GenomeNet

Database: RefSeq
Entry: NC_005789
LinkDB: NC_005789
Original site: NC_005789 
LOCUS       NC_005789              23564 bp    DNA     circular PLN 01-JUN-2007
DEFINITION  Ashbya gossypii ATCC 10895 mitochondrion, complete genome.
ACCESSION   NC_005789
VERSION     NC_005789.1
DBLINK      Project: 10623
            BioProject: PRJNA10623
KEYWORDS    RefSeq.
SOURCE      mitochondrion Eremothecium gossypii ATCC 10895 (Ashbya gossypii
            ATCC 10895)
  ORGANISM  Eremothecium gossypii ATCC 10895
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Eremothecium.
REFERENCE   1  (bases 1 to 23564)
  AUTHORS   Dietrich,F.S., Voegeli,S., Brachat,S., Lerch,A., Gates,K.,
            Steiner,S., Mohr,C., Pohlmann,R., Luedi,P., Choi,S., Wing,R.A.,
            Flavier,A., Gaffney,T.D. and Philippsen,P.
  TITLE     The Ashbya gossypii genome as a tool for mapping the ancient
            Saccharomyces cerevisiae genome
  JOURNAL   Science 304 (5668), 304-307 (2004)
   PUBMED   15001715
REFERENCE   2  (bases 1 to 23564)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 23564)
  AUTHORS   Dietrich,F.S., Goff,S., Pohlman,R., Steiner,S., Mohr,C. and
            Philippsen,P.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) Applied Microbiology, Biozentrum,
            Universitaet Basel, Klingelbergstrasse 50-70, Basel CH-4056,
            Switzerland
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AE016821.
            This is low coverage sequence generated to identify the complete
            set of genes and the gene order on this chromosome. Regions of low
            quality are identified. Before doing extensive work on any gene
            identified here the sequence should be confirmed.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..23564
                     /organism="Eremothecium gossypii ATCC 10895"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="ATCC 10895"
                     /db_xref="ATCC:10895"
                     /db_xref="taxon:284811"
     gene            505..573
                     /locus_tag="AGOS_ErgofMt01"
                     /old_locus_tag="ErgofMt01"
                     /db_xref="GeneID:2936287"
     tRNA            505..573
                     /locus_tag="AGOS_ErgofMt01"
                     /old_locus_tag="ErgofMt01"
                     /product="tRNA-Val"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /db_xref="GeneID:2936287"
     gene            660..1406
                     /locus_tag="AGOS_AMI001W"
                     /old_locus_tag="AMI001W"
                     /db_xref="GeneID:2760769"
     CDS             660..1406
                     /locus_tag="AGOS_AMI001W"
                     /old_locus_tag="AMI001W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0250 (COX2)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI001Wp"
                     /protein_id="NP_987078.1"
                     /db_xref="GeneID:2760769"
                     /translation="MLLMNLFTIINNDVPTPYNMYFQDSTTPHQEGILELHDNIMFYM
                     LTVLGLVSWMMIIIIKDYKNNPITYKYIKHGQMIEIIWTILPAIILLMIAFPSFILLY
                     LCDEVISPAMTIKVIGLQWYWKYEYSDFINDNGETIEYESYMIPEELLEEGQLRMLDT
                     DTSIVIPVDTHVRFIVTATDVIHDFAVPSLGIKIDTTPGRLSQVSTLIQREGIFYGQC
                     SELCGAQHSAMPIKIETVKLPTFLTWLNEQ"
     misc_feature    702..959
                     /locus_tag="AGOS_AMI001W"
                     /old_locus_tag="AMI001W"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:280885"
     misc_feature    714..1397
                     /locus_tag="AGOS_AMI001W"
                     /old_locus_tag="AMI001W"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00154"
                     /db_xref="CDD:214438"
     misc_feature    987..1391
                     /locus_tag="AGOS_AMI001W"
                     /old_locus_tag="AMI001W"
                     /note="C-terminal domain of Cytochrome c Oxidase subunit
                     II; Region: CcO_II_C; cd13912"
                     /db_xref="CDD:259979"
     misc_feature    order(987..992,996..998,1002..1004,1035..1037,1176..1178,
                     1194..1196,1257..1268)
                     /locus_tag="AGOS_AMI001W"
                     /note="subunit II/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(1140..1142,1146..1148,1161..1166,1290..1292)
                     /locus_tag="AGOS_AMI001W"
                     /note="subunit II/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     misc_feature    order(1206..1208,1311..1313,1317..1319,1323..1325,
                     1335..1337,1344..1346)
                     /locus_tag="AGOS_AMI001W"
                     /note="CuA binding site [ion binding]; other site"
                     /db_xref="CDD:259979"
     misc_feature    order(1236..1238,1242..1244,1251..1253,1257..1259,
                     1263..1265,1308..1319,1329..1331,1335..1340)
                     /locus_tag="AGOS_AMI001W"
                     /note="subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:259979"
     misc_feature    order(1296..1298,1302..1304)
                     /locus_tag="AGOS_AMI001W"
                     /note="subunit II/IV interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259979"
     gene            1777..1848
                     /locus_tag="AGOS_ErgofMt02"
                     /old_locus_tag="ErgofMt02"
                     /db_xref="GeneID:2936288"
     tRNA            1777..1848
                     /locus_tag="AGOS_ErgofMt02"
                     /old_locus_tag="ErgofMt02"
                     /product="tRNA-Pro"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="CCU"
                     /db_xref="GeneID:2936288"
     gene            1957..3564
                     /locus_tag="AGOS_AMI002W"
                     /old_locus_tag="AMI002W"
                     /db_xref="GeneID:2760766"
     CDS             1957..3564
                     /locus_tag="AGOS_AMI002W"
                     /old_locus_tag="AMI002W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0045 (COX1)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI002Wp"
                     /protein_id="NP_987079.1"
                     /db_xref="GeneID:2760766"
                     /translation="MYLQRWLFSTNAKDIAILYFIFSTFCGLAGTAMSFIIRMELSAP
                     GQQYLQGQNQLFNVLVTGHTILMVFFLVMPMLIGGFGNYYLPLMIGASDMSFARLNNI
                     SFWTLPPTLICLLTSTMVESGTGTGWTVYPPLSSIQSHSGASVDLAIFSLHLTTISSL
                     LGTINFIVTALNMRTNGMTLHKMPLFTWSILITAVMLLMSLPVLSAGVTMLLMDRNFN
                     TSFFEVQGGGDPILYQHLFWFFGHPEVYIMIVPTFGMMSHIVSTYSKKPVFGEISMIY
                     TMGSISLLGFLVWSHHMYVVGLDTDTRAYFTSATMIITIPTSIKVFSWLTTIYGGSLR
                     LTTPMLYTLSFLFLFTVGGLTGVVLANTSLDVAFHDTYYVVTHFHYVLSLGAVFSMFA
                     GYYYWSPTVLGLNYNEKLSQIQFWLIFLGTNIIFFPMHFLGINGMPRRIPDYPDTFTG
                     WNLVSSFGSMMTIMSLMLFTYIIYDQLMNGLTNKVNNKSINYMKTPDFIESNNIFLMN
                     TTKSSSIEFMLNSPPTIHSFNTPTIQS"
     misc_feature    1984..3423
                     /locus_tag="AGOS_AMI002W"
                     /old_locus_tag="AMI002W"
                     /note="Cytochrome C oxidase subunit I. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(1984..1986,2230..2232,2242..2244,2248..2250,
                     2269..2271,2392..2394,2404..2406,2458..2460,2470..2472,
                     2530..2532,2551..2553,2560..2562,2584..2586,2611..2619,
                     2632..2637,2641..2643,2671..2673,2782..2784,2791..2793,
                     2800..2805,2815..2817)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    1996..3339
                     /locus_tag="AGOS_AMI002W"
                     /old_locus_tag="AMI002W"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:278541"
     misc_feature    order(2011..2013,2200..2202,2233..2235,2254..2256,
                     2263..2265,2428..2433,2449..2451,2461..2463)
                     /locus_tag="AGOS_AMI002W"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2029..2031,2041..2043,2050..2052,2062..2064,
                     2308..2313,3157..3159,3376..3378,3385..3387)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2071..2073,2080..2085,3181..3183,3190..3195,
                     3292..3294,3346..3348)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(2125..2127,2641..2643,2752..2754,2761..2766,
                     2839..2847,2854..2856,2863..2865,2887..2889,2911..2913,
                     2920..2922,2941..2949,2983..2985,3037..3042,3046..3048,
                     3052..3066,3256..3261,3271..3279,3304..3309)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(2143..2145,3091..3093,3103..3105,3229..3231,
                     3340..3342)
                     /locus_tag="AGOS_AMI002W"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2302..2304,2311..2313)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2365..2367,2599..2610)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2530..2532,2551..2553,2671..2673,2782..2784,
                     2791..2793,2800..2805,2815..2817)
                     /locus_tag="AGOS_AMI002W"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2641..2643,2656..2661,3049..3051,3061..3066,
                     3271..3273)
                     /locus_tag="AGOS_AMI002W"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2680..2682,2827..2832,3085..3087)
                     /locus_tag="AGOS_AMI002W"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(2680..2682,2692..2694,2725..2727,2827..2832,
                     2905..2907,2914..2916)
                     /locus_tag="AGOS_AMI002W"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(2830..2832,3061..3066,3271..3276)
                     /locus_tag="AGOS_AMI002W"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    2845..2847
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    2944..2946
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(3088..3090,3271..3276)
                     /locus_tag="AGOS_AMI002W"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(3184..3186,3355..3357)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(3292..3294,3304..3306)
                     /locus_tag="AGOS_AMI002W"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     gene            3601..3672
                     /locus_tag="AGOS_ErgofMt03"
                     /old_locus_tag="ErgofMt03"
                     /db_xref="GeneID:2936289"
     tRNA            3601..3672
                     /locus_tag="AGOS_ErgofMt03"
                     /old_locus_tag="ErgofMt03"
                     /product="tRNA-Thr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="CUA"
                     /db_xref="GeneID:2936289"
     gene            3857..4666
                     /locus_tag="AGOS_AMI003W"
                     /old_locus_tag="AMI003W"
                     /db_xref="GeneID:2760768"
     CDS             3857..4666
                     /locus_tag="AGOS_AMI003W"
                     /old_locus_tag="AMI003W"
                     /note="similar to Saccharomyces cerevisiae Q0275 (COX3)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI003Wp"
                     /protein_id="NP_987080.1"
                     /db_xref="GeneID:2760768"
                     /translation="MLYLNRSKFQQFPFHLVTPSPWPIVTSFSLLGLTLTLAFTMHGI
                     IGNIYPLLLSLLVVLLTMTLWFRDIVAETTYLGDHTLAVRKGINLGFTLFVVSEVLIF
                     ASLFWAYFHSAMSPDITLGNVWPPVGIEAVQPTELPLLNTIILLASGTTITYSHHGLI
                     EGNRKHALSGLTITFWLIVTFVLCQYIEYSNTSFTITDGIYGSVFFAGTGLHFLHMVM
                     LTIMLGINYWRMRNYHLTSTHHVGYETTTIYLHVLDIIWLALYICFYWWGV"
     misc_feature    3893..4663
                     /locus_tag="AGOS_AMI003W"
                     /old_locus_tag="AMI003W"
                     /note="Cytochrome c oxidase subunit III; Region: COX3;
                     pfam00510"
                     /db_xref="CDD:278911"
     misc_feature    order(4046..4048,4055..4060,4067..4069,4076..4084)
                     /locus_tag="AGOS_AMI003W"
                     /note="Subunit III/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(4049..4054,4061..4066,4073..4075,4091..4093,
                     4124..4129,4136..4138,4520..4522,4541..4543,4577..4582)
                     /locus_tag="AGOS_AMI003W"
                     /note="Phospholipid binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238834"
     misc_feature    order(4100..4102,4109..4114,4145..4147,4154..4156,
                     4166..4171,4187..4189,4451..4456,4463..4465,4475..4477)
                     /locus_tag="AGOS_AMI003W"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    4235..4237
                     /locus_tag="AGOS_AMI003W"
                     /note="Subunit III/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     misc_feature    order(4259..4267,4316..4318,4394..4396,4424..4432,
                     4445..4453)
                     /locus_tag="AGOS_AMI003W"
                     /note="Subunit III/VIa interface; other site"
                     /db_xref="CDD:238834"
     misc_feature    4352..4354
                     /locus_tag="AGOS_AMI003W"
                     /note="Subunit III/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238834"
     gene            4870..4941
                     /locus_tag="AGOS_ErgofMt04"
                     /old_locus_tag="ErgofMt04"
                     /db_xref="GeneID:2936290"
     tRNA            4870..4941
                     /locus_tag="AGOS_ErgofMt04"
                     /old_locus_tag="ErgofMt04"
                     /product="tRNA-Phe"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UUC"
                     /db_xref="GeneID:2936290"
     gene            4944..5027
                     /locus_tag="AGOS_ErgofMt05"
                     /old_locus_tag="ErgofMt05"
                     /db_xref="GeneID:2936310"
     tRNA            4944..5027
                     /locus_tag="AGOS_ErgofMt05"
                     /old_locus_tag="ErgofMt05"
                     /product="tRNA-Leu"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UUA"
                     /db_xref="GeneID:2936310"
     gene            5042..5114
                     /locus_tag="AGOS_ErgofMt06"
                     /old_locus_tag="ErgofMt06"
                     /db_xref="GeneID:2936309"
     tRNA            5042..5114
                     /locus_tag="AGOS_ErgofMt06"
                     /old_locus_tag="ErgofMt06"
                     /product="tRNA-Gln"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="CAA"
                     /db_xref="GeneID:2936309"
     gene            5120..5191
                     /locus_tag="AGOS_ErgofMt07"
                     /old_locus_tag="ErgofMt07"
                     /db_xref="GeneID:2936311"
     tRNA            5120..5191
                     /locus_tag="AGOS_ErgofMt07"
                     /old_locus_tag="ErgofMt07"
                     /product="tRNA-Lys"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AAA"
                     /db_xref="GeneID:2936311"
     gene            5194..5265
                     /locus_tag="AGOS_ErgofMt08"
                     /old_locus_tag="ErgofMt08"
                     /db_xref="GeneID:2936308"
     tRNA            5194..5265
                     /locus_tag="AGOS_ErgofMt08"
                     /old_locus_tag="ErgofMt08"
                     /product="tRNA-Arg"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AGA"
                     /db_xref="GeneID:2936308"
     gene            5279..5350
                     /locus_tag="AGOS_ErgofMt09"
                     /old_locus_tag="ErgofMt09"
                     /db_xref="GeneID:2936303"
     tRNA            5279..5350
                     /locus_tag="AGOS_ErgofMt09"
                     /old_locus_tag="ErgofMt09"
                     /product="tRNA-Gly"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="GGA"
                     /db_xref="GeneID:2936303"
     gene            5375..5446
                     /locus_tag="AGOS_ErgofMt10"
                     /old_locus_tag="ErgofMt10"
                     /db_xref="GeneID:2936304"
     tRNA            5375..5446
                     /locus_tag="AGOS_ErgofMt10"
                     /old_locus_tag="ErgofMt10"
                     /product="tRNA-Asp"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="GAC"
                     /db_xref="GeneID:2936304"
     gene            5452..5533
                     /locus_tag="AGOS_ErgofMt11"
                     /old_locus_tag="ErgofMt11"
                     /db_xref="GeneID:2936307"
     tRNA            5452..5533
                     /locus_tag="AGOS_ErgofMt11"
                     /old_locus_tag="ErgofMt11"
                     /product="tRNA-Ser"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AGC"
                     /db_xref="GeneID:2936307"
     gene            5539..5610
                     /locus_tag="AGOS_ErgofMt12"
                     /old_locus_tag="ErgofMt12"
                     /db_xref="GeneID:2936306"
     tRNA            5539..5610
                     /locus_tag="AGOS_ErgofMt12"
                     /old_locus_tag="ErgofMt12"
                     /product="tRNA-His"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="CAC"
                     /db_xref="GeneID:2936306"
     gene            5758..5828
                     /locus_tag="AGOS_ErgofMt13"
                     /old_locus_tag="ErgofMt13"
                     /db_xref="GeneID:2936305"
     tRNA            5758..5828
                     /locus_tag="AGOS_ErgofMt13"
                     /old_locus_tag="ErgofMt13"
                     /product="tRNA-Met"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:2936305"
     gene            5926..6945
                     /locus_tag="AGOS_AMI004W"
                     /old_locus_tag="AMI004W"
                     /db_xref="GeneID:2760771"
     CDS             5926..6945
                     /locus_tag="AGOS_AMI004W"
                     /old_locus_tag="AMI004W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0140 (VAR1)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI004Wp"
                     /protein_id="NP_987081.1"
                     /db_xref="GeneID:2760771"
                     /translation="MKYNLLNNMKINNKKLKLKLILMMITMKRLNNMNQHNIYKNRYY
                     NKNNNLQYLNKLNTYNNKMYYFNKQLMNNMLIIDNTFNNLLKKMMMSNNILMTNLKFE
                     HRTNSIHIKYYFYNYMNINNDELSKLYNNYMMSINNQMINLLNNDNNSLNNLMTKYYN
                     KKVYINTYKLNYMYLDTELLSQTLTNIYNNNGLSLKSLKMIINKLPFNNDMLLSKNYV
                     NKMNKYNLTINNNLNNNKKDLINLYTLDNKLLDLSITNNMLLGKYLVGSNIQLKGRTL
                     NRNITRTMKMNIMKGTFNNYMYQWSKLNNLYKLNYMSTNINKTNNTFINKNGMFNIKI
                     KLNTI"
     misc_feature    5992..6942
                     /locus_tag="AGOS_AMI004W"
                     /old_locus_tag="AMI004W"
                     /note="Mitochondrial ribosomal protein (VAR1); Region:
                     VAR1; pfam05316"
                     /db_xref="CDD:283074"
     gene            7040..7186
                     /locus_tag="AGOS_AMI005W"
                     /old_locus_tag="AMI005W"
                     /db_xref="GeneID:2760772"
     CDS             7040..7186
                     /locus_tag="AGOS_AMI005W"
                     /old_locus_tag="AMI005W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0080 (AAP1)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI005Wp"
                     /protein_id="NP_987082.1"
                     /db_xref="GeneID:2760772"
                     /translation="MPQMIPFFFMNQLTYGFTFILTILFLTSYVFLPMILRLYISRLY
                     ISKL"
     misc_feature    7040..7183
                     /locus_tag="AGOS_AMI005W"
                     /old_locus_tag="AMI005W"
                     /note="Fungal ATP synthase protein 8 (A6L); Region:
                     Fun_ATP-synt_8; pfam05933"
                     /db_xref="CDD:283561"
     gene            7252..8043
                     /locus_tag="AGOS_AMI006W"
                     /old_locus_tag="AMI006W"
                     /db_xref="GeneID:2760773"
     CDS             7252..8043
                     /locus_tag="AGOS_AMI006W"
                     /old_locus_tag="AMI006W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0085 (ATP6)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI006Wp"
                     /protein_id="NP_987083.1"
                     /db_xref="GeneID:2760773"
                     /translation="MYLNNNNNMKYYINSPLEQFEIRDLLGLTSPMMDFSFINITNFG
                     LYTMITLLVILTMNLMTNNYNKLVGSNWYLSQEMIYDTIMNMVKTQIGGKVWGYYFPL
                     VYTFFITIFTMNLISMIPYSFAMTSHVVFVVSMSMIIWLGTTIIGFYTHGLKFFGLFL
                     PTGTPLILVPLLVSIELLSYFARTISLGLRLSANIMAGHLLIVILGGLLFNLMAMNIL
                     TFLLGFLPMIAILGIVCLEFAITIIQAYVWCILMSSYLKDTIYLH"
     misc_feature    7351..8031
                     /locus_tag="AGOS_AMI006W"
                     /old_locus_tag="AMI006W"
                     /note="ATP synthase subunit 6 (eukaryotes),also subunit A
                     (prokaryotes); Region: ATP_synt_6_or_A; TIGR01131"
                     /db_xref="CDD:273458"
     gene            8226..8297
                     /locus_tag="AGOS_ErgofMt14"
                     /old_locus_tag="ErgofMt14"
                     /db_xref="GeneID:2936302"
     tRNA            8226..8297
                     /locus_tag="AGOS_ErgofMt14"
                     /old_locus_tag="ErgofMt14"
                     /product="tRNA-Trp"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UGA"
                     /db_xref="GeneID:2936302"
     gene            8389..8619
                     /locus_tag="AGOS_AMI007W"
                     /old_locus_tag="AMI007W"
                     /db_xref="GeneID:2760770"
     CDS             8389..8619
                     /locus_tag="AGOS_AMI007W"
                     /old_locus_tag="AMI007W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0130 (OLI1)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI007Wp"
                     /protein_id="NP_987084.1"
                     /db_xref="GeneID:2760770"
                     /translation="MQLVLAAKYIGAGISTIGLLGAGIGIAIVFAALIQGVSRNPSMK
                     DTLFQFAILGFAISEATGLFCLMISFLLLYGV"
     misc_feature    8392..8616
                     /locus_tag="AGOS_AMI007W"
                     /old_locus_tag="AMI007W"
                     /note="ATP synthase subunit C; Region: ATP-synt_C;
                     cl00466"
                     /db_xref="CDD:294318"
     gene            8657..8729
                     /locus_tag="AGOS_ErgofMt15"
                     /old_locus_tag="ErgofMt15"
                     /db_xref="GeneID:2936301"
     tRNA            8657..8729
                     /locus_tag="AGOS_ErgofMt15"
                     /old_locus_tag="ErgofMt15"
                     /product="tRNA-Thr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="ACA"
                     /db_xref="GeneID:2936301"
     gene            8749..8820
                     /locus_tag="AGOS_ErgofMt16"
                     /old_locus_tag="ErgofMt16"
                     /db_xref="GeneID:2936300"
     tRNA            8749..8820
                     /locus_tag="AGOS_ErgofMt16"
                     /old_locus_tag="ErgofMt16"
                     /product="tRNA-Gln"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /db_xref="GeneID:2936300"
     gene            9139..10293
                     /locus_tag="AGOS_AMI008W"
                     /old_locus_tag="AMI008W"
                     /db_xref="GeneID:2760767"
     CDS             9139..10293
                     /locus_tag="AGOS_AMI008W"
                     /old_locus_tag="AMI008W"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Saccharomyces cerevisiae Q0105 (COB)"
                     /codon_start=1
                     /transl_table=3
                     /product="AMI008Wp"
                     /protein_id="NP_987085.1"
                     /db_xref="GeneID:2760767"
                     /translation="MAYRKSNLYLNLVNSYVIDSPQPSSINYWWNLGSLLGLCLVIQI
                     TTGIFLAMHYSSNIELAFSSVEHIMRDVQTGWLIRYMHTNGASFFFICMYIHIGKGLY
                     YGSYKSPRVIVWTVGVIIFILTMAAAFLGYCLVYGQMSHWGATVITNLFSAIPFIGND
                     IVTWLWGSFSVSNPTIMRFFTFHYLVPFIIAAMVIMHLMTLHVHGSSNPLGITGNLDR
                     LPMHGYFIFKDLVTVFVFMIFFSLFVFFSPNTLGHPDNYIPGNPLVTPASIVPEWYLL
                     PFYTILRSIPDKLGGVITMFGTILVLLMLPITDRSIIRGNTFKTLSKFFFFLFITNFI
                     LLGKLGECHVEVPFILMGQICTFIYFAYFLILVPIISMIENILFYLTNKK"
     misc_feature    9160..9759
                     /locus_tag="AGOS_AMI008W"
                     /old_locus_tag="AMI008W"
                     /note="Cytochrome b (N-terminus)/b6/petB: Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cd00284"
                     /db_xref="CDD:238176"
     misc_feature    9166..10236
                     /locus_tag="AGOS_AMI008W"
                     /old_locus_tag="AMI008W"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00156"
                     /db_xref="CDD:214440"
     misc_feature    order(9184..9189,9238..9240,9247..9249,9730..9732,
                     9754..9756)
                     /locus_tag="AGOS_AMI008W"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(9187..9192,9202..9210,9226..9231,9238..9243,
                     9250..9252,9322..9324,9367..9369,9376..9381,9388..9393,
                     9397..9402,9406..9411,9418..9420,9439..9456,9466..9471,
                     9478..9483,9490..9492,9499..9504,9532..9534,9544..9564,
                     9574..9579,9601..9603,9757..9759)
                     /locus_tag="AGOS_AMI008W"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(9190..9195,9199..9201,9208..9210,9271..9273,
                     9283..9285,9292..9297,9322..9327,9334..9339,9346..9360,
                     9364..9372,9379..9381,9463..9465,9742..9747)
                     /locus_tag="AGOS_AMI008W"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    order(9226..9228,9235..9240,9244..9249,9403..9405,
                     9415..9417,9424..9429,9433..9435,9475..9480,9487..9492,
                     9496..9501,9718..9720,9727..9732,9739..9741,9754..9759)
                     /locus_tag="AGOS_AMI008W"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(9256..9258,9265..9270,9277..9282,9286..9291,
                     9298..9300,9331..9333,9373..9375,9382..9387,9394..9396,
                     9517..9522,9529..9534,9538..9543,9685..9690,9697..9699)
                     /locus_tag="AGOS_AMI008W"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(9502..9504,9511..9516,9523..9528,9565..9567,
                     9574..9579,9589..9591,9673..9675,9682..9684)
                     /locus_tag="AGOS_AMI008W"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    9760..10203
                     /locus_tag="AGOS_AMI008W"
                     /old_locus_tag="AMI008W"
                     /note="Cytochrome b(C-terminus)/b6/petD: Cytochrome b is a
                     subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: cytochrome_b_C;
                     cd00290"
                     /db_xref="CDD:238179"
     misc_feature    order(9760..9768,9772..9798,9805..9813,9817..9822,
                     9829..9831,9838..9843,9850..9852,9859..9864,9871..9876,
                     9880..9882,9898..9900,9907..9912,10072..10077,
                     10090..10095)
                     /locus_tag="AGOS_AMI008W"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    order(9760..9765,9778..9780,9787..9795,9799..9801,
                     9811..9813,9820..9825,9832..9837,9844..9846,9856..9861,
                     9865..9873,9880..9882,9895..9897,9901..9906,9910..9924,
                     9928..9936,9943..9945,9949..9960,10003..10005,
                     10033..10035,10042..10047,10051..10059,10063..10065)
                     /locus_tag="AGOS_AMI008W"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(9799..9801,9823..9825)
                     /locus_tag="AGOS_AMI008W"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(9943..9945,9949..9954,9961..9963,9970..9975,
                     10021..10023)
                     /locus_tag="AGOS_AMI008W"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    10462..10469
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="potential site of initiation of transcription of
                     15S ribosomal RNA"
     gene            10504..10589
                     /locus_tag="AGOS_ErgofMt17"
                     /old_locus_tag="ErgofMt17"
                     /db_xref="GeneID:2936299"
     tRNA            10504..10589
                     /locus_tag="AGOS_ErgofMt17"
                     /old_locus_tag="ErgofMt17"
                     /product="tRNA-Ser"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UCA"
                     /db_xref="GeneID:2936299"
     gene            10621..12190
                     /locus_tag="AGOS_ErgofMr01"
                     /old_locus_tag="ErgofMr01"
                     /db_xref="GeneID:2936298"
     rRNA            10621..12190
                     /locus_tag="AGOS_ErgofMr01"
                     /old_locus_tag="ErgofMr01"
                     /product="15S ribosomal RNA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /db_xref="GeneID:2936298"
     gene            complement(12462..12534)
                     /locus_tag="AGOS_ErgofMt18"
                     /old_locus_tag="ErgofMt18"
                     /db_xref="GeneID:2936296"
     tRNA            complement(12462..12534)
                     /locus_tag="AGOS_ErgofMt18"
                     /old_locus_tag="ErgofMt18"
                     /product="tRNA-Cys"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UGC"
                     /db_xref="GeneID:2936296"
     gene            complement(12808..12880)
                     /locus_tag="AGOS_ErgofMt19"
                     /old_locus_tag="ErgofMt19"
                     /db_xref="GeneID:2936297"
     tRNA            complement(12808..12880)
                     /locus_tag="AGOS_ErgofMt19"
                     /old_locus_tag="ErgofMt19"
                     /product="tRNA-Ile"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AUC"
                     /db_xref="GeneID:2936297"
     gene            complement(12902..12973)
                     /locus_tag="AGOS_ErgofMt20"
                     /old_locus_tag="ErgofMt20"
                     /db_xref="GeneID:2936292"
     tRNA            complement(12902..12973)
                     /locus_tag="AGOS_ErgofMt20"
                     /old_locus_tag="ErgofMt20"
                     /product="tRNA-Ala"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="GCA"
                     /db_xref="GeneID:2936292"
     gene            complement(12989..13060)
                     /locus_tag="AGOS_ErgofMt21"
                     /old_locus_tag="ErgofMt21"
                     /db_xref="GeneID:2936295"
     tRNA            complement(12989..13060)
                     /locus_tag="AGOS_ErgofMt21"
                     /old_locus_tag="ErgofMt21"
                     /product="tRNA-Asn"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="AAC"
                     /db_xref="GeneID:2936295"
     gene            complement(13076..13160)
                     /locus_tag="AGOS_ErgofMt22"
                     /old_locus_tag="ErgofMt22"
                     /db_xref="GeneID:2936294"
     tRNA            complement(13076..13160)
                     /locus_tag="AGOS_ErgofMt22"
                     /old_locus_tag="ErgofMt22"
                     /product="tRNA-Tyr"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_recognized="UAC"
                     /db_xref="GeneID:2936294"
     misc_feature    13402..13409
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="potential site of initiation of transcription of
                     21S ribosomal RNA"
     gene            13422..15101
                     /locus_tag="AGOS_ErgofMr02"
                     /old_locus_tag="ErgofMr02"
                     /db_xref="GeneID:2936293"
     rRNA            13422..15101
                     /locus_tag="AGOS_ErgofMr02"
                     /old_locus_tag="ErgofMr02"
                     /product="21S ribosomal RNA"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /db_xref="GeneID:2936293"
     gene            18723..18794
                     /locus_tag="AGOS_ErgofMt23"
                     /old_locus_tag="ErgofMt23"
                     /db_xref="GeneID:2936291"
     tRNA            18723..18794
                     /locus_tag="AGOS_ErgofMt23"
                     /old_locus_tag="ErgofMt23"
                     /product="tRNA-Met"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="initiator tRNA"
                     /codon_recognized="AUG"
                     /db_xref="GeneID:2936291"
ORIGIN      
        1 aaattattta atttatttac ttatttattt acacatttat ttatttacta attattatta
       61 cttaagaact tattatcatg aatatatatt aatattataa agtattaata tgtataaggg
      121 gttactaggg gtatatagag tacttatgga aattaaggag gatatagata ctagaggagt
      181 tactgggggt actagagtac ttgaggtact agggttacta acgaacggag cgtttactgg
      241 gaatatggat actaacaaat acagttacat aggatagaat gcacaagggg ggaaatataa
      301 aaggtatgag ggcgaattag gatttcacat tattgaggat tacaagggaa gtcgagtaag
      361 ttttactttg tgaatatgta tataattttt aattcttgag tacttattat tgataaaatt
      421 tagaaacatt ttataagttt tatattaaat ccttcaatga aaaagtagtt agattaaatt
      481 cttcaagatt gatcaaataa aaatagaaat tagcttaatg gtagagcatt cgttttacac
      541 acgaataatt tgagttcgat tctcaaattt ctaaataata attaacaata atttaaattt
      601 gggtaaaaat taataaatat taacgtatat aataattata tactttataa aattactcaa
      661 tgttattaat aaatttattt cttatcatta ataatgatgt acctactcca tataatatat
      721 attttcaaga ttcactacta cctcatcaag aaggtatttt agaattacat gataatatta
      781 tattctatat gttacttgtt ttaggtttag tttcttgaat aataattatt attattaaag
      841 attataaaaa taatcctatt ctttataaat atattaaaca tggtcaaata attgaaatta
      901 tttgaactat tttaccagct attattttat taataattgc atttccatca tttattttat
      961 tatatttatg tgatgaagtt atttcaccag ctataactat taaagttatt ggtttacaat
     1021 gatattgaaa atatgaatac tcagatttta ttaatgataa tggtgaaact attgaatatg
     1081 aatcttatat aattcctgaa gaattattag aagaaggtca attaagaatg ttagatactg
     1141 atactagtat tgttattcct gttgatactc atgtaagatt tattgttaca gctctagatg
     1201 ttattcatga ttttgctgta ccatcattag gtattaaaat tgatctaaca ccaggtagat
     1261 taagtcaagt atcaacatta attcaaagag aaggtatttt ttatggtcaa tgtagtgaat
     1321 tatgtggtgc tcaacatagt gctatgccta ttaaaattga actagttaaa ttaccactat
     1381 tcttactttg attaaatgaa caataattaa tattcttttt ttaatatatt ttatataata
     1441 attaataatt aataattaat tagagagtta gggttcaccc ccctaatgct tatcagcatt
     1501 atgaggtacc actctaatta attaatgtat tccctctaaa taaaagaata ttaattacta
     1561 taaaagatat aaagatataa tataatatca aataatataa taattattta ataataaata
     1621 atatataagc aatattaatc tataaaaatc atataattat ataatataat ttaaataaaa
     1681 taaataaata aataaatgat aataataatt ataaataatt aattaataaa ttatagtgaa
     1741 ataattaata agaaatatgt ttattaagat aatatacaga ttgaaccgag tggtttaggg
     1801 gctgtttttg ggaagcagaa tatgttagtt cgattctaac caatctgaaa atataaataa
     1861 ttaaattaaa attaaataat gattaatcaa aatattaata taaaattatt aataaataac
     1921 tttattattt taattaataa aataataaat aaaactatgt atttacagag atgattattt
     1981 tctacaaatg ctaaagatat tgctatttta tattttattt ttagtacatt ttgtggatta
     2041 gcaggtacag ctatatcatt tattattaga atagaattat cagcacctgg tcaacaatat
     2101 ttacaaggtc aaaatcaatt atttaatgta ttagttactg gacatcttat tttaatagta
     2161 ttctttttag taatacctat attaattggt ggttttggta attattattt accattaata
     2221 attggtgctt ctgatatatc atttgctaga ttaaataata tttcattttg actattacca
     2281 ccactattaa tttgtttatt aacatctact atagttgaat ctggtctagg tactggttga
     2341 actgtttatc ctcctttatc ttctattcaa tcacattctg gtgcttctgt tgatttagct
     2401 attttctctt tacatttaac tactatttct tcattattag gacttattaa ttttattgtt
     2461 acagctttaa atataagaac taatggtata actttacata aaataccttt atttctatga
     2521 tcaattttaa ttactgctgt tatattatta atatcattac cagtattatc agctggtgtt
     2581 actatattat taatagatag aaattttaat acatcattct ttgaagtaca aggtggtggt
     2641 gatcctattt tatatcaaca tttattttga ttctttggtc atcctgaagt atatattata
     2701 attgtaccac tatttggtat aatatcacat attgtatcaa cttattctaa aaaacctgta
     2761 tttggtgaaa tttctataat ttatctaata ggttctatta gtttattagg tttcttagtt
     2821 tgatctcatc atatgtatgt agtaggttta gatcttgata ctagagctta ttttacttca
     2881 gctactataa ttattcttat tcctactagt attaaagtat ttagttgatt actaactatt
     2941 tatggtggtt cattaagatt actaacacca atattatatc tattatcatt tttattttta
     3001 tttactgtag gtggtttaac tggtgtagta ttagctaatc tatcattaga tgtagcattc
     3061 catgatactt attatgtagt actacatttc cattatgtat taagtttagg tgctgtattc
     3121 tctatgtttg ctggttatta ttattgaagt cctcttgttt taggtttaaa ttataatgaa
     3181 aaattatcac aaattcaatt ctgattaatt ttcttaggtc ttaatattat tttcttccct
     3241 atgcatttct taggtattaa tggtatacca agaagaattc ctgattatcc tgatctattc
     3301 ctaggttgaa atttagtatc ttcatttggt tctataataa ctattatatc attaatgtta
     3361 ttcctttata ttatttatga tcaattaata aatggtttaa ctaataaagt taataataaa
     3421 tctattaatt atataaaact acctgatttt attgaatcaa ataatatttt cttaatgaat
     3481 actactaaat catcatctat tgagtttata ttaaattcac cacctcttat tcattcattt
     3541 aatactcctc taattcaatc ttaaaatatt cttaattatt aaattatata ataaaagtta
     3601 gtggatatag tttaattggt aaaacatatg ttttagggac atatatcttc agttcaaaac
     3661 tgaatatcta catattatat cattaatata ataactcttt aattagagtg gtaccacaag
     3721 aatgctgaaa gcattagggg tgtgtacctt agctctctaa ttaaagttat aaaattatct
     3781 taactaataa aaataattaa ttaaataaat aaataattaa ttaaatttaa aatgtttaaa
     3841 aaaagaaata aataatatgt tatatttaaa tagatcaaaa tttcaacaat ttccatttca
     3901 tttagtacta ccatcaccat gaccaattgt tacatcattt agtttattag gtttactatt
     3961 aactttagct tttactatac atggtattat tggtaatatt tatcctttat tattatcttt
     4021 attagtagtt ttattactaa taactttatg atttagagat attgtagctg aacttactta
     4081 tttaggtgat catactttag ctgtaagaaa aggtattaac ttaggtttcc tattatttgt
     4141 tgtatctgaa gtattaattt ttgcttcttt attttgagct tacttccatt cagctataag
     4201 tcctgatatt ctattaggta atgtttgacc accagtaggt attgaagcag ttcaaccaac
     4261 agaattacca ttattaaata ctattatttt attagcatca ggtctaacta ttacatatag
     4321 tcatcatggt ttaattgaag gtaatagaaa acatgcttta tcaggtttac ttattacttt
     4381 ctgattaatt gttacatttg tattatgtca atatattgaa tatagtaata catcatttac
     4441 aattacagat ggtatttatg gttcagtatt ttttgctggt actggtttac atttcttaca
     4501 tatggttatg ttactaatta tgttaggtat taattattga agaataagaa attatcattt
     4561 aacatcaaca catcatgtag gatatgagac tactactatt tatttacatg ttttagatat
     4621 tatttgatta gcattatata tttgttttta ttgatgaggt gtatagtgtt atacattatc
     4681 atttaggtgt gtagggttca cccccctatt gctagtcagc aatatgttgg taccctccta
     4741 aacgataatt caatttaaat attaaaatat taattaataa ataataaata ataaataaaa
     4801 tatataaaag attaatattc attattataa aaatatataa taaaaatata tataaaagat
     4861 taaaagaaag cctttatagc ttagtggtaa agcgataagc tgaagattta ttaacatgta
     4921 gttcgattct cattaaaggc atagctattt tggtggaatt ggtagacacg acactcttaa
     4981 gatgtgttct ttaacaaaag atgaaggttc aaatccttta aatagcattt aattttatta
     5041 atgagctgtt gactaatagg taagtcacca agatttgagt ttggtatatg tttgttcaaa
     5101 tcaaaccagt tcaaatagag ggaatattgt ttaatggtta aaacagttgt cttttaagca
     5161 tctcatgtcg gttcaattcc ggctattcct aaactctctt agcttaatgg ttaaagccta
     5221 atacttctaa tattatgatt ctatgttcaa atcatagaga gagtaatata ataatataat
     5281 agatataagt taattggtaa actagatgtc ttccacacat tatttgtgag ttcgagtctc
     5341 actatctata tttaaataat taaataaata ataaggattt gtagcttaat agtaaagcac
     5401 tatcttgtca cgatagtaga tgtcagtgcg attctgatca aattcgttaa tgaaaagtta
     5461 gctattggta aagcgagtta cttgctatgt aatgaattat taattcttat gagttcgatt
     5521 ctcatacttt tcgtttaagg taaatatatt tcaatggtag aaaagatgct tgtggtgcat
     5581 tcaatatgag ttcaattctc attatttacc ctttatataa aataaatatt attaatctat
     5641 ttaataaata aatattatta tcattttatt aaataaacta aatatcattt agagtggtac
     5701 cacaagaatg cgtaagcatt aggggtgtgt accctaactc tctaaatgat agttaaactt
     5761 atatagctta atggctaaag catttgtctc ataaacaaat aatataggtt cgattccttt
     5821 tataagtatt tttaactaca ttctttataa tattttatta attaattaaa taatgataaa
     5881 atattaatta aataattaat ttaattaaat aaataaataa ataaaatgaa atataattta
     5941 ttaaataata taaaaattaa taataagaaa ttaaagttaa aattaatttt aataataatt
     6001 cttataaaaa gattaaataa tataaatcaa cataatattt ataaaaatag atattataat
     6061 aaaaataata atttacaata tttaaataaa ttaaatcttt ataataataa aatatattat
     6121 tttaataaac aattaataaa taatatatta attattgata atctatttaa taatttatta
     6181 aagaaaataa taatatctaa taatatttta ataactaatt taaaatttga acatagacta
     6241 aatagtattc atattaaata ttatttttat aattatataa atattaataa tgatgaatta
     6301 agtaaattat ataataatta tataataagt attaataatc aaataattaa tttattaaat
     6361 aatgataata atagtttaaa taatttaata cttaaatatt ataataaaaa agtttatatt
     6421 aatctttata aattaaatta tatatattta gatctagaat tattaagtca actattaact
     6481 aatatctata ataataatgg tttatcatta aaatcattaa agataattat taataaatta
     6541 ccatttaata atgatatatt attatcaaaa aattatgtta ataaaataaa taaatataat
     6601 ttactaatta ataataattt aaataataat aaaaaagatt taattaattt atatacttta
     6661 gataataaat tattagattt aagtattctt aataatatat tattaggtaa atatttagta
     6721 ggtagtaata tccaattaaa gggtagacta ttaaatagaa atattactag actaataaaa
     6781 ataaatatta tgaaaggtac atttaataat tatatatatc aatgaagtaa attaaataat
     6841 ttatataaat taaattatat atcacttaat attaataaac ttaataatct atttattaat
     6901 aaaaatggta tatttaatat taaaattaaa ttaaatacta tttaataaat attctataag
     6961 taatttctta tttattttat aacattttaa aatgttttat gttaaataga taataatcaa
     7021 ttaaataata aaaattaaga tgccacaaat aattccattt ttctttatga atcaattaac
     7081 ttatggtttt ctatttattt tactaatttt attcttacta tcttatgtat ttttacctat
     7141 gattttaaga ttatatatct ctagattata tatttctaaa ttataaatag ttaattaaaa
     7201 ttttaaatta agatctatta atgatcatta tattataaaa tataataaag aatatattta
     7261 aataataata ataatatgaa atattatatt aattctccat tggagcaatt tgagattaga
     7321 gatttattag gtttaacatc accaataata gattttagtt ttattaatat tactaatttt
     7381 ggtttatatc ttataattct tttattagta attttactaa tgaatttaat aactaataat
     7441 tataataaat tagtaggttc taattgatat ttaagtcaag aaataattta tgatactatt
     7501 ataaatatag ttaagacaca gattggtggt aaagtatgag gttattattt tccattagtt
     7561 tatacatttt ttattcttat ttttactata aatttaatta gtataattcc ttattcattt
     7621 gctataactt cacatgtagt atttgtagta tcaataagta taattatttg attaggtcta
     7681 actattattg gtttttatac tcatggttta aaattctttg gtttattttt accactaggt
     7741 acaccattaa ttttagtacc attattagta tcaattgaat tattatcata ttttgctaga
     7801 cttatttcat taggtttaag attatcagct aatattatag ctggtcattt attaattgtt
     7861 attttaggtg gtttattatt taatttaata gctataaata ttttaacatt tttattaggt
     7921 ttcttaccaa tgattgctat tttaggtatt gtatgtttag aatttgctat tcttattatt
     7981 caagcttatg tatgatgtat tttaatatca tcatatttaa aagatctaat ttatttacat
     8041 taattaataa ttaataatat ttaataatat tcaataattt atatatttta ttatatttaa
     8101 taattatata aatactttaa ttacataaat actttaatta gagagttagg gttcaccccc
     8161 ctaatgctta tcagcattat gaggtaccac tctaattaaa ggtaaatata tatatttaat
     8221 aataaaagga tatagtttaa ttggtaaaac tattgacttc aaatcaatca ttaagagttc
     8281 aaatcttttt atccttgtta tattttaata atataaatta ataaataata aatatgataa
     8341 atcataatat taaagatatt gattaatatt tttaattaat taaataatat gcaattagta
     8401 ttagcagcta aatatattgg tgcaggtatt tcaacaattg gtttattagg agcaggtatt
     8461 ggtattgcta ttgtatttgc agctttaatt caaggtgtat caagaaatcc atcaatgaaa
     8521 gatactttat tccaatttgc tattttaggt ttcgctatta gtgaagctac aggtttattc
     8581 tgtttaatga tttctttctt attattatat ggtgtttaat tttattaaat tatataataa
     8641 ttaatattca aaataagtta tattagctta attggtagag cattcgtttt gtaatcgaaa
     8701 ggttaggagt tcaaatctct tatgtaacaa tttaattaaa taaataaaga tcttatcgtc
     8761 taatggttac gacatcatct cttcatgttg aaaatatcgg ttcaattccg attaagatta
     8821 ttaatatatt ttaataatta ttataattaa caatattaat tagaggggta ccaacatatt
     8881 gctaactagc aataggggtg tgtaccttat ctctctaatt aataatttat aaattaaata
     8941 attaaataaa ttaaataatt aaataattaa atcttaatgg tttattaggt tcaattccta
     9001 taaagattat ataaatatta ataaataata aataataaat taatatatta attaaataat
     9061 ataatttatt ataaagaatt atattataat ctaatattta ttaaataata atttaataat
     9121 attttaataa taaaatatat ggcatataga aaatcaaatt tatatttaaa tttagttaat
     9181 agttatgtta ttgattcacc tcaaccatca tcaattaatt attgatgaaa tttaggttct
     9241 ttattaggtt tatgtttagt tattcaaatt cttactggta tttttttagc tatgcattat
     9301 tcatctaata ttgaattagc tttctcatca gtagaacata ttatgagaga tgtacaacta
     9361 ggttgattaa ttagatatat gcatcttaat ggtgcttcat tcttctttat ttgtatgtat
     9421 attcatattg gtaaaggttt atattatggt tcttataaat cacctagagt tattgtatga
     9481 acagttggtg ttattatctt tattttaact atagcagcag ctttcttagg ttattgttta
     9541 gtatatggac aaatgtcaca ttgaggtgct actgttatta ctaatttatt tagtgctatt
     9601 ccatttattg gaaatgatat tgtactatga ttatgaggat catttagtgt tagtaatcct
     9661 actattataa gattctttct atttcattat ttagtaccat ttattattgc agcaatagta
     9721 attatgcatt taatgctatt acatgtacat ggttcatcaa atccattagg tattacaggt
     9781 aatttagata gattaccaat gcatggttat tttattttta aagatttagt aacagtattt
     9841 gtatttataa ttttcttttc attatttgta ttcttttcac ctaatacttt aggacatcct
     9901 gataattata ttccaggtaa tcctttagta acaccagcat ctattgtacc tgaatgatat
     9961 ttattaccat tctatcttat tttaagatct attcctgata aattaggtgg tgttattact
    10021 atatttggtc ttattttagt tttattaata ttacctatta ctgatagatc tattattaga
    10081 ggtaatacat ttaaactatt atctaaattc ttcttcttct tatttattct taactttatc
    10141 ttattaggta aattaggtga atgtcatgtt gaagtaccat ttattttaat aggtcaaatt
    10201 tgtacattta tttattttgc ttatttctta atcttagtac ctattatttc tataattgaa
    10261 aatattttat tttatttact aaataaaaaa taataattaa ataaataata ataatattca
    10321 ttaaatactt taatattaat atttatatat tatacttctt tatcatttag gagggtacct
    10381 catattgctg actagcaata ggggggtgaa ccctacgcac ctaaatgata agagtttatc
    10441 attaaattat atactatata ttataagtaa attatcaaac catatataag gtatatatat
    10501 taagaaagtt tgactgagtg gtttaaagtg taatatttga gctattataa atctttatga
    10561 tttcataggt tcgaatccta taactttcgt attaaataat tatttaaaat aattaaaaat
    10621 agttaataat aatgagaaca tgatgttggt tcagattaag cgctaactaa ggacattaca
    10681 catgcgaatc aaacgttaat attattaatt aatagtatta ataagtggtg tactcgtgag
    10741 taaaaattaa gaataatgaa cttaaaattt aactaaatat taaataataa ataaagaata
    10801 atgtaataat tatttgtttt aagtcaagct tataatgatt taggtattag ttaattaaaa
    10861 aataataact agccaaaaat tcataattgt taattaaagt tagaacaatc acgttgattt
    10921 agaaattata atcaatatct atatgataca gcagtgggga atattggaca atgatcgaaa
    10981 gattgatcca gttacttagt agaatgataa aattaataaa tattatttat taatatttgg
    11041 ttaacaataa aattcaataa tttatttaaa taatgattaa ataatctcaa tataaaatta
    11101 ttaatataat gagatatata tttttaaaaa gaatatataa ttaaataatc ccaaccaaaa
    11161 tttgtgccag cagctgcggt aagacaaagg gggttagcgt taatcgtaat ggcttaaagg
    11221 gttcgtagaa tgattattta aaataataat tagaattaat aaaaataatt taagaattat
    11281 tcaagtaaag atgaaataat aattatatga ataagactta taaagtgaaa atttaaatta
    11341 tatattaatt gacattgagg aacgaaggct aaagtagcaa atcggattcg atacccgagt
    11401 agttttagca gtaaacaatg aatacctatt tattttttat taattaaaga ataaattaaa
    11461 tgaaaattaa agtattccgc ctgatgacta cgttagcaat aataaaaatc aaaacaatag
    11521 acggttacag acttaagcag tggaacatgt tatttaattc gataatcctc gataaatctt
    11581 accatttttt gaatatttaa ttataataat ttataattaa ttacaggcgt tacatagttg
    11641 tcttcagttc gtgctgcaaa gttttagaat ttatcataaa cgaacataac tctaaatatt
    11701 ttttattaat aaaatattaa ttaattattt aatgaataat taagaaaaga attaagacaa
    11761 atcattatga tccttataaa atgggcaata gacgtgttat aatataatat acaaaattat
    11821 aaataaatat ttaataaaat ataaaattaa taattaaagt attataataa ttaataaaat
    11881 tatttattaa taagtatgga tttttaactg aaatttgtta aaatgaaata agaattgcta
    11941 gtaatctatt aataagaaag taatggtgaa tactctaact gtttcgcact aatcactcat
    12001 cacgcgttga aacatataat taaataaaga atattaatta atttattaat tattaattat
    12061 tattaatatt atttaataaa tataataaat attttaattt aaattatgaa ttaatgcgaa
    12121 gttgaaatac agttactgta ggggaacctg cagtgggctt ataaatatct ttaatattcc
    12181 atttttataa aataaatata ttttttaata tattttataa taactataat taaatagtta
    12241 aaatttaaat tataatttaa taatttaata acttattaat tagagagtta gggtacatcc
    12301 cccctaatgc tatgcattat ggttggtacc actctaatta ataaactata ataaataaat
    12361 actaatattt tatatcaatt aaattataat tattttttat taatatttta atattattta
    12421 atgaaatata taaataaagt attataaatt taataataaa taagaaatga agagaatcga
    12481 actcttaata attaaatttg caatttaata gtttaaccat taaacaacat ttccttatta
    12541 atattattta atcaattaat taatatctta ttattaatta gaaggatagg gtacacaccc
    12601 ctaatgctta cgcattcttg tggtacccat ctaattaata atgtattatc atatcatatt
    12661 attttgataa aagattaaat aatattaatt tattacctaa aatataataa tatattatct
    12721 taatatttat attgatttat ttataatatt tatatatctt gattatatac attaatatta
    12781 tatcttaata tcttaatata attgaaataa gattaatagg atttgaacct atattggtac
    12841 cttatcaaag tactattcta accttttgaa ttataatctc tttatatata tttataaaat
    12901 atggaattaa tgagaattga actcatatta aatgcatgca aagcaatcat tttaccaatt
    12961 aaattataat ccctttattt aattatttag ttcttaatag gaatcgaacc tatatagttt
    13021 cattaacagt gaaatgcttt aaccattaag ctataaaaac ttttaatatt attaatgaag
    13081 agaataggaa ttgaacctat gaagaactat gtcattgagt ttacagctca acttcaatta
    13141 ccaacattga aaatctctcc ttatatttat tatattcata atatatatct atctaaaata
    13201 tttacttata ctatatcttt tagtatacta tatattttaa tataaatatt tatgataata
    13261 actaatagtt taattaatgg ggtaccacca ctaatagggg ggtgtgtacc ctacaccatt
    13321 aattaactat tttaattaat aattatttat tatttttttt aattattttt aatatttata
    13381 tttaaaaggg taaaatcttt gtataagtaa gttctaaaat tagaactaaa gtttaaataa
    13441 atttgaaata tttattataa agatttaaag ggacaattat ggataataat aactattaat
    13501 aataaggtta ctaataaata tattttataa taatatttta aaacctaagg taaaccatta
    13561 ttatatattt taaaaatata taaattatat taaactaagt gaactaaaac atttaattaa
    13621 cttaaggaat ataaatcaac agagatattg agagtatagg tgatagaaat cgatatagtc
    13681 aataagtatt atgttattaa ttaatgtaag aatataggat aacaaattct aagactaaat
    13741 attattaata agtttaaaga agtaccgtaa gggaaaatta tttaaatagt tgttctataa
    13801 gcaattatat atattatatt aaataatata aataatgtac cttttgtata atgggtcagc
    13861 aagtaattaa tattagcata atattaaaat aaaaaatgat attaaaaata atataaatat
    13921 ttaacaatgt taaaattaat taaaataaat taaatttagt taatattaat taacccgaaa
    13981 gcagatgatc ttactattat caaatgatta aaatatatat ttattatatt taaaatataa
    14041 taaaatataa aaacgattga acaggttaat gtagcaatat tatctgatga ataatggtaa
    14101 gtagagaaag tcaaatctga tttgcaaata gctggttttc tacgaaacat atgttagtat
    14161 gattatttaa atattagata tatatggtat agttattaat attatttagg gaataattat
    14221 ttattttatt aaaaatatta aatctcagaa tatattatta atctaaaatt aaatatttca
    14281 gattattagc gataaggtta ataatcaaaa gggaaacagc ccagactaat agataaagtt
    14341 cctaattctt aattaagtga aattaatatt taataaatat ataacaatta gttgatggtt
    14401 ttgataataa tcattcttta atgaacatgt aacaatgcac taattatttt ttataaaaaa
    14461 tatttattta aatcattatt tttaattaaa taatgtaaat aaaaaataca cggatctaaa
    14521 ttaataactg aatctttaga ttattattat taattaataa aataataata atggtagtag
    14581 aacatttaat gatataaaat ataattatta ttcaattata ttatttaaaa agaattaaat
    14641 agagaatgct gacatgagta acgaaaataa ggtataatcc ttatcaccta aagcataagg
    14701 tttaacaata aaagcggttc ttaagtaata tattaaaaaa tataatatga tagaaataat
    14761 ctaatatata aattaactta aataatgtct ttataaattt attaagttca agaaatattt
    14821 atgtataaaa taccgtaatg tagaccgact caggtatgtt agtagagtat atgaaggtga
    14881 attagataat taaaggaaag gaactcggca aaaatagctc tgacgttagt caataaagag
    14941 atattaatta aaataataat taataataag aacaaagttg tacaactgtt tactaaaaac
    15001 acaacacttt gcagaaacgt aagttaaagt ataaagtgtg aactctgctc catgataaaa
    15061 tataaaaatt aatattttaa taaagataat aataataaat tttattaaat agcagcctta
    15121 ttatgagggt tataatgtag cgaaattcat tgtccactaa ttatggtcct gcatgaatga
    15181 cgtaatgata caacaactgt ctctccttta atctaagtga aattgaaatc ttagtgaaga
    15241 tgctaagtat ttgtagaaag acgaaaagac cctttgcagc tttactgtaa ttagatagat
    15301 cgattaatta atattattat ttagttatat aaagtaatag attatatatt aatgaaatac
    15361 ttttttttaa tatttaatta tatcttatcc tttttaaata tttaatagat aattcttaaa
    15421 tatattttat ttttataaaa aaataaatta aggaaacaat ctctaattgg tagttttgat
    15481 ggggcgtcat tttcataaaa agtatctgaa taagtccatt aaataaatat taattaattt
    15541 aaataaagaa atatatatat taaatatata tgatattaaa aattattaaa taaattaatt
    15601 aataataatt aataatttta ataataaaat agataaaata atgtacagtt ttatatgtta
    15661 ataaaacata atataggata atatattaaa taaatataat ggtataactg tgctataatt
    15721 gtaataccta caagtagaac aataacgtaa gtttggcata atgaacaaaa tatacatatt
    15781 gtaatggtat ttgataacga ataaaagtta cgctagggat taattaatag tcccattaaa
    15841 ttgtgaaatt taattatcaa tatttaaata tattgagtaa attgggttaa ttgcaaagaa
    15901 ctcctaatat tattttataa taataaagga caatctgcag cgaagcttat aacaatcctt
    15961 tttataaagt tataagaacg ttcaacgact agatatatga gtaggattaa caataattat
    16021 atccacgaaa gcccaatatg tattaattaa taaataatac ataatgaaat agtctgaaca
    16081 ataatgagaa ttattgaaat aataattaaa tgttattatg ataacaaaat tgaacagggt
    16141 aatataacga tagagtagct attgtaagtt atgtttgcca cctcgatgtc gactcaacct
    16201 atcctcttgg ttgtaacagc taagtagggt ttgactgttc gtcaattaaa aggttacgtg
    16261 agttgggtta aatacgacgt gagtcagtat ggtttctatc ttctacaaat aatattatta
    16321 attaaagtct aactcttagt acgcaaggat cagagttatt aaacctatga tgtaactatt
    16381 gattatatta attaaatatt aaaataaata tatttaatca ttattaattt ataataaata
    16441 atataaacat agtagttaag ttaagtttaa aaataataaa tattgaaagc atataaaata
    16501 tgaagtagtc tttaataaat aattatattg ataattttat actaaaattt attaaatagg
    16561 ttatatatat aatataaatt attaatatta attattaata ttttataata atgtataata
    16621 ctaatttatc aataatcttt ataatatcaa atttatttaa actttaaacg tatcatttag
    16681 gtgtgtaggg ttcacccccc aatacctatc ggtatttgtt ggtaccctcc taaacgatac
    16741 tctaagtatt aatataatta tataacatag ttattaatat ataatatata taatatataa
    16801 atagttaata attaataata tctaaatatt aaattgaaat atcaaatatg atatgaaata
    16861 taaatattaa gtattaaata tgatatgaaa tattaaaata tattaaatat acattaattt
    16921 attatttgta tatttaattt ttaattaata aagttaaatt aagaattaat aatttattaa
    16981 tctaataata taataaatat ataaaatatt aacaatatta atattagtat ttaatataaa
    17041 tattaaaatt taatactaaa taatattaat ttgttaatta ttaataaagt atataaagta
    17101 ttaattattt aataatataa tttaataaag tctcatttag aaggttaggg tacatccccc
    17161 ctaatgctat gcattatggt tggtacccat ctaaatgctc ctagttatta tatatatata
    17221 ctttattatt attagttata tatccccccc tatacttata tatatatata ctatatcaat
    17281 aattaatttt aataattagt aataatagtt ataatatata tagtattaat ataaatagtt
    17341 aataataaat agttataata gtattaatat aaataatata taaatattag ttattattaa
    17401 atataatatt aagtattaat aatattagta gttaataaat aataatatat agtaattata
    17461 atagtattaa tatatagtta taatagtatt gatatagata gtagttatta ttaaatatga
    17521 tatattaagt attaataata ttggttatta atgataatat taagtattaa tgatataata
    17581 ttagtagtta ataaatagtt atagtatagt aataatatgg tatgtattaa ttattatatg
    17641 tagttataca tataagatta attaatatca tattagtaag taagtattaa taagtattag
    17701 taattattat taatattgta aataataatt taataaataa tataataaat agtaataata
    17761 agtatttaaa acatatcatt tagagagtta gggttcaccc ccctaatgct tatcagcatt
    17821 atgaggtacc actctaaatg atattagtat atagtattaa tatataaata taattagtat
    17881 atagtattaa tataataata tatatatata atatatagta ttaatataaa gtatatatat
    17941 ttaatataat atttagttat aatatataat taataatgta ttataaatag tattaatagt
    18001 aataatatgt aattaataat attaatatag tatagtaata ataatgttaa taaatatata
    18061 atagtatcaa tatatagtta tagttaataa taaataatat tgaattatag tattagtata
    18121 gaatatatag tattaatata aaatattagt aataattata tatataaata aatatataat
    18181 atattagtta attaatagta tttattaatt ttaactatca tttagaagga taaggtacac
    18241 acccctaatg cttacgcatt cttgtggtac ccatctaaat gatattagtt ttatatgtca
    18301 atataaaata ttaatatcat atatattaag tatataatat gttaataata attaattata
    18361 aattagataa ttaaatatta gaattataaa tattaaatag aaatattaaa tagtaatata
    18421 aaatatagat tatagatata gaatatgaaa atataaatat taaaatataa atattaaatt
    18481 atatatatag ttaaataatt aagtatatag taattataat aattatttta aattatttaa
    18541 ataataaata taaaattgat atgtaatgat tagattatta aatgatataa atggtggggc
    18601 gatcaattag tgatatatat taataacaga taaatatata aatattataa actattatat
    18661 aaaatataaa taatattaga tattatataa agtataaata ttatagtata tagtataggt
    18721 aatgcaagat agtgtaattg gtaacatata aggctcatgt ccttttgata tacgttcaac
    18781 tcgtattttt gcaataatta actattatta aataagttaa taattaataa tatataataa
    18841 tatatagtat atatgatata tagataatta atatataata gtatatagta ttaatattac
    18901 ttaattcccg acgtaattaa ttgataataa taataaagtg tacaataata tataattatt
    18961 ataactatta gatatataat aactattaga tatatataat atataataat atgtatatat
    19021 aattaataaa tataaaaggt atataggtaa tatgaaatat taaatataaa tattaaataa
    19081 gtaatattga tgtgtactta aataataagt aacaatatta cgattatata aagatagtta
    19141 agttaatata ctaacataat cataatatag aatacaataa ttaaatagac aatattaatc
    19201 atataatcat attaataaat tatcatacta atatttaaat aaatataaat gtatataaag
    19261 ttattaatag gtagattata aatataataa ttatgtatag taatatttaa aatattaata
    19321 aatcatatat aaaatatata attaaatata tataaattaa ttatcaaatt acattaagta
    19381 atcatgataa ttaataatat tgaatatata ataatataaa tatagtataa tataatataa
    19441 aatattgata attagttaat aaataagtta ataatatata ataatatgtt attaatagtt
    19501 aataatgata ataatactta attccgggta gttaataaca ttaaataata aatattaaga
    19561 ttacattatc atattaccat taagtaataa tgataattaa tattaagtat ataaatatat
    19621 atataatata tataataata tagtatataa taataattca ttattaataa tataatattc
    19681 aattatataa ttaaataata ataatataga atacataata tatagttaat agtatagtat
    19741 actaatatta attgattccc aacgggatga atattaataa taataaatat acttaatgat
    19801 atagattatt aatcaggtaa ccatatatta aatatgaaat atatgataat attagataat
    19861 tagtatagta taagattata tatattatag ttatatatag ataatattag tattatatag
    19921 tatagtatat atatgtaata gttaaatatg ataataatac ttaattcact acggggtgaa
    19981 tagttaatta aataattata attaatatca ttaataacaa tagttaataa tatattaatt
    20041 taatatatag agtattaata aatatagttt gtatatatta gtatttatat atatatattg
    20101 ataatatata atataatagt atagtattag tatattgtat ttaatagtta tatataataa
    20161 taaacttaat tccctacgga gttaataata taaatattaa ttatataatg tataatataa
    20221 agataatata gatataataa ttaatattaa ataagtatat ataatagttt aatataatta
    20281 ctaataagat tagtaaatta aagatatcag attattagtc aggtaaccaa ttatattaat
    20341 taaaatatat tataattaat attagattaa taatatatta attatagaat aaatatagat
    20401 atagtatatt aatagtatag tataataata atacttgatt ccctacggaa ttagtattaa
    20461 tataaaatta aattattaaa tatataatta gataactaat attataaagt attgtatata
    20521 tgattatata gtatagtatt aatatataat agttaaatat aataataaac ttaattccct
    20581 acgatgttaa tagtaagtaa tattattagt attcatatca ttaatataat tagataataa
    20641 ttgttatttg ttattaagta tatatatcat attatttgat atatagttat attagataaa
    20701 tatatatagt attaattaag taaatagtag agtatgtata tatattatta atagtataat
    20761 aagataatat taattgattc cctacggagt taatagttat taattattaa tttataatta
    20821 gagtatcaga attatagttt ggtaaccatt gttattaagt attatatgat atgatataat
    20881 aatatagtat tagtttatat tatataaatt agatatagat tagatatatt atttatattg
    20941 taatagatat atagagtata tagttataat agttaaatat gataatatta cttaattccc
    21001 tacgaagtta gtgaatatag ttaatattga ttatatatat attattaatt attgatatta
    21061 ttatcaggta acctattgtt tattaatata tagagtatat aataagtaga cattatagtt
    21121 attaatatta tttctaattt gtatatttat taattattaa ttgggtaact attgttatca
    21181 tttgataata ttgataagat attaatcaga ttattagttt gttaatctat tgttaataat
    21241 atagagatag atatagtata gatattatat attatatagt atagatattg tatataaatc
    21301 ttatagatat taattattca ttaatcattg atcaagtaat caatagttaa taatattaag
    21361 aatataatat gtagacattt agtctagtct attaattatt aattattttg taatttgttg
    21421 ttaatttgtt gatattttat tgattttgtt gacattttgt tgacatgttg atatgttata
    21481 aaatataatt taatattatt ttatataatt attattatta tctagtcata gactcatata
    21541 aatatgaata tattccatta ttaattgttt aggataaaca taaattaata taataactta
    21601 tttttaagtt caataaatat gttcatattt atatgattaa ttcataacgt attcgatata
    21661 aatatctcat acccttttat gaattaatta agcggtatta aattattctg attggattaa
    21721 gttattattt aatttatgtt cctaacaatt aattgattcc ataaatatcg atatttatta
    21781 ttatttatta aaatattaat gataatattg taatacttca attattttat caaatggcaa
    21841 gtaatctatt aatcatttaa tacgattgat aagaaagaaa agaatatcat ctatcgtata
    21901 atatatttca agtatgacct cttcaatata attagaagtt taaacttgta gagaattaag
    21961 aatttaatat gagtcttaca ttaatacttg atatgaatcc tttaatctac ttatttgttt
    22021 aaccgttgaa agagaagaat agttaatcta agtattacat tatatattga tataatagtt
    22081 ttatttaatt atttgtttat tcgttagata agaattaaac taatctattg tataatttaa
    22141 tttatatatg acctcttcaa tatacttaga agtttaacct tagaaggaaa taggacatta
    22201 atagaagtat tacattaata cttgatataa tagtttaatt aacttatttg tttatacgtg
    22261 gagaagggaa atacactaat ccattgtata atttaatatg agtatgacct ctttaataaa
    22321 cttagaggtt tatacttgta aggaattaag aatttaagat aagtcttaca ttaatatctg
    22381 atataatagt ttaatcttat tagaagttta tcgttgagag ataaagatag ttaatctatt
    22441 atataattta atattgatat gattccttaa tataattaga tatttaatct ttagttattt
    22501 ttaataattt aatttataaa aggtctttaa catattaatt agagcgttag ggttcacccc
    22561 cccaattccc taggggaata tggttggtac ccctctaatt aatatttaaa tatatcagcc
    22621 aaacattaat taatacctta ataataatat ttaagaatta ttatattaat cattattatt
    22681 acataatttt atatcaatta ttaattatga attataagaa ttagtattaa tagtttattt
    22741 agtttgtaca atttaatatc agttaacatt taatccaacg gtattataaa atatcaataa
    22801 attatattaa tcatattaat tcaatagata tatatattag ttagtattta atagataata
    22861 tataaacaat agttattata agatattata ttaatagttt attaagtctg tataatttaa
    22921 tcttagttag catttaatac aacggttaaa gattaagata tattaattat aattatttaa
    22981 taataagtta tataaattat attagttatt tattaatatt taattagata ttagtacatt
    23041 acatccatta tcatttagag gggtaccaca agaatgcgta agcattaggg gtgtgtacct
    23101 tatctctcta aatgatatga ttaattatta taacattctt tatttaatta ttattaaaat
    23161 attaaaatta ttaattatta ctttataaga ttatattatt taattattat gatatgagat
    23221 atttattagt tattagacat tcatagctta taccacaata aatattggtg ttatcaacat
    23281 ttattgggta gctattcatt aattattaag aaattgttaa tattagttat ttaaagatta
    23341 gtaatagata tttatattat ttattaatta gttatagatt gttaataaga tatattaaga
    23401 tatagtattt atatactaag atatatacat taggaacatt taggagggta ccaacaaata
    23461 ccgataggta ttgggggggt gaaccctaca cacctaaatg tgactattaa aaactattat
    23521 cattaattta gatactctca atttataagt taagtactta gatt
//
DBGET integrated database retrieval system