGLDKGLGSVDSMWKTPRTAFQVY
                     LPNVVGDFSTVVPITTYTGMLFDDIIVDIVESLEFNRHEVARQVVTLDLYFKPGIFTE
                     PGLSIAQLLVQHNEMPELSTYKIEDLAIENILGLIFKLPTVTQSFAYFYTLLVEICQN
                     SPKAIAPVFGRAFRLFYNNLDNMDHELKMRYLDWFSIQMSNFNFSWKWNEWEQDSIAF
                     SKSFYNPKITFAKNLIRKELRLTSNRPDVEDSLTPEFKQYLDASYISKDQLASYYQSF
                     FEGFSFDPEVIKDNDLLFKNEVFPFHEKVQLILDYIHKQPLEKNISELESLLEDIKSA
                     HGDKIPDFNRFTVTLLIQALVYSGNRSLSHANKYISDAKSDLVTILEKMEVPPEVKEQ
                     WIIEAVIRYWNCNSQNGFLIVDSFKHSELVTAKSILTFSLTDLNGQNLGLVDATSIES
                     TFRTLTELALQQASDISVFEFVFERLLEIINDTVSQLGTNEEIVAPSVDNETMLDVDE
                     LARLDLIWKYESAVGFIKSILRKYSDEYSVLLDKFSAGLEQAVPHEPTRKQLDQWFNE
                     IREL"
     gene            complement(<830534..>831358)
                     /locus_tag="AGOS_AFR219C"
                     /old_locus_tag="AFR219C"
                     /db_xref="GeneID:4622028"
     mRNA            complement(<830534..>831358)
                     /locus_tag="AGOS_AFR219C"
                     /old_locus_tag="AFR219C"
                     /product="AFR219Cp"
                     /transcript_id="NM_211120.1"
                     /db_xref="GeneID:4622028"
     CDS             complement(830534..831358)
                     /locus_tag="AGOS_AFR219C"
                     /old_locus_tag="AFR219C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR126C (DLT1)"
                     /codon_start=1
                     /product="AFR219Cp"
                     /protein_id="NP_985766.1"
                     /db_xref="GeneID:4622028"
                     /translation="MGAVNIPTWARHSFATVLILLLLAFSLILPVDVIRRVSQMPHEI
                     LNTAIIVGAAITLLITFTSLSFGRLLVHRSCMQDIPKRYVPITERDLPNTRIRGEIYH
                     KLEHCKQLAHDFSTPETRVVHAGLEPPAHVDHCGDDMLPPLLDYQACVKIIADRFKFQ
                     GILLNKYMLEPKLGMTFAAQLRRTVSENDCVDRNQLEEFITLYETIRYSGHPVTRGKF
                     IRFMELCLLLVDFSLLTHRVDTPPSGEPSSTTDSATNFNAHVLYSRTEESISQSSA"
     gene            <831695..>834952
                     /locus_tag="AGOS_AFR220W"
                     /old_locus_tag="AFR220W"
                     /db_xref="GeneID:4622029"
     mRNA            <831695..>834952
                     /locus_tag="AGOS_AFR220W"
                     /old_locus_tag="AFR220W"
                     /product="AFR220Wp"
                     /transcript_id="NM_211121.2"
                     /db_xref="GeneID:4622029"
     CDS             831695..834952
                     /locus_tag="AGOS_AFR220W"
                     /old_locus_tag="AFR220W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR032W (RAD5)"
                     /codon_start=1
                     /product="AFR220Wp"
                     /protein_id="NP_985767.2"
                     /db_xref="GeneID:4622029"
                     /translation="MQRTGDGERPRFFQQDLDVIPDDKGSDLFIQTAEGPDGHVDDEV
                     IEDKTRFITNLKEVLGALPDDILEGYWNSYGASKDGLSKAIQQHFEGKETKGCSDAHD
                     DLNTETQNSQNTIVNGHVSNQIKRASEGGLPILKRKKQLCCWRRFLGSTQVNAMATRP
                     TAQPLKYGSELLIRRTSGQPNNSGLRSRKKPGFSQYVRFCDATSSRELGRLPEDISEI
                     LHTLLQTPGVEFKATMIFCNSKRLSVGDLFVVRLDCFVTSLLFDPALPGKAEDEQFQQ
                     RNRALMLLFKNLNMTPLAEGADLVPEKPEFYDLEEDESITDATVNSPTASDDYMDLNQ
                     LRNFYRSTQESASIFKLRETTPPVDKFQLELRRYQKQGLTWMLLREREHAILEPGSQD
                     ALADGPMDPMWRMFKWPRDTSWDVSRGTTYVSLEADIPDKFYANLHTGEFSLVKPISK
                     SILKGGILADEMGLGKTISILALITMVPSDTKHLLTTAQEKPPVGHLSLELGISTVKP
                     YTASTTLIVVPMSLLPQWRNEFVRVNDGNGLYCEVYYAGNVSNLRTLLVKQKSPPSVV
                     LTTYGVVQTEWSKLQQFDYEASNEGLFSVEFFRIILDEGHNIRNRTTKTSKAVMALTS
                     RRKWVLTGTPIMNRLDDLFSLIKFMNFEPWCKIDYWRQFVSDPFEKKDYSSALEVIQA
                     VMGPILLRRTKNMKDEDGNPLVQLPPKEVVIEMIRFSDTEAGLYKYFLSKAEHSVKES
                     LARGDLLKKYSTILLHILRLRQVCCHFKLLGSQDENDEDLKNMKLINDIPDISTLLGE
                     DSQSPGSSSEGMPDFIEDFKTKYPNSDALKDLECSICTCEAISPLTSVVFTRCGHPFC
                     ESCLLEYIQFQNKKGSETICPNCRAAVESRYLLKLEDINGKLEPVPYSNTKKSSKIVA
                     LIRHLKHLQDTSANEQVVVFSQFSSYLDILENELRQSFASDICEIYKFDGRLDLKERS
                     NVLAKFTEKSLVKMKVLLLSLKAGGVGLNLTCASHAFIMDPWWSPGMEDQAMDRIHRI
                     GQSNTVKIYRFIVENSIEEKMLRIQEKKRSLGEFVDADEEERRRSRIEEIKMLFA"
     gene            complement(<834993..>835937)
                     /locus_tag="AGOS_AFR221C"
                     /old_locus_tag="AFR221C"
                     /db_xref="GeneID:4622030"
     mRNA            complement(<834993..>835937)
                     /locus_tag="AGOS_AFR221C"
                     /old_locus_tag="AFR221C"
                     /product="AFR221Cp"
                     /transcript_id="NM_211122.1"
                     /db_xref="GeneID:4622030"
     CDS             complement(834993..835937)
                     /locus_tag="AGOS_AFR221C"
                     /old_locus_tag="AFR221C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR127C (SAS2)"
                     /codon_start=1
                     /product="AFR221Cp"
                     /protein_id="NP_985768.1"
                     /db_xref="GeneID:4622030"
                     /translation="MKSSSSPSDEGDLYGILDKPNIKQVQFGLGKRFKTWYGSAVYFA
                     RDKRTLGYKAKNVGMCDRSMDESTEGGFWLDELFVCEYCFKYYDRPDELVGHVKSCRY
                     KLRLPGRIKYMSPEYTIRKVKGKKHELFCQCMCLFTKLFLDNKSVYFRMTSYEFYILY
                     NTEGREPLGFFSKDLYSYNRNNLACILVFPPYQRRNLGTLLIDFSYRLSRNEGIVSGP
                     EFPLSPFGLIGYLKYWSFAIVWHLTEGELSNLHKVSLNVISEVTGIRVSDVIITLKHL
                     QCLTENNEILLPVIRRWAKELKVDRGFMIQEQYLLLND"
     gene            <836196..>839906
                     /locus_tag="AGOS_AFR222W"
                     /old_locus_tag="AFR222W"
                     /db_xref="GeneID:4622031"
     mRNA            <836196..>839906
                     /locus_tag="AGOS_AFR222W"
                     /old_locus_tag="AFR222W"
                     /product="AFR222Wp"
                     /transcript_id="NM_211123.2"
                     /db_xref="GeneID:4622031"
     CDS             836196..839906
                     /locus_tag="AGOS_AFR222W"
                     /old_locus_tag="AFR222W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR128W (ECM16)"
                     /codon_start=1
                     /product="AFR222Wp"
                     /protein_id="NP_985769.2"
                     /db_xref="GeneID:4622031"
                     /translation="MGTYRKRWNEKARAGQAAKLKELKRIRNKQFTKYDDDSEQVSDH
                     PEGEETSNPNAEVLPALTAEEKEQKKRKLEELFTPKETKISRKKKKRLEKFIEHQLKR
                     EEKKEIISKLQDYKIDTSILTSSKGLGHGRKTRKEEFAEALKLEKQGLGDEQTREVLY
                     EEHKVRSWEADNADGSGSSGGGSDDDSGEDDEVDAPQRSVFVDNRPAKFGGFGSGFSF
                     ANAVVVDKGKSRESKKKYNWRQRLEQEERRKHEKDDDNDFASDSESESNDDVETSDSS
                     SAAEDDSQPEDDTSKEDTDPENKIDKFKHSKVGEQFKEWANSEMKRIEGRDKEYVLPT
                     LEYKVEARVRMEDLDDGLQADNVPVDESSTRKAFVVDVQRPDTLQAVRMQLPVFAEEH
                     RIMEAIHHNDVVIICGATGSGKTTQVPQFLYESGYGHPDAPDTPGMIAITQPRRVAAV
                     SMAKRVGSELGNHGDKVAYQIRFDSTTKEDTRVKFMTDGVLLREMMNDFRLTKYSCII
                     IDEAHERNINTDILIGMLSRCVKLRAKEHSVDPVKNKKLKLIIMSATLRVADFSENSS
                     LFATPPPVLEVEARQYPVAIHFNRKTSFDYAEEAFKKTCKIHRRLPPGAILIFMTGQQ
                     EITHMVKRLRNEFPFAKNASTRLEMESELPTVKVNPETTDMEVEDIDFSVKISQEEYD
                     DGLSDAEGEHTEDSEEEEGFEEELEEGQSENDPLYVLPLYSLLPTKEQMKVFADPPKG
                     SRLCVVATNVAETSLTIPGVRYVVDCGRSKERNYNEESGVQSFEIEWISKASADQRSG
                     RAGRTGPGHCYRLYSSAVYERDFQQFSRPEILRMPVETVVLQMKSMSIHRVTNFPFPT
                     PPERTALGKAVELLQHLGALDESERITADGRKMSLFPLSPRFAKMLLVSDEQGCLPYI
                     VAIVSILSVGDPFISENELGIDQVDAQDGGVPHGSDEQKRQLRARFHKSRAKFSKLDP
                     HSDVFRLLSAVSALDYVPTERRNQFLHDHFLRGKVMDEVCKLRKQVLYIIRANTSRDN
                     VAVAIRDEELRVPVPSPTQLRLLKQMVAAGFIDQVAARADLLYPDDAPLANRAALTGI
                     PYLPVLARYTRPISDAFVYVHSASVLATSSDLPPAYVVYHSLHRSATGTVRMRPLCDI
                     KSTPLANVARSGCLLTYSKPLITKGLRPHTVSAVERYCYVTPRFGAAADSDTKIGWDL
                     NPIPVHQKRTNGRWLTTKILTKAQLSAHTVSQ"
     gene            <840121..>841792
                     /locus_tag="AGOS_AFR223W"
                     /old_locus_tag="AFR223W"
                     /db_xref="GeneID:4622032"
     mRNA            join(<840121..840176,840244..>841792)
                     /locus_tag="AGOS_AFR223W"
                     /old_locus_tag="AFR223W"
                     /product="AFR223Wp"
                     /transcript_id="NM_211124.2"
                     /db_xref="GeneID:4622032"
     CDS             join(840121..840176,840244..841792)
                     /locus_tag="AGOS_AFR223W"
                     /old_locus_tag="AFR223W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR033W (RSC58); 1-intron"
                     /codon_start=1
                     /product="AFR223Wp"
                     /protein_id="NP_985770.2"
                     /db_xref="GeneID:4622032"
                     /translation="MEDSLKEEIFKDLYTILEAASSKCNVIDEKFPGEFFESEPTRIY
                     SSYVEFLRGRADADAQIDEQQLALTNIRQRFEEGEYARSKDGLYRLYHDVRLVSTMLI
                     QYYSPGTRSYQMVDKFYKFATELLLRECYKHGAMLVHAEPYVKSKEETEFFNIISKDF
                     IKISTSYTLPIVESYHISTKFGDLFSSTISSSPLDERPPDLPNSNFEVTKIIPHTGLH
                     LSNKLGFVAANTSNIPDPTLPPTEMMTKFLHPNWYALPTTLWLKYGGYESFAPTITEN
                     GSVVDSSRIGDIWLERTSYHELWKLRKGVRDGESNAMREEENGGKVGEPEATIEEVHD
                     KVEEADTTREEDNSVDKEKDESAGKEQEDKIDDSENIPEVPVTSTLSAALINGGTAQQ
                     HKNDAVSAVEPSEQQKTNTYTPKSVNVNLEHLYRWAPSNEIDDDELEAFRNNTHQQLI
                     SKCLLQLQQMKRSRIQAGKVSKPTSEETKIYFKIQRMLKEVILAQQAAEFPKIYIKEF
                     PVLQANYAGNIPVVRTYPNRKKKYKK"
     gene            complement(<842097..>843515)
                     /locus_tag="AGOS_AFR224C"
                     /old_locus_tag="AFR224C"
                     /db_xref="GeneID:4622033"
     mRNA            complement(<842097..>843515)
                     /locus_tag="AGOS_AFR224C"
                     /old_locus_tag="AFR224C"
                     /product="AFR224Cp"
                     /transcript_id="NM_211125.1"
                     /db_xref="GeneID:4622033"
     CDS             complement(842097..843515)
                     /locus_tag="AGOS_AFR224C"
                     /old_locus_tag="AFR224C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR034C (SMF3)"
                     /codon_start=1
                     /product="AFR224Cp"
                     /protein_id="NP_985771.1"
                     /db_xref="GeneID:4622033"
                     /translation="MELQRMMQYLRKLGHFIGPGIMVSVAYMDPGNYSTSVAGGAQYK
                     YHLLFSIFVSNIFAVVLQCLCVKLGTVTGRDLAENCRRHLPRKLNYVMYAFAEVAIIA
                     TDLAEVVGTAVALQILFGIPLIWGVLLTILDVLLILVFYRPEKQTMREVRMFEFFVSI
                     FVAGTMVCFVLELFKLSVPSKLELFRGFLPSPVLFKEQRAIFISLGILGATVMPHSLY
                     LGSALVKPRVQEYDIKKYGKLKESGPSLEAIKYTLNFSYAELIVSLFFIATFVNSAIL
                     IVAGATLFGEPEAEDADLISIYQLLCKTISPAAGLIFALAMLFSGQSAGVICTMAGQI
                     VSSGFLKWNLDPWIIRLVTRLIAIVPCFIVALFMGEKGISNILNLSQVVLSLILPIVS
                     APLIYFTSSKKIMTVVDHDGNEDDLDEPSERTNLVTIKKPFVDYSNDKWLAYVSVGIW
                     ALIGSLNCYLVVSFLLGADVQF"
     gene            <843964..>847863
                     /locus_tag="AGOS_AFR225W"
                     /old_locus_tag="AFR225W"
                     /db_xref="GeneID:4622034"
     mRNA            <843964..>847863
                     /locus_tag="AGOS_AFR225W"
                     /old_locus_tag="AFR225W"
                     /product="AFR225Wp"
                     /transcript_id="NM_211126.1"
                     /db_xref="GeneID:4622034"
     CDS             843964..847863
                     /locus_tag="AGOS_AFR225W"
                     /old_locus_tag="AFR225W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR129W (POM152)"
                     /codon_start=1
                     /product="AFR225Wp"
                     /protein_id="NP_985772.1"
                     /db_xref="GeneID:4622034"
                     /translation="MMGMKYRYDVPAEKRSWRDTMQHNEKLYRKSSSFDADSLLRSQA
                     TSQEEVTEKEETVERTEVDVKTVIASEKVTEQMGAVRERPLISTEVLDVPSQRALAFS
                     LFLIIQTYKLYDLVLLKSGLPVSGVLLTNSKFNFISKYAIVDSLFLYFLPSFKIPKLR
                     FRPIVTFLQILLAVALTILLSNDTNIPLISLLVSAWGRYNTKELSLTGASVNHRKIMD
                     TSSHFKGAHTIKILPENTVMFNPFHESFCLPMEMAITDLKVPIRINSTSEISFLQLEH
                     HDIYTNEIQLLNFTRKELSKMNVKSEPDPQILYLQVPLERVGFYQLKKIVDTNNFGLR
                     IYKPQVIVSHCPMATVGGIGSKDKCIGDQDTVTIQVTGVPPMKLKYTKTINNEDFNFV
                     DSSLQPEYFESPLLSNKKTFSRADIADLKWARTYPVDITLESFINSDGVYSYAIDEVV
                     DGLGNVMDFKALSPEVLEKYELEHTFHAHDLPRASLDEKINPNSGTKRSLLLHVESSS
                     AQQDVPYLAAINYEHNNERSTLEYEFTDQNAEIFIENPGAYTLTSIRSKYCSGAILGK
                     STIVVTKPIPPQLSVKSTPILDQCIGQVGLNFDLTFTGVPPFYYTAKIYKQENGQLRL
                     HEKKDFKSQGTRNQYSYNPTTEGHYEIVFDAISNTLFKDPIPLLPASDYTFNTSMRVK
                     ANAVINTKYDSTLCLGDRSKIPVKFTGEPPFNLDYDIVETSSNKRISYHLEKVTSYHY
                     DIQTPPFNVGGDYILSLISVKDSSGCLVPLSGNDARINVRRDIPTAAFSLANSTTNEL
                     KIKEGSTAFLPLRLSGEQPFTVRYQHISKDGTASGTYESKFQSNYRPVLKVNQEGSYR
                     LLSMKDHSCDGNVESELMPKVSFFEKPTFSVVEHNKIAKLNSFNFAKEPVCQGFEETV
                     DLSLVGSAPFTVMYELTSPNGQITSKSIQVATKYASLKLPNDHQGEYILTVKAVYDSY
                     YTQHDLQGKPLRSAEVTIRQTVNPLPTVRFADRGKTYRTCSANVDQPYLLDAIPLHIS
                     GGKGPYSISFSIYHESTSKTDFLTLDNVTLDSFDYTQLYHGLKLGNHIVSIEKVVDKN
                     GCINDAIMENNHVLISITDVPKIVLMDPTMEYCVGDYVSYQLNGVAPFLIKYEFNGVQ
                     LRSKEQTSQFVRFASEPGMISINSIQDSSSHCVIDFSNPALKAEFERLSLLVHPIPSV
                     TVSQGDNVIEDIHEGDQAEVIFTFEGTPPFSLTYVRTEEVDGRKGRRPQIVETHKVTD
                     IYSYEYRVSTSLQGTYEAIEVADAFCSAKNDAFFNNY"
     gene            complement(<848029..>850143)
                     /locus_tag="AGOS_AFR226C"
                     /old_locus_tag="AFR226C"
                     /db_xref="GeneID:4622035"
     mRNA            complement(<848029..>850143)
                     /locus_tag="AGOS_AFR226C"
                     /old_locus_tag="AFR226C"
                     /product="AFR226Cp"
                     /transcript_id="NM_211127.1"
                     /db_xref="GeneID:4622035"
     CDS             complement(848029..850143)
                     /locus_tag="AGOS_AFR226C"
                     /old_locus_tag="AFR226C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YLR035C (MLH2)"
                     /codon_start=1
                     /product="AFR226Cp"
                     /protein_id="NP_985773.1"
                     /db_xref="GeneID:4622035"
                     /translation="MGIHRIEDESKWKVVSASFIYSPTTAVKELLDNAIDAGASNVHI
                     EVDSKTGGCDYISVRDDGNGVGVVDRHMMCLNHTTSKLRKYEDVSTCGTLGFRGEALF
                     MLATLSNHCGTMEVSTRCKSERMGTRWQVDGSGEVKEGSTSSVPMPVGTTVTIRKLLH
                     GLRARHVTISSRPRKSLDDISQLVLQYTLVFRRIRFHFYLVSLDRADFVCQRKLQLNV
                     DPKLSLLRVLGLQARIRKLSGNLHEFGPVPVTDTLSARGVLPSMTRGAEVTQTKKTIK
                     AVALNRRPMSLSLSLGSAVNKMLNKTYRSYSLPDPTIWMVELECDPHLVDVNIEPTKD
                     DAAISSLATLIQCLQDALEPIIIRLHRIDRDGESVSRTDDPQSTLLDDDDNDDIFEIL
                     ATSERRRKLPSSCFMKQEPGSDKTHELHLNITESQQGTLQASTEAELIDRNQQKPVEE
                     WGPTDFEDSLNSDIQSTSNPISVLAYRYDETSHDDSVAFPRNISLSNPFHMSKLKSGW
                     NTSLDSSTDGSILDSAASQTSRSDLHSSYGNSSTTNPTSDAQSPQITYNAGTKRKASG
                     SESKRNARPTKMKTTNRRPTQREERELLKLQYSSTGPSEENVPIQKDKIKPTKDRRRN
                     LNMFSEYTNNFISRVHYDRNNIVLQKHSKLTYKKELTWIFRKGDPALSLIDFVQQKAE
                     EIDNNVDLKLEQTSKGWYVVGI"
     gene            <850302..>851170
                     /locus_tag="AGOS_AFR227W"
                     /old_locus_tag="AFR227W"
                     /db_xref="GeneID:4622036"
     mRNA            join(<850302..850482,850536..>851170)
                     /locus_tag="AGOS_AFR227W"
                     /old_locus_tag="AFR227W"
                     /product="AFR227Wp"
                     /transcript_id="NM_211128.2"
                     /db_xref="GeneID:4622036"
     CDS             join(850302..850482,850536..851170)
                     /locus_tag="AGOS_AFR227W"
                     /old_locus_tag="AFR227W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YMR130W; 1-intron"
                     /codon_start=1
                     /product="AFR227Wp"
                     /protein_id="NP_985774.2"
                     /db_xref="GeneID:4622036"
                     /translation="MSRGVLLEALARNRQPKVITFDAYNCLFSTRLPVAEQYSAVGRR
                     HGVDVAPSVLAARFPAVFRETSARHPDYGKYTGLSVQGWWTLVIQRLFKPAEVGEKMV
                     AEILQRFQGHGAYKVFPDALWLLEELRVRRPEVVVGVLSNSDPTMRQVLLNLGLGSYF
                     TDAIYLSYDLGAKKPERRAFDAALERILERNPQLLGDLGAEELRAACWHVGDEKSADL
                     CGATGAGWNGILVDRQDIYGQLGQGSAVALGLNQFVVPDFYTVGKLFGLAYNI"
     gene            complement(851205..851277)
                     /locus_tag="AGOS_t0153"
                     /db_xref="GeneID:4622037"
     tRNA            complement(851205..851277)
                     /locus_tag="AGOS_t0153"
                     /product="tRNA-Ala"
                     /codon_recognized="GCA"
                     /db_xref="GeneID:4622037"
     gene            <852357..>854087
                     /locus_tag="AGOS_AFR228W"
                     /old_locus_tag="AFR228W"
                     /db_xref="GeneID:4622038"
     mRNA            <852357..>854087
                     /locus_tag="AGOS_AFR228W"
                     /old_locus_tag="AFR228W"
                     /product="AFR228Wp"
                     /transcript_id="NM_211129.1"
                     /db_xref="GeneID:4622038"
     CDS             852357..854087
                     /locus_tag="AGOS_AFR228W"
                     /old_locus_tag="AFR228W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKR093W (PTR2)"
                     /codon_start=1
                     /product="AFR228Wp"
                     /protein_id="NP_985775.1"
                     /db_xref="GeneID:4622038"
                     /translation="MNEEKETAKVNFVQDLEKEKYITETETLQIPTEHEELTLRRIVT
                     SPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGALGKG
                     LAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALPSV
                     LAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRD
                     ASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQEDI
                     KTNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAG
                     FYDEKYVYDTKLTISACTIFLYYVIYQMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNP
                     ISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPC
                     GYMGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGFVL
                     ALFMFTVAISSAIILPITPFFKDPYLIQPFAVCAGVGALTAIIFLWRYWDLDKQMKLE
                     RELSSPENSS"
     gene            complement(<854462..>856069)
                     /locus_tag="AGOS_AFR229C"
                     /old_locus_tag="AFR229C"
                     /db_xref="GeneID:4622039"
     mRNA            complement(<854462..>856069)
                     /locus_tag="AGOS_AFR229C"
                     /old_locus_tag="AFR229C"
                     /product="AFR229Cp"
                     /transcript_id="NM_211130.1"
                     /db_xref="GeneID:4622039"
     CDS             complement(854462..856069)
                     /locus_tag="AGOS_AFR229C"
                     /old_locus_tag="AFR229C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YIL166C, YOL163W and YOL162W; YOL162W and YOL163W
                     represent one ORF in this genome"
                     /codon_start=1
                     /product="AFR229Cp"
                     /protein_id="NP_985776.1"
                     /db_xref="GeneID:4622039"
                     /translation="MESTRGLNKDNFDVWSEVSSREATKLNPFDDPFVADYYRKVYED
                     AKYECRKAFDPQLTWTHEEERKLVRKLDLRVALTSCVLFAALQIDRGNLGQAVADNML
                     DDIKMNTNDYNLGNQLFYVFFLLAEVPSQLISKKLGPDIFIPIQMVAWSVVAMSQAAL
                     SNKTGYLITRSVIGLLEGGFIADLVLWLSYFYTATELPIRLSFFWTTMSLVEVCTSLL
                     AFLLFRLRGIAGLTGWQWLFLLEGLLTLIIGLSGFYLMVPSAVQTKNMLHPQGWFTER
                     EELIVVNRVLRDDPSKGDMHNRQALTPKLIWQALTDYDLWPIYVIGLVHYLPDGTVSP
                     YLTLTLKSVGFSKFTVQLLAIPRSIIFIIFLLGITRFSEKISQRALLGLIPSVWNTTL
                     LGLLRWWSGSLVKAWPTYTILTLLLGAPYIHAICVSWASRNSNSIKTRAISAAVYNMF
                     VQMGSIISNQLYREDDAPLYHRGNEILFWIMATNIPLFILVKLYYMHRNKSRDKKWNS
                     MTECQQRAYIVNTTDKGNKRLDFRFAH"
     gene            complement(<856877..>858691)
                     /locus_tag="AGOS_AFR230C"
                     /old_locus_tag="AFR230C"
                     /db_xref="GeneID:4622040"
     mRNA            complement(<856877..>858691)
                     /locus_tag="AGOS_AFR230C"
                     /old_locus_tag="AFR230C"
                     /product="AFR230Cp"
                     /transcript_id="NM_211131.1"
                     /db_xref="GeneID:4622040"
     CDS             complement(856877..858691)
                     /locus_tag="AGOS_AFR230C"
                     /old_locus_tag="AFR230C"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKR039W (GAP1)"
                     /codon_start=1
                     /product="AFR230Cp"
                     /protein_id="NP_985777.1"
                     /db_xref="GeneID:4622040"
                     /translation="MAKQAGTPDDDVEDIEKSFYVSGKEQARVSTDLAVDEPISVQPE
                     PRKGWNGFVDTFRRAEMPVIDPNLSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIG
                     VGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFI
                     DESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKLAFVALFWVVIVSINLF
                     GVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPS
                     DKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLI
                     VGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVY
                     SSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLL
                     AISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFIGSCYAVGLICVVLV
                     AQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSRNWKFFIKAKEMD
                     IDTGRRELDLELFKEELAQERALLAQKPFIIRVFNFWC"
     gene            <859344..>860411
                     /locus_tag="AGOS_AFR231W"
                     /old_locus_tag="AFR231W"
                     /db_xref="GeneID:4622041"
     mRNA            <859344..>860411
                     /locus_tag="AGOS_AFR231W"
                     /old_locus_tag="AFR231W"
                     /product="AFR231Wp"
                     /transcript_id="NM_211132.1"
                     /db_xref="GeneID:4622041"
     CDS             859344..860411
                     /locus_tag="AGOS_AFR231W"
                     /old_locus_tag="AFR231W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL222C (EDC1) and YER035W (EDC2)"
                     /codon_start=1
                     /product="AFR231Wp"
                     /protein_id="NP_985778.1"
                     /db_xref="GeneID:4622041"
                     /translation="MSSDTMFINSARLLPTENRKVKQLQRPDRKKHTRGSYAAQKQQL
                     PNGEQPNFGHGQKQSRKRGSGRQKGRDGAAGDSANVGLTEDLKQLLSIPSGSAGSESA
                     QKETSAGQPATGAVADRKRSVPAGGPAGKSSSEPASASSAVDGMPGLGFQSAHVPFSS
                     PVVNHPMLAEPAATGPVLSVPFPGHVAGYMPCVNNTRVQYPLQTRNNVPMSQPMSQPM
                     SQPMSQPMSQPMSQPISPYLPQGFQMHPQSFVGLPVAPMYPQYMSAQYQSPKQQSACQ
                     MPLRAQPPLIPSITRNALPCVSSANSTAKASVRSKGSPGSEGGSRRSQNWKSSQNVGY
                     AGATFATDQPALSSLPKPSFV"
     gene            complement(<861077..>862900)
                     /locus_tag="AGOS_AFR232C"
                     /old_locus_tag="AFR232C"
                     /db_xref="GeneID:4622042"
     mRNA            complement(<861077..>862900)
                     /locus_tag="AGOS_AFR232C"
                     /old_locus_tag="AFR232C"
                     /product="AFR232Cp"
                     /transcript_id="NM_211133.2"
                     /db_xref="GeneID:4622042"
     CDS             complement(861077..862900)
                     /locus_tag="AGOS_AFR232C"
                     /old_locus_tag="AFR232C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER036C (ARB1)"
                     /codon_start=1
                     /product="AFR232Cp"
                     /protein_id="NP_985779.2"
                     /db_xref="GeneID:4622042"
                     /translation="MPPVSTSKAKREAKKAERDAKRAASGKPTTARRTKKKDGDDADL
                     AADEIAKLKLQQDKDGISDRVVTGVLDSLETSRDVKMSSVSLLFHGKVLIQDSQLELN
                     YGRRYGLLGENGCGKSTFLKAIASREYPIPENIDVYLLDEPAEPSEYSALEYVVREAQ
                     NELKRLEDLVEKILLEDGPESELLDPLYEKMDSMDPSTFESRAAIILIGLGFNAKTIN
                     KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLV
                     SHSQDFLNGVCTNMLDMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIK
                     KFIASAGTYANLVKQAKSRQKILDKMEADGLIQAVVADRVFSFRFPEVERLPPPVLAF
                     DEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRVS
                     RHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLGRYGLTGEAQTA
                     QMATLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAIDAFNGGVVVVS
                     HDFRLLDRIAKDIYVVENKTATRWDGSILDYKNKLAKNVVL"
     gene            <863137..>864264
                     /locus_tag="AGOS_AFR233W"
                     /old_locus_tag="AFR233W"
                     /db_xref="GeneID:4622043"
     mRNA            <863137..>864264
                     /locus_tag="AGOS_AFR233W"
                     /old_locus_tag="AFR233W"
                     /product="AFR233Wp"
                     /transcript_id="NM_211134.3"
                     /db_xref="GeneID:4622043"
     CDS             863137..864264
                     /locus_tag="AGOS_AFR233W"
                     /old_locus_tag="AFR233W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL223C (COG1)"
                     /codon_start=1
                     /product="AFR233Wp"
                     /protein_id="NP_985780.3"
                     /db_xref="GeneID:4622043"
                     /translation="MAATTEELFTTCSIAGVRDTKLQLSQQLARSREQLNHQLQASYG
                     EILHVCGQVTELYQASREVDGKFMDLCFNDPDYKLGQLQEVWQEDVARGFRLSSGPRG
                     VEESLQNTEELLELGQWSASISAFERSPGPATLELLLEHFRVVAARTQARTALVSRGC
                     RKLEAFLVEGVPRALGTNLYIDLYELLEAFPHHAFGTAVLNAILDCLLVDHRDVLADK
                     SRQVQLFIKRPEFVAGIRQKLRRDLDAELSRCRAACTRTDEPAFSPYDCSAMDTDTAR
                     FVFDLVYYDKGLTTAARVEIAECIDNAIAMLTELKNFETDGAVLDNLRDNWRLLLRKE
                     LDGYPPSADTPATADVVDEIVATYTTDRYRSLLEDKLQLLE"
     gene            <864468..>865316
                     /locus_tag="AGOS_AFR234W"
                     /old_locus_tag="AFR234W"
                     /db_xref="GeneID:4622044"
     mRNA            <864468..>865316
                     /locus_tag="AGOS_AFR234W"
                     /old_locus_tag="AFR234W"
                     /product="AFR234Wp"
                     /transcript_id="NM_211135.2"
                     /db_xref="GeneID:4622044"
     CDS             864468..865316
                     /locus_tag="AGOS_AFR234W"
                     /old_locus_tag="AFR234W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL224C (SDT1) and YER037W (PHM8)"
                     /codon_start=1
                     /product="AFR234Wp"
                     /protein_id="NP_985781.2"
                     /db_xref="GeneID:4622044"
                     /translation="MAPTFGVTHAMQLKQYQEQVAQQLLENTKHLESLTHPGSKVHFP
                     VDVETFPEPDMRLRVFFFDIDNCLYKRSTKIHDLMQVSIQQYFKHQLCLGDDEARELN
                     HTYYRQYGLAIRGLVKHHQIDALDYNRMVDDALPLQNILQPDPELREMLLRLRTSGKV
                     DKLWLFTNAYKNHGLRCVRLLGIADLFDGITYCDYSKEDLICKPDPLAFDKARRESGL
                     GAYSNAYFVDDSGNNIRTSLELGILNCAHVVEREVDEDLGNSPRGCKIISQITDIPEA
                     FPELFA"
     gene            complement(<865381..>866622)
                     /locus_tag="AGOS_AFR235C"
                     /old_locus_tag="AFR235C"
                     /db_xref="GeneID:4622045"
     mRNA            complement(<865381..>866622)
                     /locus_tag="AGOS_AFR235C"
                     /old_locus_tag="AFR235C"
                     /product="AFR235Cp"
                     /transcript_id="NM_211136.1"
                     /db_xref="GeneID:4622045"
     CDS             complement(865381..866622)
                     /locus_tag="AGOS_AFR235C"
                     /old_locus_tag="AFR235C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER038C (KRE29)"
                     /codon_start=1
                     /product="AFR235Cp"
                     /protein_id="NP_985782.1"
                     /db_xref="GeneID:4622045"
                     /translation="MNAEQGDFVDDSQDEDDQIIPVGLSESDASEVHNMINSDLSDAI
                     SSLDDERDSDWENGTGEEFENSVANDPILNKVISSRVHESTPVPPINREVGAREATLE
                     QIRASQMREQIDRSLIDNIEKLERLQKQINSSPEKPWLRSTDVVEERRQAISAKIVNP
                     VPKRLLEYLARDRVGSNKDWYFLTHNAIYQEPTLTELFLGSRPLLSIRDLYLQFGASE
                     DALDAEFKILECNSYEQLNNRAPLELMCYEIERHIPFSANDQLELSLRYFILFILDRK
                     VFDCVELDTEWCATLWEKHKAIDRIAVYLSVVPKDCYFLHYRATRLLPLKDELLCKLF
                     IGSQPQEVIKQFDTLLENDDWFQILYFMLLVNGLPDYPLGGIRIWQYFKDRIYDMNID
                     NVSSIELSLLKSYVNMCTSYK"
     gene            complement(<866864..>867853)
                     /locus_tag="AGOS_AFR236C"
                     /old_locus_tag="AFR236C"
                     /db_xref="GeneID:4622046"
     mRNA            complement(<866864..>867853)
                     /locus_tag="AGOS_AFR236C"
                     /old_locus_tag="AFR236C"
                     /product="AFR236Cp"
                     /transcript_id="NM_211137.2"
                     /db_xref="GeneID:4622046"
     CDS             complement(866864..867853)
                     /locus_tag="AGOS_AFR236C"
                     /old_locus_tag="AFR236C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL225W (VRG4), YER039C (HVG1) and YER039C-A; YER039C and
                     YER039C-A represent one ORF in this genome"
                     /codon_start=1
                     /product="AFR236Cp"
                     /protein_id="NP_985783.2"
                     /db_xref="GeneID:4622046"
                     /translation="MSELKVDTGRLSHIANSGPMSILAYCASSILMTVTNKCVVGSDK
                     FNMLFVMLFAQSLVCVTALVLLKALGYVQYRPLNKVDVKNWLLISVLLVLMTYTSSRA
                     LKYLAVPIYTIFKNLTIILIAYGEVLFFGGRVTAMELSSFLLIVLSSVVATLGDQQAL
                     AKKPLAAAVESILGLNVGYFWMFTNCICSALFVLIMRKRIALTKFKDFDTMFYNNILS
                     LPLLMLASFMFEDWGAANIARNLTKDYIIIMIISGLASVGISYCSGWCVRVTSSTTYS
                     MVGALNKLPIALSGLLFFDAPKNFLSIFSIFLGFLSGIVYAVAKQKKQSQPAN"
     gene            <868261..>870684
                     /locus_tag="AGOS_AFR237W"
                     /old_locus_tag="AFR237W"
                     /db_xref="GeneID:4622047"
     mRNA            <868261..>870684
                     /locus_tag="AGOS_AFR237W"
                     /old_locus_tag="AFR237W"
                     /product="AFR237Wp"
                     /transcript_id="NM_211139.2"
                     /db_xref="GeneID:4622047"
     CDS             868261..870684
                     /locus_tag="AGOS_AFR237W"
                     /old_locus_tag="AFR237W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER040W (GLN3)"
                     /codon_start=1
                     /product="AFR237Wp"
                     /protein_id="NP_985784.2"
                     /db_xref="GeneID:4622047"
                     /translation="MKEADTVEANSDGQQVDEKVGERTFCRDEVGRGVPQVGQFDSML
                     EMLPEDMGDAPFGLWANGGESGEEAAGGLGSAYHEKNDMGFSFGGLGPVAGGEGTQPI
                     DILPAAGRNNYLNLQNGEIDQLWHFNVDEFMMTPSEQSGMSDGATISQPNSFTSDAAL
                     GMPGSQLVPSDVQDGVPFLADARPMQRRSSASVGQGDRAWDGVFMSGQALRPGYEHDM
                     GFFSPAIFTNGARILDGRATMQDNLQVQDSGPGDLNAVPRPLAAPKRPPGHLKTNSIA
                     EDGHIPLSSHTTTNAIKKTQLTRQPSSSSLSSYRKGPQNNASSADGCTKPQTQCFNCK
                     TFKTPLWRRDLQGNTLCNACGLFQKLHGTMRPLSLKSDVIKKRNTKKRARKAEQDAQK
                     AANSVIPRKVSGSLQRGATDYSNGAGLENGRTHNELQAMKYPSRRVYGSPTKVGNVQS
                     GHTGMDFAGGRHYRKSSQEVPFFPVNETYRLNSSDLMKHNSRMASSSQNGTRKSRQGS
                     ASSSTSSKSSSRQVVPILPKPSSLDTTIPHQSLSSTMSLSNLQTYNSTMNSTASSPRY
                     MNSPRGSNGAILSATSPIQSSGMLSTSAGCGSATITIPRKNSSRGVSQSLSFMAQSLQ
                     QLQNQNSNTLSSSAQQTLPVSNVAGSVSPQHQTSKSPSSPDLFSDQSSRDPMCTESKS
                     HTSLLSQQLQQNHGHNGLKPAQPQFQSPDTPAAVPSHKSMLVSTAVSPALPFQAVNAT
                     VSPRHSYAVSMQQQRGVLTHDQQIKRSSSLSPMNGDAANPARHQKSASGTRIKESVME
                     DLDWLKFSI"
     gene            <871119..>873215
                     /locus_tag="AGOS_AFR238W"
                     /old_locus_tag="AFR238W"
                     /db_xref="GeneID:4622048"
     mRNA            <871119..>873215
                     /locus_tag="AGOS_AFR238W"
                     /old_locus_tag="AFR238W"
                     /product="AFR238Wp"
                     /transcript_id="NM_211140.1"
                     /db_xref="GeneID:4622048"
     CDS             871119..873215
                     /locus_tag="AGOS_AFR238W"
                     /old_locus_tag="AFR238W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER041W (YEN1)"
                     /codon_start=1
                     /product="AFR238Wp"
                     /protein_id="NP_985785.1"
                     /db_xref="GeneID:4622048"
                     /translation="MGSSELWDIIKHYTKPERLPFRCFVANFKKEHGRSPKIAVDAFQ
                     WLFECGFLFNVQQEERSTSAVWPAPRKAILNFVTKLRDLISLDLDFVLVFDGDEKPIY
                     KQHYWKKRGTGQQTEARYSPRGRSPQLPHQLHSVVDLAGGICRAFNVDYITAAGEGEA
                     ECAALQVAGSVDYILTNDSDAAIFGASRILRNFSKHAQDLPSSGVSPVKKHVSEYFVT
                     VVDIRAATEEHPTFSRKAFALFAILTGADYGTGLQHLGYKRAWALTQWSNGRFANHFW
                     NMCSTIPEDAGVDPPQYVTFKTVLLEACRMHTKDIFGQDLKYFQKDHASDTIWWPPVG
                     VLQSYYNPKVTRKDFRKSLFVRGASNSATGPFVTLKSAYSTLTTMRIPSLLKDFDSWY
                     HFLVHNSALLKHLLYDDIKNTAKITEEKVLEVHSVLIPLWRVRYRSFLSDVPSPPVPS
                     QGVSPRKRSPSRRQLDIETFPYAMWIAQGLLPRTHRLVEEFKTDAARVQKSPTKVGLL
                     TRSPQKRTLDDYLDQSSSPVKRQKPTTGSETPIITLDSDDSSYEFSETSVVAPTLTPL
                     WRPFSRDVSGSTEQRPSIADVTALACLREPARLKAWFAAGFERAEGSEVHQSILWRRY
                     REFLLATTGSTDTILDYHDLPVLLETVIPGVNVRAGDRTGRVFCGVRSHTGCVSPNQG
                     TTNARRRLSFDSFAQD"
     gene            <873368..>873937
                     /locus_tag="AGOS_AFR239W"
                     /old_locus_tag="AFR239W"
                     /db_xref="GeneID:4622049"
     mRNA            <873368..>873937
                     /locus_tag="AGOS_AFR239W"
                     /old_locus_tag="AFR239W"
                     /product="AFR239Wp"
                     /transcript_id="NM_211141.2"
                     /db_xref="GeneID:4622049"
     CDS             873368..873937
                     /locus_tag="AGOS_AFR239W"
                     /old_locus_tag="AFR239W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER042W (MXR1)"
                     /codon_start=1
                     /product="AFR239Wp"
                     /protein_id="NP_985786.2"
                     /db_xref="GeneID:4622049"
                     /translation="MTFDTPPPAAPVSPSLKFSPQKHKLLTLAAGCFWGTEHMLRKHL
                     GHKIVDLVAGYANGNVPTDTKGVTYERVCVGNTNFAEVVQVAFDPEVLGLSELCDFFF
                     RMHDPTTLNAQGPDVGTQYRSALYAHSDEDLSQVRQILERWQPRWANCIKTEVALAES
                     FYDAEEYHQRYLTNNPTGYQCPTHYLRNV"
     gene            complement(<873973..>874383)
                     /locus_tag="AGOS_AFR240C"
                     /old_locus_tag="AFR240C"
                     /db_xref="GeneID:4622050"
     mRNA            complement(<873973..>874383)
                     /locus_tag="AGOS_AFR240C"
                     /old_locus_tag="AFR240C"
                     /product="AFR240Cp"
                     /transcript_id="NM_211142.1"
                     /db_xref="GeneID:4622050"
     CDS             complement(873973..874383)
                     /locus_tag="AGOS_AFR240C"
                     /old_locus_tag="AFR240C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL226W (MTC3)"
                     /codon_start=1
                     /product="AFR240Cp"
                     /protein_id="NP_985787.1"
                     /db_xref="GeneID:4622050"
                     /translation="MLAAIRRPLATRQLLLRHASTEAYTPPEYRDLNAQTWAKLSEPV
                     REELIEYFAWRMEDRWHTISRDEARAAYFIGYGTWGPRAAKGNPTQQPPAGELVGRAI
                     FSLVLFSALGVAAFNHVTDKRVHAALARLEVSDV"
     gene            <874502..>874819
                     /locus_tag="AGOS_AFR241W"
                     /old_locus_tag="AFR241W"
                     /db_xref="GeneID:4622051"
     mRNA            join(<874502..874522,874580..>874819)
                     /locus_tag="AGOS_AFR241W"
                     /old_locus_tag="AFR241W"
                     /product="AFR241Wp"
                     /transcript_id="NM_211143.2"
                     /db_xref="GeneID:4622051"
     CDS             join(874502..874522,874580..874819)
                     /locus_tag="AGOS_AFR241W"
                     /old_locus_tag="AFR241W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL226C-A (OST5); 1-intron"
                     /codon_start=1
                     /product="AFR241Wp"
                     /protein_id="NP_985788.2"
                     /db_xref="GeneID:4622051"
                     /translation="MSYEKLYKQFQNGADFSPMVPLEKQPYYGATALVISMLCILGAI
                     VSANRSKGLAVPLLIFIPLGLVGSLLFGLASIFLANSFGVYV"
     gene            complement(<874940..>877411)
                     /locus_tag="AGOS_AFR242C"
                     /old_locus_tag="AFR242C"
                     /db_xref="GeneID:4622052"
     mRNA            complement(<874940..>877411)
                     /locus_tag="AGOS_AFR242C"
                     /old_locus_tag="AFR242C"
                     /product="AFR242Cp"
                     /transcript_id="NM_211144.1"
                     /db_xref="GeneID:4622052"
     CDS             complement(874940..877411)
                     /locus_tag="AGOS_AFR242C"
                     /old_locus_tag="AFR242C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL227W (VID30)"
                     /codon_start=1
                     /product="AFR242Cp"
                     /protein_id="NP_985789.1"
                     /db_xref="GeneID:4622052"
                     /translation="MSLFMDEIDHQYVKALFPHYLLEQPMAYELWKLYFQHKKLFNKL
                     KLKRRVIPNYTENGETELYRRSTKLTYATRKVIWEKLSQLGVLGIIPYDSATDEYLVQ
                     VYKYFYTTHNDRLAGGDRLLREGEATGGTAGRDEDVAMEERGEDYDEEDADDYEQSSD
                     ALPSDSDESALVVQPTQSVEPDHGAELDGGADVEAFYPAITDSKHSTKRKGNPLFSDV
                     YSSIGYPLPHLWTTQSNNSVLVSTDGFTNLRPNPNWQLYSGYDNSPIVNNRLRTSVNN
                     QKQQWASTWANACINHKKVAIFYYEIKVLSVTSAQSGQTCNINIGFKDWSKVASNAGE
                     ANTSDPPSRDPGEFSALNRQTSNILRGPFEGSRPTSQQSSTGKDVYIYNGSDGYINDG
                     SLFKSYSKPYGRDDVIGCGINYVDGTIFFTKNGIHLGTAFKDVAHLDLVPYVSLKPAN
                     SIRTNFGLYEEFLFDIVGYQNHWKAKAYHNIFTAISGGEESDFGFEDDDESEENAGDH
                     LDADVQMNDTNAGVGQDYDDINNSTLERNQQESHTDGFLLSWDTRFSGGQLYKPDKDK
                     INNISGTDDSIPCTLNTMINDYLIHHGLIDVAKGFLKDLQKDCIPNNNEERTRSVIRH
                     HERQIKREEENLKIRQDIRLLIKDGDIPRCIKYIDSKFPGLLTKHVELAFEFKVAEYL
                     LAIMKLEQVTIDYVLQKGLEISNEFIYNEKLSQELRQKFKAHFGDISALMAYDNPLVE
                     CPKELAVYLTPSYLQDRLFQLVNTTILMFLKKKSESSLENMISYTRAMVNTLMEYGDQ
                     PGSSNSDSQERYYKLVNIDEDLLNL"
     gene            complement(<877768..>879117)
                     /locus_tag="AGOS_AFR243C"
                     /old_locus_tag="AFR243C"
                     /db_xref="GeneID:4622053"
     mRNA            complement(<877768..>879117)
                     /locus_tag="AGOS_AFR243C"
                     /old_locus_tag="AFR243C"
                     /product="AFR243Cp"
                     /transcript_id="NM_211145.1"
                     /db_xref="GeneID:4622053"
     CDS             complement(877768..879117)
                     /locus_tag="AGOS_AFR243C"
                     /old_locus_tag="AFR243C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YER043C (SAH1)"
                     /codon_start=1
                     /product="AFR243Cp"
                     /protein_id="NP_985790.1"
                     /db_xref="GeneID:4622053"
                     /translation="MSIPAQNYKVADLSLAAFGRKEIELSEHEMPGLMAIRKAYGDAQ
                     PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFA
                     WKGETEEEYLWCIEQQLFAFKDGKKLNLILDDGGDLTTLVHEKYPEMLDDCFGVSEET
                     TTGVHHLYRMLKEGKLKVPAINVNDSVTKSKFDNLYGCRESLVDGLKRATDVMLAGKV
                     AVVAGYGDVGKGCAAALRGMGARVIVTEIDPINALQAAMEGYQVTTMDQCASYGQVFV
                     TTTGCRDIIKKEHFLAMPEDAIVCNIGHFDIEIDVAWLKANAVEAVNIKPQVDRYLLS
                     SGRHVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDEAFRQKYIEFQK
                     TGPFDIGVHVLPKILDEAVAKFHLDKLGVKLTKLSSTQSEYLGIPEEGPFKADHYRY"
     gene            complement(<879457..>881175)
                     /locus_tag="AGOS_AFR244C"
                     /old_locus_tag="AFR244C"
                     /db_xref="GeneID:4622054"
     mRNA            complement(<879457..>881175)
                     /locus_tag="AGOS_AFR244C"
                     /old_locus_tag="AFR244C"
                     /product="AFR244Cp"
                     /transcript_id="NM_211146.1"
                     /db_xref="GeneID:4622054"
     CDS             complement(879457..881175)
                     /locus_tag="AGOS_AFR244C"
                     /old_locus_tag="AFR244C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL228W (SHE10) and YFR039C"
                     /codon_start=1
                     /product="AFR244Cp"
                     /protein_id="NP_985791.1"
                     /db_xref="GeneID:4622054"
                     /translation="MRAISKLFVFTVLVLGSLQYYCGRYGACPAQIAVISHYTWPCTY
                     APAVRDKLGKASEWYGANAAPHVSVASGWMQGKVMPHLTKVSQWTEKHVQPRMRQAGA
                     DAIVTARVAWNVVQQYQRRHVVPLTGRLLAKCPCLERWAEQAARGWQWLCKHARALAT
                     AVQQQYPAFVAHMGGIWEPLHGAYNRIYLDLGRPVQEKTSEDASAAPGGTQYITSTIT
                     MTMTSLDELVTVTAEDGLSDVVEASFKDLVADEFSAWQQAIERKADSVLQAFTEEVGE
                     FEMQQHEAVAPKFRALLKHISAKSQEHYAKINQAIRDINSTMELDPATNQTIWFDAHG
                     TQLHQYITRPLMREYFSQANDELANITNHIRAELREVVDSVNGQVDVIRQEHIEVYEE
                     WADVMVSEWSRRMAYIDVVDRDLEAEAERNRNWKRFLKLKKRVIKVRDQLLEHPVKFN
                     QLETFLKEIQSTLRILAQENGEYLYILRSKANLSFQEREKNDRLREQHEQEAREMTLR
                     EQLSTELAANGTEVIIDTFEVDLDQLLRSNSTSWSVPPADARAEPASGSPIQQAASEA
                     AQQPSV"
     gene            <881718..>884417
                     /locus_tag="AGOS_AFR245W"
                     /old_locus_tag="AFR245W"
                     /db_xref="GeneID:4622055"
     mRNA            <881718..>884417
                     /locus_tag="AGOS_AFR245W"
                     /old_locus_tag="AFR245W"
                     /product="AFR245Wp"
                     /transcript_id="NM_211147.2"
                     /db_xref="GeneID:4622055"
     CDS             881718..884417
                     /locus_tag="AGOS_AFR245W"
                     /old_locus_tag="AFR245W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR040W (SAP155) and YGL229C (SAP4)"
                     /codon_start=1
                     /product="AFR245Wp"
                     /protein_id="NP_985792.2"
                     /db_xref="GeneID:4622055"
                     /translation="MSFWPFGQNVNNSNINRILDDYFRVLHSLEEDGAGESGEREAGG
                     GPAAPAAGRIVKERSTNGGGASGGARDSLQRTEGGDAMRPVYHNPNSSEQGTVSSAPC
                     VPSALSSAVSICTEELADSDEAPLTKFSLNYSFIDSILKESELLNELTRQNNTLLDFV
                     CFGFFYDTDGNKIDNIEYLIDQLMFCIDRVNEEQKENDETRTPGHEQENEQHDDFLPP
                     QQAGFLEGQDSEFIKKGVSPEPPSHEGDDAILPFLHGRRDTRQSSLLNRVNTISEIFA
                     LDIWLISESLVKDPSHLSKIWSVLNHKDFKAEKSPLVPIFLKINQNLLLTRQDQLLNF
                     IRARESLVDEFLQHLEISVLMDFFLKIISTDKQESPTGIIELVYDQGLIPKMLSFLDN
                     HKYSADIQACAGDLMKALISISTNAPLDELSIGPNALTRQLCSEESIDCFLDAIINKR
                     GHALTTAVSVVIELIRKNNSDYDQINLLCTSVKTHPPSTRDPIYLGRMLKKFAEKLPN
                     FKRVLLEIENDGSIKDIRNQLGIEYKPLGFERFKIVELIAELLHCSNMGLMNSKKAER
                     IVKERDEVRNHMVKQLQDALTELNMNDGNDRTKGDEKGLTGLCATNTSMSTQTTAVND
                     NADEEIDESFEIPYLNMNQNSKLRHNPTIGDLFKIQLYDTQLLPKIIQLFIEHPWNNF
                     WHNVVFDIIQQIFNGRMDFSYNSFLVYSLFNNKDAGQFVIDVKPEENRAQDFTDFAIT
                     RDLVLQGYKNSHAFYEQYNTNLGYMGHLVLIAEEIVKFSKVYKVELISPDIHRVLQDP
                     DWIFYSEDALNDTRMMYSKILGGSEYLGEENGCTAAEMEQLTETGENLPEFGGKLSGY
                     SFSTQADLHQKLKEKLIKRSQEEVDLKNKKNGVIILGPPPAHE"
     gene            complement(<884535..>885401)
                     /locus_tag="AGOS_AFR246C"
                     /old_locus_tag="AFR246C"
                     /db_xref="GeneID:4622056"
     mRNA            complement(<884535..>885401)
                     /locus_tag="AGOS_AFR246C"
                     /old_locus_tag="AFR246C"
                     /product="AFR246Cp"
                     /transcript_id="NM_211148.1"
                     /db_xref="GeneID:4622056"
     CDS             complement(884535..885401)
                     /locus_tag="AGOS_AFR246C"
                     /old_locus_tag="AFR246C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR041C (ERJ5)"
                     /codon_start=1
                     /product="AFR246Cp"
                     /protein_id="NP_985793.1"
                     /db_xref="GeneID:4622056"
                     /translation="MLARFVWLIAAGLLAIVNGFTADEAEIFNLQKVLTDKYGKDMNL
                     YRFLKLEKLEKSDGREITRQMRALAKKYHPDKNPKYKKLYERLHLAAQILTDGEKRKT
                     YDYYLDYGFPEYRVDKRGFVFQRVQPKTWVVLAFVLVATSAIHWTVLKLQHRSRVRRV
                     EGFLREVKEQDDTLGLGEKRLQLQLGDSDPQEVVVRFGDVFVVQENNTETRICAEELR
                     APGLLDTLMFALPMWAVGRVRAPFRKQTEPEAPVRTEPAAVKKKSPKPKGKGQKWQLP
                     NGKVLYSRAKKD"
     gene            <885519..>886154
                     /locus_tag="AGOS_AFR247W"
                     /old_locus_tag="AFR247W"
                     /db_xref="GeneID:4622057"
     mRNA            <885519..>886154
                     /locus_tag="AGOS_AFR247W"
                     /old_locus_tag="AFR247W"
                     /product="AFR247Wp"
                     /transcript_id="NM_211149.1"
                     /db_xref="GeneID:4622057"
     CDS             885519..886154
                     /locus_tag="AGOS_AFR247W"
                     /old_locus_tag="AFR247W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR042W (KEG1)"
                     /codon_start=1
                     /product="AFR247Wp"
                     /protein_id="NP_985794.1"
                     /db_xref="GeneID:4622057"
                     /translation="MADLQGIPGKPAHTPNSMVSRAYQFYRLSCMFLYAALVARWLAL
                     FPLVGTRWVPGGIHGFLIYLLGGSAVLEVLWMIWFYRFTKGLWTRTLLKCANMLYFVA
                     VMHFYDDYEHAPVLKNIGYSIFILSIGMNQALHHGGRLFRGRRRRRSWWWRSDTFVLQ
                     PALYISQFYLLLLNVQNPSFHSTPKLDIINRTVLVAYVPLALQCFRRQLTS"
     gene            complement(<886156..>887070)
                     /locus_tag="AGOS_AFR248C"
                     /old_locus_tag="AFR248C"
                     /db_xref="GeneID:4622058"
     mRNA            complement(<886156..>887070)
                     /locus_tag="AGOS_AFR248C"
                     /old_locus_tag="AFR248C"
                     /product="AFR248Cp"
                     /transcript_id="NM_211150.1"
                     /db_xref="GeneID:4622058"
     CDS             complement(886156..887070)
                     /locus_tag="AGOS_AFR248C"
                     /old_locus_tag="AFR248C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR043C (IRC6)"
                     /codon_start=1
                     /product="AFR248Cp"
                     /protein_id="NP_985795.1"
                     /db_xref="GeneID:4622058"
                     /translation="MVAEGLCQCYIRRMSTGGPHGAAPDRSCLARDTEGRSPCKNCQG
                     CTQGAADPIPIRILMADSDVEQAPSVSVLPRNKILILAPAGKAYQAEVIRDLFNIEAS
                     ESDRIVRDVKWSNKYYEVDLDLYIDSYESLQTWGAEFCSDECADLRDVVAGIFLVFEE
                     TEDAETFQQLIEDCHFTDERVLVACDLSSAEHPASLERALEVHDVALVRWRERGTNEL
                     GEQQGRERVRELLDIHPWSERMLRMHASTAAALAELDPLQADIPLDSVVTRIKQARER
                     YLEITDVHAADEYAARIAHELTEQLLPE"
     gene            <888012..>888557
                     /locus_tag="AGOS_AFR249W"
                     /old_locus_tag="AFR249W"
                     /db_xref="GeneID:4622059"
     mRNA            <888012..>888557
                     /locus_tag="AGOS_AFR249W"
                     /old_locus_tag="AFR249W"
                     /product="AFR249Wp"
                     /transcript_id="NM_211151.1"
                     /db_xref="GeneID:4622059"
     CDS             888012..888557
                     /locus_tag="AGOS_AFR249W"
                     /old_locus_tag="AFR249W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL231C (EMC4)"
                     /codon_start=1
                     /product="AFR249Wp"
                     /protein_id="NP_985796.1"
                     /db_xref="GeneID:4622059"
                     /translation="MSSEAPTWARCLVEPEYLKSISVVSSNTLPQPPGFSKKQKSQTR
                     SVSKEEGEANRERINALQVKKAWQLAFQPSKAIPMNFFMSYMSGTSLQIIPIMTALML
                     LTGPVKSVLQVRSTFKGLLNNEAAYGQVLAAMCLYVFFQAVLMAIGLQKLNAMGLLPN
                     KHSDWLAWETPMAYSMQSYAF"
     gene            complement(<888645..>889478)
                     /locus_tag="AGOS_AFR250C"
                     /old_locus_tag="AFR250C"
                     /db_xref="GeneID:4622060"
     mRNA            complement(<888645..>889478)
                     /locus_tag="AGOS_AFR250C"
                     /old_locus_tag="AFR250C"
                     /product="AFR250Cp"
                     /transcript_id="NM_211152.1"
                     /db_xref="GeneID:4622060"
     CDS             complement(888645..889478)
                     /locus_tag="AGOS_AFR250C"
                     /old_locus_tag="AFR250C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL232W (TAN1)"
                     /codon_start=1
                     /product="AFR250Cp"
                     /protein_id="NP_985797.1"
                     /db_xref="GeneID:4622060"
                     /translation="MAKRARSGDSSGPKKKYKVVHATIDPNTSGIYATCARRHEKQAS
                     RELMSILQEKAEEYYVDELKAIAETELLSDKEDEEELSVEEQVQKELEQLKKGSGPVD
                     TKKKPVLQEIQLGCECMVFIKTRRPIKPECFVKRLVQELASSENTTKVSRYVQRLTPI
                     TDSCNASLTELEKLCRRVLAPHFHTDKEIKYKFAVEVVKRNFNTIDKMDIIKLVAKEV
                     GKSGELGHSVDLKDYDKLVIVQCYKNNIGMSVVDKDYSVALKKYNLQEIYDTKLQTKD
                     A"
     gene            complement(<889646..>892252)
                     /locus_tag="AGOS_AFR251C"
                     /old_locus_tag="AFR251C"
                     /db_xref="GeneID:4622061"
     mRNA            complement(<889646..>892252)
                     /locus_tag="AGOS_AFR251C"
                     /old_locus_tag="AFR251C"
                     /product="AFR251Cp"
                     /transcript_id="NM_211153.2"
                     /db_xref="GeneID:4622061"
     CDS             complement(889646..892252)
                     /locus_tag="AGOS_AFR251C"
                     /old_locus_tag="AFR251C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL233W (SEC15)"
                     /codon_start=1
                     /product="AFR251Cp"
                     /protein_id="NP_985798.2"
                     /db_xref="GeneID:4622061"
                     /translation="MSLELEQEPHTQLSQELQKVLLTAEFAATRDDDYTPGETGDGLM
                     CLSDQTFEKWVPYLRQAVESDRLDGVVEEVYSSVEENFQNFETQILQDSQVSDNLSSS
                     IDEIERIQNLAESYLQGQVADLQAQLSASTNEVVSKKRALTSNRRTSIKISESIILIE
                     KIFQMLELTNKCQELIRDGNFYKALQNLDKLERIYIHDFKNYKFEFLAVIYNSIPKLK
                     NIIKDESINLIKKSLSSNLEKTLSQVGQTYFQVYNDQLLPHWLAMKKAMKLSNYKFNS
                     PVEVSLRDDSFLAGLKLEDYYNLDEFYDSIMIFESLKETNYLCDEFTKEYDFRKVKLV
                     YPLDWKSTTTMTHSANEQVDSFYQQLSLPFLKEYLLKILGFLLYDKFLHKSTDYIFAY
                     NTYTTTEEFWEQFMTKVSPHLSRFIKEKLTTEDQLIEFKNFLGILIAILENMKLNSES
                     MYKIQVQVFEKYCGLLIHVFDKEFTNLLNDDDFMPLPISDRNFYEKVMKLCWMKPDSV
                     PIVTQDDANGFSVTLPFSPLYPMTCALIKKSYANMLLFLNTFFQHDLSYLNIVLVRTV
                     DDIFIKVVNNKIRSKLDTTSREEIAQILINLDYFIVAAKEFSDIMTKENITQNPDIEI
                     KLSSTKQLADTKKYAETKLIELIDSKVTDLMEFVELDWTTEEVRDEPGLSIRDIAQFL
                     EMMFTSTLANLPYSIKSLLIFREFDQLTRKFLELLVHESPSYITTQSVANFETDMKFL
                     ENVISNIFPNESTEQNVEISPSTPTTPVADSFNVKSPNMIESNVRSLFSTFTDLNQHI
                     LLMKSNNFDEYKDSSIRMRKYPRIKPEVAHLLMNKLSRPTTATTDGDNTTVSDYSVTS
                     NGRFAKFFNRGG"
     gene            complement(<892637..>894223)
                     /locus_tag="AGOS_AFR252C"
                     /old_locus_tag="AFR252C"
                     /db_xref="GeneID:4622062"
     mRNA            complement(<892637..>894223)
                     /locus_tag="AGOS_AFR252C"
                     /old_locus_tag="AFR252C"
                     /product="AFR252Cp"
                     /transcript_id="NM_211154.1"
                     /db_xref="GeneID:4622062"
     CDS             complement(892637..894223)
                     /locus_tag="AGOS_AFR252C"
                     /old_locus_tag="AFR252C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR044C (DUG1)"
                     /codon_start=1
                     /product="AFR252Cp"
                     /protein_id="NP_985799.1"
                     /db_xref="GeneID:4622062"
                     /translation="MRGLSTGRSVWLLSLFSWMLLRTLPRVSASRIGLNRAINFRTMT
                     TMKSETDFAPLFEKIDELKPRYLERLSKAIGIPAVSGDESMRAHVVRKADFLAAELER
                     LGFTDVEKRELGPQPAPVQTPGLKLPPVLLARYGQDAAKKTVLVYAHYDVQPANKDDG
                     WATEPFEFYLDEKNGVMRGRGVTDDTGPLTGWLNVVEAFQEAGIELPVNLVVCFEGME
                     ESGSIGLEELIEQEKDKYFAGVDAVCISDNYWLGTKKPVLTYGLRGVNYYQVAIEGPA
                     ADLHSGLFGGAVAEPMTDLVKVLNTLVDSQGRILIEGVDEMVAPVTDAERALYDKIDY
                     SLEEFNQAVGANISLYEDKRDILMHRWRYPSLSLHGVEGAFYGAGEKTVIPAKVIGKF
                     SIRTVPDMDSDKLNKLVMDHCRKAFEKLGSPNKCTPEVLHCGAYWLSNPFNASFSAAS
                     KAIKAVYNVEPDFTREGGSIPITLFFEEKLKTDVLLLPMGRGDDGAHSINEKLDLSNY
                     FGGMKTMAAYLYYYSISDSK"
     gene            <894399..>895493
                     /locus_tag="AGOS_AFR253W"
                     /old_locus_tag="AFR253W"
                     /db_xref="GeneID:4622063"
     mRNA            join(<894399..894446,894507..>895493)
                     /locus_tag="AGOS_AFR253W"
                     /old_locus_tag="AFR253W"
                     /product="AFR253Wp"
                     /transcript_id="NM_211155.1"
                     /db_xref="GeneID:4622063"
     CDS             join(894399..894446,894507..895493)
                     /locus_tag="AGOS_AFR253W"
                     /old_locus_tag="AFR253W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR045W; 1-intron"
                     /codon_start=1
                     /product="AFR253Wp"
                     /protein_id="NP_985800.1"
                     /db_xref="GeneID:4622063"
                     /translation="MADGTQDGTEASLVAERHGVRSSVIAGAAAAVFQTTMSHPFEFL
                     KTGQQLHRALPGAAAFNMLHPFKYYFSGCAALNVGTLLKTGTRFATFEQACVWLRDPE
                     HADQPIAGPRLLLAGAITGFLESLWVVPFESIKTTAVENALELSRRVQGEPETRAAAV
                     SKGPAPKATFHAARPVQTAHERWLLHYERQPSSHFAGTVLEIYRTRGVRGFLQGAMPT
                     IFRQLGNSVVRFTTYAWIVQSLSPHKALDEYQAFAAGALSSAAVVALTQPIDVIKTRM
                     QSKTAWFTYKSSLNCAYRIFVEEGFRYMWKGWVPRLFKVSLSGGISFGVYQYVENLVL
                     LWEHERSLAP"
     gene            complement(<895584..>897965)
                     /locus_tag="AGOS_AFR254C"
                     /old_locus_tag="AFR254C"
                     /db_xref="GeneID:4622064"
     mRNA            complement(<895584..>897965)
                     /locus_tag="AGOS_AFR254C"
                     /old_locus_tag="AFR254C"
                     /product="AFR254Cp"
                     /transcript_id="NM_211156.2"
                     /db_xref="GeneID:4622064"
     CDS             complement(895584..897965)
                     /locus_tag="AGOS_AFR254C"
                     /old_locus_tag="AFR254C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL234W (ADE5,7)"
                     /codon_start=1
                     /product="AFR254Cp"
                     /protein_id="NP_985801.2"
                     /db_xref="GeneID:4622064"
                     /translation="MSMNILLLGSGGREHALAWRLAQSPSVEKVYVAPGNGGTATMGT
                     KVINLPDLGTSKQHFGALRDFALANDVSLVVPGPEQPLIDGVTDVFQKVGIPVFGPSQ
                     KAAVFEGSKTFSKDFMARHDIPTARYANFDNYDEARAHIDAVDYRIVLKADGVAAGKG
                     VLLPTTKAEAVEALDAIMVQKQFGAAGDSVVIEEFLEGDEISILTISDGHEFFNLPPA
                     QDHKRIGENDTGLNTGGMGTYAPAPIATPALLEIIDKEIIKPSIDGMRKDRLPFVGVL
                     FTGIIVTKDGPKVLEYNVRFGDPETQSVLPLLSEETDLAEVFLAAAEHRLDSVNIGIK
                     PDTYATTVVLAAGGYPESYKSGDEITVDSSRLPSGSYIFHAGTKKEGEKIYTAGGRVL
                     AASSAAATLRDAVDGAYLAVGCIHFDNMYFRKDIAHRAFKTGDAAQNKSITYSDSGVS
                     VDNGNLLVQTIKAKVKSTSRPGADSDIGGFGGLFDLKAAGYNADDALLVAATDGVGTK
                     LLIAQETNVHNSVGIDLVAMNVNDLVVQGAEPLLFLDYYATGSLDVQTAAEFVSGVAD
                     GCIQAGCALVGGETSEMPGMYPPGHYDTNGTAVGAVYKNSLLPKIAEMKAGDVLLGLA
                     SDGVHSNGFSLVRKIMEHTGKLWSDTCPWDASMSLGQAMLIPTRIYVKQLLPSIKKQL
                     LLGLAHITGGGLVENIPRALPKHLQARVDMRAWEVPAVFKWLGSAGNVPVADILKTFN
                     MGIGMVAIVQRENVPAVMNLLMEAGEKVYEIGTLVERPEGEASCIVDHASNIY"
     gene            <898353..>900440
                     /locus_tag="AGOS_AFR255W"
                     /old_locus_tag="AFR255W"
                     /db_xref="GeneID:4622065"
     mRNA            <898353..>900440
                     /locus_tag="AGOS_AFR255W"
                     /old_locus_tag="AFR255W"
                     /product="AFR255Wp"
                     /transcript_id="NM_211157.2"
                     /db_xref="GeneID:4622065"
     CDS             898353..900440
                     /locus_tag="AGOS_AFR255W"
                     /old_locus_tag="AFR255W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL236C (MTO1)"
                     /codon_start=1
                     /product="AFR255Wp"
                     /protein_id="NP_985802.2"
                     /db_xref="GeneID:4622065"
                     /translation="MSCMLTIRSCADAERDLLVSLRLKMLRSAYGFATLHSRAVLQWQ
                     GRRSIILTAELQKALEELPDSGVVVIGGGHAGCEASSAAARAGGKATLVTPSLDKIGT
                     CSCNPSMGGIGKGTLLREVDALDGLAPRVTDLAGLQFKVLNRSRGAAVWGPRAQIDRK
                     IYMREMQRVMTNYPGLTLLEGSVDDLVVEEKEVAGTIRRSIRGVILQDQRLLRASRVV
                     LTTGTFLGAEIHIGLQSFPAGRLGEAPTYGISKTMRGLDFMMGRLKTGTPARLDKNSI
                     DYTGMTREFGDEPPHPMSYLNNKVAAERQEVCFGTHTTKELHAYVVSNLHQSIHIKET
                     VKGPRYCPSLEAKVLRFPHKDSHRIWLEPEGWDSEVIYPNGISNSMPEDVQHRMLQMI
                     PGLANVKMLYPAYGVEYDYIDPRELKQTLETKRVDGLYLAGQINGTTGYEEACAQGIV
                     AGANAGLASVGKSPLIIGRPDAYVGVLIDDLITKGVEEPYRMFTTRSEFRLTVRADNA
                     DMRLTDLGHRAGVVGDERWKTFTEHRALYNDIHEKLNHYTCSNTQWHKLCNEVVRSPQ
                     KGVSAWEMYKYSNINLALLAASVPDLNIDIGSVPVHVMHKLDAEGRYAPYLKKQRQQV
                     HAYQADENIRLPDNIDYSTVQGINTEGQLLLNRVRPQTLGQARRIQGITPVAMFELYK
                     LAAKRAPRADLTA"
     gene            complement(<900458..>901366)
                     /locus_tag="AGOS_AFR256C"
                     /old_locus_tag="AFR256C"
                     /db_xref="GeneID:4622066"
     mRNA            complement(<900458..>901366)
                     /locus_tag="AGOS_AFR256C"
                     /old_locus_tag="AFR256C"
                     /product="AFR256Cp"
                     /transcript_id="NM_211158.2"
                     /db_xref="GeneID:4622066"
     CDS             complement(900458..901366)
                     /locus_tag="AGOS_AFR256C"
                     /old_locus_tag="AFR256C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR046C (CNN1)"
                     /codon_start=1
                     /product="AFR256Cp"
                     /protein_id="NP_985803.2"
                     /db_xref="GeneID:4622066"
                     /translation="MSREDLSSTVERTPVKENAEEKRRLREEAFLASTPGWQPPSTRR
                     RIELTRDPQKLRHYLRELSSVLVNVSESPVPSSAQAEPGTDAHAGNPAGQGGKIARGA
                     RLAQDVFGNLPPGYERKARRLNSSLPVVIQSASEDAPDVTLEGEPDMMQDLPAAGGPA
                     AGAGTSSPQWYEQLDIGEMSEAESEASASERSAEAGSVARSLPLSLLRRLVGPTVDKG
                     GYYLRAQALERLQQVAAELVQSLAQDLCRVDGAVVVDRSALVRIFANHGVLGGTAGNL
                     ELFRLCQRYLPLEVLNSMESALFGGD"
     gene            <901532..>902338
                     /locus_tag="AGOS_AFR257W"
                     /old_locus_tag="AFR257W"
                     /db_xref="GeneID:4622067"
     mRNA            <901532..>902338
                     /locus_tag="AGOS_AFR257W"
                     /old_locus_tag="AFR257W"
                     /product="AFR257Wp"
                     /transcript_id="NM_211159.1"
                     /db_xref="GeneID:4622067"
     CDS             901532..902338
                     /locus_tag="AGOS_AFR257W"
                     /old_locus_tag="AFR257W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL237C (HAP2)"
                     /codon_start=1
                     /product="AFR257Wp"
                     /protein_id="NP_985804.1"
                     /db_xref="GeneID:4622067"
                     /translation="MIGYEAGEPEVVTSEAERDYPPLDSGLAHYTPRDAAVSQRRDTP
                     RIDAAELHGSSPARHQGTHGGPLEAVLKVPAEPHADMFLYEQPAAGLSSAPAGDDASV
                     DGEPPRVGRDGILHGRGPFFEGAGLDFTSTDQVALESMAAADPAEQPFYVNAKQYYRI
                     LKRRYARAKLEENLKISRERRPYLHESRHKHAMRRPRGQGGRFLTAAEIDELKKQELA
                     QSKAKSPAKDTADDRPKSPDTSYPPHKIQPQPPGGAVDKQQVADAAPSRT"
     gene            <902518..>903306
                     /locus_tag="AGOS_AFR258W"
                     /old_locus_tag="AFR258W"
                     /db_xref="GeneID:4622068"
     mRNA            <902518..>903306
                     /locus_tag="AGOS_AFR258W"
                     /old_locus_tag="AFR258W"
                     /product="AFR258Wp"
                     /transcript_id="NM_211160.1"
                     /db_xref="GeneID:4622068"
     CDS             902518..903306
                     /locus_tag="AGOS_AFR258W"
                     /old_locus_tag="AFR258W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR050C (PRE4)"
                     /codon_start=1
                     /product="AFR258Wp"
                     /protein_id="NP_985805.1"
                     /db_xref="GeneID:4622068"
                     /translation="MNHDPFEWGRPLDSHYGAYNAAIANAGPSQHTQQPIVTGTSVIA
                     MKYNNGTIIAADRLGSYGSLLRFTDMDRLFAVGESTVVGVSGDVSDMQYLQRLLQDME
                     IENNYDNSHADGAEALKPSYIFEYLASLMYQRRSKLNPLWNAIIVAGVEDGQAFLRYV
                     DLKGVKYSAPSLATGFGAHMAIPLMRKVADAEKDVAGVDLSIARATILESMKVLFYRD
                     ARSSRRFSLAIIDNDAGVSMEQLEVENMTWGFAKDIRGYGTQNV"
     gene            <903567..>904634
                     /locus_tag="AGOS_AFR259W"
                     /old_locus_tag="AFR259W"
                     /db_xref="GeneID:4622069"
     mRNA            <903567..>904634
                     /locus_tag="AGOS_AFR259W"
                     /old_locus_tag="AFR259W"
                     /product="AFR259Wp"
                     /transcript_id="NM_211161.1"
                     /db_xref="GeneID:4622069"
     CDS             903567..904634
                     /locus_tag="AGOS_AFR259W"
                     /old_locus_tag="AFR259W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL248W (PDE1)"
                     /codon_start=1
                     /product="AFR259Wp"
                     /protein_id="NP_985806.1"
                     /db_xref="GeneID:4622069"
                     /translation="MGGFELTVLGSCGGPWESGTQSFMLKPRGSTNYGYVCVDAGSGL
                     KQLIELAAAQDPNAEVESFYKRDFEPVAAYHSERATANPGLGTLSARTAEHFRTELVA
                     VQRGAALYHEIGEVFVTHPHLDHVIALALNSPMAGIREKRVLGLPFTIQALRKHIFND
                     KVWPDLLGPRDPVFELEAMEPVKPHVSSIVPHWTITPFPVSHGVTVREREPFYSTGFL
                     FRDLNGGDMLLIIGDLESDRCSGKDHLARIWKYLARTGPLALLRGIVIECSTADLEDE
                     AYLYGHMSPQHIVYELQQLRQAYNRPLDGLSIIITHTKMECIDEDPRLLILRDLRQKS
                     AEANLGRIDFSVAVRGYTHFM"
     gene            complement(<904754..>905113)
                     /locus_tag="AGOS_AFR260C"
                     /old_locus_tag="AFR260C"
                     /db_xref="GeneID:4622070"
     mRNA            complement(<904754..>905113)
                     /locus_tag="AGOS_AFR260C"
                     /old_locus_tag="AFR260C"
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /transcript_id="NM_211162.1"
                     /db_xref="GeneID:4622070"
     CDS             complement(904754..905113)
                     /locus_tag="AGOS_AFR260C"
                     /old_locus_tag="AFR260C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR049W (YMR31)"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /protein_id="NP_985807.1"
                     /db_xref="GeneID:4622070"
                     /translation="MQQSAVRLARAYVPMIRFVGGRHPAVARGEAGPHPCTSGGLAPG
                     SPECVSVAEYLSKLTPFRVVRYTKPQAGVNGSRYEFRQRELQEGELSSVLDLPARYRT
                     RPLEDAEMECINQGGIY"
     gene            <905607..>906110
                     /locus_tag="AGOS_AFR261W"
                     /old_locus_tag="AFR261W"
                     /db_xref="GeneID:4622071"
     mRNA            <905607..>906110
                     /locus_tag="AGOS_AFR261W"
                     /old_locus_tag="AFR261W"
                     /product="AFR261Wp"
                     /transcript_id="NM_211163.1"
                     /db_xref="GeneID:4622071"
     CDS             905607..906110
                     /locus_tag="AGOS_AFR261W"
                     /old_locus_tag="AFR261W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL247W (BRR6)"
                     /codon_start=1
                     /product="AFR261Wp"
                     /protein_id="NP_985808.1"
                     /db_xref="GeneID:4622071"
                     /translation="MGEHNHVAYRGNGAPFPRANIRHPIDYVQVVFNGCIAFGALFLL
                     ARFVQLVQYDVQLQRAQQHLEDAFTIQQCAKYYEENRCGGQKQPPALAERCARWAQCM
                     ALDAHPTSDASVRLWARTLASTLNEFTEQVSLRTVIVLLVCTLSVILAANFAFGTYRV
                     YYVQQRT"
     gene            complement(<906122..>908449)
                     /locus_tag="AGOS_AFR262C"
                     /old_locus_tag="AFR262C"
                     /db_xref="GeneID:4622072"
     mRNA            complement(<906122..>908449)
                     /locus_tag="AGOS_AFR262C"
                     /old_locus_tag="AFR262C"
                     /product="AFR262Cp"
                     /transcript_id="NM_211164.1"
                     /db_xref="GeneID:4622072"
     CDS             complement(906122..908449)
                     /locus_tag="AGOS_AFR262C"
                     /old_locus_tag="AFR262C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL246C (RAI1); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="AFR262Cp"
                     /protein_id="NP_985809.1"
                     /db_xref="GeneID:4622072"
                     /translation="MTTISVWSNSQHRSLFKKPDGYYSDSPPNRLRIMEDPNLSHYLF
                     SDAHIDKNTDPLVWKPELQEEQAQSEDDAGSLHGLLYMLMEYERRNGKKIDADFIASG
                     EHLKHLIYPLLGGPSAHVDIYVRNFDGQIFIRAVQKKHCPLRYENRGKICSCGKRMQE
                     EGRSPSMTINSSYELPFWSKQVVRNGPQYMNVARAGVGEHKMVIGVEADGILASKELK
                     GGNLKHYVELGVCKERWDLDRRLFFVWLHCFVVGIDRITIGFRDDSFKLVDVQEYRTM
                     EILQLFETSALRNDCNSVMNWYGEILKNLSRFFKRRADDFCVYKLNVSRSLGILMAQD
                     CTWGYDNDIRAVDDFIPGWFREWRQSLKQPHHVLGDGRIDVFEPYTLSLRNCWSASPR
                     TSVSGTLTSVARLLQRSRDMVIESELSPWGSMIFWPPEELGYYSTNVSGELKVMDDSN
                     LSYYYLPDADIEKHIDLSAGARKFQDEQAEAEDDTGSLHGLLQTLMEYERRKSKKVNA
                     DIIAFRGQVKRLIHCAFGGHATDVDMYVMSFDGQLFIRAARKKLEFPTSPRESWAYLA
                     YYSGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQYRTVMRTGVGEHKLVLGAEI
                     DGIIDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGFRDEKFV
                     LKSVEEFSTSEIPHLLKGTEYSNVCVDAIEWYGALTKWLCELPRGPEDDFKLYRLSCS
                     HGALRLRQLHDEDLANGDDIIPGWFREWRRSLNST"
     gene            complement(<908589..>909719)
                     /locus_tag="AGOS_AFR263C"
                     /old_locus_tag="AFR263C"
                     /db_xref="GeneID:4622073"
     mRNA            complement(<908589..>909719)
                     /locus_tag="AGOS_AFR263C"
                     /old_locus_tag="AFR263C"
                     /product="AFR263Cp"
                     /transcript_id="NM_211165.1"
                     /db_xref="GeneID:4622073"
     CDS             complement(908589..909719)
                     /locus_tag="AGOS_AFR263C"
                     /old_locus_tag="AFR263C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL246C (RAI1); Tandem gene duplication in this genome"
                     /codon_start=1
                     /product="AFR263Cp"
                     /protein_id="NP_985810.1"
                     /db_xref="GeneID:4622073"
                     /translation="MVFESELLLQRRLATTALKQPKELGYYSTNVGGELKVMDESNLS
                     YYYLPDADIEKHIDLSAGARKFQDEQAEAEDDTGSLHGLLQTLMEYERRKSKKVNADI
                     IAFRGQVKRLIHCAFGGHATDVDMYVMSFDGQLFIRAARKKLEFPTSPRESWAYLAYY
                     SGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQYKTVVRTGVGEHKLVLGAEVDG
                     IFDFREPTGDNLKHYVELKVAKKVQTLKDATNFEQKLFSVWLQCFLVGINRVIIGFRD
                     EKFVLKSVEEFSTSEIPLLLKSTGLRNACVDAIKWYGALTKWLCELPRGPEDDFKLYR
                     LSCSRGALHLRQLHDEDLANGDDIIPGWFREWRRSLSKSHGS"
     gene            <910045..>912168
                     /locus_tag="AGOS_AFR264W"
                     /old_locus_tag="AFR264W"
                     /db_xref="GeneID:4622074"
     mRNA            <910045..>912168
                     /locus_tag="AGOS_AFR264W"
                     /old_locus_tag="AFR264W"
                     /product="AFR264Wp"
                     /transcript_id="NM_211166.2"
                     /db_xref="GeneID:4622074"
     CDS             910045..912168
                     /locus_tag="AGOS_AFR264W"
                     /old_locus_tag="AFR264W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL245W (GUS1)"
                     /codon_start=1
                     /product="AFR264Wp"
                     /protein_id="NP_985811.2"
                     /db_xref="GeneID:4622074"
                     /translation="MSSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAA
                     AASFDGESQNALERMVEKYPDVLGSVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDA
                     HLNLRTFVLGGMQPTVADVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGG
                     AHEFLAKSLKELKAAGNVNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHA
                     KAALLNQYFAQAYKGKLIIRFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYF
                     QEMYDYCVQMIKEGKAYCDDTPTERMREERMEGIASARRERSVEENLKIFTEEMKNGT
                     EEGLKNCVRAKIDYAALNKTLRDPVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALE
                     GVTHALRTIEYRDRNAQYEWMLNALKLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQV
                     VSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPIA
                     PRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNPAVGEKKVIYYKDVLIGAEDAAML
                     AAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFKKTKFKLTWLADTSDTVPVDLVD
                     FDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKDMKVGDVIQFERTGYYRLDTV
                     GSGDKPFVFFTIPDGKAVNKYGAKK"
     gene            complement(<912266..>914029)
                     /locus_tag="AGOS_AFR265C"
                     /old_locus_tag="AFR265C"
                     /db_xref="GeneID:4622075"
     mRNA            complement(<912266..>914029)
                     /locus_tag="AGOS_AFR265C"
                     /old_locus_tag="AFR265C"
                     /product="AFR265Cp"
                     /transcript_id="NM_211167.2"
                     /db_xref="GeneID:4622075"
     CDS             complement(912266..914029)
                     /locus_tag="AGOS_AFR265C"
                     /old_locus_tag="AFR265C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR048W (RMD8)"
                     /codon_start=1
                     /product="AFR265Cp"
                     /protein_id="NP_985812.2"
                     /db_xref="GeneID:4622075"
                     /translation="MAGDDMVQVGNNRTVPRNMMSRRSPSILVTDARSTKKRSSAPFA
                     GNANTRRDKTGGSMPTVIENRAGRRMGPMGGREFMPKAGSGRTRQGKFSEVSMDNILS
                     EMSDVPSGRRQERLSSSSFEYERRPAHYNKTIRPLPSRTSKTSEKFVLIPDENVKRFA
                     QGFHKRSASRVFSELSYGEHNTAGLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYD
                     ECLYVPYCLPLLPGKDGFRIRSNVSKKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETV
                     EDMHNNFEINENGNGRDPDGLRNADHLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQ
                     DSSSEQHEREKVLDAQQHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRP
                     LDEQDIEIEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKR
                     ITPILGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSF
                     EPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEFFDICVNSIAEKDMARITWWLVIVI
                     FISVLVSTAEILVRYFIIKRH"
     gene            <914311..>915999
                     /locus_tag="AGOS_AFR266W"
                     /old_locus_tag="AFR266W"
                     /db_xref="GeneID:4622076"
     mRNA            <914311..>915999
                     /locus_tag="AGOS_AFR266W"
                     /old_locus_tag="AFR266W"
                     /product="AFR266Wp"
                     /transcript_id="NM_211168.1"
                     /db_xref="GeneID:4622076"
     CDS             914311..915999
                     /locus_tag="AGOS_AFR266W"
                     /old_locus_tag="AFR266W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL244W (RTF1)"
                     /codon_start=1
                     /product="AFR266Wp"
                     /protein_id="NP_985813.1"
                     /db_xref="GeneID:4622076"
                     /translation="MSDLDEDLLALAAGEDGDDGDEDFGVTSQKRSKHDSSGSKKRRV
                     MDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHEASEDEVEEENPYPLLGKYR
                     DDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKNIRAQQQRRQQKDGSAL
                     RSSGRSTRTTGHSDLRDSKLSELRKQRAKKSGNYDYSAGEDDSDHSDDYVDSDNEDDY
                     DPHDGRQLYREEADEVKWAEDDLDRDAELDDFNKIKVGRSFVAKFCFYPEFNQRVQGC
                     YGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFF
                     SDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAKDLTNFVSQPMTPKLTDQIVRNRM
                     QFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQLKNLEKRMSSYEKHHEND
                     QTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVKTDPFSRLKTRTKIYYQEIQ
                     QEENEKAQELAKQKQQQDKEEKHDRKQQLLAKFRRLGGLEDALSKLDFRIKLDS"
     gene            <916082..>917239
                     /locus_tag="AGOS_AFR267W"
                     /old_locus_tag="AFR267W"
                     /db_xref="GeneID:4622077"
     mRNA            <916082..>917239
                     /locus_tag="AGOS_AFR267W"
                     /old_locus_tag="AFR267W"
                     /product="AFR267Wp"
                     /transcript_id="NM_211169.1"
                     /db_xref="GeneID:4622077"
     CDS             916082..917239
                     /locus_tag="AGOS_AFR267W"
                     /old_locus_tag="AFR267W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL243W (TAD1)"
                     /codon_start=1
                     /product="AFR267Wp"
                     /protein_id="NP_985814.1"
                     /db_xref="GeneID:4622077"
                     /translation="MDDDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVV
                     LVDRQTAECRLVSAATGVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLV
                     TDGRSAECDLVEQAKTQDRFRLASRWQAALYISKAPCGDCSMDMADDDADEMTFSPDD
                     PIQYVAEHNYTMLRGRFNYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSM
                     TWELFEEPVFLDYLVLPHTIATAGFERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAP
                     QQPPALTASVYLNITAKKHVEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFM
                     QLHQAPPLSYAAFKRQQHARNRLKRHVRHRLSPDGWPTTRVDDCIASLAAT"
     gene            complement(<917252..>917758)
                     /locus_tag="AGOS_AFR268C"
                     /old_locus_tag="AFR268C"
                     /db_xref="GeneID:4622078"
     mRNA            complement(<917252..>917758)
                     /locus_tag="AGOS_AFR268C"
                     /old_locus_tag="AFR268C"
                     /product="AFR268Cp"
                     /transcript_id="NM_211170.1"
                     /db_xref="GeneID:4622078"
     CDS             complement(917252..917758)
                     /locus_tag="AGOS_AFR268C"
                     /old_locus_tag="AFR268C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL242C"
                     /codon_start=1
                     /product="AFR268Cp"
                     /protein_id="NP_985815.1"
                     /db_xref="GeneID:4622078"
                     /translation="MSVDGASLGEQLLEAARRNNVELLEAVVRDAGPEIEDLINGSRD
                     PLGNTCLHLCCTHGSWEALDMILDLDCAIEVDPQNTAGDTPLHAAARYAAEEPEHATF
                     LASNLVQVGADPRVRNKAGLRPVELVHGSELEPLVDVLQGGELAYDTHGEAVNADEIE
                     EIDDEPSD"
     gene            <917910..>920963
                     /locus_tag="AGOS_AFR269W"
                     /old_locus_tag="AFR269W"
                     /db_xref="GeneID:4622079"
     mRNA            <917910..>920963
                     /locus_tag="AGOS_AFR269W"
                     /old_locus_tag="AFR269W"
                     /product="AFR269Wp"
                     /transcript_id="NM_211171.3"
                     /db_xref="GeneID:4622079"
     CDS             917910..920963
                     /locus_tag="AGOS_AFR269W"
                     /old_locus_tag="AFR269W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL241W (KAP114)"
                     /codon_start=1
                     /product="AFR269Wp"
                     /protein_id="NP_985816.3"
                     /db_xref="GeneID:4622079"
                     /translation="MKPAALSIKARYWKQSEKMDLRQLVLAAQSAGKIERESAEQSLL
                     EACRADPAAVCVGLVKMATQENTELASRQFCLYTLRKLITMYWNAGFESYCGPPGVRE
                     DAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAVDFPDEWPGLLKSVYESITGER
                     SLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLGDDGPVALKDAAMKLYHSCL
                     LQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSLEPHADLLQFQAHTYENLVL
                     IKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEGDEELLKAVAESAIHMVIF
                     LSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFISKETGLTSSYTPRDE
                     IFQYLSDLGGHNYREFLRVLFEQLLQVESMAWRSQESLLFLLQSCQLNSEGPQFDEQT
                     VAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDLVREFVFLTFNTT
                     VTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNILDGIDEDTPG
                     FLLEVLSGVTGCNKESRNRELKLSELQLVLNVATADPSNIQVVVEAQECLKNLLQYDP
                     ENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFMRKKPVDSALPRSMVD
                     YIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVIITILEKLLSARTS
                     HSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVFCYLTS
                     IDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFFLED
                     PRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQPD
                     PGRYPKDGSGPADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSDIDDTGDSLLFTS
                     NIEEDVTTLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLSACMV"
     gene            <921094..>922489
                     /locus_tag="AGOS_AFR270W"
                     /old_locus_tag="AFR270W"
                     /db_xref="GeneID:4622080"
     mRNA            join(<921094..921193,921252..>922489)
                     /locus_tag="AGOS_AFR270W"
                     /old_locus_tag="AFR270W"
                     /product="AFR270Wp"
                     /transcript_id="NM_211172.2"
                     /db_xref="GeneID:4622080"
     CDS             join(921094..921193,921252..922489)
                     /locus_tag="AGOS_AFR270W"
                     /old_locus_tag="AFR270W"
                     /note="NOHBY632; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A00825g;
                     1-intron"
                     /codon_start=1
                     /product="AFR270Wp"
                     /protein_id="NP_985817.2"
                     /db_xref="GeneID:4622080"
                     /translation="MNTVHSRARSLSSIQLLDSGTWISQKTSLRDTMKATVAPIQVES
                     RYLSPDIVKGYLSPLSEDQRMGVLESRRAVQDIVDKYKEPTRSKDSKMRRFFSGLRQD
                     KEQLQSGNLLVVVNIPAAVQKSELSLVSNWLRLVSTKTDSQEKRRFLDRIDNDKIQEV
                     YARTIDKPLDRLEFLLNIEMPTQLGNIAETRDVLRAICEHTGVCLDILDNTLMNFVSD
                     IPSLVVLDARSPDISLKVASGLPSNVAVRCRNANEIFSAIKILEHIAQPTLYPTVSHD
                     GLPICIHTTGNPDTFLALNYTPEVEDEVVRLVTRGIKMPKIMLKIAIEDLALFCDTWQ
                     DSILPTFVIGVEVDCSCVRFASYFNSQAQEEYRTERNVLGTMFSPMEPEAPPSKLSWI
                     KTLFRSSKEKRGGAGNEAAVDELTAASKEITDGISKFYSFLNYLHTAFNEQVN"
     gene            <922636..>923517
                     /locus_tag="AGOS_AFR271W"
                     /old_locus_tag="AFR271W"
                     /db_xref="GeneID:4622081"
     mRNA            <922636..>923517
                     /locus_tag="AGOS_AFR271W"
                     /old_locus_tag="AFR271W"
                     /product="AFR271Wp"
                     /transcript_id="NM_211173.2"
                     /db_xref="GeneID:4622081"
     CDS             922636..923517
                     /locus_tag="AGOS_AFR271W"
                     /old_locus_tag="AFR271W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR047C (BNA6)"
                     /codon_start=1
                     /product="AFR271Wp"
                     /protein_id="NP_985818.2"
                     /db_xref="GeneID:4622081"
                     /translation="MPEFKNLLPANGAWKHDITNWLQEDVPAFDYGGYVVGSATKTAT
                     LLCKQKGVLAGVPFADEVFRQCNLECQWLFVEGDELDPSATGKIPVAKVTGEARNILL
                     AERTALNILSRCSGIASASRNIIASARAAGYRGTVAGTRKTTPGLRRLEKYAMLVGGC
                     DTHRYDLSSMVMLKDNHIWATGSITRAVQDARAACGFTIKIEVECQSEAEADEAIAAG
                     ADVIMLDNFTGTSLRATAQRLKERWAGKKNFLLECSGGLRIDNLSEYLCQDIDIYSTS
                     SIHQGTPVVDFSLKIDH"
     gene            <923656..>924405
                     /locus_tag="AGOS_AFR272W"
                     /old_locus_tag="AFR272W"
                     /db_xref="GeneID:4622082"
     mRNA            <923656..>924405
                     /locus_tag="AGOS_AFR272W"
                     /old_locus_tag="AFR272W"
                     /product="AFR272Wp"
                     /transcript_id="NM_211174.1"
                     /db_xref="GeneID:4622082"
     CDS             923656..924405
                     /locus_tag="AGOS_AFR272W"
                     /old_locus_tag="AFR272W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL240W (DOC1)"
                     /codon_start=1
                     /product="AFR272Wp"
                     /protein_id="NP_985819.1"
                     /db_xref="GeneID:4622082"
                     /translation="MNQSALRRIEQIVPRVNLAEPREKPLRDRPLVLDDSQPNAPDRH
                     RYVTDLNVEYHEEDLSADLFLAKYTQGLHTLENQGYVDITSLAYWKPSSFKAGYPIEN
                     ALDDNPATFWQSDGSQPHTIDVFFSKRVDIIQLAMYFSLFVDESYTSETLRIYAGHSP
                     SDATYYKTLEVRNVNGWVKFTFEDNRPSDGLLKCQFLRIEVVTNHENGKDTHLRGIRM
                     FGPGESLVNIADAAIFEGFHSIEFLSQSRIR"
     gene            <924503..>927412
                     /locus_tag="AGOS_AFR273W"
                     /old_locus_tag="AFR273W"
                     /db_xref="GeneID:4622083"
     mRNA            <924503..>927412
                     /locus_tag="AGOS_AFR273W"
                     /old_locus_tag="AFR273W"
                     /product="AFR273Wp"
                     /transcript_id="NM_211175.2"
                     /db_xref="GeneID:4622083"
     CDS             924503..927412
                     /locus_tag="AGOS_AFR273W"
                     /old_locus_tag="AFR273W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL238W (CSE1)"
                     /codon_start=1
                     /product="AFR273Wp"
                     /protein_id="NP_985820.2"
                     /db_xref="GeneID:4622083"
                     /translation="MVSSSPQRLAFARDMSDLTTVAHYLGQSVIASTARSAEQQLRGL
                     ESQEGFALTLLHVVASNNLAASTRLAGALFFKNFIRRRWVDENGEHLLSARDVELVKK
                     EIVPLMIQLGSHLQVQIGESIAVIADSDFPERWPTLLDDLVDKLSAEDMVTNKGVLTV
                     AHSIFKRWRPLFTSDALYLEIKLVLEKFAGPFLHLLQTVDEQISANRADEAKLRLLFD
                     VLLVLVKLYYDLNCQDIPEFFEDNMQVGMGIMHKYLAYDNPLLEDETEDEEASVVTKV
                     KSSIAELVQLYTSRYEDVFGPMVEQFIQTTWNLLVSLTCQPKYDILVSKCLSFMTAVA
                     RIPRYFNLFNNEAAINSVTEKIILPNVTLRDSDVELFEDDPIEYIRRDLEGSDSDTRR
                     RACTDFLKELKEKNESLLTNIVLSHIKKFFEKYHAHPQENWKYKDLCVYLFTSLAVKG
                     NVTSSGVSSTNAMLDVVDFFTKEVMSDLNGHVPHVILRVDAIKYIHTFRNQLTKEQLV
                     EILPVMANFLQDSEYVVYTYAAVTIERILSIREPNPSNAMLFTKNDLTNSAHLLLDNL
                     FGLTLKQNTSPEKLAENEFLMKTIHRILLTAEDSIKPYAMDILNQLLEIIKIIAKNPS
                     NPRFTHFTFESVSVVIRYNHHNLNVLIDTMMPIFLDILAEDIQEFIPYVFQIIAYCLE
                     QIPSGNNIPENVKQLCQPLLSPAVWEMKGNIPAVTRLLKDIIKIDASVYPDLVPVLGV
                     FQRLIASKAYDTQGFELLEYFMNYIPLPSLQPYLKQIAVLLLQRLQSSRTEKYVKKLT
                     VFLGVISHKLGSDFVVQFIDDVQPGLFEQIWSNFIITALPSIGNLLDRKLALIGSLNT
                     VVNGSLFTSRYGSLVVPTMNVILTTAVSESIVHTKSEYINSEPSDEITTFGSSFSRLG
                     TIAEKSFDPLSHIDLTRGVKLYIANILTRLDPSFMNEITMGLSEDAKKALNSLGP"
     gene            complement(<927546..>929144)
                     /locus_tag="AGOS_AFR274C"
                     /old_locus_tag="AFR274C"
                     /db_xref="GeneID:4622084"
     mRNA            complement(<927546..>929144)
                     /locus_tag="AGOS_AFR274C"
                     /old_locus_tag="AFR274C"
                     /product="AFR274Cp"
                     /transcript_id="NM_211176.1"
                     /db_xref="GeneID:4622084"
     CDS             complement(927546..929144)
                     /locus_tag="AGOS_AFR274C"
                     /old_locus_tag="AFR274C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR051C (RET2)"
                     /codon_start=1
                     /product="AFR274Cp"
                     /protein_id="NP_985821.1"
                     /db_xref="GeneID:4622084"
                     /translation="MVVLAVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVANSS
                     RQHTFVEEEHVRYVYKPFDDYYIILITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDE
                     ILDNAFDILGSFDEIISLGCKENLSLSQINTFLSMESHEEKLQEIIERNKEFEAAEER
                     KRRAREISQRERERKLGIDPYAATEFRGSSDQNMSQAYSSYYSNASPAAQQSYKHLQQ
                     QQSHTIEEAIVPSQAYAGTSRGAGMKLGGKKGVHAPDLSSRSAGPQRVANMLQPVEEK
                     RTNEGILVSVKETVNAEIARDGTISTSELKGVLELRIKKPELSHVRLILDSAVDVKDR
                     SFQFKTHPNIDKALFMSSKVIGLKDPEKSFPSNDQSLGVLRWRKVGSADDPSLIPLQV
                     STWVSPADGAFDITVEFEINEAYNQEIKDLRFVLPLYTTDVVIKDDSNDVNAEIETID
                     EEHGIVVKVQSLVPGVSGVFCVSVETSDEEALFPMSVVFSHTDASKTFSRVGISKVTS
                     AKDDAEELPFEATSSLRTDEYVVV"
     gene            <929946..>932207
                     /locus_tag="AGOS_AFR275W"
                     /old_locus_tag="AFR275W"
                     /db_xref="GeneID:4622085"
     mRNA            <929946..>932207
                     /locus_tag="AGOS_AFR275W"
                     /old_locus_tag="AFR275W"
                     /product="AFR275Wp"
                     /transcript_id="NM_211177.1"
                     /db_xref="GeneID:4622085"
     CDS             929946..932207
                     /locus_tag="AGOS_AFR275W"
                     /old_locus_tag="AFR275W"
                     /note="Non-syntenic homolog of Saccharomyces cerevisiae
                     YKL034W (TUL1)"
                     /codon_start=1
                     /product="AFR275Wp"
                     /protein_id="NP_985822.1"
                     /db_xref="GeneID:4622085"
                     /translation="MDIDGNTFIFVIVIIFILMASPGGDGVTSQYEFNQMEQLKSQFR
                     DEYTSFKNMFSSSNFQNITGFKLSYSDAVQDPERNATYPIDGKSYTTWAPNQEYLLFP
                     DEVRDSVWEHVWRTDDVLETYPPNITATLHGNISLVSNNKYVRVPMPIPLFYQPPTDF
                     AQNQPPSGEYYLRSPDDILRYGLHNVTFDVGKVDLSVRHIDTVSPTWRRNSSKSKRFN
                     SQEDKWKLLRLNMDFADDEEHERHNVHGYGIYDVQRGQIIVMSESAKCHSLFAFPHYM
                     NLREDKARYKSLMKLIDDYWEASDYVNTLTMDDLQNWYRDANQKCEYVGFLQLKPWAQ
                     YTKDQIKMIDDELFWPIGRPVNISDIPEIEIEAGELYSPDCGVHLRLGTVAGPRYEVQ
                     VRSIRKHLLVGCALFGAQIYLLILQMQHTNTPSSVNKISFWCLAMMNLVDGLLGVSFW
                     VASSLRKDLYLSLLMDAIVCMILSGMFEIRYMISVYASQVNERGISVWTLLRGSNAET
                     NPPPAVIADETTISGSLYTQFIFKQLLCMFLVISSSSWPKNIRTIFEYVCLAILNSYW
                     IPQIYRNAVKGNQPRQRRRGARSENGRNNKMPMLWKFIVGTTIIRTAPVIYVFTYPSN
                     IFRHHRDIRYAVGLSVWLLLQMLILFLQDTFGARWFLPKSAIPEGYSYHKPLNSTCLL
                     EHGANDNYCVSCAICMSELAIHVEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYK
                     LQCPVCRAPLPPL"
     gene            complement(<932769..>933578)
                     /locus_tag="AGOS_AFR276C"
                     /old_locus_tag="AFR276C"
                     /db_xref="GeneID:4622086"
     mRNA            complement(<932769..>933578)
                     /locus_tag="AGOS_AFR276C"
                     /old_locus_tag="AFR276C"
                     /product="AFR276Cp"
                     /transcript_id="NM_211178.2"
                     /db_xref="GeneID:4622086"
     CDS             complement(932769..933578)
                     /locus_tag="AGOS_AFR276C"
                     /old_locus_tag="AFR276C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL250W (RMR1)"
                     /codon_start=1
                     /product="AFR276Cp"
                     /protein_id="NP_985823.2"
                     /db_xref="GeneID:4622086"
                     /translation="MSENTVPRAEDDVLGGSDQEYDRLSENQLDVEIQDMDRADISLW
                     GDESKSGSAAPSDTAVHEVAKQLLFLSAPLITVSFKDTTFTLFPLDNNTAGGPQAASA
                     RGHMLADGGHMHKSFSELIAAIRAFLEREYGRLELATKELLLTFPDLDLCITEDNTYS
                     KNISMNDIASIFNILRENSLERDEPNIPDHLHIVLTLCPRFVAKYNDLVELVDSHASF
                     SHVRGFSNDRQHPLVIDGNEPVPERYSEVVLKSSPTEDDSDELLEIIDGPA"
     gene            <934797..>936560
                     /locus_tag="AGOS_AFR277W"
                     /old_locus_tag="AFR277W"
                     /db_xref="GeneID:4622087"
     mRNA            <934797..>936560
                     /locus_tag="AGOS_AFR277W"
                     /old_locus_tag="AFR277W"
                     /product="AFR277Wp"
                     /transcript_id="NM_211179.2"
                     /db_xref="GeneID:4622087"
     CDS             934797..936560
                     /locus_tag="AGOS_AFR277W"
                     /old_locus_tag="AFR277W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL252C (RTG2)"
                     /codon_start=1
                     /product="AFR277Wp"
                     /protein_id="NP_985824.1"
                     /db_xref="GeneID:4622087"
                     /translation="MSAISDSDTEADVVSRNLCGVVDIGSNGIRFSISSKASHHARIM
                     PCVFKDRVGISLFEVQHCKNSLEKIPIPVDTIKEVCAAMKRFKLICDDFGVPETAVRV
                     VATEATREALNAQEFVDAIRESTGWLAKMLTREEEGRIGSYGVISSFNAVSGLYMDLG
                     GGSVQLSWVSCQNGEIKHSSTPVSLPYGAGALSRRMHTENKRDLFMEIKCALQDALPK
                     IGIPHAMIAAAKSSGGFELFTCGGGLRAMGYLLLSQIKEYPIKTVINGFSCSSEEFLT
                     MSDLLFLKGKVPGHKKDSKIFKVSQRRAQQLPAVGLLMSAALESLPKINIVHFSEGGV
                     REGTLYSILPREIRAQDPLIIATRPYAPLLASKYLELLKAALPESDVPALVIDRIAPA
                     LCNLAFVHASYAKELQPTAALHVATTGIIAGCHGLSHRIRALIGIALCNRWGADIPKP
                     EEAHKKALEEAVLRDSGKPDCHRTLFWTKYVGFIMFLICGVHPGGNIRDGVFTFDVHR
                     KDDVEADLQDLALGDSRYTKSQTSSRKPVFEVVVKISRDDLKTSASVRQRIITLQKRI
                     RRLSRGSTEKVKVGVQFSEAC"
     gene            <936648..>937556
                     /locus_tag="AGOS_AFR278W"
                     /old_locus_tag="AFR278W"
                     /db_xref="GeneID:4622088"
     mRNA            <936648..>937556
                     /locus_tag="AGOS_AFR278W"
                     /old_locus_tag="AFR278W"
                     /product="AFR278Wp"
                     /transcript_id="NM_211180.1"
                     /db_xref="GeneID:4622088"
     CDS             936648..937556
                     /locus_tag="AGOS_AFR278W"
                     /old_locus_tag="AFR278W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YFR052W (RPN12)"
                     /codon_start=1
                     /product="AFR278Wp"
                     /protein_id="NP_985825.1"
                     /db_xref="GeneID:4622088"
                     /translation="MEICHHKGLLILFSRTELSESRSTGHIEVVMVSLHELVKGLKAA
                     FQIRDYRTCVDLLGPIKIELIKTRLLVPDLLAASEGNATYLEDLEVAKKILEIGALSS
                     INLLDFAGFENYYAQLRAFYFGLPENHTLADSENKKKLISLYLLILLSQGDVTKFHSE
                     LEFLSKRDLGNIEENKYLSYPVRLEKLLMEGSYQKAWDMLQNGREDDKIEEFNIFDET
                     LMNAIRDSIARNTEVAYARLPLSNVKALLFFKSEKDTEAFAKARGWNIVNGCVLFDED
                     DVSEKKEQTSIVSKALSYATNLESIV"
     gene            complement(<937749..>939215)
                     /locus_tag="AGOS_AFR279C"
                     /old_locus_tag="AFR279C"
                     /db_xref="GeneID:4622089"
     mRNA            complement(<937749..>939215)
                     /locus_tag="AGOS_AFR279C"
                     /old_locus_tag="AFR279C"
                     /product="AFR279Cp"
                     /transcript_id="NM_211181.1"
                     /db_xref="GeneID:4622089"
     CDS             complement(937749..939215)
                     /locus_tag="AGOS_AFR279C"
                     /old_locus_tag="AFR279C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGL253W (HXK2) and YFR053C (HXK1)"
                     /codon_start=1
                     /product="AFR279Cp"
                     /protein_id="NP_985826.1"
                     /db_xref="GeneID:4622089"
                     /translation="MVHLGPKKPPTRKGSMADVPKTLVEQIASFERIFTVSAEKLQEI
                     TKHFVTELDKGLSKKGGNIPMIPGWVMDYPTGNETGDYLAIDLGGTNLRVVLVKLLGN
                     HQFDTTQSKYRLPNRMRTTQNASELWDFIAESLKDFLEEQFPEGVHQTLPLGFTFSYP
                     ASQDKINMGILQRWTKGFDIPGVEGHDVVPMLQESLRKVNVPIEVVALINDTTGTLVA
                     SLYTDAETKMGVIFGTGVNGAYYDVVKDIEKLEGRLPEDIPPESAMAINCEYGSFDNE
                     HLVLPRTKYDILIDEQSPRPGQQAFEKMTSGYYLGEVLRLALLDLHGQGLIFQGQDIS
                     KLETPYVMDTSFPARIEDDPFENLEETDDLFKDNLDIDTTRPERKLIRKLSEMIGNRA
                     ARLSVCGIAAICQKRGYETAHIAADGSVFNKYPGFQTRAAEGLRDIYGWEHSSSQDYP
                     IKIVAAEDGSGAGAAVIAALTTKRLAAGKSVGLPEAQN"
     gene            <940384..>942876
                     /locus_tag="AGOS_AFR280W"
                     /old_locus_tag="AFR280W"
                     /db_xref="GeneID:4622090"
     mRNA            <940384..>942876
                     /locus_tag="AGOS_AFR280W"
                     /old_locus_tag="AFR280W"
                     /product="AFR280Wp"
                     /transcript_id="NM_211182.1"
                     /db_xref="GeneID:4622090"
     CDS             940384..942876
                     /locus_tag="AGOS_AFR280W"
                     /old_locus_tag="AFR280W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL143C (SSL2)"
                     /codon_start=1
                     /product="AFR280Wp"
                     /protein_id="NP_985827.1"
                     /db_xref="GeneID:4622090"
                     /translation="MTEHNYQTRSRGKVYADTENGYLSDDSVATADGSDYMDQDEEPV
                     RAELIAAKPKARKSGSRKSKASDGGADTFNKLAAKDENFLNRLSLDVPPDFIPDAVSG
                     MFRSSDFSYLKLKPDHASRPLWIAPNDGRIILESFSPLAEQAQDFLVTIAEPVSRPSH
                     VHEYKITAYSLYAAVSVGLETDDIIAVLDRLSKVPVASSIVNFIKGATVSYGKVKLVI
                     KHNRYFVETSQADILQMLLKDKVIGPLRIDSTDAKPAAALNPAAAGNGAAAPVDQNDV
                     EAVFSSIVGGDNDLEEEDDDIDAVHSFEIDRESVELVKRRCQEIDYPVLEEYDFRNDN
                     RNPDLEIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAACTIKK
                     SVIVLCTSSVSVMQWRQQFLQWCTIQPENVAVFTSDNKEMFQTESGLVVSTYSMVANT
                     RNRSHDSQKVMDFLTGREWGFILLDEVHVVPAAMFRRVVSTIAAHAKLGLTATLVRED
                     DKISDLNFLIGPKLYEANWMELSQKGHIANVQCAEVWCPMTAEFYQEYLRENARKRML
                     LYIMNPTKFQACQFLIQYHEKRGDKIIVFSDNVYALQEYALKLGKPFIYGSTPQQERM
                     NILQNFQYNDQISTIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKR
                     RNDEGFNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLNGMESLPNLAYASA
                     RERRELLQEVLLKNEEAAGIEIGEDSENFVGRGAGAIKRMKSKAVKGEGSLAGLAGGE
                     DIAYLEYSSNKNKDLKDHHPLIRKMYYKNVKK"
     STS             941019..942377
                     /locus_tag="AGOS_AFR280W"
                     /old_locus_tag="AFR280W"
                     /standard_name="ha2600"
                     /db_xref="UniSTS:515570"
     gene            complement(<943074..>945059)
                     /locus_tag="AGOS_AFR281C"
                     /old_locus_tag="AFR281C"
                     /db_xref="GeneID:4622091"
     mRNA            complement(<943074..>945059)
                     /locus_tag="AGOS_AFR281C"
                     /old_locus_tag="AFR281C"
                     /product="AFR281Cp"
                     /transcript_id="NM_211183.2"
                     /db_xref="GeneID:4622091"
     CDS             complement(943074..945059)
                     /locus_tag="AGOS_AFR281C"
                     /old_locus_tag="AFR281C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL144W (TID3)"
                     /codon_start=1
                     /product="AFR281Cp"
                     /protein_id="NP_985828.2"
                     /db_xref="GeneID:4622091"
                     /translation="MAERRGSSGANGVLNSLNPQRFTSQIPSIGGNTNKKGVPGTNAA
                     LTDMINKSLARNGRSSLSRPVPEVRKSLRRSLRSSQRPSIVPGGGPSAYGALQSTRDP
                     RPLRDKNYQAVLQQEIFDYLQSRKFDIETGHAISLKSLKQPTQKDFICIFRWLYRRLD
                     PGYSFKRSLETEVYSILKTIQYPFLDTINKSQISAVGGSNWHKFLGMLHWLMNTSQRL
                     DSCLHKLDESKTMQLTQDITILNQPVTTLDEQDEKHEQYELMVERLFIEYISKCYKSF
                     INMEDDFSPFKEELEIGFDRFVHIIETDINNLGRQEEMLQQDCEMFAARCEGLKLARS
                     KHQALKGDLVKFQNYINAMKNKAEDWPRKLNQMVEEINEKKGLIKDIHAEIDKLRQAL
                     SQEDIQEIDQMNQQRDTFSKMLDTVSSKLDNLTGSVKSQKLNLESSSKVFLDTLEKFN
                     ASINGFVLARNNLQHPINPAELLIPVKANITLTDSTAITPSTILEGCTDILSSIKPNL
                     LKVNKEIDERISALQTENNQLEKELRGLRDTITSKGHMLESMENELSNIKSEYDEYQQ
                     VSHSKLLSQRIEIEKLERKIQNDRHKTQQRVAQAEQEIEDAAFKLKELTLKIQQERVV
                     LHRKLIKVIEYVVSFKMDVQGSIEALHDFSVEQLESL"
     gene            <945431..>946354
                     /locus_tag="AGOS_AFR282W"
                     /old_locus_tag="AFR282W"
                     /db_xref="GeneID:4622092"
     mRNA            <945431..>946354
                     /locus_tag="AGOS_AFR282W"
                     /old_locus_tag="AFR282W"
                     /product="AFR282Wp"
                     /transcript_id="NM_211184.2"
                     /db_xref="GeneID:4622092"
     CDS             945431..946354
                     /locus_tag="AGOS_AFR282W"
                     /old_locus_tag="AFR282W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL145C (PAN6)"
                     /codon_start=1
                     /product="AFR282Wp"
                     /protein_id="NP_985829.2"
                     /db_xref="GeneID:4622092"
                     /translation="MHVLNKVQEVSQWRKQTVDCKTQTIGFVPTMGCLHEGHMTLVRR
                     SCAENDFTVVSVFVNPSQFAPNEDLDRYPRTLAADRALLEEAGVDVLFAPSPAEMYPR
                     GIPLEVEAQRGPFVSVLGVSEMLEGRTRPRFFRGVATVVAKLVNIVAPDRAYFGQKDI
                     QQCIVVDTMFRELFMSVQMIMLPIERDANGLALSSRNKYMCAETIALASNIYRGLRAA
                     ATVLQDAPSDVLREAVIAAANTVWEPLINSGDFRVDYLSVADRTTLAELGPTISREQD
                     VVLSCAIYVTDRAKPDTVVRLLDNILVPPRT"
     gene            <946995..>948353
                     /locus_tag="AGOS_AFR283W"
                     /old_locus_tag="AFR283W"
                     /db_xref="GeneID:4622093"
     mRNA            <946995..>948353
                     /locus_tag="AGOS_AFR283W"
                     /old_locus_tag="AFR283W"
                     /product="AFR283Wp"
                     /transcript_id="NM_211185.2"
                     /db_xref="GeneID:4622093"
     CDS             946995..948353
                     /locus_tag="AGOS_AFR283W"
                     /old_locus_tag="AFR283W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL146C (ATG32)"
                     /codon_start=1
                     /product="AFR283Wp"
                     /protein_id="NP_985830.1"
                     /db_xref="GeneID:4622093"
                     /translation="MSTKSQVTRRVRTSIATPEDGVHGNNQHKGILDPHLSVLEMLDR
                     QDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDYSFLSGTHEVGAMHSSV
                     GILSSSDTSEEEAEMRPSAHGTVHLGSSLASPMRQLLVEEDNSCAEEDDCQTVTISMP
                     SSSTSLVMPKLSLSQRLGEPQLLLVGQPARKFWLTIPKCYQKLFDVKNLGMVTRWDVG
                     QRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIPVCQKGQKSTLAALLKRYTARKCIR
                     VYCSPIIMSNHHEKHRLLKHLHNLCNESESGYETELTVKSKKQHRRPRKKDAGPVALR
                     HWAIWTASFTIGIGIGCCISLMATTRFTFFSSAPLPLTAVIPAQIPSSVASDKPPHRL
                     VPHFYMLCKTTIRQLGTSLRLFFFEKFESRTWVHIFGMDLHSDDPLASLGRLMPLDFI
                     ML"
     gene            <948587..>951898
                     /locus_tag="AGOS_AFR284W"
                     /old_locus_tag="AFR284W"
                     /db_xref="GeneID:4622094"
     mRNA            <948587..>951898
                     /locus_tag="AGOS_AFR284W"
                     /old_locus_tag="AFR284W"
                     /product="AFR284Wp"
                     /transcript_id="NM_211186.2"
                     /db_xref="GeneID:4622094"
     CDS             948587..951898
                     /locus_tag="AGOS_AFR284W"
                     /old_locus_tag="AFR284W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL147C (SLN1)"
                     /codon_start=1
                     /product="AFR284Wp"
                     /protein_id="NP_985831.2"
                     /db_xref="GeneID:4622094"
                     /translation="MRLGYLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTT
                     GVYFTSNYRTLRADRLHVAARLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGN
                     RSAENWIEADKILGGFLERSKTFYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRP
                     LEMDKYEYNEALDVQVETLPYNKTLNLMSMTLPVEASTIIGRGNVVGFLTIVMSADPI
                     TAVNDTSVLGESMVSILTGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRD
                     AFLNRSDNYVTSTSSFYHFGALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPA
                     FKLTKIIIGTVLGVAVFMCIVTFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRS
                     SSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPFVTENHAANSGSCSSMSDHERYLHHI
                     ARYHDGETSTNILSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDR
                     QYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAIAMAE
                     QDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIF
                     GKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIK
                     LVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVVEEEEKACEEEPTADDTPERK
                     KKDSETVDDADAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRS
                     WVIVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTM
                     KLESKVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSR
                     KGKMNNSNGAGSIAESAIESFGKSESEASFGSVRVDRPFLQSTGTATSTRSVPTLSSA
                     ESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIF
                     MDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRP
                     MLKKILLEHTSQLKT"
     gene            complement(<952057..>952604)
                     /locus_tag="AGOS_AFR285C"
                     /old_locus_tag="AFR285C"
                     /db_xref="GeneID:4622095"
     mRNA            complement(join(<952057..952435,952597..>952604))
                     /locus_tag="AGOS_AFR285C"
                     /old_locus_tag="AFR285C"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="NM_211187.1"
                     /db_xref="GeneID:4622095"
     CDS             complement(join(952057..952435,952597..952604))
                     /locus_tag="AGOS_AFR285C"
                     /old_locus_tag="AFR285C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR094C (RPL40B) and YIL148W (RPL40A); 1-intron"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="NP_985832.1"
                     /db_xref="GeneID:4622095"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            <952954..>958230
                     /locus_tag="AGOS_AFR286W"
                     /old_locus_tag="AFR286W"
                     /db_xref="GeneID:4622096"
     mRNA            <952954..>958230
                     /locus_tag="AGOS_AFR286W"
                     /old_locus_tag="AFR286W"
                     /product="AFR286Wp"
                     /transcript_id="NM_211188.1"
                     /db_xref="GeneID:4622096"
     CDS             952954..958230
                     /locus_tag="AGOS_AFR286W"
                     /old_locus_tag="AFR286W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR095W (MLP1) and YIL149C (MLP2)"
                     /codon_start=1
                     /product="AFR286Wp"
                     /protein_id="NP_985833.1"
                     /db_xref="GeneID:4622096"
                     /translation="MSDHIESKAESKAEEVDYSRLAARLGLEQGQVQQLGEQLVRTLW
                     GREQAFRQLEAENTRLKVSIGAAESACEHGVEALRERQQQLAAEAGAQQRGQGEAGSA
                     GRAGGPSVPERVQQQLEETERRVAAGDSARRDLARLLEEKISDLDASQQELERVLGVN
                     KELRRHEMELEFTVQSQRSQSLREQAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNS
                     YREKTNGEIQSTQVELNIVKNELEVEHANVAALRSKNGELSKQLQDALCETKRLTDSL
                     HSEKQEFAREMALKQRLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFD
                     TKKKLELSQANVSRLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLA
                     ALRKQLVQERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEAT
                     ARERDEKVVQIKQYKNKVGDYETQVGHLVQQRSDLARQVQCLLIHISVRDDSSGPLTA
                     EEVEFVKKLQSCRDSATGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQ
                     EEHKTQSKVKSLEQNTVNEAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNN
                     SLPNPVGAAALQPQEVADGIAHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIE
                     LERERSSRELADEKLSLIQKSLELVKGENADLQNRAGSLQALLLEQDTRRQSTIEEFV
                     SAKSELFSISSQLTILQSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKER
                     DSLIEETRKRYETRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSLK
                     EELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSK
                     DLDEANRKLSSAYSEIERYKAASNATERPSLSYNAVQDNKDGSKQAAISLEAELTKLN
                     SDIAMANDRIKVLEDELNRREATYSTERSELQEKINALVTDKQRIEEAKADYQQKITQ
                     LQTDLEKQISSTNEAETKYQTALQKQAEISENIESLRKSSESYKSEIAKFKSAAEEAR
                     KVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRSPSSSLEPDTK
                     ISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQLSESKGLV
                     TEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQEKVQPM
                     EEQIKSLTATLTEKEQKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLASEIEVLK
                     AELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEAKLSE
                     AREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESFKK
                     QLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQEL
                     TARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIR
                     EAEEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKAD
                     LIKDHQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAK
                     APLGTNVPTKIPLENTQPLAQQVPVKPSPFQLAYAQATFGNVPFLFNKNSEQKKVEHQ
                     DDSDSHQNTGNGNKRQSEDRAEESPGKKLREE"
     gene            <958422..>960257
                     /locus_tag="AGOS_AFR287W"
                     /old_locus_tag="AFR287W"
                     /db_xref="GeneID:4622097"
     mRNA            <958422..>960257
                     /locus_tag="AGOS_AFR287W"
                     /old_locus_tag="AFR287W"
                     /product="AFR287Wp"
                     /transcript_id="NM_211189.1"
                     /db_xref="GeneID:4622097"
     CDS             958422..960257
                     /locus_tag="AGOS_AFR287W"
                     /old_locus_tag="AFR287W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL150C (MCM10)"
                     /codon_start=1
                     /product="AFR287Wp"
                     /protein_id="NP_985834.1"
                     /db_xref="GeneID:4622097"
                     /translation="MLSTTLNDPREIVPTSNYDILSDEEDMIEEGMNNMGFGLREDGT
                     ITNTKYSTVKLRLKQIESERSDLLARLEELKHRSKKKAKKSPTVEVPRSPTKAKCVED
                     EPAPSTSASTTYVEEPEENENERYLLSANTPTTSYFAEKFARARDSSASTMRRKQELL
                     KRRVYTFSDRDTAIEYTTFAVDEVETYSNMRINKRYVPEEDLKRILHDIKVLRLPKLF
                     AKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEKPAKYFTIRITDFHYDVQITVFGQ
                     KNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETARTTGRSFGLSIKHNMNCILEIG
                     HSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHLRSVNAKRVELNGNISLRAP
                     TRDGIQQAGYMTRNSHGTKIGLLPDVYAPRAPGAEQKFREHFASANAHRAYFDSDYHN
                     PDVLQNLESKRRKIQLSKKDQQINKQLSLVLGKNHTQVKDRVSEESLQQREKATKNVM
                     KTGILRHIGFDPTGGRMAAVLYQGDHGPADTVREPSISEILANKKRNIDLKPSKEARR
                     KRIQQRNEVYNSIFKEEAVATPQGSCETAQLSSADSSDEELEIVN"
     gene            complement(<960254..>961381)
                     /locus_tag="AGOS_AFR288C"
                     /old_locus_tag="AFR288C"
                     /db_xref="GeneID:4622098"
     mRNA            complement(<960254..>961381)
                     /locus_tag="AGOS_AFR288C"
                     /old_locus_tag="AFR288C"
                     /product="AFR288Cp"
                     /transcript_id="NM_211190.2"
                     /db_xref="GeneID:4622098"
     CDS             complement(960254..961381)
                     /locus_tag="AGOS_AFR288C"
                     /old_locus_tag="AFR288C"
                     /note="NOHBY633; No homolog in Saccharomyces cerevisiae;
                     Syntenic homolog of Kluyveromyces lactis KLLA0A00550g"
                     /codon_start=1
                     /product="AFR288Cp"
                     /protein_id="NP_985835.2"
                     /db_xref="GeneID:4622098"
                     /translation="MKETELFCKEGLEYAVAELWEEGKLRSVELAVREGRGAEARAPG
                     GPLVVLDSVRSGAGREPATDFYAKVMGPVLAVLSVEHEYVRTSSAASVRELAETFPRT
                     SETTVLVMSGDTTISEFVNALGSGAGVTVYALPLGTANAWAHSVGLGTPAKALQAFVQ
                     GRVHAVPFPLYRARFPSGYSIRFFIVLSAGFHANLLHLCNDERYQRLGVERFREASTE
                     ILDRYALAEHVRVRAADGSEQLAGLYAYFALLNTPHLEETYVPSPLSDPLLKQLHVLA
                     FEAELSRDKLNELLMAGYSTIRGSALSAPGLVYRNLGDSFTLSIENGASDRVANELCV
                     DGHLLNLVDLQAPGDVFDGSIEVGVVPASFGLKALVPAHIS"
     gene            <961480..>961776
                     /locus_tag="AGOS_AFR289W"
                     /old_locus_tag="AFR289W"
                     /db_xref="GeneID:4622099"
     mRNA            join(<961480..961493,961545..>961776)
                     /locus_tag="AGOS_AFR289W"
                     /old_locus_tag="AFR289W"
                     /product="AFR289Wp"
                     /transcript_id="NM_211191.1"
                     /db_xref="GeneID:4622099"
     CDS             join(961480..961493,961545..961776)
                     /locus_tag="AGOS_AFR289W"
                     /old_locus_tag="AFR289W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR095W-A (PCC1); 1-intron"
                     /codon_start=1
                     /product="AFR289Wp"
                     /protein_id="NP_985836.1"
                     /db_xref="GeneID:4622099"
                     /translation="MDHTLHLHVPFESARLADIAARALAPDPLLRPEELSVSFASDGA
                     SLNIKLAAIDARVLRVATNSIFEALKTVVETADELDF"
     gene            <962243..>965896
                     /locus_tag="AGOS_AFR290W"
                     /old_locus_tag="AFR290W"
                     /db_xref="GeneID:4622100"
     mRNA            <962243..>965896
                     /locus_tag="AGOS_AFR290W"
                     /old_locus_tag="AFR290W"
                     /product="AFR290Wp"
                     /transcript_id="NM_211192.2"
                     /db_xref="GeneID:4622100"
     CDS             962243..965896
                     /locus_tag="AGOS_AFR290W"
                     /old_locus_tag="AFR290W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL151C and YKR096W"
                     /codon_start=1
                     /product="AFR290Wp"
                     /protein_id="NP_985837.2"
                     /db_xref="GeneID:4622100"
                     /translation="MQVNEVAMEESGTRMDTALHQKRHSSALGGCRDGLAKRRGPRGG
                     LTACGLVVDAIGAEPGSPSYLPTTSSSNLDAAARAIDNSSLRQVSSTTLHDTRLELPS
                     RLSSSPVQVALDPYLTCADGQSCIVDRVEHFGYPQEEPSPRMGARPKEGVPQSLWSPH
                     SKSGFNTHSKAVASNSGRRGYPCTGSRFADAAGGEQLDDQGPSSNGNNGSSNNGDASG
                     EGAGHPGGGKSSAGGASNGSRGNSDNSANNNSNGNNSGNSNDSDNNGNSDSSVPTVAV
                     TAKQSSQALMEKLQEIYRNIVRQETELQQRCSQLTTSQTTDLKNLWIIYKVNAELIDN
                     YFMFITTALLPTQPEADLLIGKEIIEVYRIERRLWVYGTITFLDVLKNFSNFMDPEVC
                     CQFIIYVFISISNMLGDIPPKFSIIWLERLGDLSRMAIALYPSGFIDWKLSAEHWYHE
                     ALKYTFGHGKLYYHMSTVQQNTLAAFVNLGKSVFCRDTFIPSQQYMQLVIDNIYQRAF
                     AERNSGHHRNAHLVEYLKHTEVMLLPSFLESSELQDVVLAFFEQKFGVTSNVDFFDPR
                     LVFVQDSERLKHFFRHASLYAESHLLQLVGFGDPRNPFALLFELPKHLKERKDRREKR
                     KSKSSTSTQYDTSIDDDCAFAAPSEFFETIDSTKYIYKFPDDINIWKESLSYANVTAM
                     KCSMIVLRKFLHGPLLTALPHLLPWGYFLAATNSRVITIPQDEIRRFWVALVRQLFPF
                     NTIITFLNVLLLYMNNQTQANFPFDEYFEQFIDMSLADLVGYFCENEELPEVWECWGT
                     LWFDALNTKHITNLTDINSTGVKDHMFMDSPIDGISFDHNDESGEKFWKRCARVILLF
                     RALALECPFGLREISGGRNWRSLVFKFEEPPSEWCDMYLEPFTLVFDTFEQISPVNLD
                     QRATPYCGMTPDIDIRTLQGYRILLPDYYCFNRNGDMITGSLYTIGTLESSGIHGGDD
                     FNGKRLLENGELVSTERRDYNSLIDREEQPIMDEFLRHTHCKNDVRWEQMLPRGDLHC
                     FADTHVTYFVLDATTWLRHFGHVYKLAANNILKFAICLTTFQELRFLRKSKDESVLEA
                     ATRAVITVRQLYYERKLLPLRFTGNVAGHLEEHLEIEEQMTWRSHVDEFVIEAIHKAQ
                     DKFNALNDDAKAASRDCIPTGADQRFNFIALVTDDLNMRNKAGAQNIKAFSTRFMFSV
                     CNELGHAKNVCTN"
     gene            complement(<965927..>966493)
                     /locus_tag="AGOS_AFR291C"
                     /old_locus_tag="AFR291C"
                     /db_xref="GeneID:4622101"
     mRNA            complement(<965927..>966493)
                     /locus_tag="AGOS_AFR291C"
                     /old_locus_tag="AFR291C"
                     /product="AFR291Cp"
                     /transcript_id="NM_211193.1"
                     /db_xref="GeneID:4622101"
     CDS             complement(965927..966493)
                     /locus_tag="AGOS_AFR291C"
                     /old_locus_tag="AFR291C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL152W"
                     /codon_start=1
                     /product="AFR291Cp"
                     /protein_id="NP_985838.1"
                     /db_xref="GeneID:4622101"
                     /translation="MAQREVRRGAVLRQEGRRPLRVMARAAAPLATGRWLCEVVPAAV
                     AVRAVRAAPATAAMQALVCAGRRTSPGQSSQAVRMGGRGADMPERIQSALGRFATECK
                     VRRSRSRLGMERDGPTGPQVVVAICPVGARLVALHTAMGTIVVVAGGPGGGWQLGDRI
                     CTDGPLTFALYTGVYWSVGWRAEREASV"
     gene            <967045..>968670
                     /locus_tag="AGOS_AFR292W"
                     /old_locus_tag="AFR292W"
                     /db_xref="GeneID:4622102"
     mRNA            <967045..>968670
                     /locus_tag="AGOS_AFR292W"
                     /old_locus_tag="AFR292W"
                     /product="AFR292Wp"
                     /transcript_id="NM_211194.1"
                     /db_xref="GeneID:4622102"
     CDS             967045..968670
                     /locus_tag="AGOS_AFR292W"
                     /old_locus_tag="AFR292W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR097W (PCK1)"
                     /codon_start=1
                     /product="AFR292Wp"
                     /protein_id="NP_985839.1"
                     /db_xref="GeneID:4622102"
                     /translation="MSPSKVYQTPEEKIRAELGLSSGVLTIRRNAPAAVLYEDALAER
                     KTAISSTGALIAYSGEKTGRSPKDKRIVDEPTSSDNIWWGPVNRKASEKTWLINRERA
                     ADFLRTREHLYIVDAYAGWDPRYRIKIRIVCCRAYHALFMTNMLIRPTEEELAEFGEP
                     DFTVWNAGQFPANTHTEGMSSKTTVEINFRAMEMVILGTEYAGEMKKGIFTVMFYLMP
                     INHNVLTLHSSANQGPNNDVTLFFGLSGTGKTTLSADQHRKLIGDDEHCWSDYGVFNI
                     EGGCYAKCIGLSGEKEPEIFNAIKYGSVLENVVYDPVTRVVDYEDSSITENTRCAYPI
                     EYIPSAQIPCLSENHPSNIVLLTCDASGVLPPVSRLTPEQVMYHFISGYTSKMAGTEQ
                     GVTEPEATFSSCFGQPFLALHPMKYATMLAEKMSQHNASAWLINTGWTGSSYTAGGKR
                     CPLKYTRAILDSIHDGTLAQAEYETLPVFGLSIPKAVEGVPAELLNPAKNWVEGEGKY
                     ASAVSALASKFTENFKIYQDQATEEVVRAGPQI"
     gene            complement(<968775..>969872)
                     /locus_tag="AGOS_AFR293C"
                     /old_locus_tag="AFR293C"
                     /db_xref="GeneID:4622103"
     mRNA            complement(<968775..>969872)
                     /locus_tag="AGOS_AFR293C"
                     /old_locus_tag="AFR293C"
                     /product="AFR293Cp"
                     /transcript_id="NM_211195.1"
                     /db_xref="GeneID:4622103"
     CDS             complement(968775..969872)
                     /locus_tag="AGOS_AFR293C"
                     /old_locus_tag="AFR293C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL153W (RRD1)"
                     /codon_start=1
                     /product="AFR293Cp"
                     /protein_id="NP_985840.1"
                     /db_xref="GeneID:4622103"
                     /translation="MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLK
                     LVQGQKIPKSSQNRAVVRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGE
                     LDGLLETLLPEAARRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWT
                     EDKFTGEDMLYVWARYYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQD
                     RNVPMQPSDILDPKAVARYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWS
                     KVTTGLIKMYRVEVLNKFPVVQHFWFGTGFFPWVDMAHGMSLPNYEAPSETSEKPAAG
                     TAHTTTTTMPPPRMTANCGYGPLGRLVTPRR"
     gene            <970083..>971105
                     /locus_tag="AGOS_AFR294W"
                     /old_locus_tag="AFR294W"
                     /db_xref="GeneID:4622104"
     mRNA            <970083..>971105
                     /locus_tag="AGOS_AFR294W"
                     /old_locus_tag="AFR294W"
                     /product="AFR294Wp"
                     /transcript_id="NM_211196.1"
                     /db_xref="GeneID:4622104"
     CDS             970083..971105
                     /locus_tag="AGOS_AFR294W"
                     /old_locus_tag="AFR294W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL154C (IMP2)"
                     /codon_start=1
                     /product="AFR294Wp"
                     /protein_id="NP_985841.1"
                     /db_xref="GeneID:4622104"
                     /translation="MDEPSRGILNRSGAGTTFGTQGANAGDAGSAGKEGAGRRTSSPI
                     GVTIKIEEPPEQRGRTRNKQSGAAFSSSRSRTKSRSRSRVSVTDQEFLRWTILRADPS
                     ERLHLGAVEDEEDDDELSDEEQLSDVENDYDVDAELDYDLGARVLPNFAASIQQVLDV
                     QPTWLARYRASQPAGAARVDVLQDTCTRAVRHFARHSGAPGPAGKTFLAYLEDLNVSA
                     AEKLYALTYTFGAVLANHDTLYIFVLCDAVDVESHLNRVAEQVAFLLDCSAAALDDLD
                     VVVLALQHAYPRHLLTETIHAFRPAGLIVPLQIATRSLAGYVSSVPTLIVRKKLKRAR
                     RRGIFD"
     gene            <971645..>973540
                     /locus_tag="AGOS_AFR295W"
                     /old_locus_tag="AFR295W"
                     /db_xref="GeneID:4622105"
     mRNA            <971645..>973540
                     /locus_tag="AGOS_AFR295W"
                     /old_locus_tag="AFR295W"
                     /product="AFR295Wp"
                     /transcript_id="NM_211197.2"
                     /db_xref="GeneID:4622105"
     CDS             971645..973540
                     /locus_tag="AGOS_AFR295W"
                     /old_locus_tag="AFR295W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL155C (GUT2)"
                     /codon_start=1
                     /product="AFR295Wp"
                     /protein_id="NP_985842.2"
                     /db_xref="GeneID:4622105"
                     /translation="MFRHTSRRLLPWACGAVAAAAAVGAVSRPSLVNEVPTELKLERR
                     APAPPSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTS
                     SKSTKMAHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYK
                     WWQVPYFYVGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFN
                     DSRMNATIAVTAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVV
                     VNATGPFSDRLLQMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIIL
                     PSYYCPKNMGLLDAETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDIL
                     KELQHYIKFPVKREDVQSAWAGIRPLVKDPRKNLSDTQGLVRSHLVFTSKNGMVTISG
                     GKWTTYREMAEETVNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSQQYNIPP
                     LLAEHLSQNYGTKAAQVCELFEDDRANMLPVSLAADKPTSIDYNAFRYPYTIGELKFT
                     MTHEYARTPLDFLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIE
                     YIKTFGV"
     gene            complement(<973986..>977495)
                     /locus_tag="AGOS_AFR296C"
                     /old_locus_tag="AFR296C"
                     /db_xref="GeneID:4622106"
     mRNA            complement(<973986..>977495)
                     /locus_tag="AGOS_AFR296C"
                     /old_locus_tag="AFR296C"
                     /product="AFR296Cp"
                     /transcript_id="NM_211198.2"
                     /db_xref="GeneID:4622106"
     CDS             complement(973986..977495)
                     /locus_tag="AGOS_AFR296C"
                     /old_locus_tag="AFR296C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL156W (UBP7) and YKR098C (UBP11)"
                     /codon_start=1
                     /product="AFR296Cp"
                     /protein_id="NP_985843.2"
                     /db_xref="GeneID:4622106"
                     /translation="MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERA
                     ANLFESYQDLVREGQTREGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYE
                     REPNMTNVVQMVTEKVDAVLLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHL
                     TVDGKRRGGHHAIGGAIPEVAVQADTLWSAPKLEENDLLRTVVSVSRSPSVSLSRPSS
                     RGGDFVENALDGNSTKNGGRNTSKREGRRNSRRSDRSGRRNDGAKQRNGRSPNRSRSR
                     GRSRSRVRNRSRSQTRIGGPTSDMADAKERGRTRSRSWSRSGSRSPSYSIRSTGGSRS
                     PSRSPSRSASRSPIRGRSRSRSGSRTPELGSATASVHSWSYLQTTGQQSRWSVLPNDL
                     PNAGQNKYNQESAVSFEQQELDRPHNSRVEPYNPFANGNAAGLESCNPLTRLYETSSI
                     KCSDLMIILESDIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSV
                     NEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLTKCLQ
                     GGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRDTSVSDHNPFRATPPVPTARPPVPP
                     LPTAPPPVAPYISSPRPVPFIPLQQPSLSLLHTSANIVKPGKAELRNELSRITGQIDH
                     TQYNQPEKYRYLPDSRESPYPIEYEDPKHTERSRGWLSAGSSEAHFSVPTIEKNPNEY
                     IALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLKSSNMDNMSRSFYML
                     FKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFLLFLLDRLRDELSYLAAV
                     VNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQGQIEHQLSCQRCDFS
                     SYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTGQNAWDCPKCGVNS
                     SGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRLFKIGSKSRSRSSSPFISGPKS
                     SGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLK
                     NNEVAKYRLYSTINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHG
                     NYDRGITSVSSSDVYLLFYERIS"
     gene            <977917..>980148
                     /locus_tag="AGOS_AFR297W"
                     /old_locus_tag="AFR297W"
                     /db_xref="GeneID:4622107"
     mRNA            <977917..>980148
                     /locus_tag="AGOS_AFR297W"
                     /old_locus_tag="AFR297W"
                     /product="AFR297Wp"
                     /transcript_id="NM_211199.1"
                     /db_xref="GeneID:4622107"
     CDS             977917..980148
                     /locus_tag="AGOS_AFR297W"
                     /old_locus_tag="AFR297W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR099W (BAS1)"
                     /codon_start=1
                     /product="AFR297Wp"
                     /protein_id="NP_985844.1"
                     /db_xref="GeneID:4622107"
                     /translation="MAASVPKSNAAEDIKSKKMKCRRQKINPLDVTESLGYQTHRRGI
                     RKPWSKEDDDVLRNAVHQSLLELGYPEGIESIRTIRESQEVCKQIPWEKVVLYFDTKV
                     RKPKDVRKRWTSSLDPNLKKGRWTPEEDRLLLESYQRHGPQWLKVSQELAGRTEDQCA
                     KRYIEVLDPSTKDRLREWTMEEDLALISKVKMYGTKWRQISSEMESRPSLTCRNRWRK
                     IITMVIRGKASETIIQAVESGSEMLSKKGALQDTLRTHSEEQALDDEDGESGTTNSLE
                     HEGPQPGTGAGAHRATGEHPEQNGIPGGRPDGVVETGVPTLLAVNGRPKEPHSAMDME
                     GSPGYTSESTLFSHQTVRIQSAMSPQGCGLGPNVDNRAKRDAPTPAIQVGGSVNYMEG
                     ETNMGFGLPSAHTPVQGPAATPHMQNERMMRSEAINSSLATPEEPPVVNRTVPHLGQC
                     SQQAHPGISGLPDRPAHVLQHAQPRIPDSTFTEWKYSLKGPDGVALGGDILEMSMVEK
                     LVNYSKQNGISISIHQHVHHHYVNTVMPQTHLPDDKRFDAQFGSGFGLTSRQPDAFEL
                     DVDLGARTSHYDGLMLDSLPQPPLGNLYMQNYNMSPQPPFSRPPTTSSAGSGKADLSE
                     LSPQRKAHFTALPPHVRLQLGSSDASRDSSQRPRKQRRKRLRDPAHSSASSATNTPHS
                     AIASPSSRDHAPSAAPEEEDDFWESLRKLASNPPRTSARAAPRRDSWTAGEPYRGLPY
                     NPS"
     gene            complement(<980197..>980470)
                     /locus_tag="AGOS_AFR298C"
                     /old_locus_tag="AFR298C"
                     /db_xref="GeneID:4622108"
     mRNA            complement(join(<980197..980409,980462..>980470))
                     /locus_tag="AGOS_AFR298C"
                     /old_locus_tag="AFR298C"
                     /product="AFR298Cp"
                     /transcript_id="NM_211200.1"
                     /db_xref="GeneID:4622108"
     CDS             complement(join(980197..980409,980462..980470))
                     /locus_tag="AGOS_AFR298C"
                     /old_locus_tag="AFR298C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL156W-B; 1-intron"
                     /codon_start=1
                     /product="AFR298Cp"
                     /protein_id="NP_985845.1"
                     /db_xref="GeneID:4622108"
                     /translation="MTLLGKAVHISIDLVLVSTCLAGIRRNTGLTVKLDNVQDNFIKD
                     YTEKLLNVGESAFDYAVAYCGSSSSFQRK"
     gene            <980614..>981171
                     /locus_tag="AGOS_AFR299W"
                     /old_locus_tag="AFR299W"
                     /db_xref="GeneID:4622109"
     mRNA            <980614..>981171
                     /locus_tag="AGOS_AFR299W"
                     /old_locus_tag="AFR299W"
                     /product="AFR299Wp"
                     /transcript_id="NM_211201.1"
                     /db_xref="GeneID:4622109"
     CDS             980614..981171
                     /locus_tag="AGOS_AFR299W"
                     /old_locus_tag="AFR299W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL157C (COA1)"
                     /codon_start=1
                     /product="AFR299Wp"
                     /protein_id="NP_985846.1"
                     /db_xref="GeneID:4622109"
                     /translation="MFKTGISVFRSRVLARGIAQCRVGARAASTAAETVLKDGAKPMR
                     IDRELPDPYKDRFKQRATFAVFATATTAALLLIFNYEKVQSPVVTNTMYQMRRLGVVR
                     ELLGDNLEFGGLLGWVHGELNQVAGRVNVRFTLKGSKGVPGEVRLVADRENRQQQFLI
                     REWTVTIDGKTVDLLADGAVRTLET"
     gene            complement(<981342..>982265)
                     /locus_tag="AGOS_AFR300C"
                     /old_locus_tag="AFR300C"
                     /db_xref="GeneID:4622110"
     mRNA            complement(<981342..>982265)
                     /locus_tag="AGOS_AFR300C"
                     /old_locus_tag="AFR300C"
                     /product="AFR300Cp"
                     /transcript_id="NM_211202.1"
                     /db_xref="GeneID:4622110"
     CDS             complement(981342..982265)
                     /locus_tag="AGOS_AFR300C"
                     /old_locus_tag="AFR300C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YKR100C (SKG1) and YIL158W (AIM20)"
                     /codon_start=1
                     /product="AFR300Cp"
                     /protein_id="NP_985847.1"
                     /db_xref="GeneID:4622110"
                     /translation="MAVDTTTVAVALAVVLPVSIAVLIALVFWCKTQRRFKREEQDDE
                     KNRGYDDEVVTFREMRASSGTLGPDGTPPTACAEGSGSSEGSESEKDPSPTPAPAGRA
                     ARTYMPAYRRRLNRSLSRQQSRADEMTTNSSAASYDTQHAQNAQLSVFEQMVPVLQVD
                     NSSPFANPRDAAFERGSRHSSESLMKSLKNQDFGSYPKRRPSAANTANLAVYNGSVSS
                     FSSRVPSSTTLNCMGDESFYAYEGSVLPRTGRDLPEVKQDVYMLKNNYDVTNNEEITE
                     EDQYENEFTNYSENKREFIDSLRPKAERMSN"
     gene            complement(<982676..>987643)
                     /locus_tag="AGOS_AFR301C"
                     /old_locus_tag="AFR301C"
                     /db_xref="GeneID:4622111"
     mRNA            complement(<982676..>987643)
                     /locus_tag="AGOS_AFR301C"
                     /old_locus_tag="AFR301C"
                     /product="AFR301Cp"
                     /transcript_id="NM_211203.1"
                     /db_xref="GeneID:4622111"
     CDS             complement(982676..987643)
                     /locus_tag="AGOS_AFR301C"
                     /old_locus_tag="AFR301C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL159W (BNR1)"
                     /codon_start=1
                     /product="AFR301Cp"
                     /protein_id="NP_985848.1"
                     /db_xref="GeneID:4622111"
                     /translation="MKTRATRARQMSSVKLVLAHNYMMRPWSAGSGAERGWEAGGASR
                     GARWAGAERWARAPHSLPYLCGAGAPVGGAGRGAAAAPVSAFDQERMPGAHVVDFYFE
                     RMRGGRVRQGRKYMPDISYMKKWELVCTHHNQAAMGPALEHLAAEDEDAAIQLVALVN
                     TKLNAPICAANLLYQLEQLLRQNSLCLIFVAQDGIAQLLRHSAAMPTEMEYVYLRCFK
                     TLITQEQGRLAVLESPEAVRVLCRYVAAFESQARTRLLTTDILLLLSYVDSTRVSQEL
                     EQHYSRWLAAVETTITDEAQWRRSPFRAQSPQQFMIDYCVSTMFLINALIQGMPSYQA
                     KGKTIRLLRDAGIHRIFHRIVSSGEKFDSEILLDEISKYQTRETEINAKFVPETPPSR
                     YVSFAAQIKTIVSLTQGTSLESSMALVLDSIRQIITSRTSAEAAKLLQLFHSIFKYLI
                     AHSYDREELGTESVLRAALNKLMDDLQSTQVNQRAVQELEAAHAQIEDLKKAVTKLEH
                     QKFVTKSIISRELSATKQTLSQKLDYIAELEDKLEALETQLKNEREKYEREIANRDSE
                     RRLSNSSVFLFAQLKNGNGLPHSNVSRTPSLTRSKRVSYSALLTENQSRRSFSGPEGI
                     TTSENDNPRADHTFGSQSHRRTHSTMLSGAVSPINLADLESRPLHVTSPRPTLASNKS
                     KTTKPQKLGKDIATTRPLIPPPPPLPPSPYSGQLGAKGAAAAPSVTEAASVGTLAPAQ
                     TAMASAVHEATVPGIESSAVPGETTPIRVGGASRLSHASWGEGTPKLESVPEVAAAEI
                     NQEMAGSDIVGGATAQAPVPLDQSTGAAPLPGRQAPQSVPMPKCLNCPATSTDKTVIS
                     QPQLQMAREPTHDDSGAVASGLGEACTESNQGQTLENQCPAAPAAVIQTASAATQVPM
                     GSQAVAASGVPASLSRVPTPAAGSAQQTCEGLAGPPAHPYAEVISEPLSVSELTQVLE
                     TAISPSTRDTEFGKNALITTSPGSILPPPPPLPGVLTKHVTGTSFQLQTELAPPPPPL
                     PDVLTKHVAASCLQPQAVPAPAPQSELKNAVVPAPPPAPPVPDVLLKNVIVPPPPPPM
                     PEVLLRNAGAPPAPPIPDVLLKNAILPIPPPPPPPPLFDGHACPPPPPLPNFASAAGQ
                     GLAPTMLTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQQRVSKSSELESLGIFKEI
                     EELFEIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKV
                     LSCDSEVMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYLTGERPEKDPAELERADR
                     IYLELFYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFF
                     IIVEIGNYMNQKPVQGIQLSSLNKLAFTKTIKDNNLSFIHVLERIVRTRYPSVHDFVE
                     GINSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTK
                     LAQAKKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAK
                     ENTEREELDRTYEKRRRLLEQTAALQDRRRSSGLSSVPSSAGDSADKDAVDTLMRRLR
                     DLNQDARNTRDRKTEVTRLPGRLKRKEEDELMSRTQEMLFDIKKI"
     gene            <988058..>989269
                     /locus_tag="AGOS_AFR302W"
                     /old_locus_tag="AFR302W"
                     /db_xref="GeneID:4622112"
     mRNA            <988058..>989269
                     /locus_tag="AGOS_AFR302W"
                     /old_locus_tag="AFR302W"
                     /product="AFR302Wp"
                     /transcript_id="NM_211204.1"
                     /db_xref="GeneID:4622112"
     CDS             988058..989269
                     /locus_tag="AGOS_AFR302W"
                     /old_locus_tag="AFR302W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YIL160C (POT1)"
                     /codon_start=1
                     /product="AFR302Wp"
                     /protein_id="NP_985849.1"
                     /db_xref="GeneID:4622112"
                     /translation="MSSRLNNIKDHVTGQSQATVKGTSPDDVVIVAAYRTAIAKAFKG
                     GFHEMPSDQLLYEFLVKFFEKVDVDKKLIQEVTCGNVLNLGAGANEHRAACLAAGVPF
                     NVPFMAINRQCSSGLTAVNDIANKIKVGQINVGLALGVESMSVNYPRMNFDHTSPDLQ
                     ENKEARKCYIPMGITNENVAKAFKIPRAVQDEFAADSYKKAEAAVKGGLFQEEILPIT
                     NPDGKVINTDEGPRKGVTAESLGKLRPAFIPEKGVTTAGNASQVSDGAAGVLLARRSV
                     AEKLGLPILGKYVAFQAVGVPPEIMGVGPAYAIPAVLEQTGLQVGDVDIFEINEAFAG
                     QALYCVEKLGIDKTKLNPRGGAIALGHPLGCTGARQIATIMRELQPGQIGLTSMCIGS
                     GMGAAAIFVKE"
     gene            990019..990192
                     /locus_tag="AGOS_AgSNR45"
                     /old_locus_tag="AgSNR45"
                     /db_xref="GeneID:4622113"
     ncRNA           990019..990192
                     /ncRNA_class="snRNA"
                     /locus_tag="AGOS_AgSNR45"
                     /old_locus_tag="AgSNR45"
                     /product="AgSNR45"
                     /note="Identified by similarity to Saccharomyces
                     cerevisiae SNR45; start and end coordinates are
                     approximate; in synteny"
                     /transcript_id="NR_149390.1"
                     /db_xref="GeneID:4622113"
     gene            <990504..>992219
                     /locus_tag="AGOS_AFR303W"
                     /old_locus_tag="AFR303W"
                     /db_xref="GeneID:4622114"
     mRNA            <990504..>992219
                     /locus_tag="AGOS_AFR303W"
                     /old_locus_tag="AFR303W"
                     /product="AFR303Wp"
                     /transcript_id="NM_211205.1"
                     /db_xref="GeneID:4622114"
     CDS             990504..992219
                     /locus_tag="AGOS_AFR303W"
                     /old_locus_tag="AFR303W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR124W (ASN2) and YPR145W (ASN1)"
                     /codon_start=1
                     /product="AFR303Wp"
                     /protein_id="NP_985850.1"
                     /db_xref="GeneID:4622114"
                     /translation="MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTI
                     LVHERLAIVGLDSGAQPINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPII
                     PLYLKYDVETPQHLDGMFAWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFAS
                     ELKCLVDECDEITAFPPGHVYDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEK
                     AVRKRLMAEVPYGVLLSGGLDSSLIASIAARETERANREAGDVYADGKHLAGMDDRGL
                     LHTGGWSRLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLE
                     TYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETV
                     KRVNNLHLADCLRANKSTMAWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKY
                     ILRKAFDTSDEPGVDPYLPEEILWRQKEQFSDGVGYSWIDGLKDAAERAISDEQFANP
                     NPAWGDDIPTTKEAFWYRLKFDALFPQPTAAATVMRWVPKADWGCAEDPSGRYAKIHD
                     QHISS"
     gene            <993113..>996160
                     /locus_tag="AGOS_AFR304W"
                     /old_locus_tag="AFR304W"
                     /db_xref="GeneID:4622115"
     mRNA            <993113..>996160
                     /locus_tag="AGOS_AFR304W"
                     /old_locus_tag="AFR304W"
                     /product="AFR304Wp"
                     /transcript_id="NM_211206.2"
                     /db_xref="GeneID:4622115"
     CDS             993113..996160
                     /locus_tag="AGOS_AFR304W"
                     /old_locus_tag="AFR304W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR125W"
                     /codon_start=1
                     /product="AFR304Wp"
                     /protein_id="NP_985851.2"
                     /db_xref="GeneID:4622115"
                     /translation="MTKNRRFSAWSHRPSISEALNIQLNIPDSPSGGANAGGAVSERI
                     PTLMRPEAYLGRSYVGSFSNSGSLMSREAGAAGPDSPPLPRFRDQASSYVHNGSHLHR
                     QTAALCDDSRAYDGGPEEEEALVFEGNMILQEGAPPRFGVGPYNLCKVDSNISEVLLN
                     VDEAVDDSDSDQEAGTRLFLSPITTDYIHSYGAINEEQSASETASRAETGPSPLRFWG
                     TRTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVY
                     SGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGA
                     VFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLF
                     MDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTL
                     RDKGWIFPLTESGGRWYDYLELYNPQRIHWKLVLGEIPTMLALTFFGILHVPINVPAL
                     AISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLA
                     IATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIIL
                     TMGIFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSAVHRDYLQSNFLEKV
                     AEQIYVLKLQNNLFFGTIISIEEKIGNLLEPNGSEYKKIIKYLILDFKHINIDNIDYS
                     AAEGFNRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCEN
                     ELLCEYRSLLSRAHRVKVRRRSKDIVPKAQIPLENTPRNAQIMTAAQAVYSGEQQLNK
                     TLSKYKASHPALALLLVALKTYRSGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDE
                     GDMFFVVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSVVRTETECVLWM
                     IDAPGLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING"
     gene            <996522..>997451
                     /locus_tag="AGOS_AFR305W"
                     /old_locus_tag="AFR305W"
                     /db_xref="GeneID:4622116"
     mRNA            <996522..>997451
                     /locus_tag="AGOS_AFR305W"
                     /old_locus_tag="AFR305W"
                     /product="AFR305Wp"
                     /transcript_id="NM_211207.1"
                     /db_xref="GeneID:4622116"
     CDS             996522..997451
                     /locus_tag="AGOS_AFR305W"
                     /old_locus_tag="AFR305W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR127W"
                     /codon_start=1
                     /product="AFR305Wp"
                     /protein_id="NP_985852.1"
                     /db_xref="GeneID:4622116"
                     /translation="MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPY
                     DMALQDADGLDHGSPCGTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEY
                     LKDFDHNNWDSWNTYEKFGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQ
                     SPYYVVSNGPSDGAKALGQWPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY
                     VSNQPIGVHDDSIPKRTIFVPALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT
                     REHVIHDSDQDLDSYSILNPKEQVTHRFSLQMH"
     gene            complement(<997469..>998428)
                     /locus_tag="AGOS_AFR306C"
                     /old_locus_tag="AFR306C"
                     /db_xref="GeneID:4622117"
     mRNA            complement(<997469..>998428)
                     /locus_tag="AGOS_AFR306C"
                     /old_locus_tag="AFR306C"
                     /product="AFR306Cp"
                     /transcript_id="NM_211208.1"
                     /db_xref="GeneID:4622117"
     CDS             complement(997469..998428)
                     /locus_tag="AGOS_AFR306C"
                     /old_locus_tag="AFR306C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR147C"
                     /codon_start=1
                     /product="AFR306Cp"
                     /protein_id="NP_985853.1"
                     /db_xref="GeneID:4622117"
                     /translation="MSSQTTKEAAKARTVVETLCDPDIDADMLHIWSEWIQPECILIF
                     LPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKRVYTLVEQVEHKV
                     KAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRSPK
                     GVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECVLQSAEKLV
                     KNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMK
                     DIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF"
     gene            complement(<998637..>1000589)
                     /locus_tag="AGOS_AFR307C"
                     /old_locus_tag="AFR307C"
                     /db_xref="GeneID:4622118"
     mRNA            complement(<998637..>1000589)
                     /locus_tag="AGOS_AFR307C"
                     /old_locus_tag="AFR307C"
                     /product="AFR307Cp"
                     /transcript_id="NM_211209.1"
                     /db_xref="GeneID:4622118"
     CDS             complement(998637..1000589)
                     /locus_tag="AGOS_AFR307C"
                     /old_locus_tag="AFR307C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR128C (UTP8)"
                     /codon_start=1
                     /product="AFR307Cp"
                     /protein_id="NP_985854.1"
                     /db_xref="GeneID:4622118"
                     /translation="MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTV
                     GVSGSSISQYVINPTPKLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTL
                     HAVLRKAGAAPQETGLDASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDY
                     QLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQNKKTCYKLFQLNHSAENLPIT
                     ELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFVRKDDQVS
                     LQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGESNRT
                     FAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDDDE
                     SPNIDFAAILAELTSRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIF
                     ATFADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHEL
                     FTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAK
                     PQLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKH
                     LNSVTRLDESPVAATIPLYSVEYLDS"
     gene            <1000963..>1001541
                     /locus_tag="AGOS_AFR308W"
                     /old_locus_tag="AFR308W"
                     /db_xref="GeneID:4622119"
     mRNA            <1000963..>1001541
                     /locus_tag="AGOS_AFR308W"
                     /old_locus_tag="AFR308W"
                     /product="AFR308Wp"
                     /transcript_id="NM_211210.1"
                     /db_xref="GeneID:4622119"
     CDS             1000963..1001541
                     /locus_tag="AGOS_AFR308W"
                     /old_locus_tag="AFR308W"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR129W (SYF2)"
                     /codon_start=1
                     /product="AFR308Wp"
                     /protein_id="NP_985855.1"
                     /db_xref="GeneID:4622119"
                     /translation="MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVY
                     SMAEEPADEAEADDTQSEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYR
                     SELHQLHRRGVVKGRATNGRISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQKKA
                     AKDGGRATAGSLNDKNRHFNEKLDREFRKRGQ"
     gene            complement(<1001546..>1002640)
                     /locus_tag="AGOS_AFR309C"
                     /old_locus_tag="AFR309C"
                     /db_xref="GeneID:4622120"
     mRNA            complement(<1001546..>1002640)
                     /locus_tag="AGOS_AFR309C"
                     /old_locus_tag="AFR309C"
                     /product="AFR309Cp"
                     /transcript_id="NM_211211.1"
                     /db_xref="GeneID:4622120"
     CDS             complement(1001546..1002640)
                     /locus_tag="AGOS_AFR309C"
                     /old_locus_tag="AFR309C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YPR148C"
                     /codon_start=1
                     /product="AFR309Cp"
                     /protein_id="NP_985856.1"
                     /db_xref="GeneID:4622120"
                     /translation="MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKI
                     DDPKTILSLKTRKRQLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFE
                     VEGYDYPPNPTESISDWWNTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSDPPSFAHA
                     LHRAAKGSQGIIQELKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMD
                     QFMVKEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAK
                     QAEGATPSTGVTQSSTADLAFYAQLEDAEDEFVSNTAEAVEFMTSIADATKLISLVKL
                     FQNFQLVYHRKCVQELEVSLNSLTSLEESN"
     gene            complement(<1002958..>1004829)
                     /locus_tag="AGOS_AFR310C"
                     /old_locus_tag="AFR310C"
                     /db_xref="GeneID:4622121"
     mRNA            complement(<1002958..>1004829)
                     /locus_tag="AGOS_AFR310C"
                     /old_locus_tag="AFR310C"
                     /product="AFR310Cp"
                     /transcript_id="NM_211212.2"
                     /db_xref="GeneID:4622121"
     CDS             complement(1002958..1004829)
                     /locus_tag="AGOS_AFR310C"
                     /old_locus_tag="AFR310C"
                     /note="Syntenic homolog of Saccharomyces cerevisiae
                     YGR130C"
                     /codon_start=1
                     /product="AFR310Cp"
                     /protein_id="NP_985857.2"
                     /db_xref="GeneID:4622121"
                     /translation="MSIALFKKKLKPADPFEELSGLPEEKKKDPTEFLRQSHHPPTGG
                     AAVTGDASHDEYYSPFRDAIAVEEAQRLRNLKFPTTGTHVTEEARRRVPDIDEPKRFS
                     TVDERQRQQLQELELKEGQLRLYKESQKIVDVRGKSDVTQRRAAQNTSKTSTTTGDKG
                     ALGDDDAVLVDYKSVLIVYPSGTYDGAYGPVTDRLGGDAKATTQKDVSDVSVQAADKD
                     SEEGKPLLERSSTKRAAETTERRHSAGPLSNIMSHMPFKLQKGGKLGGLFKHHDKEQL
                     LVPNGTPEEPEVVLLTNRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHY
                     EKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQA
                     EAQRAEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSR
                     ELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVRE
                     IDAKNSEILTEIAKIRQEIEFQRKELVALKERPQRTAASSFQGVATAVPVARHGTNDV
                     KPFATASADPNSSALKNLSSGPSTNKESSLYD