GenomeNet

Database: RefSeq
Entry: NC_005967
LinkDB: NC_005967
Original site: NC_005967 
LOCUS       NC_005967             491328 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome A complete sequence.
ACCESSION   NC_005967
VERSION     NC_005967.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 491328)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 491328)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380947.
            On Aug 5, 2010 this sequence version replaced NC_005967.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..491328
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="A"
     gene            complement(<18037..>18876)
                     /locus_tag="CAGL0A00165g"
                     /db_xref="GeneID:2886422"
     mRNA            complement(<18037..>18876)
                     /locus_tag="CAGL0A00165g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444779.1"
                     /db_xref="GeneID:2886422"
     CDS             complement(18037..18876)
                     /locus_tag="CAGL0A00165g"
                     /note="some similarities with KLLA0E10593g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444779.1"
                     /db_xref="GeneID:2886422"
                     /db_xref="GOA:Q6FXW0"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW0"
                     /translation="MYELNNEEVLRKRKERFSKFGKEAIINDPLRDVALLSRSGESNT
                     IIDLKINHDKRSEMVSMLKLLFYDEKQLTTVEHGLRKLREVFMSIRQDHRDEDESFWK
                     QASEVYKLSYDFLLRHGQYNKLGGLVLNAIHEWFPLQYRKPYAKIYALYLSHIEKDVP
                     KCVDFLQYSSVSQSESLDIINMANIYVLKSESPRIWFHYCKNLKDDELNFLELSSVMQ
                     VMINRTDNLLQLCYNQLSVKVAQQLWFGDHFTSNLETRIKDKYDMRAGTDIILFKKRQ
                     IKG"
     gene            complement(<19487..>21757)
                     /locus_tag="CAGL0A00187g"
                     /db_xref="GeneID:2886420"
     mRNA            complement(<19487..>21757)
                     /locus_tag="CAGL0A00187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444780.1"
                     /db_xref="GeneID:2886420"
     CDS             complement(19487..21757)
                     /locus_tag="CAGL0A00187g"
                     /note="weakly similar to uniprot|P53191 Saccharomyces
                     cerevisiae YGL023c PIB2 phosphatidylinositol 3-phosphate
                     binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444780.1"
                     /db_xref="GeneID:2886420"
                     /db_xref="GOA:Q6FXV9"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV9"
                     /translation="MSVLEREHGNGSSGSTENPAPTGEKPDGDGPSDGHGSGRGKQQG
                     FTSNGINKDQTRSEGKSVAFEVGDERETSQDTILGDGGMTQNGDTSGEFTDRDDTSQN
                     RMNGSLQSEGLVFEKRKVIPQRRTQSQQSMLSSISLRSMIQEQQHVNNQQQQQQQSMH
                     RNSMGSNNTNNDQNLISHSLLNMSQQIRSPAMFSIKRTGSLMHSASRTASNFGKQETI
                     YDSNSLDSNEIGKKLPFTNDERIQIGSKKESPTVPRIRNEIVDNATPTALRELPEVIS
                     DLKPEDEDEISQKDLTTQALRKLSNFKGSNLNEAFSEHTTSTGTPTTNVSENEKGKIM
                     RESSNFLVADKSSPSPMKASSEAPKKTVKLNDQSSTDTDLSRTSSSNILNFTTNSHSM
                     MNMKFGDRNITVENNPEMTTNTHAQNFIADAKQPQVRTITKMHSLDMLQKPVRYRSNS
                     NNPTLQKQGVNRRHAKQINDPKKPLYMPVVLRNVVETNITNDDLQEISPRLSGRTTPA
                     ANKKSPGYRTDINYAGSQKSGTSNTSSVVETYKRYISSFLFPNRQQQVTDDAISSILH
                     KRNITPSTIGSYSSSIVSATSRSPQLPTRTHWIPDSKRSACHQCHKLFTFFDRKHHCR
                     HCGDIYCQKHLRHWLYLDSDAKFVVGGGGVGTLSKVCDACHIEYEDLARTSLTPSVVV
                     PNKKYGPFSNGIVTKSNLNVEMSLDSALSSGEHSKAKPIEVAGSESEDKQNKKDEPTV
                     NSVVGSIPADWNWSSF"
     gene            <22260..>24440
                     /locus_tag="CAGL0A00209g"
                     /db_xref="GeneID:2886291"
     mRNA            <22260..>24440
                     /locus_tag="CAGL0A00209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444781.1"
                     /db_xref="GeneID:2886291"
     CDS             22260..24440
                     /locus_tag="CAGL0A00209g"
                     /note="highly similar to uniprot|P39007 Saccharomyces
                     cerevisiae YGL022w STT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444781.1"
                     /db_xref="GeneID:2886291"
                     /db_xref="GOA:Q6FXV8"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV8"
                     /translation="MSSAVSDRQTVQWVLVVLKALVFMAIFGAAISSRLFAVINFESI
                     IHEYDPWFNFRATKYLVSHSFHEFLNWFDDRTWYPLGRVTGGTLYPGLMTTSAFVWHM
                     LRKIGLPVDIRNICVLFAPAFAGITAIATYQFTKELKDSSAGLLAAVFMAIVPGYISR
                     SVAGSYDNEAISITLLMITFMFWIKAQKTGSIMHATFAALFYFYMVSAWGGYVFITNL
                     IPLHVFILILMGRYNSRLYTAYSTWYAIGTLASMQIPFVGFLPIRSNDHMAALGVFGF
                     IQIVAFGDFVKARVPAQKFKVISLVSLLVLMAVGILGLFGLTYFGLIAPWTGRFYSLW
                     DTGYAKVHIPIIASVSEHQPVAWPSFFFDQHFLIWLFPAGVFLLFMDLKDEHVFVICY
                     SVLCSYFTGVMIRLMLTLTPIVCVSAAIALSKIFDIYLDFSKRDADGKAVPSLDKPAS
                     ILAKLVISGSFIFYLYLYVLHCTWVTKTAYSSPSVVLQTRDQVGNNIIIDDFREAYYW
                     LRMNTAEDAKIASWWDYGYQIGGLADRTTLVDNNTWNNTHIAIVGKAMAAPEEVSYKL
                     LKEHDVDYVLVIFGGVLGFGGDDINKFLWMIRISSGIWPDEIQEKNYFSDSGEYRVDA
                     MASRAMRQSVMYKMCYQGFADLFPNGQAVDRVRNQQIDNSHVEPLDYFDEVFTSENWL
                     VRVYKLKDEDPEGRELGDVGLINRHPATFRKNSLKKPELNMRIL"
     gene            <25241..>27622
                     /locus_tag="CAGL0A00231g"
                     /db_xref="GeneID:2886428"
     mRNA            <25241..>27622
                     /locus_tag="CAGL0A00231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444782.1"
                     /db_xref="GeneID:2886428"
     CDS             25241..27622
                     /locus_tag="CAGL0A00231g"
                     /inference="similar to AA sequence:UniProtKB:P43633"
                     /note="similar to uniprot|P43633 Saccharomyces cerevisiae
                     YGL021w ALK1 DNA damage-responsive protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444782.1"
                     /db_xref="GeneID:2886428"
                     /db_xref="GOA:Q6FXV7"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV7"
                     /translation="MDTSFEEYVNGNRNVLALVVSDNEDDYDSSMDSVSISTELNGSS
                     TNLDRQDTIQDQSSPVPKQELVVPRQRANEKGEKGTKSGGSKRWSFISNHSSSSKKRW
                     STLSSIPSESASRVLSGTKDPIKRLSSASNFSVDSMGFDAVSRRQTSSDKNSVPSLKR
                     SSTGLSLRQLFNKIVVAEDDTLSQGGDKENTGNKKETASLRNSASSRYPLRTLTNENA
                     SGLYQAQSRTTYSNTARHSVHFNPTGPETSNTSRLSKSSSITSLSSKLKFWKRAPGVP
                     KSESKRNLNISEPLELGNSDSNIRTKTSYSDLHKSIYSSYHYSKTFLSEPLESGMPMR
                     ELQQKKSRTSILNKKKSGSSLSVNTGLKHFSSTSSLSLGGLKNKSSHSSINMNVSMKH
                     KSSHSSLHKLAKHRRKSNNGDDRSSISSTTASTISANYQISLPVPDQVSREKIRNKLK
                     NSTSLLSLNSSIPVFKKEFDESLLQELLDYCNCKYVIKRLNSLDDDDVPIFHTFNNAN
                     QISKNIWRISGPFNWTKEKSIIFRRIELGSVDDITYSKKAIALHELKAHNYTSQMAGI
                     TKVLRSYVVTSDIASPGDNIDTDDLKNLYLIMVMKDHGSSLAKLTPINDWKTSVNIFW
                     NTVSILAGLEQRLQFEHRNLLLDHILVDERNGSITISNLNSSRFQQDDMNTIAFTRLD
                     DPLFFQRNARDDQYEVYSTMRMFLSENFNNQANGCPVWARFEPRTNLLWAHNLCKRLI
                     QETTDSKHQSERDHLTRICSAIDPVMLSRRSMLKRNDGDIKSLMDILKWKKTF"
     gene            complement(<27915..>28586)
                     /locus_tag="CAGL0A00253g"
                     /db_xref="GeneID:2886439"
     mRNA            complement(<27915..>28586)
                     /locus_tag="CAGL0A00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444783.1"
                     /db_xref="GeneID:2886439"
     CDS             complement(27915..28586)
                     /locus_tag="CAGL0A00253g"
                     /inference="similar to AA sequence:UniProtKB:P53192"
                     /note="similar to uniprot|P53192 Saccharomyces cerevisiae
                     YGL020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444783.1"
                     /db_xref="GeneID:2886439"
                     /db_xref="GOA:Q6FXV6"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /translation="MSWVVAIAVVFVVVLKVLEYSTSYHDLVLQSLFFKNSPISVKFE
                     TLVKERRSIQEENKSISAQDNYAKWTKNNRKLDKLDKEITELGAQLKAHNEQIKGHLK
                     KVKLLLLTVPFLCFKLWKGKHIVYNLPHHQMFPQLVAGVWSQGWLYLAILPLQLAKSI
                     VTGSSFAIETASFPHMGVSLGIWLWALNSVISNIEFMTMQLWAKPVSKPSKKLEIVTD
                     EIKVD"
     gene            <29069..>29869
                     /locus_tag="CAGL0A00275g"
                     /db_xref="GeneID:2886490"
     mRNA            <29069..>29869
                     /locus_tag="CAGL0A00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444784.1"
                     /db_xref="GeneID:2886490"
     CDS             29069..29869
                     /locus_tag="CAGL0A00275g"
                     /note="highly similar to uniprot|P43639 Saccharomyces
                     cerevisiae YGL019w CKB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444784.1"
                     /db_xref="GeneID:2886490"
                     /db_xref="GOA:Q6FXV5"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV5"
                     /translation="MSEYMEDNSHSDDSGTYDEWIPSFCSRFGHEYFCQVPTDFIEDD
                     FNMTSLAQEVPHYRKALDLILDLEMVSDEEDMDEKESGAESSSGANNNGGVNSKALVN
                     RNIIGHAAEQLYGLIHARYILTKPGLQAMAEKFDHKDFGTCPRYFCHGMQLLPCGLSD
                     TIGKQAVRLYCPSCQDLYLPQSSRHLCLEGAYWGTSFPGVFLKHFKELEEYVERKNKE
                     SYELKVFGFRINDQAVSGPRMKWLRQYPVTEEDWEEFNKCEFEMPIVE"
     gene            complement(<30179..>30775)
                     /locus_tag="CAGL0A00297g"
                     /db_xref="GeneID:2886456"
     mRNA            complement(<30179..>30775)
                     /locus_tag="CAGL0A00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444785.1"
                     /db_xref="GeneID:2886456"
     CDS             complement(30179..30775)
                     /locus_tag="CAGL0A00297g"
                     /inference="similar to AA sequence:UniProtKB:P53193"
                     /note="similar to uniprot|P53193 Saccharomyces cerevisiae
                     YGL018c JAC1 molecular chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444785.1"
                     /db_xref="GeneID:2886456"
                     /db_xref="GOA:Q6FXV4"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV4"
                     /translation="MLRCARLPTSGIRQVLQRRWIVSYYELFPGTFPDSQPRWDVDLG
                     KLRKEYRKLQAEVHPDKIQKEQEADSEQSSLLNKAYHALKDPLTRSQHMIQILKDVDL
                     TVDSVAREYTQMDPELLMDVMDVHEQLLDANSRDEVREIEKVNKQRIEKIEAELKECY
                     DNKEYERAINLTARLKYWKNVASAVKDWAPGKPIDLKH"
     gene            <30978..>32507
                     /locus_tag="CAGL0A00319g"
                     /db_xref="GeneID:2886383"
     mRNA            <30978..>32507
                     /locus_tag="CAGL0A00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444786.1"
                     /db_xref="GeneID:2886383"
     CDS             30978..32507
                     /locus_tag="CAGL0A00319g"
                     /inference="similar to AA sequence:UniProtKB:P16639"
                     /note="similar to uniprot|P16639 Saccharomyces cerevisiae
                     YGL017w ATE1 arginyl tRNA transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444786.1"
                     /db_xref="GeneID:2886383"
                     /db_xref="GOA:Q6FXV3"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV3"
                     /translation="MENKLIIHRPLYFSDKSDCGYCHGKKAKGSDFYSLESWYERIKE
                     NADSEVEELPVRSCTVGFQCENMTVAMYDQMCNMGFRRSGLFVYKMDALRSCCRLYTI
                     RTRPDWFKLTKDMRKCINRFRKHVLGEPVANAKTQGYVEDIVDIEGQSDSINFYTRFG
                     PAVYTDEKYELFSIYQERVHQDFDHSKKGFKRFLCDAPFTQGVIMGTEEEWEQLNNWK
                     SMKPGERLLRTGPVHESYYYKGKLIALAVTDFLPSGISSVYFIWHPDYHKWSLGKLSA
                     LRELSLVSKTNLKYYYLGYYIDDCKKMNYKANYGGELLDSCTERYFKLSQVKDMIRGG
                     KLFMVGTQGHDISREVALSDAIRDCIYQTDAFDIASDDNVAEKVYGTSSNIYRPQYLK
                     EVISFLKTSGLEYDFPIYNDGVFNQYAKRIAKDGEDPDFTIPSICPGLIPLWELKDLL
                     MSGKLQKELTGRTLVFDTSFGFIRKLEPWEDEDSTTKTAICDVVRLLGLEMASNSIVV
                     V"
     gene            <33056..>33625
                     /locus_tag="CAGL0A00341g"
                     /db_xref="GeneID:2886489"
     mRNA            <33056..>33625
                     /locus_tag="CAGL0A00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444787.1"
                     /db_xref="GeneID:2886489"
     CDS             33056..33625
                     /locus_tag="CAGL0A00341g"
                     /inference="similar to AA sequence:UniProtKB:P25338"
                     /note="similar to uniprot|P25338 Saccharomyces cerevisiae
                     YGL010w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444787.1"
                     /db_xref="GeneID:2886489"
                     /db_xref="GOA:Q6FXV2"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV2"
                     /translation="MVTSAAATVTGTNTEVGGLRKELGFYKFYHHNTVNVLIHSVCVP
                     TILFTTICILHRVSLPFQIMGVYLTLGHLLALRFATTYCRLHIPVGICATAILVCTLY
                     ALDAGLVGLTLKQESEIFVAAWIMQFIGHGVFEKKKPALLDSLEQSLVLAPYFILFEF
                     LFLLGFFPKLRAELESDVTKLKLQEKRQS"
     gene            complement(<33995..>36349)
                     /locus_tag="CAGL0A00363g"
                     /db_xref="GeneID:2886491"
     mRNA            complement(<33995..>36349)
                     /locus_tag="CAGL0A00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444788.1"
                     /db_xref="GeneID:2886491"
     CDS             complement(33995..36349)
                     /locus_tag="CAGL0A00363g"
                     /note="highly similar to uniprot|P07264 Saccharomyces
                     cerevisiae YGL009c LEU1 3-isopropylmalate dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444788.1"
                     /db_xref="GeneID:2886491"
                     /db_xref="GOA:Q6FXV1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q6FXV1"
                     /translation="MVTTETKGPRTLYDKVFDAHVVHKDENGSYLLYIDRHLVHEVTS
                     PQAFEGLTNANRPVRRVDCTLATVDHNIPTESRKSFKNLDSFITQTDSRLQVKTLEQN
                     VKQFGVPYFGLTEKRQGIVHTIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTS
                     EVEHVLATQTIIQSKSKNMRIRVDGKLSPGITSKDLILHIIGVIGTAGGTGSVIEFAG
                     EAIENLSMEARMSMCNMSIEAGARAGMIKPDNVTFEYFKGRPLAPTGAEWDKAVAYWK
                     TLHSDEGAKFDHEIVIKGSEIIPTITWGTSPQDALPISASVPDPANVDDPIKKSGMER
                     ALEYMGLKPNTPLKSIYVDKVFIGSCTNGRIEDLRNAAKVLNGHKIAPNIKRAMVVPG
                     SGLVKVQAEEEGLDKVFIAAGFEWREAGCSMCLGMNPDILDKYERCASTSNRNFEGRQ
                     GALSRTHLMSPAMAAATAVAGHFVDIREFKYNNADDAKVTISSDEDEELEEAAYEHTE
                     PQQPGDAPTDVENDQLKDIPVESETKRLKTDDTKPVAGGMDPFVVLNGLAAPLEKANV
                     DTDAIIPKQFLKTIKRTGLRSGLFYEWRFVKDDSGKDKETDFVLNVNPWRKAEVLVVT
                     GDNFGCGSSREHAPWALKDFGIKSIIAPSFGDIFYNNSFKNGLLPIRIDQDTIVNKLV
                     PVAKAGKNLVINLPDQTISDSDGNVLVEHFEVEAFRKHCLVNGLDDIGITLQKEQYID
                     QYEKIRREKYSFYEGGSKLLHFPAKQFPKKRTPLTTYDTVHQDW"
     gene            complement(<37162..>40371)
                     /locus_tag="CAGL0A00385g"
                     /db_xref="GeneID:2886283"
     mRNA            complement(<37162..>40371)
                     /locus_tag="CAGL0A00385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444789.1"
                     /db_xref="GeneID:2886283"
     CDS             complement(37162..40371)
                     /locus_tag="CAGL0A00385g"
                     /inference="similar to AA sequence:UniProtKB:P32767"
                     /note="similar to uniprot|P32767 Saccharomyces cerevisiae
                     YGL016w PDR6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444789.1"
                     /db_xref="GeneID:2886283"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:F2Z633"
                     /translation="MSSVEEVVNLIEELYSPKPNRDLNEIQQVLQGIQKSGDGLILGS
                     ALLSGPYSTNVKYFGALTLAVQINMHHDDLKKEEFGFTLFRLNLAFLVQYFENVVNDP
                     SALSSYSIVIKKLMSNLSILFVSINNNNPSENDFIASWNNPLNTLINLSIASSQMSTD
                     QKSHWYGTNNNSESDKIILDTINSEVPYNQLIEFISSSPVRNQLSLLFTEILVEDLTK
                     FQTQKHAMNSIHGVVHEHLYISTMALIIFNLSNLDATQLHDNLFNCINAWINYISISR
                     QVSPQGRMDLSELLESLLKVMLQSNENEQYGSAEKVISIFSHIFSNDPLLMNFELRSR
                     LETIFLGVSHGDTNADKSQYQWMLAYMNYLVTNEMYSELKDLSICVCDFLQINTLDLC
                     NKLFTTIQTQDQAASDNTQEYIKVLLQLTNFPLHPVSQESFSLKMVDFWLDLAEGYSN
                     LALESLKPNSQQLSIEIFQQVINIYVPKISLSNKKLFLEMGEDKTVLNEFEDFRNAVA
                     DLTQSLWLVLGNENLTNVLIAGVGSTEIASETELFNIETMSYLLEKLLKDINIPESLW
                     VLDVLEAAKFLVANVQTLLRTGLDNSGPLSIDFVRSSTTLMSSLSGFYKENPEQIGGT
                     IEILVQGLEKCAFSTGGANAFTKVESMLVKTISTLCSVCRKELYPYLDNFTSFLHSIM
                     SPDKQSSDFTRRSLTRSIGYIIQGQFENGPDAQGGNIDKLVMMFNNLIEQALGSGLSI
                     QEKQNYIQCVLDCISELGNGLVYPQEMDDPKVIQLLPPYREYWNTDPLGIRAKIMQII
                     EKVLQNPYFQKSSSLIEASCLILGKSLTLPEEEPYFLRYSMNEIINFVFTHLQTCDIA
                     PALPFFVYLLENLFSCYKATMTSAEFDVIFERVMISNYHQVIVQDPDSLQTCVNFVNS
                     ILDTKPGIAVYSQYWSSFILKEFLQLLTHKEKFTIVAVTKFWTKVVNNKKYTREELEI
                     TRQQVAAVGAQLTAHVMAGLYHTQRSDLNAYTELIRTLVAKFPIEFKSWLVAVLPQLV
                     DKPQAHEKFINKLFITRGSRAAGNVILTWWLECSGLPGY"
     gene            <41556..>42320
                     /locus_tag="CAGL0A00407g"
                     /db_xref="GeneID:2886460"
     mRNA            <41556..>42320
                     /locus_tag="CAGL0A00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444790.1"
                     /db_xref="GeneID:2886460"
     CDS             41556..42320
                     /locus_tag="CAGL0A00407g"
                     /note="highly similar to uniprot|P21243 Saccharomyces
                     cerevisiae YGL011c SCL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444790.1"
                     /db_xref="GeneID:2886460"
                     /db_xref="GOA:Q6FXU9"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU9"
                     /translation="MSGGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNLNSL
                     AVRGKNCSVIINQKKVPDKLLDPSTVSYIFKISKTIGMVANGPIPDARNAAARAKGEA
                     AEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFISVDEELGPSIYKCDP
                     AGYYVGYKATATGPKQQELTTSLENYYKKKNVGSHLDMEEWEKVVEFGITQMIDSLGT
                     EFSKKDLEIGVATENKFIILTPDEIEERLVAIAEQD"
     gene            complement(<42636..>44030)
                     /locus_tag="CAGL0A00429g"
                     /db_xref="GeneID:2886295"
     mRNA            complement(<42636..>44030)
                     /locus_tag="CAGL0A00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444791.1"
                     /db_xref="GeneID:2886295"
     CDS             complement(42636..44030)
                     /locus_tag="CAGL0A00429g"
                     /note="highly similar to uniprot|P25340 Saccharomyces
                     cerevisiae YGL012w ERG4 sterol C-24 reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444791.1"
                     /db_xref="GeneID:2886295"
                     /db_xref="GOA:Q6FXU8"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU8"
                     /translation="MSGSKEEKKTQSTGFLPQGKYLKPEEIEYEFGGTAGVLGMLIGF
                     PLLMYYMWICAEFYGGRIALPAQNETWAQFIGKLYHIFCDNAIPEKYDLVIFFTFWAF
                     QIFFYYTLPGVWTKGQPLTHLKNKQLPYYCNAMWTLYTSTALVVLLHVTGVFKLYTII
                     DRFGRIMTCAIASGFAFSIGLYIWTLFVTHDYHRMTGNHLYDFFMGAPLNPRWGILDL
                     KMFFEVRLPWFTLYFITLGACFKQYETYGYVTPQLGVVMLAHWLYANACAKGEELIVP
                     TWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHNPSEYNWSWQYNLSLYVVLLTAY
                     YFFDTTNGQKNSFRKQMSGDKTVRKTFPFLPYQVLKDPKYMVTSNGSYLLIDGWYRYA
                     RKIHYTADWTQSLIWAMSCGFNSFFPWFFPIFFFVVLIHRALRDQAKCEKKYGKDWVE
                     YCKHCPYLFIPYVF"
     gene            <47557..>50880
                     /locus_tag="CAGL0A00451g"
                     /db_xref="GeneID:2886430"
     mRNA            <47557..>50880
                     /locus_tag="CAGL0A00451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444792.1"
                     /db_xref="GeneID:2886430"
     CDS             47557..50880
                     /locus_tag="CAGL0A00451g"
                     /inference="similar to AA sequence:UniProtKB:P12383"
                     /note="similar to uniprot|P12383 Saccharomyces cerevisiae
                     YGL013c PDR1 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444792.1"
                     /db_xref="GeneID:2886430"
                     /db_xref="GOA:Q6FXU7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU7"
                     /translation="MQTLETTSKSNPGEVKAQKPSTRRTKVGKACDSCRRRKIKCNGL
                     KPCPSCTIYGCECTYTDAKSTKNLKSNDAGKSKPTGRVSKNKETTRVDKDIRKLEQQY
                     VPINANIHVGPRFPSENILNGYPQCGAPQNNVVGNPLAVNTQCHRGLSETPMSSTFKE
                     SNLRDDRLLQSSDTDDMRNGDSEERDLKGSDSENVKSKDNKSDPLIIYKDDTHIESTV
                     NKLTQAVNELKSLQNAPSSIKSSIDAIELQLRNILDNWKPEVDFEKAKINESATTKSL
                     ETNLLRNKYTNHVHLTRFRIWIDYKNANKNNHFMGECGFSLAESFFASNQPLVDELFG
                     LYSQVEAFSLQGLGYCVHLYEPYMKTEEAIKLMKETLYIILRFIDICVHHINEESISI
                     ANPLETYLRKKHLMPMTPTPRSSYGSPQSASTKSLVSKIIERIPQPFIESVTNVSSLQ
                     LLDLRDDESKMFGTLLNMCKSIRRKFDSVMSDYDSIVTEKSEGEQNDGKVTVAEFTSL
                     CEAEEMLLALCYNYYNLTLYSFFEFGTNIEYMEHLLLLLEEQLALDEYYGFEKVLNVA
                     VANAKKMGFHRWEFYVGYEESTAEKRRLLWWKLYNYEKASTMKKGFFSVIDDATVNCL
                     LPKIFRNFGYLDRVEFLENIQKPMDLSVFSDVPISVLCKYGELALTIVTSEFHEKFLY
                     ADRYTSIRNSAKPPTLKNQLIKEIVDGIAYTETSYEAIRKQTAKLWDIALGKVTKDKI
                     NKEDTAAASKFTLSYEYHRFRLINMADNLIARLMVKPKSDWLISVMKGHLNRLYEHWK
                     VMNEIILSMDNDYSIATTFEYYAPSCLCLATQTFLIVRNMEMDDVKMMVAVYKRFLNL
                     GMFLQSAKVCSLADSHTFRDFSRSFSFITIISRLMIIEFMQIKELTKVEFIEKFSEVC
                     PDLADLPPMLLDPNSCLYFSLLQQIKKSGFTLSFKKILEDARMMDFNYDRNLDSEAIK
                     KCNGEFSKSMPSCTNVSDTTTAVSDNSAKKKASMGSARVNSTDTLTASPLSGLRNQTQ
                     LDSKDSVPSLEAYTPIDSVSDVPTGEINVPFPPVYNQNGLDQQTTYNLGTLDEFVNKG
                     DLNELYNSLWGDLFSDVYL"
     gene            complement(<51137..>53497)
                     /locus_tag="CAGL0A00473g"
                     /db_xref="GeneID:2886492"
     mRNA            complement(<51137..>53497)
                     /locus_tag="CAGL0A00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444793.1"
                     /db_xref="GeneID:2886492"
     CDS             complement(51137..53497)
                     /locus_tag="CAGL0A00473g"
                     /inference="similar to AA sequence:UniProtKB:P25339"
                     /note="similar to uniprot|P25339 Saccharomyces cerevisiae
                     YGL014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444793.1"
                     /db_xref="GeneID:2886492"
                     /db_xref="GOA:Q6FXU6"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU6"
                     /translation="MTDKTQNQEKIDDKVVAETVNSALEQLHMDDVESPEPPATGDQP
                     TQHAPTAMQSTSPSHMFPPPQMYGFMPYSQMMHMPHPQGFFHPPEFQENMPNPSGNGR
                     IPTVFNNSNDASMFPPLGASFPPLGVVPDGENSTGINDPFVPSNDQLWNSSNLQASAA
                     IDVAGNTGAVPEDNGSKLTEKDAAPTAGAFRRQTFHAISTSTISDSAISDGIPTSVND
                     LPEKNFETAKNRTQSISFDKADSTLSEGKDTKDTEKGTNATADIQNVPVNYTAAYPYG
                     GPPFQGSPVPGVGPHQIPHSGYGVRSPFPGAFGDFGAPFQSFSPTLGGPAPPMHPHSP
                     IPMTHSPIQIGPMPEFMKGMRPESGEGKKDENVAMIPQGFPVMQHQQNGTPPPWMYGN
                     PAFNGMMPHSAGMNQGPQSQYPRSKDGMHDKHDKGHYNNRHRGRRNNNYYNHEDRQRK
                     MDNSQYADATLDQFIGNIYSLCKDQHGCRFLQKQLDVLGKKASDAIFEETKEYTVELM
                     TDSFGNYLIQKLLERVTDDQRVELAKIAAPKMVEISKDPHGTRALQKLIECISTKEEA
                     EIVVKSLQPDTVILSKDLNGNHVIQKCLQKLNPEDSQFIFDAAGNECGEIATHRHGCC
                     VLQRCLDHGTKTQFKDLCEKLLKYIDMLTFDPFGNYVVQYIISKETERNDYDYTYKIV
                     NQLKPRFTELSVHKFGSNVVEKVLRTPVVSETIINELINEGSAEVQALLNDSFGNYVL
                     QTALDISRDTNPYMYKKLVDLVTPLLVGNIRNTPHGKRIMGILNIE"
     gene            complement(<55014..>57722)
                     /locus_tag="CAGL0A00495g"
                     /db_xref="GeneID:2886465"
     mRNA            complement(<55014..>57722)
                     /locus_tag="CAGL0A00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444794.1"
                     /db_xref="GeneID:2886465"
     CDS             complement(55014..57722)
                     /locus_tag="CAGL0A00495g"
                     /note="highly similar to uniprot|P05030 Saccharomyces
                     cerevisiae YGL008c PMA1 or uniprot|P19657 Saccharomyces
                     cerevisiae YPL036w PMA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444794.1"
                     /db_xref="GeneID:2886465"
                     /db_xref="GOA:Q6FXU5"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU5"
                     /translation="MSDVESNNEKPPQDVYEDEEMSEDDDIDALIEELQSHHGMGDDD
                     DSEDEGHHTGSARVVPEEYLQTDPSYGLTSDEVAHRRKKYGLNQMADERESMIVKFVM
                     FFVGPIQFVMEAAAILAAGLSDWVDFGVICGLLMLNACVGFIQEFQAGSIVDELKKTL
                     ANVAVVIRDGQLVEVPANEVVPGDILQLEDGTIIPADGRLVTENCFLQVDQSAITGES
                     LAVDKGYGDQTFSSSTVKRGEAFMVVTATGDNTFVGRAAALVNKASGGQGHFTEVLNG
                     IGILLLVLVIVTLLGVWAACFYRTDNIVKILRFTLGITIIGVPVGLPAVVTTTMAVGA
                     AYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVSADDLMLTA
                     CLAASRKKKGLDAIDKAFLKSLINYPKAKDALTKYKVIEFHPFDPVSKKVTAVVESPE
                     GERIVCVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELASRGFRALGVARKRGEGHW
                     EILGVMPCMDPPRDDTAETVNEARRLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAE
                     RLGLGGGGDMPGSELADFVENADGFAEVFPQHKYKVVEILQNRGYLVAMTGDGVNDAP
                     SLKKADTGIAVEGASDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIAL
                     SLHLELFLGLWIIILNHSLDIELIVFIAIFADVATLAIAYDNAPFSQTPVKWNLPRLW
                     GMSIILGIVLAIGTWICLTTMFLPRGGIIQNFGSIDGVLFLQISLTENWLIFVTRAVG
                     PFWSSIPSWQLAGAVFAVDIIATMFTLFGWFSQNWTDIVTVVKIYIWSIGVFCVLGGF
                     YYIMSESVVFDRLMNGKPLKEEKSTRSVEDFLAAMQRVSTQHEKEN"
     gene            <58830..>62198
                     /locus_tag="CAGL0A00517g"
                     /db_xref="GeneID:2886322"
     mRNA            <58830..>62198
                     /locus_tag="CAGL0A00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444795.1"
                     /db_xref="GeneID:2886322"
     CDS             58830..62198
                     /locus_tag="CAGL0A00517g"
                     /inference="similar to AA sequence:UniProtKB:P38929"
                     /note="similar to uniprot|P38929 Saccharomyces cerevisiae
                     YGL006w PMC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444795.1"
                     /db_xref="GeneID:2886322"
                     /db_xref="GOA:Q6FXU4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU4"
                     /translation="MPHNMNFHSPKSVGAFVEQVGGSAEALARRLSTDLANGIATDKD
                     AELPPLKRRDAYGSNRLPERAPKSFWALVREAFQDRTMLLLTGAAVVSFTLGIYEVLT
                     QPPELDPEGNPITQVDWIEGLAIMMAVLVVVLVSAANDYQKELQFQQLNRKREDRQVV
                     VVRDAAESLISIHNLLVGDLLKLQTGDVVPADCVLVRGECETDESALTGESNTIKKLP
                     LADALEYHSAHGGRDIGDTSASGASGAADDSRCPDCMLISGSRVLSGLASAIVTNVGV
                     NSVHGKTMASLKEDSEDTPLQMRLSQLTDNISVYGCVAAITLFVVLFARYLSYILPSG
                     GKYHDLPPAEKGSKFMDIFITAITVIVVAVPEGLPLAVTLALAFATTRMTKDGNLVRV
                     LRSCETMGSATAVCSDKTGTLTENIMTVVRGTLGRAGFDDIGADPSKSNLVFKKKCSD
                     LLRTVIYDNIVLNSTAFENKDYKDPNNYNSIDDSQPRRLIRRITQTLQKKKPDDEENL
                     LAHAAEGRQEPYIGSKTETALLSLARKSFGLKFGALQSFRGHPEKLPTVETIVQIIPF
                     ESSRKWSAIVVKLNSNKENEGKKFRLYVKGAAEIVAKACTLKNVCNEGISEIDQKSKD
                     DIEEQIFSLAKDALRAISLAHMDFDVNEWPPKELADPENSHEALAVKLIDPKKPHLEG
                     LTLDAIVGIQDPLRENVKNSVAQCQKAGVTVRMVTGDNLLTAKAIARNCGILSSKSLN
                     DSACAMEGPAFRKLSDSERKRILPKLRVLARSSPEDKKILVRALKEMGEVVAVTGDGT
                     NDAPALKLADVGFSMGITGTEVAREASDIILMTDDFSAIVNAIKWGRCVAASIKKFIQ
                     FQLIVNVTAVLLTFVTSVISSDVKSVLTAVQLLWVNLIMDTLAALALATDKPDPNIMD
                     RKPKGRSTPLITPSTWKMIIGQAILQLSVTFTLYSHGAQYFFGKPKEDLPGHEHQQIN
                     AMIFNTFVWLQWFTLLVSRKLDEADGIKDWRKRLTASNLNFFQDLFRNYYFIFIMSLI
                     AVLQVLIMFFGGAPFSIAHQTKKMWLVSVSSGILAIPVGALIRICPDEWAQAVFPARL
                     AKAIKYFAGLEFLRNTESESRSDSEEEERLLTPA"
     gene            complement(<62416..>63225)
                     /locus_tag="CAGL0A00539g"
                     /db_xref="GeneID:2886286"
     mRNA            complement(<62416..>63225)
                     /locus_tag="CAGL0A00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444796.1"
                     /db_xref="GeneID:2886286"
     CDS             complement(62416..63225)
                     /locus_tag="CAGL0A00539g"
                     /inference="similar to AA sequence:UniProtKB:P53195"
                     /note="similar to uniprot|P53195 Saccharomyces cerevisiae
                     YGL005c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444796.1"
                     /db_xref="GeneID:2886286"
                     /db_xref="GOA:Q6FXU3"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU3"
                     /translation="MSGTTDMASQDEDAVLKMFFDEQFVPQAFVDILLSKANGTGLNE
                     VRVVTSGLQSRLDYYTEHLTKELEGTISSLEKISDTLPGTWNTSDSYGADGNIGSSKL
                     EYYLDTLANAVRSLESDIKTLNSQIDTAETESEEQTQKAAVLGRLRDFEKAKSRLNEV
                     LLYFNQLEAIATITGKKSEQKIAPITIKDFKLSLDTLQETIVNTLDESEKKESANEKN
                     EDILEKIDMFIELETVLKDIDPFYQEYHKFIESITKRANEYINTKNIENDL"
     gene            complement(<63710..>64948)
                     /locus_tag="CAGL0A00561g"
                     /db_xref="GeneID:2886437"
     mRNA            complement(<63710..>64948)
                     /locus_tag="CAGL0A00561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444797.1"
                     /db_xref="GeneID:2886437"
     CDS             complement(63710..64948)
                     /locus_tag="CAGL0A00561g"
                     /inference="similar to AA sequence:UniProtKB:P53196"
                     /note="similar to uniprot|P53196 Saccharomyces cerevisiae
                     YGL004c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444797.1"
                     /db_xref="GeneID:2886437"
                     /db_xref="GOA:Q6FXU2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU2"
                     /translation="MANVPIAHIQSDFETDYENGGEFYINVDVSPNSVIEYRVHIDAG
                     SATEVSRVDNGLRTICNDSSFTRQSNGSYKFEVNGKIYWFKTPKRLVSTEELGISESL
                     DLISCDASTDKIVIGDSGGDINVYDHEWMSKLSLVGAHVSDVTTVKIFPSNAVLLSGS
                     TDMQLKVWSLEDGSNPRTLKGHSAGITDTIIIERGRNVLSSSLDGSVRLWELGSGKTI
                     SKFCRKENTTDGVTSMSLLVGEESTSMSAQVTDRETGDRLEFGTEGKQVFAGHLSGTI
                     TVHDLFNKQQILQIPSSFVAPCNTIAQISEHAIVSGYEDGTVATWDIRKPQQYLQKLD
                     FAGNAINKILNWKDKLFLSSGLDNTFEIASDSGNGKIDITSATHLATEEVNNFVIVPS
                     APSSRLLAVGKWGLCGIYDI"
     gene            <65286..>67226
                     /locus_tag="CAGL0A00583g"
                     /db_xref="GeneID:2886414"
     mRNA            <65286..>67226
                     /locus_tag="CAGL0A00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444798.1"
                     /db_xref="GeneID:2886414"
     CDS             65286..67226
                     /locus_tag="CAGL0A00583g"
                     /note="weakly similar to uniprot|Q06149 Saccharomyces
                     cerevisiae YLR266c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444798.1"
                     /db_xref="GeneID:2886414"
                     /db_xref="GOA:Q6FXY4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY4"
                     /translation="MTTKGRSKIIRRRVIKSCQYCYAHKLKCNRESPCLTCQQQGTQD
                     QCVYNFQDNDTLTHRKSLEQFKVLKEPRYTLRSSTQYKLFKPKTFYPFFSSSLTDKLV
                     FSSIYDDVALTPNFTRNPITRLNKLDKQNLPDSIDDVISILPKSLEEALSQLDIFQSS
                     IHAIIPVLSISESRQAITNFYEDLSSSQINTTDALVLLGILFCSSYSAIASGIVIDTD
                     ICTNYYNGYRFLLHHSDFPRYPTIEALQVFTVVNFVIDPNMLDMTGHSAMLIRVAQQL
                     GLHKNDQYRGDKTNQRLNFLWNYLLYIDGSTSVVHGFPFSTRTWLYQQTDIDLKYRDP
                     DLAIPVEFSLGRFCINKVFRSVMDMSIDEETIGDRLRLQKEISELCSVLIRLSKDLES
                     RLGRIKAQYFNSTLFIFLFRLHSRFILLTSGQLPQDKILESQNTDNKKVEYSINNITW
                     ILDKPQKFDVKVTTLSLLILIQTLRRITQDSIDKYLWYTKGSTVMQYLFVLLKDLYQH
                     PSSDLHIEDVFPEYGTVVGEEILNSYSNNPNVFKIVLLDILIGVLELKLAPLWSNSDL
                     FQFTLVKSLKEAVEVKFSDFIDANDAKIHLLKESVDLFRLAEKCLVNKSSICLEDCLR
                     IWENDDEFLQYTKSFAEWLTEL"
     gene            complement(<67281..>69203)
                     /locus_tag="CAGL0A00605g"
                     /db_xref="GeneID:2886426"
     mRNA            complement(<67281..>69203)
                     /locus_tag="CAGL0A00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444799.1"
                     /db_xref="GeneID:2886426"
     CDS             complement(67281..69203)
                     /locus_tag="CAGL0A00605g"
                     /inference="similar to AA sequence:UniProtKB:P53197"
                     /note="similar to uniprot|P53197 Saccharomyces cerevisiae
                     YGL003c CDH1 substrate-specific activator of APC-dependent
                     proteolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444799.1"
                     /db_xref="GeneID:2886426"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY3"
                     /translation="MSENSNSLRNPFVSNTPQASPYKKQQLEYHRRGSVEDVTRRPTS
                     SSSSLSSPGKHSRRPRSSLQRYADRYLPTRTDLDLRTIRSIGSSNATKNNTPVVPTSP
                     TSPNSSCADHLEVRRERESMEKFDTILKNELFGDYLAKDRDLSPERDSIYNSSTSRFT
                     SPRKSLQASSIDQIRNTVNFSANSSPLKSASSIQFYRENQSDSDSDIGTDTDSDGANS
                     SGLNNPYTSPSRRRHSNLFFNNIGTSVSLPVTPKKLTFSAGASTEEVGSTKRGASLLK
                     YMTQSSTRPSTASVLHSHFESLDVSPIRRDSKKLLLSPVKQFKNISKVPYRVLDAPSL
                     ADDFYYSLVDWSSTDILAVALGKSVFLSEHQTGEVIHLCDTPNEYTSLSWMGAGSHLA
                     IGQGNGIVEIYDVTKEKCIRTLSGHLDRVACLSWNNHILSSGSRDRTILHRDVRMADP
                     FFEKIETHEQEICGLKWNTNDNKLASGGNDNMVFVYDGTSRTPFLSINEHKAAVKAMA
                     WSPHKQGILATGGGTADRTLKMWNVNTSVKLNDVDTGSQVCNMVWSTNTDEIVTSHGY
                     SKYNLTIWEASNLEPLAILKGHSFRVLHLTLSADGTTIVSGAGDETLRYWKLFEKQKR
                     KATADSTILNALNQIR"
     gene            <69832..>70485
                     /locus_tag="CAGL0A00627g"
                     /db_xref="GeneID:2886313"
     mRNA            <69832..>70485
                     /locus_tag="CAGL0A00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444800.1"
                     /db_xref="GeneID:2886313"
     CDS             69832..70485
                     /locus_tag="CAGL0A00627g"
                     /inference="similar to AA sequence:UniProtKB:P53198"
                     /note="similar to uniprot|P53198 Saccharomyces cerevisiae
                     YGL002w ERP6 and similar to uniprot|Q05359 Saccharomyces
                     cerevisiae YAR002C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444800.1"
                     /db_xref="GeneID:2886313"
                     /db_xref="GOA:Q6FXY2"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY2"
                     /translation="MQFFIFVSILCLFLENVGAFYMYSNSGDRKCFFKELPQGALLRS
                     TYKVQVHDSTTNRYVPIAASNGRDMTIDIEEVFDDNHRVVHQFSSIQSGEVTFVAVES
                     GEHKICFQPNQSDLGRKKLRIDVEFTTGSVDDIDSKKTTKLKTLHRRVIALIESVREI
                     KYEQEMVRERETLFRDASEKVNSRAIWWILSQIVVLVAICVLQMSYLGKFFVKQKII"
     gene            <70937..>71320
                     /locus_tag="CAGL0A00649g"
                     /db_xref="GeneID:2886463"
     mRNA            <70937..>71320
                     /locus_tag="CAGL0A00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444801.1"
                     /db_xref="GeneID:2886463"
     CDS             70937..71320
                     /locus_tag="CAGL0A00649g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444801.1"
                     /db_xref="GeneID:2886463"
                     /db_xref="GOA:Q6FXY1"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY1"
                     /translation="MKFIKFTIRSGAVGVYFNDIHIKISLRSINYTKLVSYNKPIPYQ
                     DRSIELLENSTSEVIQYKPCAPSHQGTNIKTTIIERQAMRFTKELSPEEIEFVDMSLS
                     GMRPSVCEYLSHVSYRETGILSVRN"
     gene            complement(71627..71735)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0A00671r"
                     /db_xref="GeneID:2886315"
     tRNA            complement(join(71627..71663,71699..71735))
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0A00671r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2886315"
     gene            <73333..>73623
                     /locus_tag="CAGL0A00715g"
                     /db_xref="GeneID:2886372"
     mRNA            <73333..>73623
                     /locus_tag="CAGL0A00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444802.1"
                     /db_xref="GeneID:2886372"
     CDS             73333..73623
                     /locus_tag="CAGL0A00715g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444802.1"
                     /db_xref="GeneID:2886372"
                     /db_xref="GOA:Q6FXY0"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY0"
                     /translation="MSYSVETKKHVRGISDHILSEHKISTTPAITGMGPFTTAVRVSL
                     SAIDDTVHYRSKVPDSTTPCNHGCFAGNMKGTSIVAERNLREVRMAHIIYVI"
     gene            <74767..>76416
                     /locus_tag="CAGL0A00737g"
                     /db_xref="GeneID:2886423"
     mRNA            <74767..>76416
                     /locus_tag="CAGL0A00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444803.1"
                     /db_xref="GeneID:2886423"
     CDS             74767..76416
                     /locus_tag="CAGL0A00737g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
                     cerevisiae YDR342c HXT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444803.1"
                     /db_xref="GeneID:2886423"
                     /db_xref="GOA:Q6FXX9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX9"
                     /translation="MSEESQSAFSASNSKVEREEDFKAYADEDGQPMVEIPKKPASAY
                     TLIFILCLFIAFGGFVFGWDTGTISGFVAEEDFIKRLGQRRANNTYYLSKVRTGLIVS
                     IFNIGCAIGGVVLSKFGDMYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFIGRIVSG
                     LGVGGIAVLSPMLISEVSPKHMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSVQWR
                     VPLGLCFAWALFMIGGMLCVPESPRYLVEVGKFEEARRSIAISNKLTPEDPAVTFELE
                     NVQAGVEAERLAGSASWGELFSTKTKVLQRLIMGIMLQCLQQLTGDNYFFYYGTTVFK
                     AVGLEDSFQTSIVIGIVNFASTFVALYVVDRFGRRKCLLWGAASMTACMVVFASVGVT
                     RLYPNGMDQPSSKGAGNCMIVFTCFYIFCFATTWAPTPWVINSETFPLRVKAKCMAIC
                     QAANWIWGFLIAFFTPFITGAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNT
                     MWEEGVLPWKSPDWIPPSKRDATYDADAMMHDDKPWYRRMW"
     misc_feature    77251..77360
                     /note="Centromere Cen0A"
     gene            <77746..>81366
                     /locus_tag="CAGL0A00781g"
                     /db_xref="GeneID:2886454"
     mRNA            <77746..>81366
                     /locus_tag="CAGL0A00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444804.1"
                     /db_xref="GeneID:2886454"
     CDS             77746..81366
                     /locus_tag="CAGL0A00781g"
                     /inference="similar to AA sequence:UniProtKB:P39702"
                     /note="similar to uniprot|P39702 Saccharomyces cerevisiae
                     YAL002w VPS8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444804.1"
                     /db_xref="GeneID:2886454"
                     /db_xref="GOA:Q6FXX8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR025941"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX8"
                     /translation="MLEQLPLDYFTKSEMARSLIKWSSYSHIYSSLTPYGYPTCFLPT
                     RSHLVIGTSKGMILIFDFREFLHGILIPQSSTSDADNALRDAVKILKISEDGTHVAGA
                     YESGHVFLWDINITGSNGSDDSKIEPIRAILYVDDYINMTVIGLDFYGNRHTGLIVGV
                     QETGTITYHSGKRNHLWKLVYTNAIVLKVPSNERLLLCNCKAYEDVVFCGILTSKYFA
                     VMKLGEVPKLIYNEPIKATSQQLGLNYSMSWNANISRVAYSVNTNLSCVALEGNNAYE
                     LMKVHDYTTSESISSLQWLSRDLVGVLTISHQFLLLDSSNGFKANAIVDLLEQDILRP
                     PSTHFQWYDSKAFLFSTYSFKIGHLMTWSQLVLTSVQKGNYIESLLLLEYFLNEESKL
                     NNILFYENKDTPKKKVLFEPFYNLAMAAVGFLIKSEIASNSKYEELFTLIFRIWGQFT
                     NGRQSSIVANEDLIDKISELLPNEKKSLYYEALALAVVYGKVKRLPAESFKELIQDQA
                     TKRHVIRLQEILTSLDVANLDIDLAVRVCNKEGLIDLSIYIWNMIFNDYLTPFIEFLQ
                     SIATSNGTKTTAAQNLSIGINDPRMVFKYLECIFGSKQYPLGNRNIPVKSAQIAFEQI
                     LSVLFSGTSIRWPLSSTNNFQLYKMDEEPAFPYLTLLLDYNVESCLQMLDHLFESDIL
                     NVDESDLDGDSVFSRQYITEILMDYMLNNKNNGNGVAVGTFIARNCPKYPQFIHVSNK
                     YYDSIIDVICNNKIESLKKRSETALEAIISKYTPKDENQFVEMIKKNMFLKALVMFYR
                     ISNKFSDMIEIIVGDESASAFTSQETSDILNFVLRNVKESIDKLKIKDAIACHFNQII
                     QNVDLDEFITICQNFDPALHDSILLNEDEDLKYRYINILFDDTKLLPEERPALLGWYL
                     HESVKRGDEKKLIDLLNKITRPPKDVNNLIEYLIHSTFFESASILYSLLGDKFQQLRT
                     LLSAVECLNKNNINQELIKPHIFKAVSIANSAVVDEKKYWCAILECLIRLFISDNIST
                     VNGGFQLYSMMVNVFVSISEKGYDIDNEDTKRFSKIFENALENQELLLVKSNRFRDGF
                     VEIFNQYNLSENVLKLVLAVVMNYSSESDILYLLSQRRGWSIGSDVCEICGKKLWGIG
                     LAKKDFETWKIRFENESDFYKLSLNHDVVVFKCRHAFHDKCLGNLGQNGEYHCLFCRY
                     KV"
     gene            complement(<81425..>84913)
                     /locus_tag="CAGL0A00803g"
                     /db_xref="GeneID:2886441"
     mRNA            complement(<81425..>84913)
                     /locus_tag="CAGL0A00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444805.1"
                     /db_xref="GeneID:2886441"
     CDS             complement(81425..84913)
                     /locus_tag="CAGL0A00803g"
                     /inference="similar to AA sequence:UniProtKB:P34111"
                     /note="similar to uniprot|P34111 Saccharomyces cerevisiae
                     YAL001c TFC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444805.1"
                     /db_xref="GeneID:2886441"
                     /db_xref="InterPro:IPR007309"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX7"
                     /translation="MVLYPDELVSQLCEEIAYEKGAVSLAQLWNIAETVMGVTALDDD
                     EPMQRYILQSLFSDPEVLVMDGEGNSVTKSVTEIDSACVVSISEEKLWQVLTGGYSKK
                     DSSIGNSAFQLLVEIAHARGQGINTMELAQITKQDPRSITGRLKKLDNLIKSVQVIHN
                     GHVVKNLRLRKFITDINEEENEEVYISMRDHLAEIVDVVKNSKNCIRQVSDLKRQLQF
                     DKTKRLSRAFISAIAWLDENGYLRKVIVVSPVNPDVKIRCVKFLKDYKPSQDANEFSD
                     SDMGEMSNDEDEAENDDDEAIERLNSTSTTDVLQGQELVLQEPSNTTSTTNGNNNIYM
                     NRFYPIQNQTYAMVEKTGVKGLPTMDIINSLTGRDYKRPFGKISDYYMVSKNSKAKGA
                     NFKKNNKYQLTRLYDFEGKKKFYRFFTKENFEKLTDTTVGNAEVKNYNWPSDLKKQNQ
                     NIYQLSKKLFSPLNVTLRTTLDNSGKRIFFWNGELDIERPEIPSGSKKRKITVSEGER
                     KSKSVQEKRSRNISDNLVEKDVEGTKLPLLNIDGFSASSLRSLSRQKAIMKVLEKSGG
                     VSLLREQFFEDVTNYMSSSTVIDKKTLKGDVDLMIGNSKLTLYTDPDTQKKVIHFPDV
                     PMAKISDLLTDTKDNKKNFFKDILHDTDIYFYDQNAKDRFNRKMKATERIRKYQNGRK
                     NNNSEVRNTNSSSVKLFEERKRSRKERIDRTKKHNGNITPIVEDKQLEKASRDFNIST
                     KLGIAKLIKLVVISKSIKNEVVWSQITTLFPYNSIDNLKRQWTARRIKMGQHGWKALL
                     SKWRKILLQGISEELVTLEQTENLELSILLRLWEDKEKEVDSERVKLLYNYQENLKQL
                     TFLKKGDNKTVSTHSSIAMSSMIQREIASLKHTPTLSHECLPDVEQKARRQDQIRTIV
                     RSILVESKEMNKNEIDILKDVPRDELDAIIMDMAKQKQLYLHSSKLKPTERIFELLQT
                     KGDFSAFKKAANLSEKIAQMLNSSYGIVINEEFEDVCSWIFIDLIDTGDACISIMPLE
                     RHVRPLKYTTRSFEIKTLTPPLVLYNGNGSTGINFDVKQIPVPLGKPFSKLWIDSEGS
                     LRSDIWKSLLTIVLTDILFKPGVQSTTIASDCESLIGVEEIEVICQWLINKNLIVKDD
                     NDGFTVQSRWYNLLKV"
     gene            <85331..>86425
                     /locus_tag="CAGL0A00825g"
                     /db_xref="GeneID:2886471"
     mRNA            <85331..>86425
                     /locus_tag="CAGL0A00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444806.1"
                     /db_xref="GeneID:2886471"
     CDS             85331..86425
                     /locus_tag="CAGL0A00825g"
                     /inference="similar to AA sequence:UniProtKB:Q06168"
                     /note="similar to uniprot|Q06168 Saccharomyces cerevisiae
                     YLR321c SFH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444806.1"
                     /db_xref="GeneID:2886471"
                     /db_xref="GOA:Q6FXX6"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="InterPro:IPR017393"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX6"
                     /translation="MVKAVERRLVPQGVVTNFYNRVKEDGTIVQSLQRGGGSRRSRAV
                     NYSEVDAFEDFEESDDERQGSNNRSASTEAVVDDKLPENVVLPDLEDIITGESDPSLN
                     VLKFRKVRDTFFGGRIAIRYKLELDQNEVRSSSLAVPIIVPITLKLEDTADGISITDS
                     LLWNINDTSVTPEQFSLVYCRDLGILGNNYIQQQIATLIRDQIENYRTLSGHLLQANE
                     NMRSYPDFHVHLNIACNLNSRYYEDNFQWNINDESLTPEKFATIVVKDLGLTRDFLPS
                     ISQVLHEQLLQIKKEWIKGEFNHELIHPDENNRMVRIEANQGELDRAWSPRVEVLSMD
                     EIQKREVERERQLRRMKRDSDRLGRRGRRK"
     gene            complement(<86551..>87540)
                     /locus_tag="CAGL0A00847g"
                     /db_xref="GeneID:2886424"
     mRNA            complement(<86551..>87540)
                     /locus_tag="CAGL0A00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444807.1"
                     /db_xref="GeneID:2886424"
     CDS             complement(86551..87540)
                     /locus_tag="CAGL0A00847g"
                     /inference="similar to AA sequence:UniProtKB:Q9URQ3"
                     /note="similar to uniprot|Q9URQ3 Saccharomyces cerevisiae
                     YLR316c TAD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444807.1"
                     /db_xref="GeneID:2886424"
                     /db_xref="GOA:Q6FXX5"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX5"
                     /translation="MVKKVDNKIKIDFKRCIVEDRLLQIQPLDISNVPELCNVWTIDI
                     QPQLSKSFIELVKLNTRDQDPIPLAHCKRIRKVINEEGNSLLRCIICSTLMYDNIDEV
                     RELIKFDYENLNSSNKVPKRGPYDKDLVKEWSEKYWPLVWNGNPNDQILNDSEFKMDE
                     INFYLKIIQEESKRIGKESGSLPIVSVFVDPKFKGDFIIAVDQRSHSEEEHLSLKIDH
                     SIMVGINKVANTEKKRRSLEDCNNVPQNYLCLDFDVYTTHEPCSMCSMALIHSRIKRC
                     IFIEQMARTGALMANSGNSYCMHANKKLNSKYEVYKWIGDEYKVPTINKNICV"
     gene            <87841..>90396
                     /locus_tag="CAGL0A00869g"
                     /db_xref="GeneID:2886360"
     mRNA            <87841..>90396
                     /locus_tag="CAGL0A00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444808.1"
                     /db_xref="GeneID:2886360"
     CDS             87841..90396
                     /locus_tag="CAGL0A00869g"
                     /inference="similar to AA sequence:UniProtKB:Q06163"
                     /note="similar to uniprot|Q06163 Saccharomyces cerevisiae
                     YLR318w EST2 catalytic subunit of the telomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444808.1"
                     /db_xref="GeneID:2886360"
                     /db_xref="GOA:Q6FXX4"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR003545"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX4"
                     /translation="MKVLREVVTTNENSLRQLGVLLDSTFVIENEVQIDIDKDFFDSS
                     AGHRKLIDQCIVFLLQKRLLNNVLVAGYKLAKNNTVRSILHCENSNSAVKTLKSSSWE
                     LLHTNIGSPKFVNLILNHSIFTFNGEFTQQVAGNSLNKPHLPPSWIIDNDYEQETDIN
                     CFSINNRPYLYHNTRGFCIKSIILDRDMLNETLDIQVKYLMREIFENDIKLNKKALRT
                     TVIETVLKQVLENQQRIPIIPILDKICPKTYSNYHLDRATPVKCVNKFIVVILEKLKI
                     LQLIGSRKNSFVLFSKISQLLKLPLNGKINVKEFFTKLNVNAVRRYLSIDPIGQQKQS
                     MRLYLTCVVNYLLSKLIPSLLKSFFYCTEVSSYSKILYFRNDEWNSISTPFLKEYLDK
                     YLVQNTHCNSHFSYMESQFNHCNFRLIPKKGNNEFRVIGIPYKGNNAEELLQYKQNHT
                     KVIVPTKLILDYLRKSRQTTQKLLFSAMQISDHICQYKCHLHSKYGYIPKLFYLKFDI
                     HNCYDSIPIAKAKSVLNSLINNCGYEEFYVRSVTILNTKNNEVRYDTIVNGHINIRDF
                     EIMVDNSTTTFLTKEDIMDLIEFEMEMTSIRLFDKCYLRKDGLFQGLSLSATIVDILY
                     DDMLEKNRVFKDILNNDGLVLRHADDFLLISPSKEIISYARLKINEGFTEYNAQVNHR
                     KIVFSESDNIANTAIPFCGVEIIPRTLEVIKRFSAMNETDISDHEGNIYSKCAVLFKM
                     RLNYGTMNANLNSISTMLKQVENATINIVRIILNSNHIATSVSSFSSFVNELYNICLL
                     SSRNLNLLNHRDLQRFLTSIKKTILTVLLKNLKRKYSIYNGISRNMNSKRTSK"
     gene            complement(<90494..>92752)
                     /locus_tag="CAGL0A00891g"
                     /db_xref="GeneID:2886429"
     mRNA            complement(<90494..>92752)
                     /locus_tag="CAGL0A00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444809.1"
                     /db_xref="GeneID:2886429"
     CDS             complement(90494..92752)
                     /locus_tag="CAGL0A00891g"
                     /inference="similar to AA sequence:UniProtKB:P41697"
                     /note="similar to uniprot|P41697 Saccharomyces cerevisiae
                     YLR319c BUD6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444809.1"
                     /db_xref="GeneID:2886429"
                     /db_xref="InterPro:IPR005613"
                     /db_xref="InterPro:IPR022782"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX3"
                     /translation="MSEEKLPLGKTHSSIETTVTKLLMSTKLLLQTLTQWSRGSVGPR
                     AVSDAYVHLGNDFKIVSKFFTHAKVDISDLGDVPLALRKVLEVALREPPSDESLNKYL
                     PQIREIIVTLLDKLKVKQALLKTMKQEQKMMMTSPQHRKQHSITSSISLESERGGVST
                     AGSRVNSIVSNVQSQRNSATVDQQFVDADTESTTTSAGLTSVTAVEDSQPEEGDALAQ
                     LKKGNNLQRKASKRYSAYHMAKLTNHSATEAANAAALASNGLPQSLDNDLSSERIISQ
                     GSKRLSSTGNKLTERLQNELEDKHEDEINPEAVQISDIDKVEAMKQVEATDKAEAKGV
                     LFLKLDNRVKKCEATFPITMTGLRLLFVEMFAYSPGGDSFPDIYINDPVHNISYELDE
                     HGLKEVKEGSLVELHSRPTQAPPSSAGSDLIDLLKDELQKNQQVMLDRISSLQINSAP
                     VQASSSEKENVATNKEYSNTLKEVQHEIAIVRQVYIDNKKALEKTIKFILEKVDAFKS
                     VNLATNNSSNRQYIEQSQTELGDVSDKLLSKVDDLQDLIEIIRKDVAERGAQPSKRKL
                     ELVQKELNDAEHDLQRMKSFIDTEKPHWKKIWETELDKVCEEQQFLTLQEDLIVDLKE
                     DLKKAVETFDLIDQCCKEQEKTPAKPRRNPVLPLLKPGTFNQVREEMLMAVQQLNPDH
                     ESRVEALERAEKIWERERGYRDEDEFRDELGNFVENSNLKKSGGVEEVERRRREKDEE
                     NLRANFGGGQLL"
     gene            <92985..>97265
                     /locus_tag="CAGL0A00913g"
                     /db_xref="GeneID:2886307"
     mRNA            <92985..>97265
                     /locus_tag="CAGL0A00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444810.1"
                     /db_xref="GeneID:2886307"
     CDS             92985..97265
                     /locus_tag="CAGL0A00913g"
                     /note="weakly similar to uniprot|Q06164 Saccharomyces
                     cerevisiae YLR320w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444810.1"
                     /db_xref="GeneID:2886307"
                     /db_xref="GOA:Q6FXX2"
                     /db_xref="InterPro:IPR013220"
                     /db_xref="InterPro:IPR019021"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX2"
                     /translation="MSDEVVLGSETEDQEVLFQQDWQDTDVPSSQLREPLSQAPVAGE
                     LGVRQSETAPLDASGDTNESRDQPVPAIGLRWSLRKRKAIQKMPYSLDRLKHKQLLQG
                     YDVSNDMMSQLELPAPTAADLDTYFQLPESDSDSESDPEASIEIKDDDELGNDSLEVV
                     VPRRYRGIRLDRSLDDDSDTDSDGDDTVNSQSNQKSSQSEIMFRGRKINLKTGFKGLL
                     PRSVWEKNMKSQQSKPKSNTSSTSRAHKGVALRKRVANRHSSTLNDGFLIDDISEVEE
                     EVTPLNLNSAQSHLIAEDMATSHERPPYILEDESGIDYISNNKQDVQGRYSTYMAGEI
                     LDGNKNLTRELNPAYNFDEPSLSMMLHRTSPNKSKKDNKSRAPRSNKPGSLIKRRKKE
                     KSTYNPITKEYSMVGIKYSRRSIRRPPKEKPYNNYEANITSKKASGDLSNLQPYLKIP
                     DVDKKDHKGDRQQKTKSRSRPYEIAPPENAIFKRNDIRSFSTVVEKIGDEIVVQHNPN
                     SKLQVTEDAPPGLQNGFLYLRERFPAIESLFNHKAIEIPNVIKISLGNESYVLSKMDY
                     KALKDNLTKLFTEIVNNGASDDEIFDFNVHVTSILLYLNKSDIYEIIEDFHRKFRTKL
                     SSIYQKAKPIHFFQIVMCQLMLFEITKYADISTQYKKILQDRLSNHTVSFFNLLDICY
                     ETLKTQESLYLNEAFHIISLIISDFEDGIELIWERLGKNTYSPSLFSIIITTLPILEP
                     QWQSVKIINSYENLKGVLKLVRYCNSYYKWKPNDLLILQLNKIFKERRFEDFPEEHME
                     SELNHVISSPTEKIKRKTIFNKYLSILRSSNVHSSIIEKITPMSEILTTDTTSILINR
                     VNLIIILSWFSNLNIEKRLSELLKPVLNDSYLHDRDSGTTRIVARSVLESFLALIRTT
                     AKKNGKISLKLNIFHLFFKEYVSKHDYLVSMWISFINRTAKISANLPTRTLKSVLKYL
                     VICFEDMQGDIETPLLSANLSLMKFMVKHLENIHMSIINSRLLSLSKQLAKTCRPWIK
                     YYTIICDYMIQRSEMTFWTYFQYSGINFDKPNGLYFLRKALSIADDASYQIIRERLYS
                     TLIDKLYIDESDDYYALYNTVLGRDLGIKLEFKKISGESHQLELVKRLVRTLAKLQMY
                     PKINILVQHIISVFNKKFISENFAVNFVQFIDENYRDYLIDYQDFSILKRLLSMNDIK
                     NERLLFKESFRKCEGRMQQMLFIQKNILSIIHKFAKDEADSASMILKDKIVQLMVSPI
                     LDCEVHFIRLMIESNIMPSDNVEIYSSSQIFISFMMDVLKGYLDSINWIIDSDSFQDY
                     YLIALKLIMAYPASLCLEGKCFFKILTFVDVLLNNYCLGLEEYSFLYQRTINAIDKNA
                     KPQFFEVEMTNEMSKLLASIKFPINRHEDHERNDTTRLISRLRNYTCQ"
     gene            complement(<97372..>98052)
                     /locus_tag="CAGL0A00935g"
                     /db_xref="GeneID:2886435"
     mRNA            complement(<97372..>98052)
                     /locus_tag="CAGL0A00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444811.1"
                     /db_xref="GeneID:2886435"
     CDS             complement(97372..98052)
                     /locus_tag="CAGL0A00935g"
                     /note="some similarities with uniprot|P53769 Saccharomyces
                     cerevisiae YLR323c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444811.1"
                     /db_xref="GeneID:2886435"
                     /db_xref="GOA:Q6FXX1"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /translation="MFKKRSAASKTRKRVKVETPVQKPAVQKPAVAVKPVLDKSHVAK
                     LEEEIASRPELDQKAVGEADATAVRLKRLKEQATKHDRLNSEPVASSKKIQQAANLRN
                     TILTDFQPDVCKDFKQTGYCGYGDSCKFLHSRDDFKAGWTLATDWKIDEQKEETRKEA
                     VPFKCVLCKESYERPVKTNCGHYFCQKCFVNRIKIDKSCFICGENTEGIAKMATDLVP
                     MDNANKDK"
     gene            <98272..>99483
                     /locus_tag="CAGL0A00957g"
                     /db_xref="GeneID:2886434"
     mRNA            <98272..>99483
                     /locus_tag="CAGL0A00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444812.1"
                     /db_xref="GeneID:2886434"
     CDS             98272..99483
                     /locus_tag="CAGL0A00957g"
                     /inference="similar to AA sequence:UniProtKB:Q06169"
                     /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
                     YLR324w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444812.1"
                     /db_xref="GeneID:2886434"
                     /db_xref="GOA:Q6FXX0"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6FXX0"
                     /translation="MSDKVVRAKFVESVQPRLGGDTTRVILKALHQGQVKEVKDGEDV
                     EVDEEQEGKSGMVVMPSPLLSSTPPSVVRSMVRLYPYLKLTDKALGVLTWSDFSIWNS
                     IVLVPAYLLFVLYYEVFVAYLGHMIVIFCVLGLMWIYNFVESPQDVPILEDIVLKMNR
                     VQYKFDKFIEPVITLKEQDITKLLYVSMLISPIYVLLGCLLGNEFIRFNIASFGVLIL
                     TYHSPWCKTLRRLLWKFKFVRTVIYRVMGIQTYEVQEPKINLDKKYKFTYVLYENQRR
                     WLGIGWKSSMLSYERTPWTDEFLNEAPKPSDFQLPNKEWKWLDSEWKLDLSNDGAIEV
                     PGERFLTNPKENDGYIYYDNTWKNPSIEDTFSKYTRRRRWIRTAELIEKLPTAATTTA
                     TSTSTTTPSVK"
     gene            complement(<100410..>100646)
                     /locus_tag="CAGL0A00979g"
                     /db_xref="GeneID:2886413"
     mRNA            complement(<100410..>100646)
                     /locus_tag="CAGL0A00979g"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_444813.1"
                     /db_xref="GeneID:2886413"
     CDS             complement(100410..100646)
                     /locus_tag="CAGL0A00979g"
                     /note="highly similar to uniprot|P49167 Saccharomyces
                     cerevisiae YLR325c RPL38"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_444813.1"
                     /db_xref="GeneID:2886413"
                     /db_xref="GOA:Q6FXW9"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW9"
                     /translation="MAREVTDIKQFLELTRRNDVQSATVKINKKLNKNGKQFRQTKFK
                     VRGSRHLYTLTVNDAGKAKKLIQSLPPTLKVNKL"
     gene            <101642..>102301
                     /locus_tag="CAGL0A01001g"
                     /db_xref="GeneID:2886462"
     mRNA            <101642..>102301
                     /locus_tag="CAGL0A01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444814.1"
                     /db_xref="GeneID:2886462"
     CDS             101642..102301
                     /locus_tag="CAGL0A01001g"
                     /inference="similar to AA sequence:UniProtKB:Q06170"
                     /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
                     YLR326w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444814.1"
                     /db_xref="GeneID:2886462"
                     /db_xref="GOA:Q6FXW8"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW8"
                     /translation="MSGLVRDFIVGYAEDFANEYAQENFQPVIDPYYARVGPQKKKVR
                     RELPAELFSKQERKRFKTLQSKSWTHDRSMCGCCCWTECIGWAPVFSIIPVVGPIIMY
                     MIHNSLVTYAERNLYNNRLPTGLKTKLLANITFDLCITLVPVLGALFSWLNGCSTRNT
                     ALIYNDLVEKRMKQVPQYQQAQAQQAQTQQAQAQQVPQYRTQQQAPAQQVPQYRTQQY
                     R"
     gene            <102793..>104028
                     /locus_tag="CAGL0A01023g"
                     /db_xref="GeneID:2886457"
     mRNA            <102793..>104028
                     /locus_tag="CAGL0A01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444815.1"
                     /db_xref="GeneID:2886457"
     CDS             102793..104028
                     /locus_tag="CAGL0A01023g"
                     /inference="similar to AA sequence:UniProtKB:Q06178"
                     /note="similar to uniprot|Q06178 Saccharomyces cerevisiae
                     YLR328w or uniprot|P53204 Saccharomyces cerevisiae
                     YGR010w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444815.1"
                     /db_xref="GeneID:2886457"
                     /db_xref="GOA:Q6FXW7"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW7"
                     /translation="MDPTRDPDFKPRDPDAKLLPPPDPTSKIPKSGPITPYVLADYNA
                     SIDAPLQMKKNTTHLPHSQGNHQRIPLNKSEFQPLSTTGSSEEDFELDDENMDSDSGS
                     KRESLGQLSGHGIGIGVHKNQIADLEEVPHGIVRQARFLEDYEFPTHRLANRLQDPNK
                     MPLVIVACGSFSPITYLHLRMFEMALDAISEMTRFEVVGGYYSPVSDNYKKQGLAPSY
                     HRVRMCELACERTSSWLMVDAWESLQPSYTRTAKVLDHFNHEINVKRGGITVHEKKRN
                     ADNSGYHMEEHKRGVKIMLLAGGDLIESMGEPGVWADEDLHHILGNYGCLIVERTGSD
                     VRSFLLSHDIMYEHRRNVLVIKQLIYNDISSTKVRLFIRRNMSVQYLLPNSVIRYIQE
                     HKLYINQSEPVKQVLSGKE"
     gene            complement(<104865..>106316)
                     /locus_tag="CAGL0A01045g"
                     /db_xref="GeneID:2886317"
     mRNA            complement(<104865..>106316)
                     /locus_tag="CAGL0A01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444816.1"
                     /db_xref="GeneID:2886317"
     CDS             complement(104865..106316)
                     /locus_tag="CAGL0A01045g"
                     /note="highly similar to uniprot|P08417 Saccharomyces
                     cerevisiae YPL262w FUM1 fumarate hydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444816.1"
                     /db_xref="GeneID:2886317"
                     /db_xref="GOA:Q6FXW6"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR005677"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW6"
                     /translation="MLRASSRAKTSLIGYSARMMHYRVETDTFGEIKVPADKYWGAQT
                     QRSFQNFKIGGARERMPEPIVRAFGVLKKSAAIVNEKLGTLDSEIAGPIQQAADEVAK
                     GKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGELGSKKIHPNNHCNQAQSSN
                     DTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEEFQDIVKIGRTHLQDATPLTLGQ
                     EFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLNTKEGFDKLIAEQISKETGID
                     FKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRYLGSGPRCGYGELHLPENE
                     PGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFELNVFKPVMISNLLSSI
                     RLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIGYDAASKIAKNAFKK
                     NITLKESALELKYLTSEEFDEWVIPENMVGPTK"
     gene            <106866..>108791
                     /locus_tag="CAGL0A01067g"
                     /db_xref="GeneID:2886416"
     mRNA            <106866..>108791
                     /locus_tag="CAGL0A01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444817.1"
                     /db_xref="GeneID:2886416"
     CDS             106866..108791
                     /locus_tag="CAGL0A01067g"
                     /inference="similar to AA sequence:UniProtKB:Q08979"
                     /note="similar to uniprot|Q08979 Saccharomyces cerevisiae
                     YPL263c KEL3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444817.1"
                     /db_xref="GeneID:2886416"
                     /db_xref="GOA:Q6FXW5"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW5"
                     /translation="MAKKKKDKEAKKARAEQKLKKNQAKAESKDKKRAKKLDEDDDDM
                     DIEEVLANFKKEQEQFEKVAVDSVDKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNP
                     QTSTTTFYNDLHTFTPENNQWKRYTSQNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQ
                     NTFYHYSDTWILDCNTKEWAKVDAKVGPSARSGHRITVWKNFFILHGGFRDLGTSTTY
                     LSDCWLFDITTYKWKQVEFPSNHQVPDARSGHSFIPTAEGAILWGGYCKVKANKKGYQ
                     KGKILSDCWYLKMKSDISGIRWERRRKQGFQPSPRVGCSMAYHKGRGILFGGVYDFEE
                     TEESLESNFFNDLFSYHIESNRWYSLSIRSRKSNNNAVAKKSGKNSKEQEKELKMLLD
                     SILEKANLQDKSDDDEDDEEINTALAKVDLEDEEEEQLAVQHTILTQLPHPRFNATTT
                     VIDDTLFIFGGIWELGDKEFMIDSLYSIDLNKLDGVTMYWEDLKEIERAKELGVEDSD
                     FEDDDEDDDDEDDDEEDDNEKDEGDDEESEEEEEEEIEEELEYPDPRPWLPHPKPFET
                     LRAFYIREGAAFLEWAISNNKNAKGKHLKKHSFDLCQERWWERRDQLRIEEDKLEEIG
                     GVGDIIERDKSASSKRR"
     gene            complement(<109009..>110616)
                     /locus_tag="CAGL0A01089g"
                     /db_xref="GeneID:2886458"
     mRNA            complement(<109009..>110616)
                     /locus_tag="CAGL0A01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444818.1"
                     /db_xref="GeneID:2886458"
     CDS             complement(109009..110616)
                     /locus_tag="CAGL0A01089g"
                     /inference="similar to AA sequence:UniProtKB:Q08984"
                     /note="similar to uniprot|Q08984 Saccharomyces cerevisiae
                     YPL272c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444818.1"
                     /db_xref="GeneID:2886458"
                     /db_xref="GOA:Q6FXW4"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW4"
                     /translation="MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWD
                     DDNDTLAATRVESRSTKKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEI
                     RTPDVISVVTFDNEKDEKVNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQ
                     LVFHCQDILFDIFSAANFHKLFLKELIAVCRPQQSYEKPLEYLFKLQKSFENNYSVPK
                     SIYDNLKLHLPATRPELLNLQTQSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNS
                     TTVISQEGNQLKLFRTRYTNILTSATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRS
                     FIAAITMLCLKPMVKSFNGTLIFSMPMNLRDSMNEKRDFGLVYKDIRVECPLSMIDDK
                     QCSVPGLNESDPEYNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTK
                     YDEKFAPNTRLIKINDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDG
                     LNICIHYPDGYNMENFVDCFESFMEEQ"
     gene            <111480..>111689
                     /locus_tag="CAGL0A01111g"
                     /db_xref="GeneID:2886293"
     mRNA            <111480..>111689
                     /locus_tag="CAGL0A01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444819.1"
                     /db_xref="GeneID:2886293"
     CDS             111480..111689
                     /locus_tag="CAGL0A01111g"
                     /note="highly similar to uniprot|P21306 Saccharomyces
                     cerevisiae YPL271w ATP15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444819.1"
                     /db_xref="GeneID:2886293"
                     /db_xref="GOA:Q6FXW3"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW3"
                     /translation="MSAVANASTAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMG
                     RGKTDAAYTKYEKGSPKSDPIPLQE"
     gene            <112037..>114442
                     /locus_tag="CAGL0A01133g"
                     /db_xref="GeneID:2886300"
     mRNA            <112037..>114442
                     /locus_tag="CAGL0A01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444820.1"
                     /db_xref="GeneID:2886300"
     CDS             112037..114442
                     /locus_tag="CAGL0A01133g"
                     /inference="similar to AA sequence:UniProtKB:P33311"
                     /note="similar to uniprot|P33311 Saccharomyces cerevisiae
                     YPL270w MDL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444820.1"
                     /db_xref="GeneID:2886300"
                     /db_xref="GOA:Q6FXW2"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FXW2"
                     /translation="MKYSGIAVLRGVRVTPLALPRAGSRYLSLLARPPTRQIIHNTGA
                     GYGVWVSHKVLTSSTIRRPFTAHRALNNEYNTTAGNASVKSQSATKEKNEEDRKYSKK
                     EKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILD
                     QLKNALAANSVDGQPVSIDKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVL
                     SERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL
                     ICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAE
                     EQLSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTV
                     LGFGSYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDR
                     VPSISTTKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGR
                     GKSTVALLLEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIV
                     YGLTEMPTKDEIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALI
                     KKPRILILDEATSALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLG
                     HDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQTTNITVTPPPTTMAEKVVEEVVEN
                     AEPETVIEDPGSPPMYISTVSEVSAEGHELINEQIEDTIENVMKDVTSERKPLKLQKD
                     ENL"
     gene            <114809..>116638
                     /locus_tag="CAGL0A01155g"
                     /db_xref="GeneID:2886461"
     mRNA            <114809..>116638
                     /locus_tag="CAGL0A01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444821.1"
                     /db_xref="GeneID:2886461"
     CDS             114809..116638
                     /locus_tag="CAGL0A01155g"
                     /inference="similar to AA sequence:UniProtKB:P32526"
                     /note="similar to uniprot|P32526 Saccharomyces cerevisiae
                     YPL269w KAR9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444821.1"
                     /db_xref="GeneID:2886461"
                     /db_xref="GOA:Q6FY01"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:Q6FY01"
                     /translation="MSNHELTFNNDLQMLLETQLPEIHDTISKLRSVQFIKGDDSSIE
                     DLCDVLEWITTQMNRILEIFPQIIDSTGIEVSSLLEYLDWLQERKELLFELVNDINSI
                     GPFLSDILEGIEANLNTDPNKSLDEHEMHLIDLIERCSTLRDDLDPWLNKLRKLLDAT
                     LEFKEISNDHMDGLDKVVSENIQSCFDIQEERFTSPVRHAPSFTLEQIVDLLKQNSDS
                     NAISVPTFNKQEKLISERFLELRRSVPAIEKSLTDILPNRIDNFARRDMTNIDSLAEF
                     LRDKYKVLMKKYEFMSSEISELNAELIDKRWNILFVNLNHEINFILDDYEKLKKKLNS
                     VEEIGINVQIREKMSHQMTQKSLTIERTFKVIFKAQEFSLLDAGIASKTNEMKNRWEK
                     VRVDDKLLRSVSVDSGPEISSVTKDFESLTLKNGSSHGASNRRSVSEGTPSASRQFGS
                     VLLKRMRIKPVSNTNKDQLLDDPNPFFDKKSRNSGKLVLNSIPALPHNKDPVTEPTKI
                     SKPQTISSSTPVKTAKSLEELEGERIMYYKTHGTTKLPSLMKKAERTQFSKYKETGTI
                     ATPQRTPKSMNAWGPSSKRGNVLRPPTPLSALITPTSSRRRPF"
     gene            <117020..>119572
                     /locus_tag="CAGL0A01177g"
                     /db_xref="GeneID:2886477"
     mRNA            <117020..>119572
                     /locus_tag="CAGL0A01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444822.1"
                     /db_xref="GeneID:2886477"
     CDS             117020..119572
                     /locus_tag="CAGL0A01177g"
                     /inference="similar to AA sequence:UniProtKB:P32383"
                     /note="similar to uniprot|P32383 Saccharomyces cerevisiae
                     YPL268w PLC1 1-phosphatidylinositol-4 5-bisphosphate
                     phosphodiesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444822.1"
                     /db_xref="GeneID:2886477"
                     /db_xref="GOA:Q6FY00"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015359"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FY00"
                     /translation="MKVSDGSKEVVCRERKLSSESRTSSESFSFLRRSNSSRSLLDDI
                     LSSSSSTSVKKNLKSVKKMAPFLNYKDLGESIGAITYPYSMAPWVPNLLEVDNSGIKL
                     DSDLERVMGVMREGVVLKKVTRKKQREYMFKLEKNKYITWKDGLKKLNLDSIKSIRPG
                     ELGSNYREEYNVDASYSKYWVTIIYKVSNKLKALHVIARDESDYNVFCSLVFGLVRTR
                     RELMESLAVPDHDKFADIHWNRALSRNPDEKAEEVLGFEDVRQMCQRFHIYCSAGYLR
                     RFFDAADTNNSGTLSFEEFQVFVKLLKARKEIDDVWQEAVGLHEDKLTFDTFYKFLTE
                     IQRERMDEDEARHLYERYETAGGGINKQGFEKYLTTSPYMLPNNEDYSRPMNQYYIAS
                     SHNTYLTGKQIGGAPSVEGYIQALQQGCRSVEIDMWDGESSPVVCHGVLTSALPLSSV
                     TQIIRKYAFITSPYPLIISMEVRCNSKNQRIAASIFKDTFGDLLYTCEDRSELPSPLE
                     LRHRILLKIKKTKTVIGDCHSDKSMNVVVSSSSSSRSSYDESTAMTKTGSRIRRLSFS
                     KRQVAIVDELYELAGLRGVKFRNFSLPESKTLYHCFSLDERRLDKMLGDAQVAAAVDK
                     HNRRHMMRVYPHALRYRSTNFEDPVRFWRLGVQMVATNWQTNDVGHQLNVAMFQLNTR
                     NQQQMPSGYVLKPGWLARPPSKRRRERCGAVLRVTFEVISAQLLPNLSESTETKSQAA
                     SIGAAETEDPYYTQVTCEMFSCGSTVEKSSKCHENGFSPVWRSALSQDVRRDEYPFVF
                     VRVVVRRCEEVVATTCVRVCQLREGYRHIPLCSPDGEQYVFSTLFVRYRVTV"
     gene            <119731..>120042
                     /locus_tag="CAGL0A01193g"
                     /db_xref="GeneID:9487957"
     mRNA            <119731..>120042
                     /locus_tag="CAGL0A01193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999463.1"
                     /db_xref="GeneID:9487957"
     CDS             119731..120042
                     /locus_tag="CAGL0A01193g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999509.1"
                     /db_xref="GeneID:9487957"
                     /db_xref="UniProtKB/TrEMBL:B4UMW9"
                     /translation="MRVTKVRSPVKVYEESRETRQRVLSSVKARLELHDDKENITQNI
                     TQNITKSSTLNSATHNCTTANGSPKTTTRRTSLPLRPLDTSRHKGYLHDLRRDTVRAL
                     Q"
     gene            <121067..>122908
                     /locus_tag="CAGL0A01199g"
                     /db_xref="GeneID:2886303"
     mRNA            <121067..>122908
                     /locus_tag="CAGL0A01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444823.1"
                     /db_xref="GeneID:2886303"
     CDS             121067..122908
                     /locus_tag="CAGL0A01199g"
                     /inference="similar to AA sequence:UniProtKB:P53388"
                     /note="similar to uniprot|P53388 Saccharomyces cerevisiae
                     YPL265w DIP5 dicarboxylic amino acid permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444823.1"
                     /db_xref="GeneID:2886303"
                     /db_xref="GOA:Q6FXZ9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ9"
                     /translation="MTTTLSVPPVFSENHSMVSLGASDSRGHHLTEHTHHEHHVNHVN
                     HDKKDGLDINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGG
                     SIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASR
                     YCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAM
                     NFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPY
                     SKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIV
                     FYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMF
                     VFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSS
                     GSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYF
                     TLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEV
                     DLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF"
     gene            <125780..>126661
                     /locus_tag="CAGL0A01221g"
                     /db_xref="GeneID:2886289"
     mRNA            <125780..>126661
                     /locus_tag="CAGL0A01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444824.1"
                     /db_xref="GeneID:2886289"
     CDS             125780..126661
                     /locus_tag="CAGL0A01221g"
                     /inference="similar to AA sequence:UniProtKB:P53386"
                     /note="similar to uniprot|P53386 Saccharomyces cerevisiae
                     YPR192w AQY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444824.1"
                     /db_xref="GeneID:2886289"
                     /db_xref="GOA:Q6FXZ8"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ8"
                     /translation="MDSDLEIQNKTQVEHVDKMGDSDVPESVSNSANMLRSRFNIGPD
                     SVRNHVIAFMGELCGTFMFLWCAYVIANIANHDVSLKDSPPHGSHPGQLIMIALGFGF
                     SVMFSIWCFVGVSGGALNPAVSLSLALARAITPTRCVVMWIAQILGGMAAGGAASAMT
                     PGPVKFDNGLGLGCSRTRGLFLEMFGTAILCLTVLMTAVEKGESNFMCALPIGISLFI
                     GHLALTAYTGTGVNPARSFGAALAKRYFPHYHWIYWIGPLLGAILAWFVWQVLQWLDY
                     ANYVAREKEAAEKAKTH"
     gene            complement(<127506..>129101)
                     /locus_tag="CAGL0A01243g"
                     /db_xref="GeneID:2886451"
     mRNA            complement(<127506..>129101)
                     /locus_tag="CAGL0A01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444825.1"
                     /db_xref="GeneID:2886451"
     CDS             complement(127506..129101)
                     /locus_tag="CAGL0A01243g"
                     /inference="similar to AA sequence:UniProtKB:P25346"
                     /note="similar to uniprot|P25346 Saccharomyces cerevisiae
                     YCR098c GIT1 glycerophosphoinositol transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444825.1"
                     /db_xref="GeneID:2886451"
                     /db_xref="GOA:Q6FXZ7"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ7"
                     /translation="MSKHLRNPVLRDIPTSASEWKYAICGRHKHEIYPIGASKANDDN
                     HDNDNDNDNDSTEHKKGFQKYWPIITTGAGLFSDGYINNSISTVSTCLSLLYGKEYSE
                     SHAIRNISSIVFAGTVCGMLIFGYLADHHSRKFSMLLGTSMLILFTILCAGAWGKGTT
                     NTHAGGLFAALTAYRFFLGIAIGSEYSSSSPAAAEASNLLPRGKRNRYFIWFTNTMID
                     FGFVIGAFVPLVLLWICGSHHLTPVWRITIGLGAIPPCSLFVLRLFYKEGKKFRETRF
                     NRKVPVWRIIKFYWFRVAIVSIIWFLYDFSSYAFGTYSSIIIGLVLPKDAPLYKNFGW
                     NVVFNLFYMPGSIVGALLSDYFGPRLVISVGLIVQAAIGFALAGSLDHLKRHIVGFVF
                     MYGVFITLGELSAGNNMGVVASKVNATPVRATLYGVAAMIGKVGAFVGTYVFPSLIKN
                     HGLSSPYYVSSALCCFSALLAFLFLPDLDQDAMKREDDKFMEYLASTGYDLSTMGIQT
                     DDESELSTISVKNSEINEKAFDK"
     gene            <131362..>135567
                     /locus_tag="CAGL0A01284g"
                     /db_xref="GeneID:9487958"
     mRNA            <131362..>135567
                     /locus_tag="CAGL0A01284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999464.1"
                     /db_xref="GeneID:9487958"
     CDS             131362..135567
                     /locus_tag="CAGL0A01284g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999510.1"
                     /db_xref="GeneID:9487958"
                     /db_xref="GOA:B4UMX0"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:B4UMX0"
                     /translation="MNEKIFRYLTLLFLFELASSLPVEDKLNIKKVFEKRAVDFTPFA
                     HYPRPEGCSSPPNSVSVGLHMNLYNYPYLYVKPSTKGMFTNDTNSDSDGETDGDSAGG
                     IEGRAGQCWNPEYQDPNFPRFGYKQYGEFGASDNVNGDISWDHNEFTEGCKPVLAALP
                     PGYNYPDEITFSNFTMVLSGYFKPKTSGVYKFELKADDFILFNFGAKNAFECCNREES
                     IDNFGPYVAYAMWPNQADQELEVYLFEDSYYPLRLFYNNRDYHSKFKIGFYPPGQTTI
                     TFDFDGYLFMLDDTGNECRDSIRYRTVCDDKVVDDTTYSTRYSTSMVPGGGSDVITIY
                     YIRMKCEEEDCLGQWDPINNVCYSPDDCADDGGYWNGQMCDQSCKLEGGIVNPDTGDC
                     DKSCIESGGFLDENGNCDTTCRDDGGMLVEGQCDYQCKEAGGILVGDHCDTTCVDSGG
                     KLNEDGTCDHSCRDQGGQLDESGECDTSCKDSGGMLIEGECDTSCKDEGGQLDENNEC
                     INHCKDQGGIIDENGNCDTSCKDSGGKLDENGACDTSCRDEGGIIDENGNCNTTCRDD
                     GGILVGDHCDTSCRDAGGILEDGICNSTCRDSGGKLNDDGTCDYSCRDQGGQLDENGD
                     CDYSCKNGGGKLDEDGNCDMSCKENGGQLDEDGDCDLSCKEDGGKLDGNGDCDYSCKE
                     EGGIIDESGNCNTTCKDSGGQIIDGECNYGCIEVGGVVIDGECDTSCVDSGGILDGDG
                     NCDRSCIESGGVLEDGACNTTCRDSGGKLNVDGTCDTSCRDDGGMLVEGQCDYQCKEA
                     GGILEDGECVFPPTSSSTSETSSTTDQSSSQSDDSSVESSSTPMDSSTIESSSSEIIT
                     SESESESVPIASSSSEVMTSESESESIPILTSSSEIPIASSSSEIIIPESESESVPVA
                     SSSSEIPVASSSSEIIIPESESESVPIASSSSEIPVASSSSEIIIPESESESIPIEST
                     SSEAVSSRSESDSSYPTSTPTTTTSTTWPNPIQPTTSNSSPIVSSSTETPGIAESSSR
                     ISDLESSRRTSILGDDRTRTRTTITSTITEDGQIITITTTVTGFVPEPTGETEGNGSD
                     DENLENPIENNTDENEFVDPEFTDDIPDDPAGPEDNGNGPVNPEQGNDNDPVNLEDSG
                     NNGAVNPEQAPVNDEDNGGNDPVNPEQDNNNGPANPGQDNTNGSSNSDQIDNNPPTPE
                     ENAGDGNSNGNDPADPSRRTSILGDERTRASPGGTSQPTGANGNVNGNSPGANVNGGG
                     TGNSNNNNNNNNNNNNNNNNGNAPNGGDGSNGDANQGPSRRTSLLGDERTRAGQAAPT
                     GGSSPNNGVAGDTSNNGGAIVSQQVDDGGAGSPRRTSILGDVRSRTTLNGEVLNFEGS
                     GVRRAVAGNLALPLMMVGLVFNL"
     gene            <136262..>137695
                     /locus_tag="CAGL0A01325g"
                     /db_xref="GeneID:9487959"
     mRNA            <136262..>137695
                     /locus_tag="CAGL0A01325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999465.1"
                     /db_xref="GeneID:9487959"
     CDS             136262..137695
                     /locus_tag="CAGL0A01325g"
                     /inference="similar to AA sequence:UniProtKB:P40356"
                     /note="similar to uniprot|P40356 Saccharomyces cerevisiae
                     YGL025c PGD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999511.1"
                     /db_xref="GeneID:9487959"
                     /db_xref="GOA:B4UMX1"
                     /db_xref="InterPro:IPR020998"
                     /db_xref="UniProtKB/TrEMBL:B4UMX1"
                     /translation="MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARI
                     KKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSND
                     FEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAP
                     TPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQA
                     AAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIP
                     ANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSP
                     MAGQGQLNQMFPMQNHNQNGHFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMN
                     PSMNMNMGMNMNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQNQNQNQSMNMNMNN
                     DSNNPKSAYDLVDFNSLDLSSLNMDFL"
     gene            <140305..>144693
                     /locus_tag="CAGL0A01366g"
                     /db_xref="GeneID:9487960"
     mRNA            <140305..>144693
                     /locus_tag="CAGL0A01366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999466.1"
                     /db_xref="GeneID:9487960"
     CDS             140305..144693
                     /locus_tag="CAGL0A01366g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999512.1"
                     /db_xref="GeneID:9487960"
                     /db_xref="GOA:B4UMX2"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:B4UMX2"
                     /translation="MNEKIFWYLTLLFLFNLASSLPVEDKLSIKRVFQKRAVDITPFA
                     HYPRPEGCSSPPNAVSVGLHMDLYNYPYLYVKNPRTGFTNDTDSDADGETDGDSAGGI
                     EGRAGQCWNPEYQDPNFPRYGYKKYGSFGSSDHVNGKISWDHNEFKEGCKPIMARLPT
                     AYNYPAKITFSNFTMVLSGYFKPKSTGLYKFEIHADDFILFNFGSKNAFECCNREESI
                     DNFGPYVAYAMWPNEADQELEVYLFEDSYYPIRLFYNNRDYHSKFMVGFYPPNTEEIT
                     YDFDGYLYMLDDTGNECKDSIRYKTVCDDDVVDDTTFSTQYSTIMEPGGGTEVITIYY
                     IRMKCEEEDCIGQWDPINNICYTPEDCANDGGYWNGDMCDQSCKMEGGIVNPDTGDCD
                     KSCIESGGFLDENGNCDTTCRDDGGMLVEGQCDYQCKEAGGILVGDHCDTTCVDSGGK
                     LNEDGTCDHSCRDQGGQLDESGECDTSCKDSGGMLIEGECDTSCKDEGGQLDENNECD
                     THCKDQGGIIDENGNCDTSCKDSGGKLDENGACDTSCRDDGGIIDENGNCNTTCRDDG
                     GIIVGDHCDTSCRDAGGILIEDHCDTTCRDSGGKLNEDGTCDHSCRDQGGQLDENGKC
                     DYSCKNGGGKLDEDGNCDMSCKENGGKLDENGDCDLSCKEDGGKLDEDGNCDYSCKEE
                     GGIIDESGNCNTTCKDSGGQIIDGECNYGCKEVGGVVIDGECDTSCVDSGGILDGDGN
                     CDRSCIESGGVLEDGACNTTCRDSGGKLNVDGTCDTSCRDDGGMLVGDECDYQCKEAG
                     GILVGDHCDTTCVDSGGKLNEDGTCDHSCRDQGGQLDESGECDTSCKDSGGMLIEGEC
                     DTSCKDEGGQLDENNECDTHCKDQGGIIDENGNCDTSCKDSGGKLDENGACDTSCRDD
                     GGIIDENGNCNTTCRDDGGIIVGDHCDTSCRDAGGILIEDHCDTTCRDSGGKLNEDGT
                     CDHSCRDQGGQLDENGDCDTSCIDAGGVLENGECVFPPTSSSTSETSSTTDQSSSQSD
                     DSSVESSSTPMDSSTIESSSSEIITSESESESVPIASSSSEVMTSESESESIPILTSS
                     SQIPIASSSSEEVTSESESETVPILTSSSKIISSESGSQSVPISSSSSEIVTSQSESN
                     IPSPNPEPRTTTITTIITEDGQIITITTTVTGFVPEPTGESEGNGESDDENPENRIEN
                     NSDENEFVDPEFADDIPDDPAGPEDNGGNDPVNPEQDNNNGPANPGQDSTNGSGNSDQ
                     IDNNPPTPEENAGDGNSNGNDPADPSRRTSILGDERTRASPGGTSQPTGANGNVNGNS
                     PGANVNGGGTGNSNNNNNNNNNNGNAPNGGDGSNGDANQGPSRRTSLLGDERTRAGQA
                     APTGGSSPNNGVAGDTSNNGGAIVSQQVDDGGAGSPRRTSILGDVRSRTTLNGEVLNF
                     EGSGVRRAVAGNLALPLMMVGLVFNL"
     gene            <145388..>146833
                     /locus_tag="CAGL0A01408g"
                     /db_xref="GeneID:2886469"
     mRNA            <145388..>146833
                     /locus_tag="CAGL0A01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444828.1"
                     /db_xref="GeneID:2886469"
     CDS             145388..146833
                     /locus_tag="CAGL0A01408g"
                     /inference="similar to AA sequence:UniProtKB:P40356"
                     /note="similar to uniprot|P40356 Saccharomyces cerevisiae
                     YGL025c PGD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444828.1"
                     /db_xref="GeneID:2886469"
                     /db_xref="GOA:Q6FXZ4"
                     /db_xref="InterPro:IPR020998"
                     /translation="MATKQEEQANLSDVLTPSMSLTELEMKFADETDGKAKDVVQARI
                     KKAEDGILPLRLQFNDFTQIMSSLDEERYANVSKQEKFQMIRSKVLGLTERLQELSND
                     FEELQPLFATVGEYSKTYKNKNFQVLENLASYNHRGKAGASISNSTPTPAAATPTTAP
                     TPGAGTKKAAKTAPTPTATATIGTPSNNAPTPATTATTPGTQAKKPRKPRQTKKQQQA
                     AAAAAAVAQAQAQAQAQAQNQNQNNMQNKNISNPGMNSNMGTPVMGNPNMKQMQSPIP
                     ANAMNNMNVPHNGAMRPSVPNGNMGNPSMGNLNMNAPNMGNPNMNNPNMNNPNAMMSP
                     MAGQGQLNQMFPMQNHNQNGQFMGQQSPGPNIGQMQFPPNNGNMNGMPGTSDMNLGMN
                     PSMNMNMGMNLNQITPANILSMNTKGKDDQMQNIGMDQNQNQNQSQNQSQNQNQSMNM
                     NMNNDSNNPKSAYDLVDFNSLDLSSLNMDFL"
     gene            <147313..>149436
                     /locus_tag="CAGL0A01430g"
                     /db_xref="GeneID:2886466"
     mRNA            <147313..>149436
                     /locus_tag="CAGL0A01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444829.1"
                     /db_xref="GeneID:2886466"
     CDS             147313..149436
                     /locus_tag="CAGL0A01430g"
                     /note="highly similar to uniprot|P00931 Saccharomyces
                     cerevisiae YGL026c TRP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444829.1"
                     /db_xref="GeneID:2886466"
                     /db_xref="GOA:Q6FXZ3"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018204"
                     /db_xref="InterPro:IPR023026"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ3"
                     /translation="MSHQLKQTFANAKNEGRNALVTFMTAGYPRVAETIPIMKGFQEG
                     GVDVIELGMPFSDPIADGPTIQVANTKALENGVTLVQTLDLLKKARDEGVTVPVILMG
                     YYNPILNYGEEKFIQDAADAGANGFIIVDLPPEEAIKVRNMMKKHGLSLVPLVAPSTT
                     DSRLELLAKIADSFVYVVSRMGTTGVQSSVASDLDTLVSRVRKYTKETPIAVGFGVST
                     REHFESVGSLSDGVVIGSKIVTLCGEAPEGKCGEVAKKYVEEILNGKKHKILSGEEYQ
                     LMKTATNELESDSDHHEFEEDHKHPIRFGDFGGQYVPEALHTCLKELEEGFEDAIADP
                     TFWEEFKSLYSYIGRPSSLHKAERLTEHCGGAQIWLKREDLNHTGSHKINNALAQVLI
                     ARRLGKTEIIAETGAGQHGVATATACAKFGLKCTVFMGAEDVRRQALNVFRMRILGAK
                     VVSVTNGTKTLRDATSEAFRFWVTNLKSTHYVVGSAIGPHPYPTLVRTFQSVIGNETK
                     EQFAALNNGKLPDVVVACVGGGSNSTGMFSPFEHDTSVKLLGVEAGGDGIDTDYHSAT
                     LTAGRPGVFHGVKTYVLQDQDGQVHDTHSVSAGLDYPGVGPELAFWKATGRAEFIAAT
                     DAQALEGFKLISQLEGIIPALESSHAVYGACERAKTMKPDEHLIINISGRGDKDVQSV
                     AEVLPKLGPQIGWDLRFEEDPSVGN"
     gene            <149750..>152194
                     /locus_tag="CAGL0A01452g"
                     /db_xref="GeneID:2886374"
     mRNA            <149750..>152194
                     /locus_tag="CAGL0A01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444830.1"
                     /db_xref="GeneID:2886374"
     CDS             149750..152194
                     /locus_tag="CAGL0A01452g"
                     /inference="similar to AA sequence:UniProtKB:P53008"
                     /note="similar to uniprot|P53008 Saccharomyces cerevisiae
                     YGL027c CWH41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444830.1"
                     /db_xref="GeneID:2886374"
                     /db_xref="GOA:Q6FXZ2"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ2"
                     /translation="MLRTLILSTILELICFVQSQNFETYQDYRKHNNDSLLWGAYRPH
                     TYFSVKPRYVDKSPFILGLMWMDSYSNNGIEGLRHFVEPHEQGLEHYGWQTYDPRIGG
                     VETIVDKKNNLNLTVSLAKSKDGANWVTRVSGKAMDPKRKSTGSIFLYLNQQTTKDDQ
                     KSMLHLTPNELKGKMTFKGVSSELGKYNVDVIDKKGKYYRSRGKDKPYSKLVDASQTR
                     HVSFRVPEDNYWKAHDLVKTLISESLTDLLHNYDVAKVTKNEFPDFYSIRDMFNFNEG
                     NFHIIQKTFDTSGSDGEFEIEIIYNSIESKQKIKPAETNALITQSLLEIDRKFNKHFQ
                     LSESQKDKTEFVKSTLANLLGGIGYFYGNQRVDRITTVDEKHFDEIKLSHGDEDGPYS
                     LFTSVPSRSQFPRGFYWDEGFHLLQIMEYDYDLAFEIISSWFNMIDEKGWVAREVILG
                     EEARTRVPDEFITQNPNIANPPTILLAFSEMLQRASNSYKLVGELGDSGADKDSDTLE
                     YNHKFLIEYSREIYPKLVKHFDWFVNSQRGFTEEYEGLIEENAISDKVHLNEIFAWVG
                     RTNSHCLPSGLDDYPRSKPCDVTELHVDALSWVGVMARSLKQIATILDEDADILKYEE
                     VENNVIENLELLHWSEKDQCFCDVVVDEYGEGISYDCHEGYVSLLPFALKLVPKESKA
                     IASVLKLISDKSKLFSPYGLLSLSKQDKYFGQDENYWRGPIWLNINYLCLDALRYYFP
                     EIHGTSNNNKASVLSKTAKTTYTQLSQNLIKNVYDNWKATGYCYENYSPVDGRGTGAK
                     QFTGWTSLIVNIINWN"
     gene            <153155..>154933
                     /locus_tag="CAGL0A01474g"
                     /db_xref="GeneID:2886376"
     mRNA            <153155..>154933
                     /locus_tag="CAGL0A01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444831.1"
                     /db_xref="GeneID:2886376"
     CDS             153155..154933
                     /locus_tag="CAGL0A01474g"
                     /inference="similar to AA sequence:UniProtKB:P53189"
                     /note="similar to uniprot|P53189 Saccharomyces cerevisiae
                     YGL028c SCW11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444831.1"
                     /db_xref="GeneID:2886376"
                     /db_xref="GOA:Q6FXZ1"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FXZ1"
                     /translation="MTLSFSIFLLLLATIQAFPVYRKREIVTRMHTASTTNTVTDFYS
                     TTTEVIIAPTVEFIVSGSVTFTTTLYPEGVNPTAVASTITTIQKNVAPTPQPDNSGDN
                     NSKNNSNNSDGNSASQNNSENSSNSNNNSDNNNSDNNNSDNNNSDNNNSDNSNGNNSN
                     NSNNSNNSNNSNNSNNSNNSNNSNNSNNSNNSNNNNNDNSNNNNNNNNNNNNSGSQSS
                     KMSSSTSSSSSKTITLSPTASSLKSSSSSTTTSSVSSVSNTVTFSKSSSAESTSTTTI
                     TTTEWDTSYTTTFTTISGSSGINSATKTVSSSSKVSNSDSPTSSTSPSGLLKGVPHSL
                     TYSPYNNDGSCKSADQVFSDLSQIKAKGVSNVRIYGTDCNSLGTVQPAAAKLGIKINQ
                     GLWITAAGVDSLDAGLQLLINYGKTNGWDIFNYITIGNEAIHSDYCSVEQLIAKIKSV
                     KQALKDAGYSGQVTTSEPPVVFENSPDLCTQSGIDFVGINAHAYFDQYASAQTAGSFV
                     KGQVQLIQNVCGTNNVVVTETGYPSAGKQNGNNIPSPENQRIAIQQILDEMNGQVTVL
                     SSFDDMWKNPGPYGIEQSFGIIDILA"
     gene            155457..155554
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0A01496r"
                     /db_xref="GeneID:2886316"
     tRNA            join(155457..155494,155518..155554)
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0A01496r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:2886316"
     gene            complement(<155862..>156342)
                     /locus_tag="CAGL0A01540g"
                     /db_xref="GeneID:2886362"
     mRNA            complement(join(<155862..156176,156340..>156342))
                     /locus_tag="CAGL0A01540g"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_444832.1"
                     /db_xref="GeneID:2886362"
     CDS             complement(join(155862..156176,156340..156342))
                     /locus_tag="CAGL0A01540g"
                     /note="highly similar to uniprot|P14120 Saccharomyces
                     cerevisiae YGL030w RPL32"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_444832.1"
                     /db_xref="GeneID:2886362"
                     /db_xref="GOA:Q6FXZ0"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /translation="MAPIKTQESINQKLALVVKSGKFTLGYKSTIKSLRQGKSKLIII
                     AANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVSVLDAGDSDILT
                     ALA"
     gene            <157645..>158112
                     /locus_tag="CAGL0A01562g"
                     /db_xref="GeneID:2886312"
     mRNA            <157645..>158112
                     /locus_tag="CAGL0A01562g"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_444833.1"
                     /db_xref="GeneID:2886312"
     CDS             157645..158112
                     /locus_tag="CAGL0A01562g"
                     /note="highly similar to uniprot|P24000 Saccharomyces
                     cerevisiae YGR148c RPL30B or uniprot|P04449 Saccharomyces
                     cerevisiae YGL031c RPL30A"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_444833.1"
                     /db_xref="GeneID:2886312"
                     /db_xref="GOA:Q6FXY9"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /translation="MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRK
                     NPRRVAWTVLYRRHHKKGITEEVAKKRSRKTVKAQRAIVGASLELIKERRSLKPEVRK
                     AKRDDKAKADKEKKKADKAARKAEKAKLAAAQGSKVSKQQAKGAFQKVAATSR"
     gene            <158780..>159037
                     /locus_tag="CAGL0A01584g"
                     /db_xref="GeneID:2886371"
     mRNA            <158780..>159037
                     /locus_tag="CAGL0A01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444834.1"
                     /db_xref="GeneID:2886371"
     CDS             158780..159037
                     /locus_tag="CAGL0A01584g"
                     /inference="similar to AA sequence:UniProtKB:P32781"
                     /note="similar to uniprot|P32781 Saccharomyces cerevisiae
                     YGL032c AGA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444834.1"
                     /db_xref="GeneID:2886371"
                     /db_xref="InterPro:IPR014404"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY8"
                     /translation="MKLSIVCLLFAMIIDYVSSDIVTTICDKTIPPNTLETTPYSSST
                     TNIVANGKKMIGVFQYYRSIKYISDCEEKEDVVDTKIIHGF"
     gene            complement(<159192..>159914)
                     /locus_tag="CAGL0A01606g"
                     /db_xref="GeneID:2886352"
     mRNA            complement(<159192..>159914)
                     /locus_tag="CAGL0A01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444835.1"
                     /db_xref="GeneID:2886352"
     CDS             complement(159192..159914)
                     /locus_tag="CAGL0A01606g"
                     /inference="similar to AA sequence:UniProtKB:P53187"
                     /note="similar to uniprot|P53187 Saccharomyces cerevisiae
                     YGL033w HOP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444835.1"
                     /db_xref="GeneID:2886352"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY7"
                     /translation="MPPKKKACLKQDGDVCGVIQAYLEKQYKPFAINDIVSNLQKDYK
                     FSKPVVLKALDTLVDEGRIVSKPFGKVTIYCCKEQDLELPKGVDVNKVTYDLISELRE
                     ELRLLEKEKSTLLEKKNALFSEPENDKLLDVLATLRESERDIDAKLDDLERNWDPTNQ
                     KEINELKNLEKNLKKDLASRKKLINDLLAIIKESGLLKKGETMAELLVCVMEIKSIFY
                     LSLFILISLFFIDRILTKQNFI"
     gene            <161327..>162601
                     /locus_tag="CAGL0A01628g"
                     /db_xref="GeneID:2886361"
     mRNA            <161327..>162601
                     /locus_tag="CAGL0A01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444836.1"
                     /db_xref="GeneID:2886361"
     CDS             161327..162601
                     /locus_tag="CAGL0A01628g"
                     /inference="similar to AA sequence:UniProtKB:P27705"
                     /note="similar to uniprot|P27705 Saccharomyces cerevisiae
                     YGL035c MIG1 transcriptional repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444836.1"
                     /db_xref="GeneID:2886361"
                     /db_xref="GOA:Q6FXY6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY6"
                     /translation="MSASASPEPHTPENNPSSVTNGSSTPNSGKSKAGKGDDAPRPHV
                     CPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNPLPKG
                     KRGRKKKPETILAEQRAREEAERNKNNPNYKPPSKSSLRRKTKRNTTFELGESTPSSS
                     LTPPQQPNPQVQLPSSPMVGDETTNAPHSDGMTPIEPQRFLSSPPNHVRPVFGSANNS
                     NSSSRIRLNALSSLQMMTPLSGRNSSSTMNLSQQASTTFLDNPDGSKNQNIILPRPKS
                     LTDFASMHANGSSTNLTTLMQQPNMGNLMKRPNSVLSLNELVTQSGAGTHGYDTGNNS
                     SLEEDDLKDPELENDQLRKKSKTATPTTGLSRSASGLNLSLKTKSLTNMQDMNKVNEK
                     LLQYQKNVVSPQIAPQDGLPPLRSLHLQFPTG"
     gene            <163770..>164126
                     /locus_tag="CAGL0A01650g"
                     /db_xref="GeneID:2886480"
     mRNA            <163770..>164126
                     /locus_tag="CAGL0A01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444837.1"
                     /db_xref="GeneID:2886480"
     CDS             163770..164126
                     /locus_tag="CAGL0A01650g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444837.1"
                     /db_xref="GeneID:2886480"
                     /db_xref="GOA:Q6FXY5"
                     /db_xref="UniProtKB/TrEMBL:Q6FXY5"
                     /translation="MSSLDEQELIFEDDIAQEVEFDMTEIEVNRLIRSPLLMPQDRDH
                     MTPQSDAAYYGTSIANELMNTEGEWPSYDDYNRQERSQQSYDIPRGFSGCMQPLSSIV
                     EHMAETNYKLWLHSKN"
     gene            complement(<164836..>166920)
                     /locus_tag="CAGL0A01672g"
                     /db_xref="GeneID:2886467"
     mRNA            complement(<164836..>166920)
                     /locus_tag="CAGL0A01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444838.1"
                     /db_xref="GeneID:2886467"
     CDS             complement(164836..166920)
                     /locus_tag="CAGL0A01672g"
                     /inference="similar to AA sequence:UniProtKB:P40357"
                     /note="similar to uniprot|P40357 Saccharomyces cerevisiae
                     YGR009c SEC9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444838.1"
                     /db_xref="GeneID:2886467"
                     /db_xref="GOA:Q6FY22"
                     /db_xref="InterPro:IPR000727"
                     /translation="MGIKKFFKIKPPKEDTVEQNRENLMDIGIATKSTTKKPQSKFAA
                     YGQFAKDRATSKIYAPPGYEDFARPPEELEKKEGEEDDLNKSELDEKETKKDKKKKKK
                     KHQQEDEPAAVQDPYARTEKSYRYNPDPYGAGAAGEKAFSSSGVYNEFNNYENGPSYG
                     NEYGRRDRSEDLNAYNGTPGQPMKPVNRATPVLDRRDSAREDPAYGYNNQNRSNPYAG
                     AGVGALAGGAAGGAVGAMGSVVSGSNPYGGASYGSGYGSSATTSAPVSKPISRTNTSA
                     SNPYGNASYGSTPGVNDRPAGSNPYAAISGDSYLNGTRSGNISRSGTNPYLRRNASNS
                     VPPQAGYITPDSNNVALAEEENQQNQDELDLNDAPEDANEFVFEDKYMGRESKYAENS
                     AALDELDLNATINDRGEDLNATGYGNMYEQQQQPQWQREEEEYGYGTQDDMNRGYKTF
                     DEIQREEEERQKEEEDQAVDEIKEQIRFTKQSSVASTRNTLKMAQEAEMAGMNTLGML
                     GHQSEKLNNVERNLDLIKIQNTAADEKVAELKKLNRNILAVHVSNPFNSKRRRRERED
                     MIKGRKMEDKMRAEHMSQELHQSTQRIEGALGGGNETSAVREKYQREKVLAAAKKYQF
                     ENDEEDDEMEVEIDRNLDKIQQISGRLKKLALATGEELDSQQRRIRDIEENTDEMDIK
                     IHMNTTRLADIR"
     gene            complement(<167242..>169167)
                     /locus_tag="CAGL0A01694g"
                     /db_xref="GeneID:2886453"
     mRNA            complement(<167242..>169167)
                     /locus_tag="CAGL0A01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444839.1"
                     /db_xref="GeneID:2886453"
     CDS             complement(167242..169167)
                     /locus_tag="CAGL0A01694g"
                     /note="some similarities with uniprot|P53185 Saccharomyces
                     cerevisiae YGL036w MTC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444839.1"
                     /db_xref="GeneID:2886453"
                     /db_xref="GOA:Q6FY21"
                     /db_xref="UniProtKB/TrEMBL:Q6FY21"
                     /translation="MEGIENGIRKLSESWDVNLATTVLEALRSIDLDVLRHSGLKDVT
                     VRSESSLQYILLCYVLLVVSPDDIAIETSETLEASCRDANDSPETRIDNDVGIFEVLL
                     IHRSSKTTNFQDFHYPIRELLSLISSKDYNCNTGNLATDLLICRSMHNGDTNDLLDSI
                     DKYQQYSVMSRVLQFPKIISDAVYQRCYKELIVKNSVCEMTQPLPNVRLSLMTLMEII
                     DQPDINLLQFPRLVTLLGSSFVFLSESHTDISELHYELDELGTTQTLLALLSYVQYCL
                     SKFLLGFINGCKVLQKTSESYDISTGAAVKEAFKNITSFEFQLPPWFDKTMIFPLPPI
                     FKSLFIYGKDDSLIKASYSDMIVTILDSLMLCIEISSKILNQYRSASINPFEIEGKEE
                     INLKHSKFQLIKNVHLLTFIPIFSSLLLAEQMQSLSEAMVISNETWNMYAEILTNNIK
                     EQVTNILLVNESVALYHLLKIVSRVSIDDTGFQRISIKLLNYLFFQSKHTKFKIWCKQ
                     NELCRSTIKTYVHLWNDGSSDYSLIYTKIINTKQPDVDHKKTILAEYLDLLPEDMKFG
                     FSREEENKTIMPAKFNAYAAPTFMPAESAVKANSQVNPFLPIDQNKVQESVQMNKLTP
                     IMESSVKWTNAPTTGQK"
     gene            <169567..>170202
                     /locus_tag="CAGL0A01716g"
                     /db_xref="GeneID:2886357"
     mRNA            <169567..>170202
                     /locus_tag="CAGL0A01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444840.1"
                     /db_xref="GeneID:2886357"
     CDS             169567..170202
                     /locus_tag="CAGL0A01716g"
                     /note="highly similar to uniprot|P53184 Saccharomyces
                     cerevisiae YGL037c PNC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444840.1"
                     /db_xref="GeneID:2886357"
                     /db_xref="GOA:Q6FY20"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:Q6FY20"
                     /translation="MKTLLVIDVQNDFITPDHSMYVPQGEEVVSPIVELMKDPQWHRV
                     VVSRDWHPQNHISFAKNHGVEDYTETTYKSPRPGDDSTQPATLWPVHCVQNTRGAQLA
                     PDILELVNSKHIKIVDKGYLSNCEYYSAFNDTWEWHKTELDEYLKKHHTTEVYVVGLA
                     LDFCVKNTAISAAKLGYDTTILKDYTKPIYTDEDHQQQLEKDLKEHNVKVK"
     gene            <170940..>172349
                     /locus_tag="CAGL0A01738g"
                     /db_xref="GeneID:2886464"
     mRNA            <170940..>172349
                     /locus_tag="CAGL0A01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444841.1"
                     /db_xref="GeneID:2886464"
     CDS             170940..172349
                     /locus_tag="CAGL0A01738g"
                     /inference="similar to AA sequence:UniProtKB:P31755"
                     /note="similar to uniprot|P31755 Saccharomyces cerevisiae
                     YGL038c OCH1 alpha-1 6-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444841.1"
                     /db_xref="GeneID:2886464"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FY19"
                     /translation="MSKWQKRHIVLAVLVLVVFLRVHGNLRGLSGQFRAKYPKNYLVS
                     NGDTSGLNLKQLKFNSNDLRSDLSKAFPYDPSKPIPRRVWQTWKVPIDSPEFPGDLKP
                     YVSRWESNSYEVDEDEIYSQENEQNYYLLPDDQIESILESFYGEVPIIVQAYKLMPSN
                     ILKADFLRYLLLYARGGIYSDIDTFPLKDFRDWPSMNQEDMKKLKKAKIIPYKNFDKT
                     MINGMNFIDPGLVVGIEADPDRPDWADWYSRRVQFCQWTIQSKPGHPVLRELILNITA
                     TTIYSSAKTPAHLKSLIDNSADEKDFNINYRHRRRFDKEYDHSQKKQRKNVDGTDIMN
                     WTGPGIFSDSILNYLTNIIRKNRNILLLNSNLDSKQKEIPSSAAGSQEEEEEEDLTYS
                     TKKFYNEISTSLLSSAKMPWEFFSLITEPLLVDDIMVLPITSFSPDVMQMQAESSQHE
                     LALVKHMFHGSWKEEADGH"
     gene            complement(<172608..>174425)
                     /locus_tag="CAGL0A01760g"
                     /db_xref="GeneID:2886306"
     mRNA            complement(<172608..>174425)
                     /locus_tag="CAGL0A01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444842.1"
                     /db_xref="GeneID:2886306"
     CDS             complement(172608..174425)
                     /locus_tag="CAGL0A01760g"
                     /inference="similar to AA sequence:UniProtKB:Q05506"
                     /note="similar to uniprot|Q05506 Saccharomyces cerevisiae
                     YDR341c arginyl-tRNA synthetase or uniprot|P38714
                     Saccharomyces cerevisiae YHR091c MSR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444842.1"
                     /db_xref="GeneID:2886306"
                     /db_xref="GOA:Q6FY18"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FY18"
                     /translation="MLPSRCLSSTRILVFSRSYSVAKVSFPEHNVLDIIKENLSNKLS
                     SLSGVDNNKVFNSIDVTSGLEKGDLIIPLPKIVAHKEDLVSLARTWGEKLSDQPYMAK
                     VVANGPFLQFFIEPHYLTGKLLPKILEERERYGQIPLVKDKKVLIEFSSPNIAKPFHA
                     GHLRSTIIGGFLSNLFQNFGWNVTKMNYLGDWGKQFGVLAVGFERYGDEKMLETDAIN
                     HLFEVYVKINKDIENEKSSNGKSLIDEQAKEYFCKLENNDTDAIKLWKKFRNLSIRKY
                     KETYSKLNIDYDVYSGESQVSKETILLVNNMLQASGLLKESNGAKVVDLSKAQKSLGA
                     VVVQKSDGASLYITRDIAAAIERKREYNFDKMIYVVASQQDLHMKQLYQILKELKFEW
                     ATSLEHINFGMVQGMSTRKGTVIFLDNILEEAQQQMLSVMSKNDVKFTQVKNPSEIAY
                     LIGTSAVMIQDMQSKRKNNYKFKWERMLTFEGDTGPYLEYAHSRLKSIELKNKHLHES
                     LTPVNYELIGEQDALDLVRVMSRYHEVLKKALETREPSTLVTYLFKIAHQVSKCYRTV
                     WVSGQPDDVAKARLHLFMASRQILYNGLKLLGVTPVDRM"
     gene            complement(<175018..>176724)
                     /locus_tag="CAGL0A01782g"
                     /db_xref="GeneID:2886478"
     mRNA            complement(<175018..>176724)
                     /locus_tag="CAGL0A01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444843.1"
                     /db_xref="GeneID:2886478"
     CDS             complement(175018..176724)
                     /locus_tag="CAGL0A01782g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
                     cerevisiae YDR342c HXT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444843.1"
                     /db_xref="GeneID:2886478"
                     /db_xref="GOA:Q6FY17"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY17"
                     /translation="MLFSKKKEDPQAVPEASPENDFSPSLSQQDSSASPYENDVKKLE
                     EEAEQTPIVDIPKKPASAYVTVSIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQ
                     KRANGTHYLSKVRTGLVVSIFNIGCAIGGVILSKLGDVYGRKPGLIIVVVIYVVGIII
                     QIATIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKHLRATLVACYQLMITLGIF
                     LGYCTNFGTKNYSNSVQWRVPLGLCFAWAIFMISGMTFVPESPRFLVEKGRIEDAKRS
                     IASSNKVSVDDPAVVAEVDSVQAAVEAERLAGSASWGELFSTKTKIFQRLVMGIMIQS
                     LQQLTGDNYFFYYGTIVFKAVGLEDSFETSIVIGVVNFFSTFVGIFLVGRFGRRTCLL
                     WGAATMTACMVVFASVGVTRLWPHGKGNGSSKGAGNCMIVFTCFYIFCFATTWAPLAF
                     VICSETFPLRVKAKCMALAQASNWIWGFLISFFTPFITDAINFNYGYVFMGCLCFSYF
                     YVFFFVPETKGLTLEEVNTMWEEGVLPWKASQWVPPSRRGADYDADALMHDDTPWYKR
                     FL"
     gene            complement(<180180..>181871)
                     /locus_tag="CAGL0A01804g"
                     /db_xref="GeneID:2886473"
     mRNA            complement(<180180..>181871)
                     /locus_tag="CAGL0A01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444844.1"
                     /db_xref="GeneID:2886473"
     CDS             complement(180180..181871)
                     /locus_tag="CAGL0A01804g"
                     /note="highly similar to uniprot|P32466 Saccharomyces
                     cerevisiae YDR345c HXT3 or uniprot|P32465 Saccharomyces
                     cerevisiae YHR094c HXT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444844.1"
                     /db_xref="GeneID:2886473"
                     /db_xref="GOA:Q6FY16"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY16"
                     /translation="MNSQPDLISPQKSSSSNEVDSHESKYLNQVGKNDMADEFVQNEM
                     IANPNTGKGAFVGVIISCFMVAFGGFVFGWDTGTISGFVAQKDFIHRFGMKHPDGTEY
                     LSKVRTGLIVSIFNIGCAIGGIILSKLGDTKGRKMGLVVVVVIYIVGIIIQIASINKW
                     YQYFIGRIISGLGVGGISVLSPMLISEVAPSDLRGSLVSCYQLMITLGIFLGYCTNFG
                     TKNYTNSVQWRVPLGLCFAWALFMIGGMTFVPESPRYLVEAGQIEEARSSLARINKCS
                     PDHPYIQQELDLIQASVDEARSAGSASWGELFTGKPAMFRRTLMGIMIQSLQQLTGDN
                     YFFYYGTIVFKAVGLEDSFETSIVFGVVNFFSTCCSLLTVDRFGRRNCLLYGAIGMVC
                     CYVVYASVGVTRLWPHGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIISETFP
                     LRIKAKAMSIATAANWMWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFVSE
                     TKGLTLEEVNEMYAEGVLPWKSSKWVPASRRGADYDADALMHDDTPWYKRVVGRG"
     gene            complement(<184013..>185779)
                     /locus_tag="CAGL0A01826g"
                     /db_xref="GeneID:2886476"
     mRNA            complement(<184013..>185779)
                     /locus_tag="CAGL0A01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444845.2"
                     /db_xref="GeneID:2886476"
     CDS             complement(184013..185779)
                     /locus_tag="CAGL0A01826g"
                     /note="highly similar to uniprot|P38695 Saccharomyces
                     cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
                     cerevisiae YDR345c HXT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444845.2"
                     /db_xref="GeneID:2886476"
                     /db_xref="GOA:Q6FY15"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY15"
                     /translation="MSNVDPTNPAYIPPTQTTNAGYIPPTQATISDEGSKSGSDYIYD
                     ANGVKQTRTDSMISGPKEELQKEVEEELHHKKKSDLIFVSLCCIMVAFGGFVFGWDTG
                     TISGFVNQTDFLRRFGQQRSDGTYYLSNVRTGLIVAIFNIGCAIGGITLSKLGDIWGR
                     RLGLVTVVVVYTIGIVIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQL
                     RGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIFGVMCVPE
                     SPRYLVEVGKLEEAKRSLARANKTTVDSPIVLLELDKYQASVEAERLAGSASWGELVT
                     GKPQMLRRTIMGMMIQSLQQLTGANYFFYYGTTIFRAVGLDDSFQTAIVLGVVNFVST
                     FYALYTVDHYGRRNCLMWGCVGMVCCYVVYASVGVTRLWPNGEGNGSSKGAGNCMIVF
                     ACFFIFCFATTWAPIAYVIVSESYPLRIRGKAMSIAIAANWIWGFLIAFFTPFITSAI
                     NFYYGYVFMGCMVFAYFYVFFFVPETKGLTLEEVNQMYEEGVLPWKSSSWVPPDRRTA
                     EYNLDDYSHDDKPWYKRVFSRN"
     gene            complement(<187900..>190704)
                     /locus_tag="CAGL0A01848g"
                     /db_xref="GeneID:2886459"
     mRNA            complement(<187900..>190704)
                     /locus_tag="CAGL0A01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444846.1"
                     /db_xref="GeneID:2886459"
     CDS             complement(187900..190704)
                     /locus_tag="CAGL0A01848g"
                     /inference="similar to AA sequence:UniProtKB:P38810"
                     /note="similar to uniprot|P38810 Saccharomyces cerevisiae
                     YHR098c SFB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444846.1"
                     /db_xref="GeneID:2886459"
                     /db_xref="GOA:Q6FY14"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6FY14"
                     /translation="MSFELAGSMSDLSLEQSQSNELKKGKSKRPTRAFHTFSGNPVQS
                     SPTTNMYAFQSNYQTPKVADNNGVFTPKRVESQTVNSPVLQYGNPPRTPVMGGNASPR
                     AHSPGYFFPNGNNENVFSHIVPTQRWEEQLRYLTKAFDTTRDSVPPSSTTEFYSSDSG
                     SCDPRLMQLSMYNIPEDQHLRAATKLPLGVTIQPFADITPGSVPVSGDGIAADTMKNL
                     EGPMRCKRCRCYINPKFQFNYDSKAICNICQIKQPAPYDYSSAVGPNGQRTDAEIRPE
                     LSKGAVDFIVPPIYNAHPDKPSVPLHYVFLIDVTSLANENGSSLAVIEGIRSSVDYII
                     ENQPNCKLAIIAYDNKLKFFNLKPELETAQEYVISELDDVFLPFYNGLFADPAESKHV
                     IDQTLSRLAAFITNDKYYHVPQACFGSAIQAAKLALKTFTGDEGGKVVCSLNSLPTIG
                     NGNLYLKKDNAHVHHMRCDNDFYKKLAHDLLASYVSIDLIVTSGGFVDLTNVGHPTLV
                     THGSLKYYPHFIQQNDEARLVQDMVSNIANTVGYQAVLKLRCSTGVGVDMYYTDASGY
                     TDKDVILPVLTKDTTIDVLLKYQEKLKAGTDIHFQCALLYTDVHGIRKVRSLNTNGAV
                     SNNVREVFKFVNQNSVLRIIVKDVIRTLGDCDFAAIRKSLDTKLVDILTQYRGLVSGN
                     SSSQLVLPDSLKTLPSYILSFQKQDLMKPNQQSTRGNERVYDLIRYETINPAELLYKL
                     YPQIIPMHVLLEENDFSFYDANDKLLQIQEDSLDEVSVRNMHSNLTDGGCYLIFNGDS
                     VYLWFNVHTNRLLLQDLLGIDPDFPINQITLYGGMLPETGTEINNKAFNLIRYWGQMV
                     NKKSLPIIPLRPNIDQYYSSIISQVLCEDKSINMIESGDNYFVALHRQIQEKLKKEDY
                     IKISTKSRGGDDIHQKFVQF"
     gene            complement(<191335..>193719)
                     /locus_tag="CAGL0A01870g"
                     /db_xref="GeneID:2886284"
     mRNA            complement(<191335..>193719)
                     /locus_tag="CAGL0A01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444847.1"
                     /db_xref="GeneID:2886284"
     CDS             complement(191335..193719)
                     /locus_tag="CAGL0A01870g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444847.1"
                     /db_xref="GeneID:2886284"
                     /db_xref="GOA:Q6FY13"
                     /db_xref="InterPro:IPR008160"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:Q6FY13"
                     /translation="MIYSLIFLCALASLSCAFTPNATSFNATESESVAVFSNSSSLLR
                     YNSSSVLFSNNYGKNWTVLLNNTATPQRHNGSNRTFNYFDFLNSEYFDDMESYYEPEV
                     IIDPLYSESRAFYGFKNVFYVFDAQGRNETSGPISNLTNSSMLFDVSTNVHNKSLIIS
                     NFIEVLDTKHYRGRSFISVNNGTSFREIKPSIPNLNDSVVDKFLCHFLASTPTTKFKN
                     SSDLVCFFTSTNRGFNNTVFFSGDFGVTLQAVNLSSGIYPLDVQITDSYVIMQTANTT
                     AANWLFNLGDDNGNSDDDSDDSDDLPPTPTVSDFPGISNFPGIPGISGFPSISGIPGI
                     SDIPHLSGIPGISGIPGIPGMPGIPGASGIPGTSGIPGASGVPGVDGVDGVPGVDGVD
                     GIPGVDGIPGIDGISGIDGIDGAIGDLFSQISELFRTVDLYVSKDGKDFNRANIPAIT
                     YNVFSVSEIMGGKLIFSNGFSPFTLGFTEVTNSTASNSSTNVSSVFISDSTGLNFTSA
                     NISYSDSLFSQLYTFGDLNGTIIMAPLGIWNSTSKISTDNGATWNDLKVNSSSVKGNY
                     SCIAHNNCTLQLSAILGYSKTGIMVAQGNINLTPQDFNRTFNITNLDDLYDDYNLTDI
                     ETDSDDYFDNFYLLTTTFLSKDGGMTWEQILDYSKAVALGNFGNIIVAEDNGLRNTTG
                     FVYSLNMGATWDRLPTSVPLFSNDVISTTPDSSGLQFILTGESRRGFRNVAEVVDFSS
                     LFNGKLCSSSSDLEQFKLNNGTCLNGSRYEINRRAPSAQCLLNINNTRWDISSC"
     gene            <194560..>194826
                     /locus_tag="CAGL0A01892g"
                     /db_xref="GeneID:2886419"
     mRNA            <194560..>194826
                     /locus_tag="CAGL0A01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444848.1"
                     /db_xref="GeneID:2886419"
     CDS             194560..194826
                     /locus_tag="CAGL0A01892g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444848.1"
                     /db_xref="GeneID:2886419"
                     /db_xref="GOA:Q6FY12"
                     /db_xref="UniProtKB/TrEMBL:Q6FY12"
                     /translation="MGHSPQTHHRHNKGKQSPPESALQKPALSTTYLTLSGKGPGVLY
                     TANVERPQVFTHLSHYLGIVLLSKVAFLKVFPNRVIDHVITMLS"
     gene            <195146..>206377
                     /locus_tag="CAGL0A01914g"
                     /db_xref="GeneID:2886440"
     mRNA            <195146..>206377
                     /locus_tag="CAGL0A01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444849.1"
                     /db_xref="GeneID:2886440"
     CDS             195146..206377
                     /locus_tag="CAGL0A01914g"
                     /note="highly similar to uniprot|P38811 Saccharomyces
                     cerevisiae YHR099w TRA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444849.1"
                     /db_xref="GeneID:2886440"
                     /db_xref="GOA:Q6FY11"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FY11"
                     /translation="MASADQISEYAEKLKDDQQSLASRYSTVSELYDLMQLLNTPEEF
                     QMFLTSMVPIILEQLEKIDISFESNSYEQKLRFSLLEILNKCMVNQSFEPYAVRVADA
                     LLDILPKENEKNGVIITKILTILFKSFKNILGEKVNSFIDIIIQFYKNRPELVEKTFY
                     SDENGGLENSSSNDDDDTNNNSNDESTMESNNDSTNILDVKSSRGSVDDDVHENSTKG
                     QKLRPSLHSFKILSECPITMVTLYSSYKQLTTTSLPEFAPYIMTLLSIEVKQQKQARE
                     EAEKRGERFVSVSPLINDKAAYNDFILAQIKATSFLAYVFIRGYAANSLQNYIPIVPD
                     LIIRLLQDCPPELPSARKELLHATRHILSTNYKKLFLPKLDYLFDKSVLIGNGFTMYE
                     TLRPLAYSTVADFIHNIRSELKLNEIEKTIKMYTEYLMDESLALTVQIMSAKLLLNLV
                     ERILKLGKENPQEAPRAKKLLMIIVHAYVTRFKKLNRQYNTIMKQHKKIEKEKNIKQH
                     SKKNPLPEVADDTDNFIKSVLKENYLEDTTAKNKEDKSEGKVEEIEVDEPVNIELFEL
                     HDLLPIQLSPKSHNDPVKDAFYLYRTLMSFLKTVVYDLKIFNPSANEYTLAHPKLWAS
                     VSRVFSYEEVLVLRDLFHECIIGLRFFSSENPVNKDLLSKKHFDITMPSLPVSATKDG
                     RELMDYLAFTFMQVDSATFNEVVNAEMDFLYDRMLEDSALLHVAQSFLTSELTSPNFA
                     GILLRFLKRKLKTLGNTDFNTSNILIRLFKLSFMSVNLFPNINEIVLLPHLNGLILDS
                     LEYSKTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNEKIVSARLPH
                     ERELYVELCITVPVRLSVLAPYLPYLMEPLVYALQEYPDLVSQGLRTLELCIDNLTAE
                     YFDPILEPVVDQVSKALFKLLQPQPFNHTISHNVVRILGKLGGRNRQFLKTPTDLKTV
                     ESLNVDLVTEAMANGKNGSMSLSVTPGVEAAVSIIENHASDLEAKLSAYKYLKSVFLL
                     FIKSSTKFPDDYHNIIKKAIDLLQQDKLELKEDYSLECYVHRKEFYDQEALLIKIFES
                     IFLATSTPELKEDAMKLLNKLADHFSLLQVNKALQQKRFQSDTFNIDIKYSDPMFSTN
                     ILTKALMSALSSYKEDVRESSILTIKRICERSLLIFGSKLVFKYSLVPDLMKDAIHLC
                     FDEAFYNKRAGVLGIGAIIDNIEASEEYLKSLRFELIDGLLFVLKDTPEEAPVLITNE
                     AENLFNKILERTCSEISEDDLSSKGLQNTLTDIVCELSNANPVVRKACKNALELISKN
                     SNMPIVKLMDHSKHFLLSPIFAKPLRALPFTMQIGNLDAVTFCLSLPGTFLQFNEELF
                     RLLQEAIVLADAEDESLSTAQRAAEYKTSQQLTQLRVSCIKLLALALKNEDFANAQQG
                     NIRIRILAVFFKTMLKTSPVIIETTYEALKDALSENSRLPKELLQNGLKPLLMNLSDH
                     QKLTVPGLDALSKLLELLIAYFKVEIGKKLLDHLNAWCRVEVLDTLFGQDIHEQTPTK
                     IIVSIINIFHLLPPQADMFLNDLLLKVMLLERKLRLQIDSPFRVPLAKYMNRFSSSVI
                     EYFKKNMALRQLVVFMCSIIQKEEAKDLATRFENELSNFYEFYMTSIPSNQVRVVSFL
                     TNMLDIFTTVWKIRGNEWLKDQKDFVMKLKDMVALTIDTIKENKFYIDHLQLSQSIEK
                     FQFIYVNLLTHYPNEQSLFFEFIEFLNAKDICMTDCFDDFIFKNIVSLSDKDKQNSLL
                     EESIEYSLKTKSLNVSVFIYKKIVNPSLIFEVAQNQDLKCYGEAKLPAWLELIDSKIW
                     KTKNSLLLGTTANCHDKFRFELLQLTAILIKYAPKILTDVKRDIIKFTWHFIKLDDII
                     LKQSAYLTTALYIKEFDFPIKVATQVFVSLLRSSPSEGKFLVKQSLDVLAPVIDERLK
                     TTEDPDIWINWVKRVMFENTSSQNIILYQFIIDHPDLFFKSRNLFVSNIIHQMNKMSF
                     MLNSNPENHILAIDLASLILRWENRSAGQANQQLLDKDGDISMSDANDTNEIKTEHGE
                     GEVVISTIPMNLRETCIAFLIRYICASNNRASDSELGSRTLQILSEFLSEQSWENVNV
                     KLEYFEKFLLSQDMETENLLYYCINALDVLYIFFQNKTDKWIYENLANIEHLLSKCIR
                     AHHHDLQEALQKVLGLVLRAIRLQESQDSSEEEQPGKGFISSLINVIEKNLQETASVA
                     AGVTLSWTLFKTFPDSIESLLLPLMKTFSKLCKDQLSMTQPKDAVAMEEAQLTTKLLE
                     KVLFILSIRIGSLGDSRRPFLSTMALLIDHSMDQNFLRKIVSITRYWIFNNVSFPTVK
                     EKAAILTKMLAFEVRGEPTLSELFYNTVLKLFDDGQSTNPEITSRMEQPFLVGTCTSN
                     KDIRKKFMSILNSSIKDDIKERIYYIICDLNWEFIADYPWLNQALQLLYGCLDSTQSY
                     EIINSYELSTPLTLKSLLEETNSESSADETTEELTAFITTHKNDIEQICEIKKADIFD
                     PLVEIFYKDHKSIQRAWVNFFPEAYKCIPKDEKYGFIRSLIVLLSKPNPTRQNSNRLN
                     VINMWLESFGKIESFEVPPHLVKYLAISCNSWYQSINILESMQNNSQIENGKIIEAVE
                     DSLLELYINLQEEDMFYGLWRRKAKYTETNIALSYEQVGLWEKAQQLYEVAQVKARSG
                     ALPYSEPEYALWEDNWIICAEKLQHWDVLTELAKHEGFTDLLLECGWRVADWNTDREA
                     LEQSVKSVMDVPTPRRQMFKTFLALQNFADTRKGDQDVRKLCGEGIQLSLHKWVSLPE
                     RYTPAHKWLLHGFQQYIEFMEATQIYGNLHTTTVQNLDAKAQEIKRVLQAWRDRLPNI
                     WDDVNMWNDLVTWRQHAFQVINNSYLPLIPALQQANNNGNINTHAYRGYHEIAWVINR
                     FAHVARKHNMPDVCINQLARIYTLPNIEIQEAFLKLREQAKCHYQNTNELTTGLDVIS
                     NTNLVYFGTVQKAEFFTLKGMFLSKLRAYDEANQAFATAVQIDLNLAKAWAQWGFFND
                     RRLTEEPNNISFASNAISCYLQAAGLYKNSKIHELLCRILWLISMDDSSGSIANAFES
                     FRGEVPVWYWITFIPQLLTSLSHKEANMVRQILIRIAKSYPQALHFQLRTTKEDFAVI
                     QRQTMNSSAEKKDKNEQIVSNGDHRQPWEYLQELNNILKTAYPLLALSLESLVAQINE
                     RFKTSTDEDLFRLINVLLIDGTFNYNRLPFPRKNPKLPTTTENNLMKFANTLLAPYIR
                     PKFNADFIESKPDFETYIKRLRYWRKRLESKLDRAPAVENLERICPHLSNFHHQKFED
                     IEIPGQYLLNKDNNLHFVKIARFLSRVDFVYGTHFSYRRITIRGHDGSLHSFAVQYPA
                     VRHSRREERMFQLYRLFNKTLSKNVETRRRNIEFHLPIAVPLSPQVRIMNDSSSFVTM
                     QQIYDQYCEKNKIDPYMIQDFISEKLNSAYDKALPPPDSTVLKVEIFSSIQSLYVPTT
                     VMKDYFLNLFTSFEEFWLFRKQFASQYSAFVFMSFMMMINSRSPHKIHVDKNSGNVFT
                     LEMLPSRYPYERVKPLLKNQELNLPSDAPIFHNNEPVPFRMTSNIQTLIGETALEGVF
                     AVDLFTIAKALIEPENELNTLLTLFIRDEIISWYSNLHRPIIENPQLRDMVQTNVDLI
                     IRRVAQMGHVSSTPTVITQFILDCISASVNPRNLAKTDISFMPWF"
     gene            complement(206530..206600)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0A01936r"
                     /db_xref="GeneID:2886493"
     tRNA            complement(206530..206600)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0A01936r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2886493"
     gene            <206981..>208201
                     /locus_tag="CAGL0A01958g"
                     /db_xref="GeneID:2886341"
     mRNA            <206981..>208201
                     /locus_tag="CAGL0A01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444850.1"
                     /db_xref="GeneID:2886341"
     CDS             206981..208201
                     /locus_tag="CAGL0A01958g"
                     /inference="similar to AA sequence:UniProtKB:P25040"
                     /note="similar to uniprot|P25040 Saccharomyces cerevisiae
                     YOL022c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444850.1"
                     /db_xref="GeneID:2886341"
                     /db_xref="GOA:Q6FY10"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:Q6FY10"
                     /translation="MSDTEHSTFEDDEYISKPGDVYLAFVDTPVKEDDELTIEDTFIG
                     GEPVWLAEDSLPPKDMLRCGACKGSNNFKLLLQAFSPLDIAQVEEVQKKLSVQDLTHV
                     NPDDDRVLYVFICTKCQRKPNSVRCIRGIKKNKSTTNRESVDKKMQQLSEPKEFKINP
                     FDITKSDTSNPFSNPFGSQDNSNPFSTNVKSGEIDDIKEPQLSTKAQLKAAQSEHDKK
                     KNKEFDTSKVFKSYLLYVEEESFKNKKPDHLKLPKNLKIDKEALDLTGTDEDDLEKDP
                     IKLDPRTEKLSKFLDDDTFQKFQEVVAYNPHQVLRYDLGGMPLLYADMKTEQPPFRVP
                     NPSYNSQSCRVFEMQLMPKLIMDLEDETDVNEGMEWGTILIYTDIQNFTPQCDENDVA
                     YVEEYVKVQWESRK"
     gene            complement(<208311..>210338)
                     /locus_tag="CAGL0A01980g"
                     /db_xref="GeneID:2886380"
     mRNA            complement(<208311..>210338)
                     /locus_tag="CAGL0A01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444851.1"
                     /db_xref="GeneID:2886380"
     CDS             complement(208311..210338)
                     /locus_tag="CAGL0A01980g"
                     /inference="similar to AA sequence:UniProtKB:P25038"
                     /note="similar to uniprot|P25038 Saccharomyces cerevisiae
                     YOL023w IFM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444851.1"
                     /db_xref="GeneID:2886380"
                     /db_xref="GOA:Q6FY09"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FY09"
                     /translation="MLKHTLRTARPSSRWLLPYRTSMVNWYTSTAPKLSRNNKLKNKR
                     KLAELRPLTFSIPNYISVNKLSNLINCRVEDLIRDLRKLGFESITNNYILSKELTELI
                     LQEYNYDISSSASALTISNVYDELKSPINPKLLKKRPPVVTIMGHVDHGKTTIIDYLR
                     KSSMVEQEHGGITQHIGAFQVVTPLSGRKITFLDTPGHAAFLKMRERGANITDIIVLV
                     VSLEDSVMPQTIEAIKHIKNSGNQLIVAITKIDKMPDKSQRNKYLEKVENDLISQGIE
                     IEKIGGDVQVIPVSAKNGENMDTFEESIVLLSDIMDIRSENGPRTVAEGWILESKVRK
                     TIGNAATVLVKKGTIKKGDILLCGNTYCKVRSMRGSDENNKSLNLAPPAEAVEISGWK
                     DLPDVGDEIIQVKSESVAKKYITKRQKLLDAEKGAELVEKMNEESVQVALQKQAQKSD
                     DVDEFENDDVEDEIPKVKDINFIVKTDVSGSVEAVVGSISHLGNEEVQCKVVSSSVGI
                     PTESDLQLANITNSTILCFNLGPLPNDVLNNTLKVQVRQYNVIYKLIEDVTQILIDNL
                     KPVFEKKIVASAEIRDIFEYSLKKKKLKIAGCKVLNGQINRNSLVQLTRGSDKNIVYD
                     GKLSTLKHGKDDVATVTKGHECGITFDSGFENYEKGDIIQVYENIQQQRYL"
     gene            complement(<210707..>211087)
                     /locus_tag="CAGL0A02002g"
                     /db_xref="GeneID:2886344"
     mRNA            complement(<210707..>211087)
                     /locus_tag="CAGL0A02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444852.1"
                     /db_xref="GeneID:2886344"
     CDS             complement(210707..211087)
                     /locus_tag="CAGL0A02002g"
                     /note="some similarities with uniprot|P43598 Saccharomyces
                     cerevisiae YFR017c and some similarities with
                     uniprot|Q08172 Saccharomyces cerevisiae YOL024w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444852.1"
                     /db_xref="GeneID:2886344"
                     /db_xref="GOA:Q6FY08"
                     /db_xref="UniProtKB/TrEMBL:Q6FY08"
                     /translation="MMNHSYTHIEEAPEAKEQDIQTPPQFLNRRRSSNYIDALSSKRN
                     EESDPISMDMQNARHQLSSIEQSDHDSKTSNCNKVAEEDEVDYMKRNNHSRQQERPLT
                     GRRRSSFEYEDFKKNIYNRSKLFE"
     gene            complement(<211829..>213901)
                     /locus_tag="CAGL0A02024g"
                     /db_xref="GeneID:2886468"
     mRNA            complement(<211829..>213901)
                     /locus_tag="CAGL0A02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444853.1"
                     /db_xref="GeneID:2886468"
     CDS             complement(211829..213901)
                     /locus_tag="CAGL0A02024g"
                     /note="weakly similar to uniprot|Q92325 Saccharomyces
                     cerevisiae YOL025w LAG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444853.1"
                     /db_xref="GeneID:2886468"
                     /db_xref="GOA:Q6FY07"
                     /db_xref="UniProtKB/TrEMBL:Q6FY07"
                     /translation="MEVSSIIEEYNNAKDNDFRYMTLKQPVLIRSIQKDFDKLMANLY
                     LPVLTHNVDSELQQLVSFEVLPRAVLSLFDSQVEEYNSNGLMWAYIERYVFYPIIDSL
                     ESGNETITNLLVQSLRNILNILISNDLNIKSVTRNDQILSDNYQSKYQDEEFMKLVSF
                     MLKESQKETTVAGLQGYQETIQKLIEVSYDGRLRFLSPKALKMCIESLHDYEDYNTSS
                     EMLLNKVIENTDIAAVAQTQQYFSLSNLKFMSKNWYKFAECCSGIIPKLIDEITKETE
                     KSDISKMLEIISNLKDYLLQGTITNEGHPKLPSDLSILLLDRVLNILTNIIPSIESRD
                     VINKHHNNNDLVTTESDTDIVVEDIDQQAYLDELDAGMSSNYDEDLSFTVDFEGDDTS
                     SNLLEVTEEELQDIDIYNRDYDVIVKHSLNILYDVFLAERTGVIQFGPHLATAREKLN
                     CIKSKVSDSNLDSKTFSLFTHFFERLEDFDRKVFETYEVLSIEELKTEISTPIPERKG
                     AVVFTLIEYLGKDQVSLEELQSIIELIDHLIDVRVTDGDNDKYLSGNDENLIAEALLP
                     HLRMNKSFVHTFKAGNISKKVDNGATLRTMIYTTLSRLDITKHLLVCKVIECLLHYGI
                     KDKQDLIRDIAQSILKKLLDEHYEEILALETTWYSKYLVPIIAESTLPTNNFLTAYPP
                     FTFHTVDS"
     gene            <215768..>218098
                     /locus_tag="CAGL0A02046g"
                     /db_xref="GeneID:2886389"
     mRNA            <215768..>218098
                     /locus_tag="CAGL0A02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444854.1"
                     /db_xref="GeneID:2886389"
     CDS             215768..218098
                     /locus_tag="CAGL0A02046g"
                     /inference="similar to AA sequence:UniProtKB:Q02805"
                     /note="similar to uniprot|Q02805 Saccharomyces cerevisiae
                     YOR018w ROD1 or uniprot|P43602 Saccharomyces cerevisiae
                     YFR022w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444854.1"
                     /db_xref="GeneID:2886389"
                     /db_xref="GOA:Q6FY06"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FY06"
                     /translation="MVVSKNSSSRDPLLFDIRLQSTEDGIILLKGSPEEASSIFLSGT
                     IVVSVQQPIYIKNLTLRLNGRILMHVPITTNTPKGSYTRYTKFQKRFYHHQWDDFNIK
                     NYFANLYDNYGKAAIESESNVSKEERKATENLLKRKRAKSTNSILSFTGTSSNASSNY
                     HTLVRGNYEFPFTAILPGSLTESVEGHPNATVMYYLEAVIERPKQSDLISKKHLRVIR
                     TLRPDALELTETISVDNTWPEKVEYSISIPSKAVPIGSSSPIDISITPLMKGLKLGPV
                     KVQLVEVGQLCSATGVSSLDDRLVSKTKIKDPFGHLAKLRKKKYTAKSLTDPNFNTGS
                     DDDSDMDFQDKWDINTTIEIPPNLLACVQDCTVLNNVKIRHKLKFVICLINPDGHMSE
                     LRASLPIQLFISPFVPIKTKSPEAIERDIKLYGTNYANGSCRPTITIGRSSGNNSPII
                     QQESTFSNNDNSGASENEDLIFSKSLSAVELSSMNVNTSESVSSLNGLMVPPNYANHV
                     YDRLWNGRMSPVDVVQKDTEPSFSPDNRSGYSTPVANRNNFNVEQLQGSLQNLVIENE
                     QEGTNENETQQLTAIQQDMLLASPSLEPDYVHISRSASFSRLASSASLKSDWQVKDLT
                     SVPSYDRAMKSDLVGDDLPPAYPDEDNQDSKDAIVLERPQFIHQKSNSSLNVPGRRYS
                     HNFSRSNNSSSTSLNNLSMATSGYGQNLGVNNYNKGSTASKKFAFEMTPVDSNHNFEE
                     SHSSIPMERASSRASLNSNHRSGSFASLVELFTKKR"
     gene            218415..218487
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0A02068r"
                     /db_xref="GeneID:2886452"
     tRNA            218415..218487
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0A02068r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2886452"
     gene            complement(<218655..>220676)
                     /locus_tag="CAGL0A02090g"
                     /db_xref="GeneID:2886340"
     mRNA            complement(<218655..>220676)
                     /locus_tag="CAGL0A02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444855.1"
                     /db_xref="GeneID:2886340"
     CDS             complement(218655..220676)
                     /locus_tag="CAGL0A02090g"
                     /note="highly similar to uniprot|P38708 Saccharomyces
                     cerevisiae YHR020w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444855.1"
                     /db_xref="GeneID:2886340"
                     /db_xref="GOA:Q6FY05"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:Q6FY05"
                     /translation="MPVDFAKLCLSDKPADAVAVKSLVFKPKTAKTATPVPIVVVALQ
                     STNTPSPAIAHHSGLKDPRLARDELFQSFFKCETAKGFTLAYLTNAESEFKLLIDNNL
                     ESVAPETLLQLNDELSIKKSDLCSFLSQFDQYKQIVDFSVEIKKEAQPKQKKEKPAQT
                     NAAIEDAKLIGITVDKSLDFSGWYQQVVTKGEMLDYYDISGCYILRPNSYAIWESIQD
                     YFNAKIKAIGVKNAYFPMFVSSRVLEKEKDHVEGFAPEVAWVTRAGSSELEEPIAIRP
                     TSETVIYPYYAKWIQSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAFLD
                     QDDAEKEVLQVLDFYAGIYNELLAVPVVKGKKTEKEKFAGAAFTTTVEGYIPETGRGI
                     QGATSHHLGQNFSKMFNLSVENPLGPEHPKVYAYQNSWGLSTRTLGVMVMTHSDNKGL
                     VVPPRVAQHQAVVIPVGITKKTTDEQRKSIHDAAKNVEDRLLKASVRAFGDYNDNYTP
                     GWKFSQYELKGIPLRVELGPKDIEQGQVVVVRRNDSRKYVVKLDELESRIPEIMDEMH
                     NDMYNKAKELFDSHRIIVDEWKDFVPALNKKNVILSPWCGVMDCEEDIKDASARKDDG
                     EEFEQDEKAPSMGAKSLCIPFEQPPLKEGQKCVKCDRAAIQYCMFGRSY"
     gene            <221288..>222934
                     /locus_tag="CAGL0A02112g"
                     /db_xref="GeneID:2886304"
     mRNA            <221288..>222934
                     /locus_tag="CAGL0A02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444856.1"
                     /db_xref="GeneID:2886304"
     CDS             221288..222934
                     /locus_tag="CAGL0A02112g"
                     /note="highly similar to uniprot|P38707 Saccharomyces
                     cerevisiae YHR019c DED81 asparaginyl-tRNA-synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444856.1"
                     /db_xref="GeneID:2886304"
                     /db_xref="GOA:Q6FY04"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FY04"
                     /translation="MSVYIHEVKGVDETGVAGTQEQPFKTAAFALFCSETEPKLFVYK
                     EADGEYQEISASALKKARKGCEGLKKKAIKQKEQDAKKQQQDADNAAKQMAALNIKIE
                     EDKSLPEAKKCKIGQSYELVGQRVKISGWIHRLRSNKKVMFIVLRDGYGYLQSVLTGD
                     LAIAQQSLDLTIESTVTLYGTITKVPEGKSAPGGVELLVDYYEVVGLAPSGDEAFTNK
                     IAEGADPSLLLDQRHLALRGETLSAVMKVRAALMKSIRRVYTEESLTEVTPPCMVQTQ
                     VEGGSTLFKLDYYGEQAYLTQSSQLYLETCLPSLGDVYCVQESFRAEKSHTRRHLSEY
                     THIEAELAFLTFEELLDHIERVLCKTVQYILEDPIAGPLVKQLNPDFQAPKMPFMRLE
                     YKDAIEWLKEHDIKNEDGEEFKFGDDIAEAAERKMTDTIGVPILLTKFPAEIKSFYMP
                     RCKDDNRVTESVDVLMPTVGEITGGSMRINTEEELLAGFKRENIDPKAYYWFIDQRKY
                     GTCPHGGYGLGTERILAWLCNRFTVRDCSLYPRFSGRCKP"
     gene            complement(<223148..>224017)
                     /locus_tag="CAGL0A02134g"
                     /db_xref="GeneID:2886455"
     mRNA            complement(<223148..>224017)
                     /locus_tag="CAGL0A02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444857.1"
                     /db_xref="GeneID:2886455"
     CDS             complement(223148..224017)
                     /locus_tag="CAGL0A02134g"
                     /inference="similar to AA sequence:UniProtKB:P32792"
                     /note="similar to uniprot|P32792 Saccharomyces cerevisiae
                     YHR017w YSC83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444857.1"
                     /db_xref="GeneID:2886455"
                     /db_xref="GOA:Q6FY03"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="UniProtKB/TrEMBL:Q6FY03"
                     /translation="MAIPAVSIALYWGSTQLKVRPILSTTENQCILVFGDMRDPIIRG
                     QVMDLYRRGFTLFVCLENAGTYKTHNDEDDFLNYIDPKSTSDWAKFSEFFRKFPTNTL
                     SAILLIPKLSYHPTGQVTLEQLENELHSNVLIYYSTLVAISPHLPQNSNSNRIPTLIY
                     NPSLSVNMKNVEHPVEWLISGLMTTIFEELKHSHIFDPYMINVGLFQLGGQLSNYKYL
                     NVKGSNIYNDLYWPIYCFIKMKGGNTFQKLHVAICSLFGLKRTFYLGKFSYLFTLPFT
                     SKLYKLLNEWYVL"
     gene            <224026..>226444
                     /locus_tag="CAGL0A02145g"
                     /db_xref="GeneID:2886484"
     mRNA            join(<224026..224036,225280..>226444)
                     /locus_tag="CAGL0A02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444858.1"
                     /db_xref="GeneID:2886484"
     CDS             join(224026..224036,225280..226444)
                     /locus_tag="CAGL0A02145g"
                     /inference="similar to AA sequence:UniProtKB:P32793"
                     /note="similar to uniprot|P32793 Saccharomyces cerevisiae
                     YHR016c YSC84 and similar to uniprot|P43603 Saccharomyces
                     cerevisiae YFR024C-A LSB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444858.1"
                     /db_xref="GeneID:2886484"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:Q6FY02"
                     /translation="MIFCLTNPVPRGLANEAQKAAKILEGFIDPRQAYGPDQVIPPSV
                     LRNAKGLVIISILKAGFLFSGRAGSGIIVARLRDGTWSAPSAIAMGGAGAGGLIGMEL
                     TEFVFILNTDEVVDSFSEFGTVTLGGNVSVAAGPVGRDAEADASASAAGIASVFTYSK
                     SKGLFAGVSVEGSAIVERRDENRKVYGDRGTTRRILNGEVEPLPSMDRLYRILESPNF
                     TPQPGEGYRTSSYSEEQARPDERYGRERYDRRYDEALYDEKPRSRARWDSGDMPHSRG
                     GVERQDHLQRNDYDSHNRGGYPPPPCERNKDVQGHGSDAHALNRNRPVPPPPPAERSF
                     PKVRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYVADL"
     gene            complement(226620..226691)
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0A02167r"
                     /db_xref="GeneID:2886483"
     tRNA            complement(226620..226691)
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0A02167r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2886483"
     gene            complement(<226945..>228762)
                     /locus_tag="CAGL0A02189g"
                     /db_xref="GeneID:2886433"
     mRNA            complement(<226945..>228762)
                     /locus_tag="CAGL0A02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444859.1"
                     /db_xref="GeneID:2886433"
     CDS             complement(226945..228762)
                     /locus_tag="CAGL0A02189g"
                     /note="highly similar to uniprot|Q05506 Saccharomyces
                     cerevisiae YDR341c arginyl-tRNA synthetase or
                     uniprot|P38714 Saccharomyces cerevisiae YHR091c MSR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444859.1"
                     /db_xref="GeneID:2886433"
                     /db_xref="GOA:Q6FY43"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FY43"
                     /translation="MTSLTAQLKNLSIEEPKALEGSFPEVNVVDLMRNYIAQELSKIS
                     GVDAAQIFPALEWTNTMDRGDLLIPVPRLVRTKGSNPREIATEWAEKFPCGDFLEKVE
                     ANGAFVQFFFKPEFLYKTVIPDVITRGEEYGACKMVDNKKIIIEFSSPNIAKPFHAGH
                     LRSTIIGGFLSNLYEKLGWDVTRMNYLGDWGKQFGVLAVGFERYGDEEKLAKDPIHHL
                     YEVYVRINKDIEEEGDSLPESESTNGKAREYFKRMEDGDPEALKIWKRFRDFSIEKYI
                     DTYARLNIKYDVYSGESQVSKESMQTALKMFHEKNLTHEDRGATLIDLTKFNKKLGKV
                     IVQKSDGTTLYLTRDVGAAMDRYEKYHFDKMIYVIATQQDLHTAQFFEILKQLGFDWA
                     NKLQHVNFGMVQGMSTRKGTVVFLDNILEETKEKMHEVMKKNEAKYAQIDNPDEVADL
                     VGISAVMIQDMQSKRINNYEFKWERMLSFEGDTGPYLQYAHSRLRSVERNAAEIPKEK
                     WASADFSQLKEPAAALLVRLLGQYPDVLRNAMKTNEPATVVTYLFKLTHQVSSCYDVL
                     WVAGQTEEVATARLALYGAARQVLYNGMRLLGLTPVERM"
     gene            complement(<229556..>231214)
                     /locus_tag="CAGL0A02211g"
                     /db_xref="GeneID:2886382"
     mRNA            complement(<229556..>231214)
                     /locus_tag="CAGL0A02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444860.1"
                     /db_xref="GeneID:2886382"
     CDS             complement(229556..231214)
                     /locus_tag="CAGL0A02211g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
                     cerevisiae YDR342c HXT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444860.1"
                     /db_xref="GeneID:2886382"
                     /db_xref="GOA:Q6FY42"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY42"
                     /translation="MSDQESRSQSVLSASNSKADREDEFKAYVDEEGQPMVEIPKKPA
                     SAYVSISIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRLGQTRANGTHYLSKVRTGL
                     VVSIFNIGCAIGGIVLSKLGDMYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRI
                     ISGLGVGGIAVLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSV
                     QWRVPLGLCFAWALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTF
                     EVENVQAAVEAERLAGSASWGELFSTKTKVFQRLIMGIMIQSLQQLTGDNYFFYYGTT
                     VFKAVGLEDSFETSIVIGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASV
                     GVTRLWPNGQDQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCM
                     AIAQASNWIWGFLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEE
                     VNTLWEEGVLPWKSPNWVPPSKRDASYDADAMMHDDKPWYKRFV"
     gene            complement(<235820..>237469)
                     /locus_tag="CAGL0A02233g"
                     /db_xref="GeneID:2886373"
     mRNA            complement(<235820..>237469)
                     /locus_tag="CAGL0A02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444861.1"
                     /db_xref="GeneID:2886373"
     CDS             complement(235820..237469)
                     /locus_tag="CAGL0A02233g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
                     cerevisiae YDR342c HXT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444861.1"
                     /db_xref="GeneID:2886373"
                     /db_xref="GOA:Q6FY41"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY41"
                     /translation="MSEESQSALSASNSKVEREDEFKAYTDEDGQPMVEIPKKPASAY
                     VAISIFCLFIAFGGFVFGWDTGTISGFVAQTDFIRRMGQTRANGTHYLSKVRTGLIVS
                     IFNIGCAIGGVVLSKLGDVYGRKIGLISVVVIYIVGIVIQIATIDKWYQYFIGRIISG
                     LGVGGIAVLSPMLISEVSPKHMRGSLVSCYQLMITCGIFLGYCTNYGTKNYSNSVQWR
                     VPLGLCFAWALFMIGGMTFVPESPRYLIEVGRVEEARRSIAISNKVSPDDPAVTFEVE
                     NVQAGVEAERLAGSASWGELFSTKTKIFQRLIMGIMIQSLQQLTGDNYFFYYGTTVFK
                     AVGLEDSFETSIVIGIVNFASTFVALYVVDRFGRRRCLLWGAAAMTACMVVFASVGVT
                     RLYPHGMKQPSSKGAGNCMIVFTCFYIFCFATTWAPIPFVVNSETFPLRVKAKCMAIA
                     QASNWIWGFLIAFFTPFITNAINFYYGYVFMGCLCFSYFYVFFFIPETKGLTLEEVNT
                     MWEEGVLAWKSPNWVPPSKRDASYDADALMHDDKPWYKRFY"
     gene            <244683..>245501
                     /locus_tag="CAGL0A02255g"
                     /db_xref="GeneID:2886474"
     mRNA            <244683..>245501
                     /locus_tag="CAGL0A02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444862.1"
                     /db_xref="GeneID:2886474"
     CDS             244683..245501
                     /locus_tag="CAGL0A02255g"
                     /note="some similarities with uniprot|P25577 Saccharomyces
                     cerevisiae YCL049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444862.1"
                     /db_xref="GeneID:2886474"
                     /db_xref="GOA:Q6FY39"
                     /db_xref="UniProtKB/TrEMBL:Q6FY39"
                     /translation="MKFGGFSTLTQAAAALALFNAVDAFDASSPGRTDLNTTEIDTGA
                     FLGDLDVVKVPESANLSEYILTYAGSDKALLDEKTGYVLLNITQNYAGNDTMAKRDVK
                     VYGYDGWYQTWHQMQTVNKGEWWSPWYPISQCVSNGLNDAEASISVNFAYTYTWSLEW
                     GLNAGPDVVGASIGYSISDSVGWGGQFQCNIAPHTRGQIWYQQRVAWADIQKQDCRRE
                     NNGKVTCSPWSAFNRVNAPLKGADNVHLGCSSGEDNIQCDAHFDSRLGQIFRNI"
     gene            <248522..>249340
                     /locus_tag="CAGL0A02277g"
                     /db_xref="GeneID:2886318"
     mRNA            <248522..>249340
                     /locus_tag="CAGL0A02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444863.1"
                     /db_xref="GeneID:2886318"
     CDS             248522..249340
                     /locus_tag="CAGL0A02277g"
                     /note="some similarities with uniprot|P25577 Saccharomyces
                     cerevisiae YCL049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444863.1"
                     /db_xref="GeneID:2886318"
                     /db_xref="GOA:Q6FY39"
                     /db_xref="UniProtKB/TrEMBL:Q6FY39"
                     /translation="MKFGGFSTLTQAAAALALFNAVDAFDASSPGRTDLNTTEIDTGA
                     FLGDLDVVKVPESANLSEYILTYAGSDKALLDEKTGYVLLNITQNYAGNDTMAKRDVK
                     VYGYDGWYQTWHQMQTVNKGEWWSPWYPISQCVSNGLNDAEASISVNFAYTYTWSLEW
                     GLNAGPDVVGASIGYSISDSVGWGGQFQCNIAPHTRGQIWYQQRVAWADIQKQDCRRE
                     NNGKVTCSPWSAFNRVNAPLKGADNVHLGCSSGEDNIQCDAHFDSRLGQIFRNI"
     gene            <250851..>251690
                     /locus_tag="CAGL0A02299g"
                     /db_xref="GeneID:2886276"
     mRNA            <250851..>251690
                     /locus_tag="CAGL0A02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444864.1"
                     /db_xref="GeneID:2886276"
     CDS             250851..251690
                     /locus_tag="CAGL0A02299g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444864.1"
                     /db_xref="GeneID:2886276"
                     /db_xref="GOA:Q6FY38"
                     /db_xref="UniProtKB/TrEMBL:Q6FY38"
                     /translation="MSALNGRAYVPKFALKLVCLLLCFELVSIVSAMGGIPTGLPEPQ
                     LQNNLDVDDSDNLVTIPDEGNFHDYIEKYAGKNTPLLDKRSGNLIVDIKKVKDASDSS
                     SIQPHTTKVYSKNKKTHTFKVMSLNSTEEVWSDWFPVSKCDIGLGDNDNQIKLKYAYH
                     YNWTKEDTLDADFKHIKSLLKLPISKEVGIGNTFKCGAEAGQTVQVWLQQRCIKALIQ
                     TQECTKESSRVIKCNDWDNGTYIMAPLKGIGNVQFGCSGTDNHTECDAKMDPKLGKKF
                     KKS"
     gene            complement(<252192..>253862)
                     /locus_tag="CAGL0A02321g"
                     /db_xref="GeneID:2886369"
     mRNA            complement(<252192..>253862)
                     /locus_tag="CAGL0A02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444865.1"
                     /db_xref="GeneID:2886369"
     CDS             complement(252192..253862)
                     /locus_tag="CAGL0A02321g"
                     /note="highly similar to uniprot|P32466 Saccharomyces
                     cerevisiae YDR345c HXT3 or uniprot|P42833 Saccharomyces
                     cerevisiae YNL318c HXT14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444865.1"
                     /db_xref="GeneID:2886369"
                     /db_xref="GOA:Q6FY37"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY37"
                     /translation="MSSSNKDSESFENYPSQNSDNSYKRDDLDPDTLEKEAKIENPNG
                     KSAYIAVSISCALVAFGGFIFGWDTGTISGFVNQTDFIRRIGSKHADGTSYLSKVRTG
                     LVVGIFNIGCAIGGVVLSKIGDTKGRKAGLVTVVLIYIVGIVIQIATIDKWYQYFIGR
                     IISGLGVGGISVLSPTLISEVAPKELRGSLVSLYQIMITLGIFLGYCTNYGTKNYSNS
                     VQWRVPLGLCFAWALLMIGGMTFVPESPRYLIEAGDDDAARKSLCAANKLPAEHPFIE
                     QEFTILKAKVEEANAAGTASWSELITGKPAMLRRTIMGIMIQSLQQLTGDNYFFYYGT
                     TVFKAVGLEDSFQTSIVFGVVNFFSTFLSLFTVDRFGRRNCLLYGAAGMVCCYVVYAS
                     VGVTRLWPNGQGNGSSKGAGNCMIVFSCFYIFCFATTWAPIAYVIISESFPLRIKTKA
                     MSIASASNWIWGFLIAFFTPFITNAINFYYGYVFMGCMVFAYFYVFFFVNETRGLTLE
                     EVDEMYAEGVLPWKSSKWVPESERDDSYDADALLHDDTPWYKRVIGRN"
     gene            <254861..>255127
                     /locus_tag="CAGL0A02343g"
                     /db_xref="GeneID:2886443"
     mRNA            <254861..>255127
                     /locus_tag="CAGL0A02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444866.1"
                     /db_xref="GeneID:2886443"
     CDS             254861..255127
                     /locus_tag="CAGL0A02343g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444866.1"
                     /db_xref="GeneID:2886443"
                     /db_xref="GOA:Q6FY36"
                     /db_xref="UniProtKB/TrEMBL:Q6FY36"
                     /translation="MELYGCSTLETNPAPTLPSPIEKALVRDDQANQHLQIRKTDASS
                     VHLCLCESLFSSVPKNGIYGENSAGISINYHYKSNCSRKQKKKK"
     gene            complement(<256250..>257581)
                     /locus_tag="CAGL0A02365g"
                     /db_xref="GeneID:2886358"
     mRNA            complement(<256250..>257581)
                     /locus_tag="CAGL0A02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444867.1"
                     /db_xref="GeneID:2886358"
     CDS             complement(256250..257581)
                     /locus_tag="CAGL0A02365g"
                     /note="highly similar to uniprot|Q05515 Saccharomyces
                     cerevisiae YDR346c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444867.1"
                     /db_xref="GeneID:2886358"
                     /db_xref="GOA:Q6FY35"
                     /db_xref="InterPro:IPR013931"
                     /translation="MLKWIQGGLSAVTGIAEPEYGKEYIHTVTERVEGKQPYRETTRE
                     DFFWKSPDHTNVETVTFYFSNLATGVVGFAQIIHSNIIGLHTAAQFTFRIFDSKNPEK
                     LNLWTSTKLENFRIEDANFYADDLSVELNADNTQYRLISKVNEQSIVDLTVTRLTPGA
                     KLGDDPSTYYGDNVEQPWGSMRHVFWPRNTCVGEIKVKIPKETAEKTAEEQAQEKEQQ
                     EEQEQEGEDEAVEETIEYEERTLKFGEDDPSYCMFVMAFQGMKPHHAAKAWNFMFFHS
                     KENTMVLMEFTTPKSYSNTKVSIGIITNDKEILAVTHDNSALHLNQEIDSVGWNVPKQ
                     IRVELKGHKSSAKDEDVEADNDEHKIKAVVEGPLENMVERIDVMGEVPNFVKNIVSGV
                     AGTKPYIYQFGDAENFHFQLDDGEKKNGLAWVEVTFISESEVVTEESYNEE"
     gene            <258667..>259626
                     /locus_tag="CAGL0A02387g"
                     /db_xref="GeneID:2886421"
     mRNA            <258667..>259626
                     /locus_tag="CAGL0A02387g"
                     /product="mitochondrial 37S ribosomal protein MRP1"
                     /transcript_id="XM_444868.1"
                     /db_xref="GeneID:2886421"
     CDS             258667..259626
                     /locus_tag="CAGL0A02387g"
                     /inference="similar to AA sequence:UniProtKB:P10662"
                     /note="similar to uniprot|P10662 Saccharomyces cerevisiae
                     YDR347w MRP1"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP1"
                     /protein_id="XP_444868.1"
                     /db_xref="GeneID:2886421"
                     /db_xref="GOA:Q6FY34"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:Q6FY34"
                     /translation="MFCSRSVPRLRACARRWYQRPSLQHVSPDKELPGVFTARGLQNA
                     WFERADHYAAQLNKYTQGTQETALENIIYEESRSYIKRHITNYASLLYNLEFAMQSLQ
                     GNPQNKIPQGPIGRESLLETPATEQLIKNEPRSSGNTDLHQLLENSFGSIAEFKTLLL
                     NSALAISGEGFTWLVARKVTQSEMDRVSNSTGDKILFDKLFVLNTYNAGSPFNFNRAG
                     SITTLNKTEKAKEAKSEQNSTTEVDEFSKTLKDIRRAKEEAVDPELAYIPLLAIDSSP
                     KAWLHNYGAFGKRQYLENVWEATEWKVVESRLAGLTRSLDSSI"
     gene            complement(<260084..>261421)
                     /locus_tag="CAGL0A02409g"
                     /db_xref="GeneID:2886294"
     mRNA            complement(<260084..>261421)
                     /locus_tag="CAGL0A02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444869.1"
                     /db_xref="GeneID:2886294"
     CDS             complement(260084..261421)
                     /locus_tag="CAGL0A02409g"
                     /inference="similar to AA sequence:UniProtKB:Q05518"
                     /note="similar to uniprot|Q05518 Saccharomyces cerevisiae
                     YDR348c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444869.1"
                     /db_xref="GeneID:2886294"
                     /db_xref="GOA:Q6FY33"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:Q6FY33"
                     /translation="MTGRPFSVNNPFRSAGMETRYQHDQQYQEWVRGNTSPSRGGSVS
                     PPLGMAEKPVPVRQNTNPFLDDGDMHDSGHMGAPVQPVQPVHSPPQGYGKALSAEEEK
                     EQLRQKYQRDREREERPSHRRDLPPSYEEVAGGRGKGYPREKESYSGNVHREHSRSSG
                     HREEYSRSAERAPHRHHSHRRHQDNSSPAKKEKRKNKVATPKNVDTIDKLDVTGLFGG
                     SFHHDGPFDAVTPHRNKNTKAAPVLAFPADGPNSTIGGVTSKKSAMNEVFGVEEDDDD
                     NDLYRISGQVAGSTTSVNTKDAIKPNVGDIKQMDIKSKTEKIHGPTTVGLGSTTFLDG
                     APASAAAIRQDIKQHSHTNRSGVQRHKSLSQRLGIGSDSSRPSRSDSYKGAGLSRTRS
                     GPTEERPHQARHNSSHADDDEEDVYLGLPTSSLKKSSGSKFMKRVRSLKVGRK"
     gene            complement(<261812..>263575)
                     /locus_tag="CAGL0A02431g"
                     /db_xref="GeneID:2886415"
     mRNA            complement(<261812..>263575)
                     /locus_tag="CAGL0A02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444870.1"
                     /db_xref="GeneID:2886415"
     CDS             complement(261812..263575)
                     /locus_tag="CAGL0A02431g"
                     /inference="similar to AA sequence:UniProtKB:Q06325"
                     /note="similar to uniprot|Q06325 Saccharomyces cerevisiae
                     YDR349c YPS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444870.1"
                     /db_xref="GeneID:2886415"
                     /db_xref="GOA:Q6FY32"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6FY32"
                     /translation="MATRTMLFLLLLVQYVFASNSSEVPLEQYFKSDLRFPNIPVGLT
                     RDGMYYVNATLGTPGQWQQLGLGLAQPYVWVVSGDADSQCNRLDSGCLSGPLYYPQES
                     RTSSTGGDKYSINFIDGISLNGTRYMDVMRLMNVSSSLNVSGVDSGVSFRNHTLTVQN
                     LSFFNADYSSGYLYGSLGLGGTLNSDTELEGDFINHSFFFLDALKEARLINSSSYSLW
                     LGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPVV
                     PMGPIYITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLD
                     LWLVSCDVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLY
                     PNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEIITRQASIVTFTDS
                     LNKTSVATFSTVPSSMTSGYIPYATYESDSAYDSMQLYPSKVGSRITSIPGQIAGTVY
                     PGGVIAGDGRSFYDTSRTTTKLQTSTQFDSFSLSGTLGWNDSLASTSSTSRRNTAQHT
                     SPAWLVSLLGTACVLLGSMVI"
     gene            263902..263974
                     /gene="tRNA-Met (CAT)"
                     /locus_tag="CAGL0A02453r"
                     /db_xref="GeneID:2886472"
     tRNA            263902..263974
                     /gene="tRNA-Met (CAT)"
                     /locus_tag="CAGL0A02453r"
                     /product="tRNA-Met"
                     /db_xref="GeneID:2886472"
     gene            complement(<264152..>265873)
                     /locus_tag="CAGL0A02475g"
                     /db_xref="GeneID:2886431"
     mRNA            complement(<264152..>265873)
                     /locus_tag="CAGL0A02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444871.1"
                     /db_xref="GeneID:2886431"
     CDS             complement(264152..265873)
                     /locus_tag="CAGL0A02475g"
                     /note="some similarities with uniprot|P50273 Saccharomyces
                     cerevisiae YDR350c TCM10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444871.1"
                     /db_xref="GeneID:2886431"
                     /db_xref="GOA:Q6FY31"
                     /db_xref="InterPro:IPR017207"
                     /translation="MMGRVNSQLLRVVQDRSVANGEKLQRLYKLISATGSKTATATTT
                     ATTTTTATATGGGRVLALDSHVHRWFNTHVRGSKFYSHYHFLIKHGVHLAHATRFFNK
                     LLTGSEVEFQLATFQIFLINEENQQVFFEKFHRLYTFDMMLQIFDRLIARRDFRYVKF
                     YLAALTRKMSELATDRTRTVQDAELMYIKFNNSLLYYLLMEGNVPMFLRTFKNEVEYI
                     KSSTLQNSDSAEVQQALLKPVHLFVQMLRKNNSPDLIFELLPALQTKSRSKVFNAYLT
                     STVASTIRTFNDPTLMLKFLLTTAKGTKFPELLNELGLWRYIVHGEPGKIDPKSLQED
                     RDKFEKANSVSALKAMKRVDVVLLTELYRVFLSYSSSVMSPDKFRHCCIDLYSHYVQF
                     CEQNKHKLRGWKFDTGVLNVILYHIRYRLRDDKLAYEVLVDFYGRESMVQSVKNTAKK
                     CPFSMVIYDNGTVTTQQLHALLQLMQRYNVPLSFQICYTMVKRLLQMNEPEQAFEWYT
                     RILESGFDVRHHGLVELVLQQGWSLPHHFNHDLLEDDKLDSIIEEEPTEECAELVEDV
                     KELMQSV"
     gene            <266055..>268655
                     /locus_tag="CAGL0A02486g"
                     /db_xref="GeneID:2886482"
     mRNA            <266055..>268655
                     /locus_tag="CAGL0A02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444872.1"
                     /db_xref="GeneID:2886482"
     CDS             266055..268655
                     /locus_tag="CAGL0A02486g"
                     /note="some similarities with uniprot|P42223 Saccharomyces
                     cerevisiae YDR351w SBE2 bud growth protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444872.1"
                     /db_xref="GeneID:2886482"
                     /db_xref="GOA:Q6FY30"
                     /translation="MQKISVASMLKPVRLHTVREEAVAGAEAKAKVGAKTGAKMGAKT
                     GAKSGLEADTAAGETLDAGASSEVLQLHVPRSRSHSQSISKSNSVISGSSYSSAGRII
                     GVNSARRPSDNLMLQISAHSDGDSDDEAGGDTPSKAAETHANAVPKPVRPTSDNSIRS
                     NDTALFSANPTDSSNGSASDSDYDEQHDTSMVSGKSATTMMSPSLALSIGSGMTRSDV
                     ITPNKYSNLDSGSLGIAETPKARYIFSNVNRNRSQSSIKSSENSSPLRFVDGPNQRRT
                     LPGASNTYLHSNSTSAILPTSRAMTPSHRYRLRKEMRDVALKKSIKQKEKFYEEQDSN
                     LDLKDDNVDASLIWNIPMASYSTSSFLNTTDSKHKDTNIKVTSPENNRVINNKIERQD
                     RRFPQKNQVHSRSQPNLPRLQQRPMKRPVHQQQQPITCFEDIPATPIPGVSNVTDTEF
                     IQDTIQNLSSVYLHSQEMKSRGQLEKRQSSTQYLPLNVKEMSDLGMEDLVLVSDKKLE
                     AVSSSRPTYLPPKSTKEKQMHEHEISKYMKMASDEQIQRKISQTKHMEEDKANHERYA
                     HLLQRGITRKSSLFDLRKISWKTAISDELRCSIYHTILESDAQLVSSKYLENFDYLNS
                     ILDQMDFPTDKESEIKQIIEKNITTKIGYSSVKDKELTLLLKLKSISKQGLMVGDAQL
                     FHNFLNCKSFKTLKDIWEIANLIQLTCFNDTCKDKFDSRIIDPRGITARILHSPSFKA
                     EMTSSIMNFNTWWNIMSRIDNNLFMWIMDIIVIENCQCFTNKQINKDQLRDKNWDYYV
                     NKYVVVNYKILASLAASVLLDYHFGFNDLKHLERIDKKFCIPLYSEDTECNIINSSFI
                     KKWHHQYKKY"
     gene            <269090..>270040
                     /locus_tag="CAGL0A02508g"
                     /db_xref="GeneID:2886301"
     mRNA            <269090..>270040
                     /locus_tag="CAGL0A02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444873.1"
                     /db_xref="GeneID:2886301"
     CDS             269090..270040
                     /locus_tag="CAGL0A02508g"
                     /inference="similar to AA sequence:UniProtKB:Q06328"
                     /note="similar to uniprot|Q06328 Saccharomyces cerevisiae
                     YDR352w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444873.1"
                     /db_xref="GeneID:2886301"
                     /db_xref="GOA:Q6FY29"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FY29"
                     /translation="MSCARSLWPFISNINGSVSFLSSFVSLFPQIIETYKDKTVEGLS
                     PLFLMCWLSGDITSLIGALMTGQLKFQIALAIYFLFNDLFVCCQYYYYGVLHENKLAT
                     VGHETVPVISSLIDDGIITVDENGLQNTDSRPETNMEGSRLSNSSIYSGSRATRSLLA
                     NALVSVKSSNAQQILSSLQVPPNAPYPGHTGRGQMGVTLSWLGASFYVGARIPQLIKN
                     YQRKSTDGLSPFLFATTLLGNITYNISIFTSCNFLDTEDKMAFIFNELPFIFGSAGTV
                     AFDLIYFYQYYVLYSRDNKLRELEREIYDNNEDETTPLID"
     gene            <270481..>271440
                     /locus_tag="CAGL0A02530g"
                     /db_xref="GeneID:2886359"
     mRNA            <270481..>271440
                     /locus_tag="CAGL0A02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444874.1"
                     /db_xref="GeneID:2886359"
     CDS             270481..271440
                     /locus_tag="CAGL0A02530g"
                     /note="highly similar to uniprot|P29509 Saccharomyces
                     cerevisiae YDR353w TRR1 thioredoxin reductase or
                     uniprot|P38816 Saccharomyces cerevisiae YHR106w TRR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444874.1"
                     /db_xref="GeneID:2886359"
                     /db_xref="GOA:Q6FY28"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6FY28"
                     /translation="MPHNRVTIIGSGPAAHTAAIYLARAEMKPTLYEGMLANGIAAGG
                     QLTTTTEIENFPGFPEGLTGTELMDRMRAQSTKFGTNIITETISKVDLSAKPFKLWTE
                     FNEDGEPITTDAIVMATGASAKRLDLPGEDKYWQQGISACAVCDGAVPIFRNKPLAVV
                     GGGDSACEEAEFLTKYGSKVFMIVRKDHLRASTIMQRRVEKNEKIEVLFNSVSLEAKG
                     DGKFLNALRIKNVKTNEESDLPVNGLFYAIGHNPATDIVKGQVETDESGYIKTVPGSS
                     LTSIPGFFAAGDVQDSRYRQAITSAGSGCMAALDAERYLTELE"
     gene            complement(<271684..>272874)
                     /locus_tag="CAGL0A02552g"
                     /db_xref="GeneID:2886309"
     mRNA            complement(<271684..>272874)
                     /locus_tag="CAGL0A02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444875.1"
                     /db_xref="GeneID:2886309"
     CDS             complement(271684..272874)
                     /locus_tag="CAGL0A02552g"
                     /inference="similar to AA sequence:UniProtKB:P32468"
                     /note="similar to uniprot|P32468 Saccharomyces cerevisiae
                     YHR107c CDC12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444875.1"
                     /db_xref="GeneID:2886309"
                     /db_xref="GOA:Q6FY27"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FY27"
                     /translation="MTMTTMTTMVGVAALPNQVFKKVHDAGSVFNMLVCGESGLGKTT
                     FINTLFPGLKQRKGKKVSTEAVDIVRAQLTEKGFTMRFNVVDTPAFGDKVDNNRAWQP
                     VVDFIDDQYDSYLRQEQQPFRDVRFDFRVHAVLYFIRPTAHGLKPLDIWTMKHLSQRC
                     NLIPVISKADTLTAQELQLFKSRIRQVIEAQEIAIFTPPLDYTDGAEGAAGSLDEANA
                     PALEHARQLIESMPFAIVGSEDRYDNGSGTMVLARKYPWGLVEVENDEHCDFRKLRAL
                     LLGTYMLDLITSTEQTHYENYRRTRLEGINRDEPNDSEKLASLTYKTPARKLSNNPKY
                     KEEENALKSYFTEQVKAEEHRFRQWEQNIINERTKLNGDLEEIQAKVKRMEEEVRRLQ
                     ARKH"
     gene            <276915..>278054
                     /locus_tag="CAGL0A02574g"
                     /db_xref="GeneID:2886366"
     mRNA            <276915..>278054
                     /locus_tag="CAGL0A02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444876.1"
                     /db_xref="GeneID:2886366"
     CDS             276915..278054
                     /locus_tag="CAGL0A02574g"
                     /inference="similar to AA sequence:UniProtKB:P07285"
                     /note="similar to uniprot|P07285 Saccharomyces cerevisiae
                     YDR354w TRP4 anthranilate phosphoribosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444876.1"
                     /db_xref="GeneID:2886366"
                     /db_xref="GOA:Q6FY26"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="UniProtKB/TrEMBL:Q6FY26"
                     /translation="MSSEDELVQLTKTLLEPVPTLTPKQLYRAMVIILELTASQDIDS
                     LIDTLTLSTHVKIASFLSCLKASRLDHRAEYIAEAAKAVLGFSHVVELDLVEKTHREH
                     REEVVLDIVGTGGDGQNTFNVSTSAAIVAAGIPGLKVCKHGGKASTSNSGSGDLINTL
                     GVQSSKVTAETVPALWENKFMFLLAPYFHYGFGKTSNLRKLMHIPTIFNILGPLLHPV
                     AHVDKRVLGVYSKDLAPEYAKAASIVYPNSETFVVWGHVGLDEVSPIGKTTVWHVTTT
                     GQVDIFELEPAMFGLQEHPLDVCKSYGPERNAEILRDDILSGKYKLGDNHPVYDYILL
                     NTAVLYCLSQGHRNWKQGVEVANESIQSGNAVKALEHFIKDVQDL"
     gene            <278467..>281085
                     /locus_tag="CAGL0A02596g"
                     /db_xref="GeneID:2886370"
     mRNA            <278467..>281085
                     /locus_tag="CAGL0A02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444877.1"
                     /db_xref="GeneID:2886370"
     CDS             278467..281085
                     /locus_tag="CAGL0A02596g"
                     /inference="similar to AA sequence:UniProtKB:P32380"
                     /note="similar to uniprot|P32380 Saccharomyces cerevisiae
                     YDR356w NUF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444877.1"
                     /db_xref="GeneID:2886370"
                     /db_xref="GOA:Q6FY25"
                     /translation="MSDIKNFEFTPIGYIKSKSGENDAKETLMSPTGASVRSPGSVGH
                     VRKARRRSINDTVNSSRVENDNDTFDETLPELEMRKLPQYRRVPESRTSARNSGAAPQ
                     EEQNRNDYSDILSKTSNPIKDQEQKIKDLEHENTVLKVKNVSYRSLLANYSGGSSQNN
                     INLVEEVSIWKTKYLETNEKLLKVKQDFESYVQKMEQEKEVNTDQEKTKEPEVIPIDN
                     PEYIKEREHILEELERVTEDFKNLRDRYNDLEIKFLSIQNELDEKKQEFESSTARLNE
                     EIHTLKSTIDDKDATISEFKRKLGNAEDQLASIDDQNGNQNQKLLHDLKEREDAIDGL
                     KEDIIEKENAIVHYKEEIQDKQNQLKESESKYAEVQKEFEDFKRELKKQTFEFEDGKK
                     STSRQLQELSVEKIQLEKQVCNLRGQIEKLEQQHRLTQSENDGLRTKLKHIESDLKNE
                     KSRTEVKIKDLTSDLEDARKNLGEANNTIKELHHEIIKNATKSKDQLSEEVVEKDKEI
                     DQLKHRVQRLDEELRTSQAELDKATKNREVDHELEIRRLQNKHEIEQESLKRELAHMT
                     DEKERLVDLHRLDIETWERQIEALRKENENLISREHKESNNIEITLQDKNIQIRRLEA
                     DIVQLNEERNDILNKLRSLEQAKDRYKSEMKDALETISRLRVDLENNKSLKDSKDSLI
                     ERKYEKLKDEFKLMKKGYLDEMIKLQSRNRELNSDLQKRMDPSISTSANTTLADKLDY
                     YKLKYNDEVRHNNDLRVINEYLNRVLRASAQDIRLNLLKVENDLNIDIHKENVPLSAP
                     LSSSGGRPYSSSYTREFDKYDYRYRQKGKRFKTVALAVLAVIRMYRAAKKHNWNEQRI
                     RYLQRKIIAKEDRITW"
     gene            complement(<281161..>281463)
                     /locus_tag="CAGL0A02618g"
                     /db_xref="GeneID:2886310"
     mRNA            complement(<281161..>281463)
                     /locus_tag="CAGL0A02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444878.1"
                     /db_xref="GeneID:2886310"
     CDS             complement(281161..281463)
                     /locus_tag="CAGL0A02618g"
                     /inference="similar to AA sequence:UniProtKB:Q06333"
                     /note="similar to uniprot|Q06333 Saccharomyces cerevisiae
                     YDR357c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444878.1"
                     /db_xref="GeneID:2886310"
                     /db_xref="GOA:Q6FY24"
                     /translation="MALQDESLGIDQLSVDYDYLVYRISDRVKSLELEATRLVQRQNE
                     LVGQVSERVIDENIERFRGVLRGLDELEEYFAMMEQIGMITDSFKERLDSAMAALK"
     gene            <281637..>283403
                     /locus_tag="CAGL0A02629g"
                     /db_xref="GeneID:2886365"
     mRNA            <281637..>283403
                     /locus_tag="CAGL0A02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444879.1"
                     /db_xref="GeneID:2886365"
     CDS             281637..283403
                     /locus_tag="CAGL0A02629g"
                     /inference="similar to AA sequence:UniProtKB:P38817"
                     /note="similar to uniprot|P38817 Saccharomyces cerevisiae
                     YHR108w GGA2 Arf-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444879.1"
                     /db_xref="GeneID:2886365"
                     /db_xref="GOA:Q6FY23"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:Q6FY23"
                     /translation="MPTGIYLTEGPVRRSQVSGNPLLRKIQRACRMSLPEPDLALNLD
                     VADYINEKQGAAPRDAVFAIVKLINCHDTHTAVFALALLDVLVKNCGYPVHLQISRKE
                     FLNELVKRFPERPPMRYSKVQRLILTAIEEWYQTICKTASYKDDLGYIRDMHRLLKYK
                     GYAFPKIQDEHLAVMRPNDQLKTASEIQKEQEIAQAAKLEELIRRGRPEDLREANKLM
                     KVMAGFKEDNIIQAKQTINHELNKLRRKADLLNEMLSQEQPDLSSETMEELYSALKVA
                     QPKFQKIIEEEHEDDTLVQSLLKFNDTVNQLLEKYNLLKIGNKQAAAAINPENISEVP
                     AGSNAGALANEINLIDFDDEPARDSSNDQQGASNGNNTSLDDLFGDLTLGQADTNNNN
                     NQSLVGGGISLGAGKPSVATTGASAGLSNDSSDLLDSVLASPPPSLVQASNTPASTNI
                     SAADDLLGDFVSSPSPVANASASQKLSLFKSGDIEIELDLARESDSTLKLKVFFNNLT
                     FQTINNLVFSIATPKSVQLRLEPQSGNLLLANSKGGITQNAWIDNAPTTLTKPLKLKW
                     KVSYTYNSSNKEETAVYTLPKI"
     gene            complement(<283634..>286783)
                     /locus_tag="CAGL0A02651g"
                     /db_xref="GeneID:2886311"
     mRNA            complement(<283634..>286783)
                     /locus_tag="CAGL0A02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444880.1"
                     /db_xref="GeneID:2886311"
     CDS             complement(283634..286783)
                     /locus_tag="CAGL0A02651g"
                     /inference="similar to AA sequence:UniProtKB:Q06337"
                     /note="similar to uniprot|Q06337 Saccharomyces cerevisiae
                     YDR359c VID21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444880.1"
                     /db_xref="GeneID:2886311"
                     /db_xref="GOA:Q6FY62"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:Q6FY62"
                     /translation="MSVSSSRSVTPTTAGEGKKEILSQRSSKLSQLYCLSRLDDVMLV
                     KGKREEFVRDLHRFLEENDVDKSIAKLNQKTEERYVLKPLKIQRFRKSLGMGSKVFRG
                     IKRSEHDIIRTKDNAIVYVREENPYSPSIEWVTRKRKLAEDQTQDVSYKRQKRSYEPI
                     HQYQISKLPPKPTPIEKPSAVSKTLNEKLNEVYDTEERLDSRYNEGSIDSLESVYLMM
                     KEIAPSMIPGGIPLAELRYMAQTLPLISLIPRAHKVLTSDMINQALHESRITVVSSRI
                     EELRRSGLWSLRQPKRFVDGWNRENTHRGTLLKEAKWMREDFVEGKKYKIAVCTTLAQ
                     AVQDYWTYGKVCCVRCKPIHVPGEDTPNSNDRSDKSVDETLAKTVLVEPLVEPVDVDI
                     VQDSVIENDEKGDDTKNVQANKETEKESQVANEDVDDVMKDVTEQDVDNDIAIDRNDG
                     SDDNDNGNGNDNDNGNGNDNDNGNDSDNAIDTWLLQRRANPKDEIVPKKLPEISDEEY
                     QRMKQSDKKSKIFKLTITENDLSGFQSTLLSEFPVYKGIDDEDSHINLDTLEMIPVSK
                     SLVLPDFDHYYKIVEKQLIDEEQTLLQLSKRRGLFYGNRRNHYLRPPSVPSLKYLQNR
                     TPTIWLPEDDQELVKNISTYAYNWDLISAQMTRMPSNSYLSNIERRTPWQCFERFVQL
                     NEKFSFSDLKGPRAHAAQQWLIEAHKFQQRQNRRISPLGVGPESIQRGHRRLRWASIF
                     EAMRKTIKKRENAPRPNPTQPRKMLDSKNMKVPTPAEMSALKAQRDEAIRRDIQLRRT
                     AKNRLQVKQNPQVSKSKQSQKQGSPSLSRQQHPVPPNGQRPVNLPVGSQFRVDNMQQQ
                     QQQQKQYDARFVQKQAMQGNAGKIVSSAAAPEKVPNTSYTNVVNKQITPAMQAQNEQR
                     IAAENKLINSYVKKIIKQNPGVSPEIALKAAQSYLTTMKNQQAQKRFKDSKLNSASGA
                     QVKNIPQPGESVNLSQQGMSVMNRGVPSPVQTDPRQIYAGRASNAPGKPVTTVDTIPE
                     TVQTMKSPTPQEILKKFQK"
     gene            complement(<287318..>288148)
                     /locus_tag="CAGL0A02673g"
                     /db_xref="GeneID:2886368"
     mRNA            complement(<287318..>288148)
                     /locus_tag="CAGL0A02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444881.1"
                     /db_xref="GeneID:2886368"
     CDS             complement(287318..288148)
                     /locus_tag="CAGL0A02673g"
                     /note="highly similar to uniprot|Q06338 Saccharomyces
                     cerevisiae YDR361c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444881.1"
                     /db_xref="GeneID:2886368"
                     /db_xref="GOA:Q6FY61"
                     /db_xref="InterPro:IPR025602"
                     /translation="MVQAIKLSELGNRKRRNDPVNEDEESEIDISSTDSEEENAGDEE
                     QEIVNIDFDFFDGNPDVDFHAVKHLIRQLLGPQESNRVQLSALSDLILSSPTTTIKTD
                     GKESDPYCFLSFINYKENKDSDYAKYLRKLDTRIETFLQTLDNTGNKSCALVMSERLI
                     NMPPEVVTPLYRITMEDAAAANEGKPFDFYVIVSRKYEVNFDMDEAEGDASARSKKRV
                     RGKSEVDYFHEEDRFFEKHAKVHFDGESKKGLIASYIIIDHDSLVKSINEFEQEVSTW
                     "
     gene            complement(<288373..>290448)
                     /locus_tag="CAGL0A02695g"
                     /db_xref="GeneID:2886314"
     mRNA            complement(<288373..>290448)
                     /locus_tag="CAGL0A02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444882.1"
                     /db_xref="GeneID:2886314"
     CDS             complement(288373..290448)
                     /locus_tag="CAGL0A02695g"
                     /inference="similar to AA sequence:UniProtKB:Q06339"
                     /note="similar to uniprot|Q06339 Saccharomyces cerevisiae
                     YDR362c TFC6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444882.1"
                     /db_xref="GeneID:2886314"
                     /db_xref="GOA:Q6FY60"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FY60"
                     /translation="MDKKRGRGRPRKHAIDETASESIAVAALKSMEGAVANASTAKGK
                     GTAKDEGAGRKLRRRGRPRKVVEAAAVTPIDDAAAAGAAGAAAVDDAVIDAKLKDDDG
                     DEEYVHQEDDGDDGDDGDDGDDYVDGDDAIDVEFQPRAKKQKKVRILSKKRGIASTLL
                     QKGRIIRTLKDLSSARDKIERIYGLDRAKLLKLAIVKECFENDLFNVRQETIEPTSPF
                     WFESKHSSELPNAGRDLQDDIAHIWASMDAHPAQFGAVSEKEYNALFKVRAEPIDCQI
                     GETGISLSAGQKAELPVLPTYQRYGLVYNAGAFVTDMAWHTTKRGDEQVQYLVLALSQ
                     YGQEPDDKHLRMFGKEEHIACLQVFRFDPHTLSLEKIHDILHPYGEVWDLKWHEALDQ
                     TEDTIGALFFACQEGTVRSLNIPTTASEEPVLCQATNIALGVKGNCVTTFDFVSVSRV
                     ICGFQNGYVAEFDLCDTQALQRPSYYLQVCSTYISTIVTAHSEFEASTIGAVSLDGYF
                     YIFDPASIHTSKVKTSRYRGGNQFPIVYMPKLYSFFCTDGANIVRAVPPRASFAQHSM
                     GSMPTTVTALSASTLHPMLLSGLSSGGLYITNAVRRLLTGVKNVASVGRTLRLWKWDY
                     NPSADQYRLDPNYEVEKAGGGEISTIELDAPQVAITATKWNESTECGRFYSFSISAGI
                     VTIERIGEK"
     gene            <290595..>291704
                     /locus_tag="CAGL0A02706g"
                     /db_xref="GeneID:2886375"
     mRNA            <290595..>291704
                     /locus_tag="CAGL0A02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444883.1"
                     /db_xref="GeneID:2886375"
     CDS             290595..291704
                     /locus_tag="CAGL0A02706g"
                     /inference="similar to AA sequence:UniProtKB:Q06340"
                     /note="similar to uniprot|Q06340 Saccharomyces cerevisiae
                     YDR363w ESC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444883.1"
                     /db_xref="GeneID:2886375"
                     /db_xref="GOA:Q6FY59"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FY59"
                     /translation="MDFSDEDSDEFFMGTSEDVEERLQQAMASRAPQAPNAEPAPVQE
                     PHAEAEAELEPEAEGPSQEQVRGQDVVVIEGDTEGSGSEGSSDSEGSSDSGAQDTYRG
                     DKEYEVRTRSGMKRARTVEDENDLFFQSIAKRSQSLPVQDGSGAVRQDKVYYVQFISH
                     VDGTKGKSVQVKALGSHPFSKLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKV
                     LGFMTCDTLRVPQRYGSDYLEIQLVPVKEEAQYLEQEVFEEPERAPTPEEDAEEEFER
                     ELRDAKEVRAPVVDLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPR
                     STQITLALDDEPLDPHATVKSQDIEDEDMLEVRLS"
     gene            <291888..>292160
                     /locus_tag="CAGL0A02728g"
                     /db_xref="GeneID:2886379"
     mRNA            <291888..>292160
                     /locus_tag="CAGL0A02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444884.1"
                     /db_xref="GeneID:2886379"
     CDS             291888..292160
                     /locus_tag="CAGL0A02728g"
                     /inference="similar to AA sequence:UniProtKB:O94742"
                     /note="similar to uniprot|O94742 Saccharomyces cerevisiae
                     YDR363wa SEM1P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444884.1"
                     /db_xref="GeneID:2886379"
                     /db_xref="GOA:Q6FY58"
                     /db_xref="InterPro:IPR007834"
                     /db_xref="UniProtKB/TrEMBL:Q6FY58"
                     /translation="MDEKNVEERRTLEEDDEFEDFPVDTWGDKDTVASTSATNGTSAT
                     NGTSATNGIGGTSGTNGKRNIIWEENWDDVEADDDFTQELRAELQK"
     gene            <292470..>293759
                     /locus_tag="CAGL0A02750g"
                     /db_xref="GeneID:2886364"
     mRNA            <292470..>293759
                     /locus_tag="CAGL0A02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444885.1"
                     /db_xref="GeneID:2886364"
     CDS             292470..293759
                     /locus_tag="CAGL0A02750g"
                     /note="highly similar to uniprot|P33297 Saccharomyces
                     cerevisiae YOR117w YTA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444885.1"
                     /db_xref="GeneID:2886364"
                     /db_xref="GOA:Q6FY57"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FY57"
                     /translation="MSTLEELDVEDGLDQEILGLSAQELQTRSKLLDNEIRIFRSELQ
                     RLSHENNVMLEKIKDNKEKIKNNRKLPYLVANIVEVMDMDEIEDKENSESATQGGNVN
                     LDNTANGKAAVIKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTLPSEFDS
                     RVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFKELGIRAPKGALMYGP
                     PGTGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPAIIFID
                     ELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFSSDDRVKVLAATNRVDVLDPALLR
                     SGRLDRKIEFPLPTEDSRAQILQIHSRKMTTDDDINWQELARSTDEFNGAQLKAVTVE
                     AGMLALRNGQSSVKHEDFVEAIGEVQARKSKSVSFYA"
     gene            complement(<293966..>295291)
                     /locus_tag="CAGL0A02772g"
                     /db_xref="GeneID:2886487"
     mRNA            complement(<293966..>295291)
                     /locus_tag="CAGL0A02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444886.1"
                     /db_xref="GeneID:2886487"
     CDS             complement(293966..295291)
                     /locus_tag="CAGL0A02772g"
                     /inference="similar to AA sequence:UniProtKB:P40968"
                     /note="similar to uniprot|P40968 Saccharomyces cerevisiae
                     YDR364c CDC40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444886.1"
                     /db_xref="GeneID:2886487"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FY56"
                     /translation="MDLLAHYSDSSDELSDQEVVAKPVAEESFDKNGKRKFKFSKAEL
                     KRRRKQRKGDGPWGSWDVEVDQKTVQDIDDGGAHDLFDSDHDQETANGPTKLLNEKST
                     FYGRKERDYQGRSYLHPPADVDVDFKRTQFKCYLPKKVIYRYKGHHNGTTSLRLLPGT
                     GHLILSGGNDNTVKLWDFYHDRKCLRDFVGHSKPIKTLDFTSDSSQFLSGSYDQQVKI
                     WDTETGKVTKRLNTYSTPNSAEFRPTSGNEFVVGLSSSKIKHYDTRVSEKDGLVQVYD
                     HHLSSILAIKYFPDGSKFISSSEDKTLRIWNNQVNIPIKQISDTTQHSMPYIGIHPEH
                     NYFSTQSMDSVIYSYSMKPKYKMHPNKKFKGHNSAGYGIGLTFSPDGRFLCSGDARGQ
                     LFLWDWNTNRKLCDLKLPTKSPITQVSWHPKETSKVICSGPDGRIFVLD"
     gene            <295534..>296371
                     /locus_tag="CAGL0A02794g"
                     /db_xref="GeneID:2886367"
     mRNA            join(<295534..295563,295751..>296371)
                     /locus_tag="CAGL0A02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444887.1"
                     /db_xref="GeneID:2886367"
     CDS             join(295534..295563,295751..296371)
                     /locus_tag="CAGL0A02794g"
                     /note="highly similar to uniprot|Q06346 Saccharomyces
                     cerevisiae YDR367w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444887.1"
                     /db_xref="GeneID:2886367"
                     /db_xref="InterPro:IPR013862"
                     /db_xref="UniProtKB/TrEMBL:Q6FY55"
                     /translation="MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALF
                     TGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLW
                     FSAQWFQSANEEKHETSAPVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRM
                     YFNFILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ"
     gene            <296851..>297783
                     /locus_tag="CAGL0A02816g"
                     /db_xref="GeneID:2886305"
     mRNA            <296851..>297783
                     /locus_tag="CAGL0A02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444888.1"
                     /db_xref="GeneID:2886305"
     CDS             296851..297783
                     /locus_tag="CAGL0A02816g"
                     /note="highly similar to uniprot|Q12458 Saccharomyces
                     cerevisiae YDR368w YPR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444888.1"
                     /db_xref="GeneID:2886305"
                     /db_xref="GOA:Q6FY54"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FY54"
                     /translation="MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLG
                     YRHIDAAAIYGNEDQVGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLD
                     YVDLYLMHWPVALKAHGSEEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGK
                     TKAIGVSNFSINNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYS
                     PFGSADAPVLKEPELHKLAEKYNISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVL
                     TLKDEDMETITNLSKVKGEKRLVQLDWSPFPTFE"
     gene            complement(<297872..>300358)
                     /locus_tag="CAGL0A02838g"
                     /db_xref="GeneID:2886298"
     mRNA            complement(<297872..>300358)
                     /locus_tag="CAGL0A02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444889.1"
                     /db_xref="GeneID:2886298"
     CDS             complement(297872..300358)
                     /locus_tag="CAGL0A02838g"
                     /inference="similar to AA sequence:UniProtKB:P33301"
                     /note="similar to uniprot|P33301 Saccharomyces cerevisiae
                     YDR369c XRS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444889.1"
                     /db_xref="GeneID:2886298"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6FY53"
                     /translation="MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDK
                     SISRQHVSLKWSSSKNCIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPV
                     KIILSRIDELFDIPNSLSQFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAAC
                     NDINIYSSGLLTEICNKLVNDHDNFDAEWRSMQSSYHRNLDLEGLLSQFGGIRGKFFF
                     LLYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISNEKIKYL
                     PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTS
                     QPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGISPVPGTNNEYNQSKVNGHLDSEISP
                     DSASTTREQKIPGQSHTISTTRMEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVV
                     EDQHHLPDRKKRDIHENTMYNNSYNGNKSLYGVENSLTQSNLLQSMGYEKSNNKTELS
                     KKNAGGIMSTEKNLDAQRPNLKSQTLNSLEDNDPKRTLQKRDIDIVKLVQTTKESEVK
                     RLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTTQQQWKNRKNFK
                     KFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQTKNVPVDYYNSHHDQNDFVDEI
                     NTAPQANKSNSFVHQILPEIGDENENSFSFTRTAIGNGNNNSANEINNSNQQLFVVDD
                     DFEDSQDVGHLLNKADTTEPPQQLQDHEDTMNDGPGSTTPVRNKRNRGKVSVTNGGNR
                     VRSVVKGFTNEDDDDDDDDDEPTFKFSRHR"
     gene            complement(<300736..>301944)
                     /locus_tag="CAGL0A02860g"
                     /db_xref="GeneID:2886287"
     mRNA            complement(<300736..>301944)
                     /locus_tag="CAGL0A02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444890.1"
                     /db_xref="GeneID:2886287"
     CDS             complement(300736..301944)
                     /locus_tag="CAGL0A02860g"
                     /inference="similar to AA sequence:UniProtKB:Q06349"
                     /note="similar to uniprot|Q06349 Saccharomyces cerevisiae
                     YDR370c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444890.1"
                     /db_xref="GeneID:2886287"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="UniProtKB/TrEMBL:Q6FY52"
                     /translation="MEEVVNQLEALSLSNDKRRVKGQRKGKKKKHGNSRARDDHTVVI
                     RGNKQRLKTSHHKNMPQFYDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPA
                     EKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVI
                     VTARHHMIDLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILK
                     KICFSGFALEDILTESANDEERNPTFLIVENEIANTRLLMRCEIDAYNPITSHYTELK
                     CYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKL
                     ISKSLPRCDSELNYDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCN
                     IRIEHRQNPN"
     gene            <302262..>302576
                     /locus_tag="CAGL0A02882g"
                     /db_xref="GeneID:2886479"
     mRNA            <302262..>302576
                     /locus_tag="CAGL0A02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444891.1"
                     /db_xref="GeneID:2886479"
     CDS             302262..302576
                     /locus_tag="CAGL0A02882g"
                     /note="highly similar to KLLA0E02266g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444891.1"
                     /db_xref="GeneID:2886479"
                     /db_xref="GOA:Q6FY51"
                     /db_xref="InterPro:IPR005545"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:Q6FY51"
                     /translation="MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYN
                     EPAQAGGERTFAGSHLQIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQP
                     KA"
     gene            <302938..>304443
                     /locus_tag="CAGL0A02904g"
                     /db_xref="GeneID:2886418"
     mRNA            <302938..>304443
                     /locus_tag="CAGL0A02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444892.1"
                     /db_xref="GeneID:2886418"
     CDS             302938..304443
                     /locus_tag="CAGL0A02904g"
                     /inference="similar to AA sequence:UniProtKB:Q06350"
                     /note="similar to uniprot|Q06350 Saccharomyces cerevisiae
                     YDR371w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444892.1"
                     /db_xref="GeneID:2886418"
                     /db_xref="GOA:Q6FY50"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:Q6FY50"
                     /translation="MHIGHRKRLGTFIVILITSLILQMSLHYKIFQKLKRRSQSDDYR
                     MPESDVLSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTS
                     SDEWSDTQLNLAKQCREYMFKRFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKKRN
                     VKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYE
                     PDAYLRMARELKLQLQKLEANILGDHSNKTFQLSMATPAFKDKLSILPIHKLDKYIDL
                     WNLMTYDYYGEWSERTGLHANLYNEKGKLLHLHRHDEDAGLSGDAAINYMVNRCKIDP
                     RKVILGMAAYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNE
                     KYDYRHVGAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKR
                     SLLNTYIRVIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDIIQES"
     gene            complement(<304789..>305775)
                     /locus_tag="CAGL0A02926g"
                     /db_xref="GeneID:2886363"
     mRNA            complement(<304789..>305775)
                     /locus_tag="CAGL0A02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444893.1"
                     /db_xref="GeneID:2886363"
     CDS             complement(304789..305775)
                     /locus_tag="CAGL0A02926g"
                     /note="highly similar to uniprot|Q06385 Saccharomyces
                     cerevisiae YDR372c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444893.1"
                     /db_xref="GeneID:2886363"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="UniProtKB/TrEMBL:Q6FY49"
                     /translation="MSTLQRRRVNKSENASNGIEDREDDGTSSGKIAYDPEESKLQND
                     SKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARM
                     RFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQL
                     KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEI
                     SYNSYFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQ
                     YPFDLQKESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL"
     gene            <306353..>306925
                     /locus_tag="CAGL0A02948g"
                     /db_xref="GeneID:2886470"
     mRNA            <306353..>306925
                     /locus_tag="CAGL0A02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444894.1"
                     /db_xref="GeneID:2886470"
     CDS             306353..306925
                     /locus_tag="CAGL0A02948g"
                     /note="highly similar to uniprot|Q06389 Saccharomyces
                     cerevisiae YDR373w FRQ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444894.1"
                     /db_xref="GeneID:2886470"
                     /db_xref="GOA:Q6FY48"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:Q6FY48"
                     /translation="MGAKASKLSKEDLTSLKQSTYFDRREIQQWHKGFLRDCPNGYLT
                     RDDFIRIYKQFFPFGSPEEFAGHLFSVFDKDNNGYIDFKEFITVLSTTSRGTLEEKLV
                     WAFQLYDLNHDGFITFDEMLTIVASVYKMMGSMVKLDEDEATPELRVRKVFKIMDKDE
                     DGYITLEEFREGSKVDPSIISALNIYDGLV"
     gene            complement(<307103..>308032)
                     /locus_tag="CAGL0A02970g"
                     /db_xref="GeneID:2886417"
     mRNA            complement(<307103..>308032)
                     /locus_tag="CAGL0A02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444895.1"
                     /db_xref="GeneID:2886417"
     CDS             complement(307103..308032)
                     /locus_tag="CAGL0A02970g"
                     /inference="similar to AA sequence:UniProtKB:Q06390"
                     /note="similar to uniprot|Q06390 Saccharomyces cerevisiae
                     YDR374c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444895.1"
                     /db_xref="GeneID:2886417"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="UniProtKB/TrEMBL:Q6FY47"
                     /translation="MKLIAAETPQKKFAMRTIEDSLKELEGLLHGGRVLRLPDLDHRY
                     TIMSYENYEQRSADVPRQQICDTSRQRDNAYKVVPVTHTTHSADINSDFITNYKLSTP
                     TQGLTTNVRTNPTVDVLTESKPNYQYYNKPTKLKASVKRKKSLAIVPAWVNVPEFSRF
                     FVIKSISLDHIKKSFYNSIWSSTHFGNRKLSQAYKELKAGAKIFLFFSVNASGRFCGV
                     AEMSSDLQDCLDTSLWDDSSKYGAAFRVRWVLVKDLKNAHLKRFLIPENEMKPITKSR
                     DTQEIPFYIGQAVLQLFKSDNTNIKCFLDQDYN"
     gene            complement(<308689..>310062)
                     /locus_tag="CAGL0A02992g"
                     /db_xref="GeneID:2886299"
     mRNA            complement(<308689..>310062)
                     /locus_tag="CAGL0A02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444896.1"
                     /db_xref="GeneID:2886299"
     CDS             complement(308689..310062)
                     /locus_tag="CAGL0A02992g"
                     /note="highly similar to uniprot|P32839 Saccharomyces
                     cerevisiae YDR375c BCS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444896.1"
                     /db_xref="GeneID:2886299"
                     /db_xref="GOA:Q6FY46"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FY46"
                     /translation="MNSGNGQSTLPPDAPTTGADTIGNELTSTLASGEKGTIRSLIDS
                     AMQNNPYFAAGGGLMLLGTGLALAKSGMVKASRLAYKQMIVDLEIQSRDKSYSWFLSW
                     MSKHPQRISKHLSVRTSYIQHDNGSVSTKFSLVPGPGNHWIRYKGAFIRIKRERSAKM
                     VDISNGTPFETVTLTTLYRDRHLFQDILNEAKDIALKTTAGKTVIYTSFGPEWRKFGQ
                     PKAKRLLPSVVLDKGIKEDIIEDVHDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSF
                     IQALAGELDYNICILNLSENNLTDDRLNHLMNNMPERSILLLEDIDAAFNKREQTGEQ
                     GFHSAVTFSGLLNALDGVTSSEETITFMTTNHPEKLDKAIMRPGRIDYKVFIGNATSY
                     QIEKMFLKFYPGEVNNCKKFVEAVESLGSSVSTAQLQGLFVMNKDDPESAIKMVHTMK
                     TNEEFVV"
     gene            <310323..>311828
                     /locus_tag="CAGL0A03014g"
                     /db_xref="GeneID:2886446"
     mRNA            <310323..>311828
                     /locus_tag="CAGL0A03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444897.1"
                     /db_xref="GeneID:2886446"
     CDS             310323..311828
                     /locus_tag="CAGL0A03014g"
                     /inference="similar to AA sequence:UniProtKB:P48360"
                     /note="similar to uniprot|P48360 Saccharomyces cerevisiae
                     YDR376w ARH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444897.1"
                     /db_xref="GeneID:2886446"
                     /db_xref="GOA:Q6FY45"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="UniProtKB/TrEMBL:Q6FY45"
                     /translation="MIFIRQLSSQVERKSVSVVGSGPSGFYTAYHLLSKSPIPLHVTI
                     WEKLPVPFGLSRYGVAPDHPEVKNCEDTFTNCAEQYISGEINDKNPLGHKFDFIGGVK
                     IGEDVPLKTLIDNQDAVILSYGCGGDKRLGIPGETDTAGVLSSREFVSWYNGHPDFAS
                     KEKLNSFDWSRVKNVAIIGNGNVALDISRVLLSNGIPEIWDKTDISKHALNILKHAPI
                     ETVKMIARRDFIHSKFTNKEFRELWELEKYGIKGHISSKYFSEDMFDFEKHQGSPLYD
                     RAFKRRVEMCSEYLKPFDQRLKKNYKKFPPVNPIGKEWELDYLKSPVEIIKDDSSGKI
                     KGLKLTENEVTQDNKVISTGKTLQYEVDLLITSLGYGGIPLQDFKTLDIGFHDSRGHI
                     INNNGKVLDNKGQVVPHLYTSGWIRKGSQGVIASTMMDAFEVGDNVLADLYATRDTYK
                     HTDLAQLLRTHRHTTWFDWQRIDKHERDAGSAEGRPRAKIEDKEEMLEYAQ"
     gene            <312174..>312479
                     /locus_tag="CAGL0A03036g"
                     /db_xref="GeneID:2886345"
     mRNA            <312174..>312479
                     /locus_tag="CAGL0A03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444898.1"
                     /db_xref="GeneID:2886345"
     CDS             312174..312479
                     /locus_tag="CAGL0A03036g"
                     /note="highly similar to uniprot|Q06405 Saccharomyces
                     cerevisiae YDR377w ATP17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444898.1"
                     /db_xref="GeneID:2886345"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:Q6FY44"
                     /translation="MIFKRAVSTLIPPKVVSAQQLGAAPNAKRIANVVSFYKSLPQGP
                     ATAANNAGYGRFLGKYKSKYYDGENASGKPIWHLSLAVITFGYSLEYFFHLRHHKDH"
     gene            complement(<312728..>313334)
                     /locus_tag="CAGL0A03051g"
                     /db_xref="GeneID:9487961"
     mRNA            complement(join(<312728..313000,313260..>313334))
                     /locus_tag="CAGL0A03051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999467.1"
                     /db_xref="GeneID:9487961"
     CDS             complement(join(312728..313000,313260..313334))
                     /locus_tag="CAGL0A03051g"
                     /note="highly similar to uniprot|Q06406 Saccharomyces
                     cerevisiae YDR378c LSM6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999513.1"
                     /db_xref="GeneID:9487961"
                     /db_xref="GOA:Q6FYB6"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /translation="MFTSISSLYSTWSKVPRGEANKMCRGKQSREYIYRAMAEESVST
                     QFLSNIIGKPVHVKLYSGMLYSGVLESIDGFMNVALSETREHYEHPNNNLLKKYASDV
                     FLRGTQVMYISEA"
     gene            <313662..>316040
                     /locus_tag="CAGL0A03058g"
                     /db_xref="GeneID:2886343"
     mRNA            <313662..>316040
                     /locus_tag="CAGL0A03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444900.1"
                     /db_xref="GeneID:2886343"
     CDS             313662..316040
                     /locus_tag="CAGL0A03058g"
                     /note="some similarities with uniprot|Q06407 Saccharomyces
                     cerevisiae YDR379w RGA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444900.1"
                     /db_xref="GeneID:2886343"
                     /db_xref="GOA:Q6FYB5"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB5"
                     /translation="MAKPPDIHVPLHDNDLRGRGREYSAHTPYISQSHDPPMPVLPDH
                     LLILSLYGKTVDDVLDATLTVDELDSLEQWDMPSGASASGSASDSATGSGSGSGSSSG
                     STSGRSQSDKNEEDSYKNLWSPRMFQPGLIRKNANDMDFDTPGLGISHSRTPSASQSH
                     TSQTHTNQTQTLVQTPSSSSNSHSRKSSNPNPQTPMARKTSLDDKDKRIARSLSRKSK
                     VFLGNLSFKKPSKTTESDTHSGWGVASAQTTEPRLESPRLGGATPNLTPKASDRRGKS
                     DSLIFAQQASPRVGSSPVGRRNGSVTNTPTVGSRKDSIGFSANTTPSIGMAFNVTQPL
                     TLEEPRPHVDVLGHRSSNSLGSANLGTHNSSTIAASMYRTPPLTHHDTFDKVTSPSTT
                     LGNSASVLSKRTNSYTNLEGRKRMGSGDAALMVDSNGVNDELFDSELKLRKLRLEIRE
                     LTLSKKHLVDEIEHLTVTRENLLQEVESLKHDKEKSSLSSFEIFDSHQGETNSQTSRK
                     SSNSANKLLAEVRTEPKPKFWRIFGSNRSGGSSEDSYVIPCESTPAPNVSLTSVCERD
                     GTEIPLVIKVCITYLEVDEDLLKAEGLYRKSASNGLVESIEREIVKLCDSLEVTDTDG
                     IIECLRDTELLSLMQRDENAVASVLKRYLRSFSEPVFTYEVYDPLINLVKKDDLINTL
                     PLLNGKPKDKFENEEEEENMGKLFRTTLGSVIRILQLLPEAHYETLKVLCGHICLVSH
                     YSDTNLMNLHNLAIVFSPGLLHDQHGDKDLSDMRERYYIVEFILGHRKEIFD"
     gene            complement(<316567..>316806)
                     /locus_tag="CAGL0A03080g"
                     /db_xref="GeneID:2886347"
     mRNA            complement(<316567..>316806)
                     /locus_tag="CAGL0A03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444901.1"
                     /db_xref="GeneID:2886347"
     CDS             complement(316567..316806)
                     /locus_tag="CAGL0A03080g"
                     /inference="similar to AA sequence:UniProtKB:Q3E785"
                     /note="similar to uniprot|Q3E785 Saccharomyces cerevisiae
                     YDR379C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444901.1"
                     /db_xref="GeneID:2886347"
                     /db_xref="GOA:Q6FYB4"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB4"
                     /translation="MARKLSGLQREVIHLYRSAVRVAHTKPVENQPHFLQFIHAEFSK
                     YRDLPRKDFTTIEHLLRVGNRRLKMYSQPELKDIH"
     gene            <317961..>319910
                     /locus_tag="CAGL0A03102g"
                     /db_xref="GeneID:2886449"
     mRNA            <317961..>319910
                     /locus_tag="CAGL0A03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444902.1"
                     /db_xref="GeneID:2886449"
     CDS             317961..319910
                     /locus_tag="CAGL0A03102g"
                     /inference="similar to AA sequence:UniProtKB:Q06408"
                     /note="similar to uniprot|Q06408 Saccharomyces cerevisiae
                     YDR380w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444902.1"
                     /db_xref="GeneID:2886449"
                     /db_xref="GOA:Q6FYB3"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB3"
                     /translation="MAPVTLDPKVTADTSRYSGVQSNSGFAYGEITFGEYVFRRLLSC
                     GTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCNELNAAYAADGYSRYTNKIGCLI
                     TTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCKNTDNKNVHHLIPALNDSNFV
                     SPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMYRYSKPGYLFIPADFADMM
                     VSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYNSSNPCILGDVLTDRYG
                     VSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSSSVIEDFSKCDLILH
                     FGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMIRGVNFVHVLNRL
                     QPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLNPGDVLVCETG
                     SVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPNPEEIEYEP
                     KLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYNDIAPWN
                     WTKMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVKMGVL
                     DFPEQLKCMVSAAMYNKKKEQSMSN"
     gene            <320671..>322666
                     /locus_tag="CAGL0A03117g"
                     /db_xref="GeneID:2886485"
     mRNA            join(<320671..320955,322253..>322666)
                     /locus_tag="CAGL0A03117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444903.1"
                     /db_xref="GeneID:2886485"
     CDS             join(320671..320955,322253..322666)
                     /locus_tag="CAGL0A03117g"
                     /note="highly similar to uniprot|Q12159 Saccharomyces
                     cerevisiae YDR381w YRA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444903.1"
                     /db_xref="GeneID:2886485"
                     /db_xref="GOA:Q6FYB2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB2"
                     /translation="MSANLDKSLDEIIGSKKTARPSNRTRAGHAARPKRAAKQINPRR
                     RVVPGRRAVSKPVAAPASAAVARAASLLHGTREARVTVEGLPRDIKQDAVREFFQSQV
                     GGVQRVLLSYNERGQSTGMANVTFRNGELAKKAVAQFSGAPIDGGKSRLRLNIVVDPT
                     VQPARPLTERIRAISRERVVAQKAKPVKGPSKKAAAVKARKQKPKAKKEKQPKKNLED
                     LDKEMADYFGEGKN"
     gene            complement(<323030..>323377)
                     /locus_tag="CAGL0A03146g"
                     /db_xref="GeneID:2886324"
     mRNA            complement(<323030..>323377)
                     /locus_tag="CAGL0A03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444904.1"
                     /db_xref="GeneID:2886324"
     CDS             complement(323030..323377)
                     /locus_tag="CAGL0A03146g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444904.1"
                     /db_xref="GeneID:2886324"
                     /db_xref="GOA:Q6FYB1"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB1"
                     /translation="MSNPFKNIGKNLLYISGVGVLSLVIVKSIVRARRDAKFKPHALV
                     GDEASSAQDYYDNLAQVKPGFPLPKKLDKDEEFSIVDAATTRKSKYEAGGVSAVTRKR
                     GDRLGFLDRRNND"
     gene            <324013..>324342
                     /locus_tag="CAGL0A03168g"
                     /db_xref="GeneID:2886331"
     mRNA            <324013..>324342
                     /locus_tag="CAGL0A03168g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_444905.1"
                     /db_xref="GeneID:2886331"
     CDS             324013..324342
                     /locus_tag="CAGL0A03168g"
                     /note="highly similar to uniprot|P02400 Saccharomyces
                     cerevisiae YDR382w RPLA4"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_444905.1"
                     /db_xref="GeneID:2886331"
                     /db_xref="GOA:Q6FYB0"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q6FYB0"
                     /translation="MKYLAAYLLLTQGGNESPAAADIKKVIESVGIEADEARINELLS
                     ALEGKSLDELIAEGQQKFASVPVGGAAAGGASAAAGGAAAGEAAEEKEEEAAEESDDD
                     MGFGLFD"
     gene            complement(<324581..>325306)
                     /locus_tag="CAGL0A03190g"
                     /db_xref="GeneID:2886350"
     mRNA            complement(<324581..>325306)
                     /locus_tag="CAGL0A03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444906.1"
                     /db_xref="GeneID:2886350"
     CDS             complement(324581..325306)
                     /locus_tag="CAGL0A03190g"
                     /inference="similar to AA sequence:UniProtKB:Q12493"
                     /note="similar to uniprot|Q12493 Saccharomyces cerevisiae
                     YDR383c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444906.1"
                     /db_xref="GeneID:2886350"
                     /db_xref="GOA:Q6FYA9"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA9"
                     /translation="MDISVPESQVYADITGFIEQQQRELTNINEYLDDSDAVPVEVQE
                     LVELGYRNKLRSKTRTTSTDLLVKNVYELENEWKLRTMTEMMDIIGDIPKHSIGSELR
                     ESIEDPAGHSHNAAIDDLIEDILKLPQLQLADTAHEDDDNAQLLREYRNLKNDVIDKC
                     NEIVASRQELRDMDINLEPVRSLLKAIPHSSEGDIRQYFIDYQGQLESVVKELSLVVE
                     EAYKQSENDPIMRGKLADIINNM"
     gene            complement(<325788..>326594)
                     /locus_tag="CAGL0A03212g"
                     /db_xref="GeneID:2886332"
     mRNA            complement(<325788..>326594)
                     /locus_tag="CAGL0A03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444907.1"
                     /db_xref="GeneID:2886332"
     CDS             complement(325788..326594)
                     /locus_tag="CAGL0A03212g"
                     /inference="similar to AA sequence:UniProtKB:Q12359"
                     /note="similar to uniprot|Q12359 Saccharomyces cerevisiae
                     YDR384c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444907.1"
                     /db_xref="GeneID:2886332"
                     /db_xref="GOA:Q6FYA8"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA8"
                     /translation="MSSSSSQIDIEKAPVTMEKAVSLPGVTVSESRSQPIQEIYADSE
                     FVTLGGYTYRRTQLLTALGIDEHREQHTPVVKKLANPVPLGLASFSICCLVLSLINAN
                     VRGVTSNQFVISMYMLFGGAIELFAGLLCFVIGDTFSMTVFSSFGGFWLSYGLDFVPS
                     MAAISEYDKDPNMLNNVIGFYLAAWCVFTFLMLMCCLKSAWGLFLLLFFLDFTFLMLC
                     IGNFINDNNCKMAGGYFGILASVCGFYMLYCCVSSKENSYVPLRAIMMPN"
     gene            <328577..>331105
                     /locus_tag="CAGL0A03234g"
                     /db_xref="GeneID:2886326"
     mRNA            <328577..>331105
                     /locus_tag="CAGL0A03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444908.1"
                     /db_xref="GeneID:2886326"
     CDS             328577..331105
                     /locus_tag="CAGL0A03234g"
                     /note="highly similar to uniprot|P32324 Saccharomyces
                     cerevisiae YDR385w EFT2 and highly similar to
                     uniprot|P32324 Saccharomyces cerevisiae YOR133w EFT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444908.1"
                     /db_xref="GeneID:2886326"
                     /db_xref="GOA:Q6FYA7"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLYSDLPEEDVKEIPQKSDGNSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVCINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYSDEVLGDVQVYPSKGTVAFGSGLHGW
                     AFTIRQFATRYAKKFGVDKQKMMERLWGDSFFNPKTKKWTNKETDTDGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPTLLEKLEINLKSDEKDLEGKALLKVVMRKFLPAADAL
                     LEMIVMHLPSPVTAQNYRAEQLYEGPADDANCIAIKKCDPTADLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVKSGQKIRIQGPNYVPGKKDDLFLKAVQRVVLMMGSRVEPIDDCPA
                     GNIVGLVGIDQFLLKTGTLTTSETAYNMKVMKFSVSPVVQVAVDVKNANDLPKLVEGL
                     KRLSKSDPCVLTQMSESGEHIVAGTGELHLEICLQDLENEHAGIPLKISPPVVAYRET
                     VEAESSQVALSKSPNKHNRIYLKAEPMDEEVSLAIEQGKINPRDDFKARARVMADEYG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVSAFQWATKEGPILGETMR
                     SVRVNILDVTLHADAIHRGAGQIMPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWATLNSDPLDPTSKAGEIVTAARKRHGMKEEVPGWQEYYDKL"
     gene            <331579..>333465
                     /locus_tag="CAGL0A03256g"
                     /db_xref="GeneID:2886325"
     mRNA            <331579..>333465
                     /locus_tag="CAGL0A03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444909.1"
                     /db_xref="GeneID:2886325"
     CDS             331579..333465
                     /locus_tag="CAGL0A03256g"
                     /inference="similar to AA sequence:UniProtKB:Q04149"
                     /note="similar to uniprot|Q04149 Saccharomyces cerevisiae
                     YDR386w MUS81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444909.1"
                     /db_xref="GeneID:2886325"
                     /db_xref="GOA:Q6FYA6"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /translation="MLPDNLKDLYVQWLQELIDSLSEKQEQLINTYSKAKKNLIDHDG
                     VFYYPKDLLKVKGIGATIAKRLEARLVKHCEEIGVDVPRKQLPIDNGTQGSKSLKRVR
                     TQLRIDGINTNDTDINKPVRKKRKYIPKKRSGAYAILLALLELGAQNKGVIKPDIIEA
                     AQKYTDHSMTPNYTTKEFYSAWSSIAQLKKHELVLIEGRPQQYTLTEEGLQLADTLRL
                     ADGIDIDGKSIASSMDTNNAYYSDEHTADFSALKHDLSGLTCAPIKDGTNSSGNYSIL
                     EKTFGSQDFNVRHHEIGMVQRSHTFGNGDSNNSIEPLPRDTSEFTTQPSLIQRRRFES
                     VSYELWQPGTYEIYPVIDHREVRSHSDREFFFNAFKARDMKSEIRQLSLGDIIWVAKN
                     KTTGQQCILNTIIERKRLDDLAMSIRDNRFMEQKNRLEKSGCKHKYYLIEETIGSSIG
                     NMADALKTTLWIILVYYRFSMIRTVNAEDSVDKLHALHTVICESYKHKALVVLYPTDL
                     KSQDHYRGILSIFQNEFERSGNLECCHTFDTFQDIMGKRELKTIKEITIHILMLVRGV
                     SLEKAVFIQRHFPTLNHLLNAYRKCNSQMEAKLMMFQKFGNAPGAKKITKQLSEKLAE
                     TFAF"
     gene            complement(<333822..>335069)
                     /locus_tag="CAGL0A03278g"
                     /db_xref="GeneID:2886486"
     mRNA            complement(join(<333822..334389,335068..>335069))
                     /locus_tag="CAGL0A03278g"
                     /product="60S ribosomal protein L19"
                     /transcript_id="XM_444910.1"
                     /db_xref="GeneID:2886486"
     CDS             complement(join(333822..334389,335068..335069))
                     /locus_tag="CAGL0A03278g"
                     /note="highly similar to uniprot|P05735 Saccharomyces
                     cerevisiae YBR084ca RPL19B or uniprot|P05735 Saccharomyces
                     cerevisiae YBL027w RPL19A"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_444910.1"
                     /db_xref="GeneID:2886486"
                     /db_xref="GOA:Q6FYA5"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA5"
                     /translation="MANLRTQKRLAASVIGAGKRKVWLDPNETSEIAQANSRNAIRKL
                     VKNGTIVKKAVTVHSRSRTREHALSKRNGRHTGYGKRKGTKEARLPSQVVWIRRLRVL
                     RRLLAKYRDAGKIDKHLYHVLYKEAKGNAFKHKRALVEHIIQAKADAQREKALSEQAE
                     ARRMKNRAARERRAQRVAEKREALLKESA"
     gene            complement(<336117..>337583)
                     /locus_tag="CAGL0A03300g"
                     /db_xref="GeneID:2886323"
     mRNA            complement(<336117..>337583)
                     /locus_tag="CAGL0A03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444911.1"
                     /db_xref="GeneID:2886323"
     CDS             complement(336117..337583)
                     /locus_tag="CAGL0A03300g"
                     /inference="similar to AA sequence:UniProtKB:P41833"
                     /note="similar to uniprot|P41833 Saccharomyces cerevisiae
                     YGL192w IME4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444911.1"
                     /db_xref="GeneID:2886323"
                     /db_xref="GOA:Q6FY82"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FY82"
                     /translation="MHCDTVEVVKFLMDNHIEIMSPPISGELSQVFVIYKATNVKIEA
                     FKRIINAIHEISHGIELKIGDLNEEPIITYIDCAILHEFHCILKNRKRQHPKGDELKL
                     NGLKQEEKFRRLIEDKSSDFQKRIEAILTTRTQATQLGIERAKQLEPVEPVIPRCNSL
                     EHRELLSKCTMISNNKIISLKWPIFINQKQEFIQCVQNKIHFVPNMKPKTDPNLGDCS
                     YLDTCHKMHCCRYVHYLQFTPQILETKYNSWLADENIARSKNSWISLYTRGECCSNLS
                     RNVAPPQWIQCDVRKFDLSLLGKFSAVIADPAWNIHMHLPYGTCNDTELLNLPLNILQ
                     DEGILLLWVTGRAIELGKESLKKWGYKVINEISWVKTNQLGRTIVTGRTGHWLNHSKE
                     HLLLGLKGDPEWLNRNIDLDIIVSPTRETSRKPDEVYGIVERLVGSKSRKLEIFGRVH
                     NLRPGWITIGNQLEGTHVIDPEIKNRLLIQELANKKST"
     gene            <338516..>339868
                     /locus_tag="CAGL0A03322g"
                     /db_xref="GeneID:2886391"
     mRNA            <338516..>339868
                     /locus_tag="CAGL0A03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444912.1"
                     /db_xref="GeneID:2886391"
     CDS             338516..339868
                     /locus_tag="CAGL0A03322g"
                     /note="highly similar to uniprot|P53096 Saccharomyces
                     cerevisiae YGL194c HOS2 or uniprot|P32561 Saccharomyces
                     cerevisiae YNL330c RPD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444912.1"
                     /db_xref="GeneID:2886391"
                     /db_xref="GOA:Q6FY81"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR003084"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6FY81"
                     /translation="MSGTFSVDSKTKEFQPLYEFGSNYAPRVSYHINPEVSHYHYGVR
                     HPMKPFRLMLTDHLVSGYGLHKIMDLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLS
                     KLPRGTLEKFNIGDDCPIFPNIFQYSSLYTGASLDASRKLINNQSDIAINWSGGLHHA
                     KKNSPSGFCYINDIVLAILNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVYTISFHK
                     YNGEFFPGTGKNDETGCADGKHFAMNVPLEDGIDDDSYINLFKSIIDPLITTFKPTVI
                     LQQCGADSLGHDRLGCFNLNIKAHGECVKFVRSFGIPMLVVGGGGYTPRNVSRLWTYE
                     TGILNNVLLPEELPDNLPFKESFGPDYSLYPVLDNLYENRNSKKFLEDIRIRCLENIR
                     FLQGAPSVRMDAENIPTQDISGLTEEEEELIKEMNEEDEDWRLQEIEKENAKMMELIY
                     "
     gene            <340501..>342378
                     /locus_tag="CAGL0A03344g"
                     /db_xref="GeneID:2886377"
     mRNA            <340501..>342378
                     /locus_tag="CAGL0A03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444913.1"
                     /db_xref="GeneID:2886377"
     CDS             340501..342378
                     /locus_tag="CAGL0A03344g"
                     /note="some similarities with uniprot|P53983 Saccharomyces
                     cerevisiae YNL008c or uniprot|P54074 Saccharomyces
                     cerevisiae YMR119w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444913.1"
                     /db_xref="GeneID:2886377"
                     /db_xref="GOA:Q6FY80"
                     /db_xref="UniProtKB/TrEMBL:Q6FY80"
                     /translation="MAIFSGVTVDLSVIFTNVYIMAYLVSRIISNILIRICSMRTRMT
                     PIKLPVWSRIMFHGISAVYAVMLLVRIEHLLGNIDIGMNVTLEDLCVQVYLCVLMFGC
                     VEEFTATTTNRKVIKATFSSPILLAADMVQAINGTTSLKLDLLRVTLRYCVVENLLVQ
                     LIELIDKRNLRFLSSLLVEFFRTFTILKIMIREENGYEFGSTFAYGQFLNFFWPATLF
                     ILTYIPYQVAKLVRWDPFENNSKIKTQRNASKLQYYMFFEGLKSTLNFTGSESVEELL
                     VTYLNRLCNIFFFDKQSVQNEMEELQLPNKISHSYVISGYLNPIKGAPEDVIKGDVTD
                     NDGKAPVSGVEKAFSILPFYSPLLFANVKTIKSVISWIFMKVRSFYKTTEDIESTEEK
                     RKNDLNKVDFNSYITEKNYYKFLTKPITNAIPQPNKNVENILPLLLPEEDNSEDYVPD
                     NDELDDDDYDENITDDNEHDDSNEDKEKSNSSRISNNDLQKELVSLITPLPEEVETLD
                     GMTWNTSVWTRYKYRDSLNQCLTRNKYSELNPDGVLTEAFIERVSHNANKIHTHEDLE
                     GELDLSCVICKVNTRKIVLWPCRCLAICDECRVSLGTRGFKKCACCNTNIEAYSKLNI
                     V"
     gene            complement(<343987..>345759)
                     /locus_tag="CAGL0A03366g"
                     /db_xref="GeneID:2886330"
     mRNA            complement(<343987..>345759)
                     /locus_tag="CAGL0A03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444914.1"
                     /db_xref="GeneID:2886330"
     CDS             complement(343987..345759)
                     /locus_tag="CAGL0A03366g"
                     /note="highly similar to uniprot|P38009 Saccharomyces
                     cerevisiae YMR120c ADE17 or uniprot|P54113 Saccharomyces
                     cerevisiae YLR028c ADE16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444914.1"
                     /db_xref="GeneID:2886330"
                     /db_xref="GOA:Q6FY79"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="UniProtKB/TrEMBL:Q6FY79"
                     /translation="MYKKTAILSVYDKTGLLDLAKGLIENDVRILASGGTANMVREAG
                     FPVDDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEKDLKDQHIDKVDFVVCNL
                     YPFKETVAKVGVTVPEAVEEIDIGGVTLLRAAAKNHSRVTILSDPNDYAIFLHELKEH
                     GEVSQELRNRLALKAFEHTADYDAAISDFFRKQYSENRAQLPLRYGANPHQRPAQAFV
                     TQLEELPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVGIP
                     LSDVEKQIYFVSDIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTATIISKEV
                     SDGVIAPGFEPEALEILKKKKNGKYCILQIDPNYIPDAMESRDVYGITLQQKRNDAII
                     NQSSFKEIVSANKNLTEQAVIDLTVASLALKYTQSNSVCYAKNGMVIGLGAGQQSRIH
                     CTRLAGDKADNWWLRQHPKVLAFKWAKGVKRPDKSNAIDLYVTGQIPEEDPEKSEYES
                     KFAEIPTPLTPEERKEWLSKLNNVSLSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVQD
                     KAVFAAADSFDLVYVENPIRLFHH"
     gene            complement(<346748..>347362)
                     /locus_tag="CAGL0A03388g"
                     /db_xref="GeneID:2886328"
     mRNA            complement(<346748..>347362)
                     /locus_tag="CAGL0A03388g"
                     /product="60S ribosomal protein L15"
                     /transcript_id="XM_444915.1"
                     /db_xref="GeneID:2886328"
     CDS             complement(346748..347362)
                     /locus_tag="CAGL0A03388g"
                     /note="highly similar to uniprot|P54780 Saccharomyces
                     cerevisiae YMR121c RPL13B or uniprot|P05748 Saccharomyces
                     cerevisiae YLR029c RPL13A"
                     /codon_start=1
                     /product="60S ribosomal protein L15"
                     /protein_id="XP_444915.1"
                     /db_xref="GeneID:2886328"
                     /db_xref="GOA:Q6FY78"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:Q6FY78"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRASRPSR
                     PDKARRMGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATA
                     EERVGRRASNLRVLNSYWVNQDSTYKYFEVILVDPSHKAIRRDARYNWICNPVHKHRE
                     ARGLTATGKKSRGINKGHRYTNTKAGRRKTWKRHNTLSLWRYRK"
     gene            <348708..>349451
                     /locus_tag="CAGL0A03410g"
                     /db_xref="GeneID:2886333"
     mRNA            <348708..>349451
                     /locus_tag="CAGL0A03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444916.1"
                     /db_xref="GeneID:2886333"
     CDS             348708..349451
                     /locus_tag="CAGL0A03410g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444916.1"
                     /db_xref="GeneID:2886333"
                     /db_xref="GOA:Q6FY77"
                     /db_xref="UniProtKB/TrEMBL:Q6FY77"
                     /translation="MTTESFKFQKVSVKKICLPEPLQWEPDTAIVEEQKSYLRTPRTA
                     NDDDQSILASILSKWSQMIRKSIRNYKQRKRNRLKFCHNLNGKYLGLNNTKLSTNFIL
                     PDIPVTMSTNEREWLPQIEPIMVRDMVIEFPTIESITYSEADITTLSNDVPQIIDFYL
                     DNDIDDIESLKHRKNMISIKKRLVEQKITDLTNLLQRKTPEHCYRQRTSRDKVISMMN
                     DLQRLNFEVETKKRTIELLKSQNLRMPKY"
     gene            <349884..>353339
                     /locus_tag="CAGL0A03432g"
                     /db_xref="GeneID:2886385"
     mRNA            <349884..>353339
                     /locus_tag="CAGL0A03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444917.1"
                     /db_xref="GeneID:2886385"
     CDS             349884..353339
                     /locus_tag="CAGL0A03432g"
                     /inference="similar to AA sequence:UniProtKB:P32849"
                     /note="similar to uniprot|P32849 Saccharomyces cerevisiae
                     YLR032w RAD5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444917.1"
                     /db_xref="GeneID:2886385"
                     /db_xref="GOA:Q6FY76"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /translation="MDQNANQKKRFFKDELESSIETTLTDKSSFLFEPQVDAIQEENA
                     NDPEEQIAQGTQESPFIEQLRAVLPTIRLEVALALEEKYRDIDDGLDLAISEYFDQYQ
                     TGNDDAPPSSLELQHSQEVLTVPDNEEKDTDLQLVSVKRKREDDFMQSSQSKKPQRAN
                     SSWKKFVGSLQVTVMVTRPTMRPVPYGTPLIFKRSNNNVPLKKIYEQLNKKKTGLAAF
                     VKIYSANDEREIGRVPEDIARIVFPLLHRNEVHFKLTMIYPGDKRLSIGDNIIIQMDS
                     FLTSTLFNRKENPTFSTQNGNGRERFGAIVETEQELEERNIRMGLIMLFDKIKLRPVK
                     DEAKFLEKLKQDGDDNEIVDLEDDESFGNFLSQEPLNDELPTQHQEDTMNINQLTSFY
                     KATQSSKQLNSLIPTTPPPELVKVELRKYQKQGLTWMLRREGISIGHDNEDKSEDDTT
                     LLNPLWRQFQWPRNMSWHNQSTGSENDNSNPKLIFFYGNLHTGEFSLERPTMNSFKNG
                     GILSDEMGLGKTISALSLVLMRPKDEHTTSQSLFHQESSNLSSDDVIEIKEPERSYAY
                     KTTLIIVPMSLLTQWRDEFDKVNNNAGLTCELYYGGNVSSLKSLLIKRKNPPTVVLTT
                     YGIVQNEWTKLSKDGTNIRSLGRTSGIFSIEFFRIILDEGHTIRNKSTITSKAVLELS
                     SKYRWILTGTPIINRLDDLYSLVKFLKLEPWSQIGYWKQFITNPFEERNFKQAFDVVN
                     AIMEPVLLRRTKQMKDTDGNPLVQLPPKEIVIEKLQLSKKQKLIYEEFLQRAEKTFRS
                     GLQSGDLLKKYSTILVHILRLRQVCCDSNLIGTLDENDEDLSSGNNKLITESVDVKTL
                     IPDTEEEEDEVPPFENDELDKLIESVEAKFIDSNQLIPVECSICTAEPIESSSAVVTE
                     CEHVFCKECLEEYGNFQKEKSLQQKCPNCRRDINLNRCLAFEKGSDGILKLIHFDRKE
                     RPAKLNALIRHLQQLQDSSAGEQVVVFSQFSSYLDILESQLNEVYSSNKLKVYKFDGR
                     LSLKERTAVLEDFKVKDYAVQKVLLLSLKAGGVGLNLTCASYAFMMDPWWSPSMEDQA
                     IDRIHRIGQTNSVKVIRFVIDGSIEEKMLRIQDRKRTLGEAMDTDEDERRKRRIEEIQ
                     MLFES"
     gene            <353884..>355344
                     /locus_tag="CAGL0A03454g"
                     /db_xref="GeneID:2886275"
     mRNA            <353884..>355344
                     /locus_tag="CAGL0A03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444918.1"
                     /db_xref="GeneID:2886275"
     CDS             353884..355344
                     /locus_tag="CAGL0A03454g"
                     /inference="similar to AA sequence:UniProtKB:Q07979"
                     /note="similar to uniprot|Q07979 Saccharomyces cerevisiae
                     YLR033w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444918.1"
                     /db_xref="GeneID:2886275"
                     /db_xref="UniProtKB/TrEMBL:Q6FY75"
                     /translation="MSQTAEKGIADLINNLFRIFRVAGAKCRVLDEPFPSKFHESDPL
                     KIYESYNRFLKSKTDHDGSIKNEDKLPLTTITERNDKKEYNVSHGGLYKLYHDIKLVC
                     IMLINYFPQGSKKYQMVDKFYKFATELMLREAYKIGAQLVYETNLDDDERETDSSRTE
                     LEKAISADFIKIATNYTVPVTETYHITTKDLELFSSTIERSEIDYRPHELPNSNFEIN
                     KVIPQTSLLDEAPKLGFLAANTSGIPDPTLPPTEMMTRFLHPNWYALPTTVWLKYNGF
                     SSWAPSFNENGTVIDSTTKGTIWLNRVGYMQELIKKEKELHEDLSKEQETTKDEEKKT
                     DMLDDADLDQTKKNEKTANEAEVKTEEENLRNDSNNNIKIENLFAWTPSNQLTDSDIA
                     LLKDGKGEQLVNDTLSRIARLRKSRIAKRLREPTDDERNLYFKARLLLKEIMLSKTDQ
                     PLKLSNHTSFPIVQVNYNGTIPVVRTQPVKKKKYRR"
     gene            complement(<355620..>357035)
                     /locus_tag="CAGL0A03476g"
                     /db_xref="GeneID:2886290"
     mRNA            complement(<355620..>357035)
                     /locus_tag="CAGL0A03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444919.1"
                     /db_xref="GeneID:2886290"
     CDS             complement(355620..357035)
                     /locus_tag="CAGL0A03476g"
                     /note="highly similar to uniprot|Q12078 Saccharomyces
                     cerevisiae YLR034c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444919.1"
                     /db_xref="GeneID:2886290"
                     /db_xref="GOA:Q6FY74"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:Q6FY74"
                     /translation="MLPRTIDILKKFATFVGPGIMVSVAYMDPGNYSTSVSGGAQYKY
                     KLLFSIFVSNIFAVLLQCLCVKLGTVTGYDLAENCRRNLPKKVNYVLYFFAEIAIIAT
                     DLAEVVGTAIALQILFNIPLTLGVILTVLDVLLILMFYRPDGQSMKKVRMFELFVGVL
                     VICTVLCFVLELFKINIPNKRELFEGFMPTSIIFKEKQALYISLGILGATVMPHSLYL
                     GSSLVKPRLYDYDIKKYGKVGSSPSLSAIKYSLNYSYAELIISLFLIATFVNSAILIV
                     AGATLAGQPEAEDADLLSIYNLLVHYISPAAGLIFAAAMLFSGQSAGIICTLAGQIVS
                     EGFLEWSLPPWATRLCTRLIAIIPCLFVTLTLGERGISNILNFSQVVLSLILPIVSAP
                     LIYFTANRSIMTVEDHHLHVADINDVDESTPLNSSAQRKKKDFTNSKLLTGAAVFVWA
                     LIGGLNCYLVGSWLNGADVHF"
     gene            complement(<357639..>359678)
                     /locus_tag="CAGL0A03498g"
                     /db_xref="GeneID:2886321"
     mRNA            complement(<357639..>359678)
                     /locus_tag="CAGL0A03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444920.1"
                     /db_xref="GeneID:2886321"
     CDS             complement(357639..359678)
                     /locus_tag="CAGL0A03498g"
                     /inference="similar to AA sequence:UniProtKB:Q07980"
                     /note="similar to uniprot|Q07980 Saccharomyces cerevisiae
                     YLR035c MLH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444920.1"
                     /db_xref="GeneID:2886321"
                     /db_xref="GOA:Q6FY73"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FY73"
                     /translation="MPIKGIIADEKWKIFASSFIVEPKAAVRELIDNSIDSGCQNIYV
                     SIDSKTGGCEYISVRDDGPGVPQPDRKLMCLNNTTSKINSLDDLDKISTLGFRGEALF
                     LIANLCCEVGTLEIITKCKDESVGEKWYIQKNGSIKPKSVRKAPATTGTVVTLRKLLG
                     GFKSREIDQSSKARKTIEDLKTILYHYALNFRNIRFSFELVSLNKNGSIAQKQLQLSV
                     APNLTRPRLLSLIANLRKPTNINFVENASLEITDKIDIQLILPTMIPQSDAVNVKKSY
                     KFLSVNNRALSRKLAFGKEFDRMLSSIYRRLQLLEPNVWYVNIISEPQLIDVNIEPEK
                     DDILLKDETKVIQKMDNIIELYLREKLNINPTVSITNSPSFKQFAANTSVMLEHNESC
                     DEPVDQSTMPILTPTSKNITEAIIESENGNNSEPRITYEADSTNMGFKSISEVNRTGI
                     SNSQIHNLPNDSSNSHFDNTTKLSHGINQDNLNSSDQVNTQQNTFRNSMTHVGHEYDA
                     RRENTKPKPYNSELASNVKDTVVQVKEEPHEPISSNLATIDKDKENTFEYPYNTHKSG
                     LSDLGASNVHDISNQTIRPQDMHVKRPHTSMNIAPVHKRVKTNEAKRKLRMFSEYTTR
                     LTTNAIYKPNPQPTMSDFDQAPFKDRVLQYIKSKQFEEVDLEETSQGWQKLVKGK"
     gene            complement(360141..360213)
                     /gene="tRNA-Ala (TGC)"
                     /locus_tag="CAGL0A03520r"
                     /db_xref="GeneID:2886351"
     tRNA            complement(360141..360213)
                     /gene="tRNA-Ala (TGC)"
                     /locus_tag="CAGL0A03520r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2886351"
     gene            complement(<360779..>361030)
                     /locus_tag="CAGL0A03542g"
                     /db_xref="GeneID:2886329"
     mRNA            complement(<360779..>361030)
                     /locus_tag="CAGL0A03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444921.1"
                     /db_xref="GeneID:2886329"
     CDS             complement(360779..361030)
                     /locus_tag="CAGL0A03542g"
                     /note="highly similar to uniprot|Q01519 Saccharomyces
                     cerevisiae YLR038c COX12 cytochrome-c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444921.1"
                     /db_xref="GeneID:2886329"
                     /db_xref="GOA:Q6FY72"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:Q6FY72"
                     /translation="MSDSPLHTVGFDPRFPNQNQTRHCWQAYVDYHKCINLKGEDFAP
                     CKVFWKTYSSLCPVEWVEKWDDQREKGIFAGDISPEESK"
     gene            complement(<361832..>364813)
                     /locus_tag="CAGL0A03564g"
                     /db_xref="GeneID:2886282"
     mRNA            complement(<361832..>364813)
                     /locus_tag="CAGL0A03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444922.1"
                     /db_xref="GeneID:2886282"
     CDS             complement(361832..364813)
                     /locus_tag="CAGL0A03564g"
                     /inference="similar to AA sequence:UniProtKB:P40395"
                     /note="similar to uniprot|P40395 Saccharomyces cerevisiae
                     YLR039c RIC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444922.1"
                     /db_xref="GeneID:2886282"
                     /db_xref="InterPro:IPR009771"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FY71"
                     /translation="MQLWPVSPPNHFCIPPRCSERDKIDDDLDILATIPLTHSNVVII
                     ITKTRVLVYNFKPFALVAAHERTSESLAEFGDNKGLVPSIAFRDKVSGVTDSKPPTYM
                     SWYQGKLVFYTTTTKNYVLAYQVLRNSTSESIFKDYGLPIIEVSQINEFESAAYDANL
                     DDDVLTVFDKVKSSKVIQNGYVLNKDRGILQFLSAKSEDPNEIPIKKLELRLKVVFKF
                     EYDIIDFIGFKRFSDEDDGKFEENLLVLFADKIQLLKLQDFKFNSSQVVEIANSKKIC
                     ICDNKLYVISQDKETKKLIIHLIDLNEQKVLEKTEHDCNSELVNAFSIGSRMLVSTKD
                     SVNFFCTEKNQFTYHRKFDFSIKLAEKLTDECFVIITENDRLEICSKFGNKLFSTISE
                     DDSSSNKIHNDTLNYTALVYIDKTLITTCESGYYQIWNFWQEFPQSTFDFRVPKVSAI
                     ANNNNDIKFYSSSGDSPLNRIQLQSLKLPTKSLNNNISHIKLNSNLKLVAINISNKNS
                     LLIQNLETSLWYQFTDVHIIDMHWIANNYLVCHLKEYNSDTVSVKCYNLPLKGLENYE
                     LEDLEIWAYEIPENVDILKFWVNTHHKYKYLKMKNQKLDSSELSSSDRFFKTAEIILS
                     TSSSIVVFDVISKVQLTGLNTIVNIHQYSSLEIANSLPTRTLEWVSTWKDGFIIYASD
                     MLFRLEKLSDGTIHTTQLLDNVEKIVDVVKHHIYMVQEDKFTIYDINGLWEDRKPILS
                     IKLDEEHYPICISSDAAIVQSLYCVFNKNLSKLIMKNSSYLDKLISVKIDRGDDLYDI
                     SRQFSNLKHYKFALEKNLSIKLMEGESITKTLELIKLLNDKPTGHGKISRYSDMLEII
                     SNCLRKSEMKNWKTLFDDLSMSPRELLALCIDNRESKMLGVLLLVFLNYGETEVLGDI
                     QEEKPVELHNPTMDDVLKDEELMFKVLKHLVESSASSSNAIKASEEWELCLQLVRLLK
                     ALDKENNTNLMEKATQIILKS"
     gene            complement(<365127..>365696)
                     /locus_tag="CAGL0A03586g"
                     /db_xref="GeneID:2886285"
     mRNA            complement(<365127..>365696)
                     /locus_tag="CAGL0A03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444923.1"
                     /db_xref="GeneID:2886285"
     CDS             complement(365127..365696)
                     /locus_tag="CAGL0A03586g"
                     /inference="similar to AA sequence:UniProtKB:Q07988"
                     /note="similar to uniprot|Q07988 Saccharomyces cerevisiae
                     YLR040c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444923.1"
                     /db_xref="GeneID:2886285"
                     /db_xref="GOA:Q6FY70"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FY70"
                     /translation="MRYALFANVVTLTIGVFAVVEDAKSMAADADMSFFLAFLDDFNE
                     RYTEYTSYMIREHHTLPQEVANYYYHLNGVDEYDLKSDIINQFPFTIFKSFITVFPWY
                     SSLLSEGGITDMVLPGDFLSTPTLDLYTSTTDAPTVSLLTSVVSSVTLSNKDITKAAK
                     AAASTYLVSNYMWILLLCMVFDLIGFLTL"
     gene            complement(<366290..>366934)
                     /locus_tag="CAGL0A03608g"
                     /db_xref="GeneID:2886349"
     mRNA            complement(<366290..>366934)
                     /locus_tag="CAGL0A03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444924.1"
                     /db_xref="GeneID:2886349"
     CDS             complement(366290..366934)
                     /locus_tag="CAGL0A03608g"
                     /note="some similarities with to uniprot|Q07990
                     Saccharomyces cerevisiae YLR042c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444924.1"
                     /db_xref="GeneID:2886349"
                     /db_xref="GOA:Q6FY69"
                     /db_xref="UniProtKB/TrEMBL:Q6FY69"
                     /translation="MFICIFQILLFITGTLARSGNVPYRPNNVNNGLLALNNNNNNND
                     GSDVATAGSAAVSGSVLFLPSSLISSYTADTESQYNTGDESSDLSQFLNGGGLQTALQ
                     KTTTGTDDLFGSAATSVVLEEAYSSDRQKELETTLSTTSVVPSSSTSITTSQSSVTSA
                     SSSSTSSMPNDPEYSKQISAVSKSLARGSTYKGAGSALAPGISILLSALVSLLT"
     gene            complement(<369404..>372592)
                     /locus_tag="CAGL0A03630g"
                     /db_xref="GeneID:2886488"
     mRNA            complement(<369404..>372592)
                     /locus_tag="CAGL0A03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444925.1"
                     /db_xref="GeneID:2886488"
     CDS             complement(369404..372592)
                     /locus_tag="CAGL0A03630g"
                     /inference="similar to AA sequence:UniProtKB:P33339"
                     /note="similar to uniprot|P33339 Saccharomyces cerevisiae
                     YGR047c TFC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444925.1"
                     /db_xref="GeneID:2886488"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FY68"
                     /translation="MIRSESDPEDSVSNGDMHEEVDMSPDEEGQFYENIEGLRNIIDY
                     DHDRDGAYRINDGEVYDGSKEGDDSLLAIFTDVEDFEEDEEDEEDNFMDAIREANNFK
                     VKRKKNNKSNNKKSSKKRPMARVKAINDPEVAQLISQANEAFVKQDLPEAERLFNEVI
                     KKDPRNFAAYETLGDIYQLQGRMNDCCNSWFLAAHLNASDWEFWKIVAILSSDLGHIR
                     QAIYCFSRVIHLNKEEWECIYRRALLYKQTGQIARALDGFQKMYTKSPSDANILRELA
                     ILYVDYNKVEKAIELYLESFEKNIKRRQAIIRASEAVFESSDDDDDDDPNSKNSDEDQ
                     GDEDDYDIQNPEELNMYPTVDFKKINKKYNCVFFEWSSLNILAELCLKSNQKKLDSIS
                     LIKRCARWIQHREGQTFWDDVHDDSEFDDRRAKNGRYDALPESEKTKSYSMPIDIRIR
                     LGLLHLRNENVMEALNHFQFLYDEPFSDVSDLYFEVGLALTKSEKYKEAIDFFTPLLS
                     IPEWCTIELYEPLTKCYKEIEDYEKAKEYGDKVLEMDPKSMDAKLNVAEINYYLGDKT
                     TFRQLLVDVIEERKRQAESIYDQGPTKKPRIEEFVSETEPEPEPEHESEHEQRVDKDT
                     SEKPLLEDSKYRVFNTKKKRTPLDAERERLDREKKMRSKVIKKYEKVHEYKEGMLMGS
                     DQDTKKWIDIVSELIDIFSSVKNFFAKSRSKKFVGIIKRTKKFTTPIDYKVEQLSKLV
                     EGESFVNDLPVLEERVILSSTTELRGLTYDQWFELFMELSLVITKHQSVEDGLSVIDT
                     AQEVNVFFQDPIRAKIMRFVKLGILLENKDESELTESLRGLLNQFQFNRKVLQVFMYS
                     LAHGQDALNILSSTVQQKFFLRQLKAFDSIRYDTHVTGQASLTNKEVENPERRPSPYL
                     YYIYAVLLYSSRGFLSALQYLSFLEKDMPDDPMVNLMMGLAHMHRSMQRLTANRHFQL
                     MHGLRYLKKYYSIRQSMYTRIERQEADYNMGRAYHMIGLVSKAIEYYKKVLDSYEDGA
                     LKKHAAYNSMLIYQESGNLELANSIMEKYLSV"
     gene            complement(<373100..>375301)
                     /locus_tag="CAGL0A03652g"
                     /db_xref="GeneID:2886320"
     mRNA            complement(<373100..>375301)
                     /locus_tag="CAGL0A03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444926.1"
                     /db_xref="GeneID:2886320"
     CDS             complement(373100..375301)
                     /locus_tag="CAGL0A03652g"
                     /inference="similar to AA sequence:UniProtKB:P38112"
                     /note="similar to uniprot|P38112 Saccharomyces cerevisiae
                     YBR142w MAK5 ATP-dependent RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444926.1"
                     /db_xref="GeneID:2886320"
                     /db_xref="GOA:Q6FY67"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGKRVVATDKELKWKKVDIPDTLDDFGGFYGLEEIDGVDVKVVN
                     GQVQFIASEAQVKEEEESSESDFPDFDAMEQEDDGDVEEAEEEEEEEEDVAEADEPEV
                     KQKQEQARVEQIDKGVDSEKHEDEKETPEDDLATNVFDIDVDLSDVGSGELPGWTDTV
                     DLSMTTINGLSNLGFTEMTPIQKLSIPAALEGKDIMGKASTGSGKTLAYGIPIIEKMI
                     KSKDNLRTNGIIFTPTRELAQQVTKHLQNVCSMLLKKNPYMILSLTGGLSIQKQERLL
                     KYDGSARIVVATPGRFLELIEKNEELMKRFAKIDVLVLDEADRLLQDGHFDEFEKILK
                     HLGRIRKSLKNMEYWQTLIYSATFSTDLFDKLANSSWKKKNNSKDESEMESVLKHLMT
                     KINFKSKPMMIDANPEDKISAQIKESLIECAPLERDLYCYYFVTLYPGTTLIFCNSIE
                     SVKKLNAYLINLGINSFQIHSSMTQKNRLKNLEKFEAMASKNNHLGKPTVLIASDVAA
                     RGLDIKGIKHVVHYHLPHSADTYIHRSGRTARGDNEGVAVMICSPQEAMGPLRKLRRL
                     LASKEQISKSTKNKKWQQTVPLLPIEIDILQQLRERSSLANDIAEHELASRSLRKDSN
                     WLKQAADELGIDMDSDEEDKDIILAKNKNKKMNKTLDKNELKSMKAELTHLLKIPIRK
                     DMRRSYLTGGLVNLADSLVKKRGHHNIIGHEKTDALNVLKKGKSNKKQKTK"
     gene            <375610..>376602
                     /locus_tag="CAGL0A03674g"
                     /db_xref="GeneID:2886427"
     mRNA            <375610..>376602
                     /locus_tag="CAGL0A03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444927.1"
                     /db_xref="GeneID:2886427"
     CDS             375610..376602
                     /locus_tag="CAGL0A03674g"
                     /inference="similar to AA sequence:UniProtKB:P38278"
                     /note="similar to uniprot|P38278 Saccharomyces cerevisiae
                     YBR141c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444927.1"
                     /db_xref="GeneID:2886427"
                     /db_xref="GOA:Q6FY66"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="UniProtKB/TrEMBL:Q6FY66"
                     /translation="MLSRKRVSISGKKPLKEVRIKPSKARRIIRRFHFLTSKRALICE
                     LLELERLRDNDEEYNSRVIDAYLGGKLLRKRYEEGQAVAAQDGMMESRLLQIRSHSDK
                     PAKEELLRCLGYIQREIRDGGLKNYQMASKIGQDKDRGGDSSKLLVKWLKELNYDQHT
                     ELRALEIGSLSVSNHISRCKIFEEVERIDLNSNDPKGIKRQDFMKRPLPRTGEEKFHL
                     ISCSLVLNFVNTPAERGQMCQRFSEFLFPPTSDVPSYVFVVLPLPCVNNSRYMTIDHF
                     TMIMDSLGYELIRSHTSHKLFYCLLRLSHRESKRKFQKKEINPGPGRNNFAIVI"
     gene            <377255..>378502
                     /locus_tag="CAGL0A03696g"
                     /db_xref="GeneID:2886319"
     mRNA            <377255..>378502
                     /locus_tag="CAGL0A03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444928.1"
                     /db_xref="GeneID:2886319"
     CDS             377255..378502
                     /locus_tag="CAGL0A03696g"
                     /inference="similar to AA sequence:UniProtKB:Q04739"
                     /note="similar to uniprot|Q04739 Saccharomyces cerevisiae
                     YER027c GAL83 glucose repression protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444928.1"
                     /db_xref="GeneID:2886319"
                     /db_xref="GOA:Q6FY65"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FY65"
                     /translation="MAENRSGSNRDASMLDVSDASHQDLNNKSDSLSYSFSQMNVDSP
                     NELEPQLNTRSRSRSTLIFDDDDEIPPYSKHQEHYSGTLSDFEGENSSVASSIDSAEN
                     TSESNTVFNNATSTDNTDNTASSQSGTASQQSQSAMNQSGQFDSDSSGSRDPRASNMV
                     PVDITWQQGGNKVYVTGSFTGWRKMIGLVPMPDQPNVLHVKLQLPPGTHRFRFIVDNE
                     LRFSDFLPTATDQMGNFVNYLEIAPVAGTDEKPPPLTPQVSGKSGDERKEPMSARSRI
                     ALEIEREPDDLGNGYSRFHDTSPLETKYEYTQDIPAVFTDPNVMEQYYLTLDQQKNNH
                     QNMAWLTPPQLPPHLENVILNSYSNAQGESNENNSGALPIPNHVILNHLATSSIKHNT
                     LCVASIVRYKRKYVTQILYAPLQ"
     gene            complement(<378874..>383832)
                     /locus_tag="CAGL0A03718g"
                     /db_xref="GeneID:2886384"
     mRNA            complement(<378874..>383832)
                     /locus_tag="CAGL0A03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444929.1"
                     /db_xref="GeneID:2886384"
     CDS             complement(378874..383832)
                     /locus_tag="CAGL0A03718g"
                     /note="highly similar to uniprot|P22137 Saccharomyces
                     cerevisiae YGL206c CHC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444929.1"
                     /db_xref="GeneID:2886384"
                     /db_xref="GOA:Q6FY64"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="InterPro:IPR022365"
                     /db_xref="UniProtKB/TrEMBL:Q6FY64"
                     /translation="MSDLPIEFTELTDLTALGISPQSLDFRSTTFESDHYVTVRETVD
                     GANSVAIVDLANGNQVTRKNMGGDSAIMHPSQNVISVRANGTIVQIFNLETKSKLKSF
                     TLDEPVIFWKWLTENTLGFVTARSILTCNVFDGNVSAKPQVLTQRHQSLNNTQIINFI
                     SNEKEDWFAVIGILQENGRIAGKIQLYSKQRNISQAVDGHVAIFTKILLEGNGSAPVQ
                     VFVTGNRNVQTGNGELRIIEIDHDASLAVQYQKKTTDIFFPPDATNDFPLSVQVSEKY
                     GIIYILTKYGFIHLYELETGTNLFVNRITAESVFTSTSYNQKNGIACINKKGQVLAVE
                     IDTTQIVPYILNKLANVSLALTVATRGGLPGADDLFSKQFESLLNQGDYQNAAKVAAS
                     STSLRNQNTINRLKNLQAAPGAISPILLYFSTLLDKGKLNKEETIELARPVLQQDRKQ
                     LFEKWLKEDKLECSEELGDIVKPFDTTLALACYLRANAHAKVISCLAELQQFEKIIPY
                     CQKVSYQPNFLVLLSQLIRTSPDRASEFAISLLQNPETASQVDIEKLADLFFSQNHIQ
                     QGTSLLLDALKGDTPDQGHLQTRVLEVNLMNAPQVADAILGNNIFSHYDKPTIASLAE
                     KAGLYQRALENYTDLKDTKRCIVHTSSLPVDWLISYFGKLNVEQSLACLRALMDDNLQ
                     GNIQIVIQVATKYSDLIGSSTLIKLFEEYRATEGLYYYLASLVNLTEDKDVVYKYIEA
                     AAKMKQYKEIERIVRDNNVYDAERVKNFLKEANLEDQLPLIIVCDRHNFVHELILYLY
                     KAQNMNYIETYVTQVNPSKTPQVVGALLDMDCDEKFIQNLLQSVIGQVPINDLTEEVE
                     KRNRLKLLLPYLEQTLSQGTQEQAVYNALAKIYIDSNNAPEKFLKENDQYDTLDVGRY
                     CEKRDPYLAYIAYDKGSNDDDLIRITNENTMYKYQARYLLKRSDPELWNKVLDSENIH
                     RRQLIDSVISVGIPELKDPEPVSLTVQAFMTNGLKLELIELLEKIILEPSPFNENTAL
                     QGLLMLSAIKYEPTKVSGYIEKLENYDADEIAQLCVEHGLNEEAFEIYDKHEMNSKAL
                     KVLIEDIMSLDRGYTYADKINSSELWSQLGTAQLDGLRIPDAIDSYIKANDPSNYENV
                     IDLAEQAEKFEELIPYLLMARDTLKASKIDNALVLSYAQLNKLHEIENLLAGSNSANL
                     EEVGDKLLDSKNYKAAKLCYSSVSNYSKLASTLVYLGDYQTAVDTARKASNIKVWKLV
                     NNACIDKKEFRLAQICGLNLIIHAEELDELVEKYESNGYFEELISLFEAGLGLERAHM
                     GMFTELAILYAKYDTSKTYDHIKLFWSRINIPKVIKAAEDAHLWRELVFLYAHYDEWD
                     NAALTMIEKSADNFDHPYFKEVIVKVANLEIYYKAINFYVNEHPSLLVDLLSVLTPRL
                     DIPRTVKIFSQSDNLPLIKPFLINVLQKNNSVVNKAYHDLMIEEEDHQALQNAVDSYD
                     KFDQLELAGRLEKHDLIYFKKIAALLYRRNKKWSKALDILKEQRLWKEAIETAAISQD
                     TKVVHDLLSYFVDTGNREAFVALLYTAYNLIKYDFVLEVSWLNSLEDFIKPYEISVKK
                     EQNAAVEKLSEEFAKKNNTSDDREGQPLMLMNSSMHPQATGF"
     gene            <384820..>387066
                     /locus_tag="CAGL0A03740g"
                     /db_xref="GeneID:2886280"
     mRNA            <384820..>387066
                     /locus_tag="CAGL0A03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444930.1"
                     /db_xref="GeneID:2886280"
     CDS             384820..387066
                     /locus_tag="CAGL0A03740g"
                     /note="highly similar to uniprot|P13711 Saccharomyces
                     cerevisiae YGL205w POX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444930.1"
                     /db_xref="GeneID:2886280"
                     /db_xref="GOA:Q6FY63"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR012258"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR029320"
                     /translation="MTKLSTVDPNASVLNPQRFIQRERENCSIDIDQVNTFLESDPRS
                     RDLTHLIVDQLVNDPIIKADSATYDQTKLTQREVTVKKIARMALYMEQDIKTVRKHFR
                     DTDLLKSLQDFGDTTTPPLTNKDLAIFDKRLSLVANMDPQLSTRIGVHLGLFGNCIKG
                     NGTDEQIKYWLQTRGAILIKGIYGCFAMTELGHGSNVAQLQTTATYDQESDTFIINTP
                     DLAATKWWIGGAAHSATHTACYARLLVNGKDYGVKTFVVPLRDPSSLQLMPGIAIGDI
                     GAKMGRDGIDNGWIQFRNVVIPREFMLSRFTKVHRNPGATPTVEVDPQLDQISGYSAL
                     LSGRVNMVMDSFRFGSKFATIATRYAVGRQQFADKPGQPEKQLIDYPLHQYRVLPQIV
                     IPYIISPAAFSLLNFYYSTLDELYAASSKNDKRALVVVSQKLKNLFIDSASLKATNTW
                     LVAQLIDELRQTCGGHGYSGYNAFGKGYNDWVVQCTWEGDNNILSLTSAKSILKKFVD
                     SATKGKYNKELDKRSFRYLDPQFIRKVFTSSSENKLDDLYDYTNIWAVALLKLLRHIA
                     KQVDSTKDLDGASKLLVLVSKFHALYVMLNTYYEKLNSPTDSYVTCPKTKEQLWNVYK
                     LFSLYFIDKHAGEFQQFKILSPDQISQVVQPRLLKLLPEIRKECISLTDSFKWPDGML
                     NAPIGYYDGDIYHNYFNEVVKNNPVEKDGAGIPPYHELLANMLTRGDEFARLGGANNA
                     EILSKLTK"
     gene            complement(387505..387576)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0A03762r"
                     /db_xref="GeneID:2886334"
     tRNA            complement(387505..387576)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0A03762r"
                     /product="tRNA-His"
                     /db_xref="GeneID:2886334"
     gene            complement(<387856..>388401)
                     /locus_tag="CAGL0A03784g"
                     /db_xref="GeneID:2886277"
     mRNA            complement(<387856..>388401)
                     /locus_tag="CAGL0A03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444931.1"
                     /db_xref="GeneID:2886277"
     CDS             complement(387856..388401)
                     /locus_tag="CAGL0A03784g"
                     /note="some similarities with uniprot|Q08749 Saccharomyces
                     cerevisiae YOR297c TIM18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444931.1"
                     /db_xref="GeneID:2886277"
                     /db_xref="GOA:Q6FYA4"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA4"
                     /translation="MMRLGLMGPRNANVYLRRCISHVRFNSVVSSAKDAPRTTETHDK
                     ELSAEMKGPQMYKCEQPTQPEDSFQNDYHKYINYTLLPLTVGTFGSVIYTGEVHPMLD
                     FTISSLFLFSTHYHFTSLILDYIPKEKFKRLHKLAIYLLYSATGFGLFGIYELETSNN
                     GVVDLVRKLWSEDDSQIFFRK"
     gene            <388858..>390270
                     /locus_tag="CAGL0A03806g"
                     /db_xref="GeneID:2886279"
     mRNA            <388858..>390270
                     /locus_tag="CAGL0A03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444932.1"
                     /db_xref="GeneID:2886279"
     CDS             388858..390270
                     /locus_tag="CAGL0A03806g"
                     /inference="similar to AA sequence:UniProtKB:Q08750"
                     /note="similar to uniprot|Q08750 Saccharomyces cerevisiae
                     YOR298w MUM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444932.1"
                     /db_xref="GeneID:2886279"
                     /db_xref="GOA:Q6FYA3"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA3"
                     /translation="MGFVTFVESYVVGSSQDISTWWYTDWIVVGWKAAIIGAYLGIHT
                     LLTMTRLVLQTIILTPLFLRCYSIYRRFWWHVPFFGPILLEAGSYCLTSIPRVINPTL
                     SLICEIIEIIFQIHVTELMFGHEKESVRIVYGEDCAEVDLFDEENQLMTTLVLSNHRS
                     LVDYLLIQHLLMKGAKQHTTLRKKDVIYNYFKQRILKGMQVQFLSWGQIVKFPTLLFG
                     FNVINSDENCFVPSDDLETFLKSTNQCMVHFPETNILTTELFLVQRSINSSKTFAVKY
                     NNLLNPRFKTFVNVIDCFAKCTEIPRLPHIPIVTETKKFINKKLDDIITNSNGDVQQN
                     AVVTHIIAHSDVKSNQESKPHKTKKQHRVRINSHIYDITIVYLRVKYVTNVHDHIDGS
                     IVPRSGYQLDEIAPSLLEFLRPDSKVDRDPIITYVNIKRFDTDAILCLKDRHLEKWLE
                     DIWKQKDLEISKVIEKITVN"
     gene            <390687..>392117
                     /locus_tag="CAGL0A03828g"
                     /db_xref="GeneID:2886327"
     mRNA            <390687..>392117
                     /locus_tag="CAGL0A03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444933.1"
                     /db_xref="GeneID:2886327"
     CDS             390687..392117
                     /locus_tag="CAGL0A03828g"
                     /inference="similar to AA sequence:UniProtKB:Q08760"
                     /note="similar to uniprot|Q08760 Saccharomyces cerevisiae
                     YOR301w RAX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444933.1"
                     /db_xref="GeneID:2886327"
                     /db_xref="GOA:Q6FYA2"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA2"
                     /translation="MPSTAIDFDQIQHQRLPTLYEVFILKTEPPVDLWSFYTYLSQFP
                     YAINYLDFWIDLMAHIRLCKDYVSTVRQSVVQGSALEEFRNLDERSNVNRHMNNDEDA
                     SVTTSILMNTLLSEGYLDFENPEKVSQFLQGNTHTSPMVTRMIQDWKLHNERNSVAAT
                     SHLQSTQAGIDISRKESMQSVSAIVDEFLKRQSQLGEKGNITTKQLYNNAQQICNTYL
                     MSQQHSPRYLANIPDDLKNQVIHNFKANRRHDPEVFRELKEVTYQFLETDCFPKFLKE
                     VALHNIHDELSDWRFHPSNKNPHRTSSPSGSKENLNGHKQLMQNHISWSPFSTYTSLS
                     RVLFGCMWMGIGFWIGYVLIFLHYSRAIRVTTVVPFGLGCYYIVCGIYQVDIIYSWFG
                     LTQRLMYSHKKGNIEEGRQVYGATYNDDVPLIFTLLGGKSRLIHIEHPFIKKILYKRG
                     LWCLTLVVIFTAIFTVIFCCVPGRRL"
     gene            complement(392268..392339)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0A03850r"
                     /db_xref="GeneID:2886388"
     tRNA            complement(392268..392339)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0A03850r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2886388"
     gene            complement(<392922..>394454)
                     /locus_tag="CAGL0A03872g"
                     /db_xref="GeneID:2886355"
     mRNA            complement(<392922..>394454)
                     /locus_tag="CAGL0A03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444934.1"
                     /db_xref="GeneID:2886355"
     CDS             complement(392922..394454)
                     /locus_tag="CAGL0A03872g"
                     /note="highly similar to uniprot|Q05785 Saccharomyces
                     cerevisiae YLR206w ENT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444934.1"
                     /db_xref="GeneID:2886355"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA1"
                     /translation="MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLAD
                     KTYDTVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYII
                     KTLREFRHEDEVSGSDEGQIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRR
                     RRSRSRSTSYRNAYDDDLQKALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKE
                     EEELKKLQDMQRMQELQAQQQQQNVYYDIFGNPISPEEYYQYQEQQAALLAQQQQAVL
                     LAQQQQQAALLQQQQQQLYYDQMQQLQLQQPTLATGSNNPFSRDNISNNNNTSANNAL
                     LPDLQPKPAPSPQPQQQQPQQQPLQKTRTGNQSISDKYSELNNLLASGTGIDTFGNTG
                     EARIPAQHTKTGTFINSQGTGYKQVTNEPKNNPFLSSQYTGLPSTNIVPSHTGYGFGN
                     QQQQQQQQQQQQQQQQQQPQQNYNYNQQQNYQYQQQPQQYQQQQQQQFATPDQGVSLI
                     DL"
     gene            <394613..>395029
                     /locus_tag="CAGL0A03883g"
                     /db_xref="GeneID:2886408"
     mRNA            <394613..>395029
                     /locus_tag="CAGL0A03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444935.1"
                     /db_xref="GeneID:2886408"
     CDS             394613..395029
                     /locus_tag="CAGL0A03883g"
                     /inference="similar to AA sequence:UniProtKB:P32344"
                     /note="similar to uniprot|P32344 Saccharomyces cerevisiae
                     YLR204w QRI5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444935.1"
                     /db_xref="GeneID:2886408"
                     /db_xref="GOA:Q6FYA0"
                     /db_xref="InterPro:IPR013177"
                     /db_xref="UniProtKB/TrEMBL:Q6FYA0"
                     /translation="MQKLKLKLMLNCSSIATTTSARMSLLRMVRPFMAVVPGVRRVSS
                     VPVAGVRVSMPMPFGKMPLPLRASIQTTVQATVQATVQTMQPTVQPLPVTPQALDKEV
                     YVDSVMRKRRKKMKKHKLRKRRRKEKAERRKLSQGR"
     gene            complement(<395219..>396067)
                     /locus_tag="CAGL0A03905g"
                     /db_xref="GeneID:2886403"
     mRNA            complement(<395219..>396067)
                     /locus_tag="CAGL0A03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444936.1"
                     /db_xref="GeneID:2886403"
     CDS             complement(395219..396067)
                     /locus_tag="CAGL0A03905g"
                     /inference="similar to AA sequence:UniProtKB:P32339"
                     /note="similar to uniprot|P32339 Saccharomyces cerevisiae
                     YLR205c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444936.1"
                     /db_xref="GeneID:2886403"
                     /db_xref="GOA:Q6FY99"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:Q6FY99"
                     /translation="MSVRFAVALRHGKLYRQGILAFYYVFQAIEQEIDALLSIDTATG
                     ATGATDVSDQKLLASKIVKQFWMPEFRRTEQLYKDLLLLYSPEYPTSTELDAMLVDHQ
                     LPPQLQGFVDMVHATVRQNPVTVLAYCHVMYLALFAGGKVMRSTLYRNTGLFPKFEHL
                     SSKELARKGTNFFTFSDAGVDVENQLKWQYKKNYELATREALAENDKLEIIDVAKRIF
                     ERNMDIIQEIGQLNKEALTNNKLDLLQYVFEELKFYNKDRSHQQLVYAVLVLLALLVL
                     YRIVYR"
     gene            <397179..>398492
                     /locus_tag="CAGL0A03927g"
                     /db_xref="GeneID:2886399"
     mRNA            <397179..>398492
                     /locus_tag="CAGL0A03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444937.1"
                     /db_xref="GeneID:2886399"
     CDS             397179..398492
                     /locus_tag="CAGL0A03927g"
                     /note="highly similar to uniprot|P32335 Saccharomyces
                     cerevisiae YLR203c MSS51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444937.1"
                     /db_xref="GeneID:2886399"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:Q6FY98"
                     /translation="MIRTRTRAVQNTGKFYACVSKRQLMGFVRNALGLDPPPSPDEPT
                     EQNRFHPWDQSPAVDLRERAARIKTLAKCPVTHKPIQYTCPISGIPTHHSREAWEQDK
                     EYHASKKYEILKKVNIYEHDLRSGRPFPEFDFPRDQGPDRTVNLTNWDLFLYTRSFYS
                     MDTEFQLAAVTKMLSYPITIGSVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYPLQN
                     RAVTTTAKNKPMRIFILGARAEAQLPGHVWKQLQFLFPQQNFEIHFIGPESLYDRERN
                     EYIRSATANGETAADGTTSSIPVTKRIDETMKFFYHTDYFHTLHTAQDFFPYDPYQDV
                     FFMFHPGLASPESKDTWMKDTVKGLLDTKCAIFTTGFNKKDMADDIQILQDTYGKEMD
                     MLMNPVKNVFGSTKWELDDSDPHSVYQFNMYIAGFRGKRYHPIKV"
     gene            <399220..>400026
                     /locus_tag="CAGL0A03949g"
                     /db_xref="GeneID:2886394"
     mRNA            <399220..>400026
                     /locus_tag="CAGL0A03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444938.1"
                     /db_xref="GeneID:2886394"
     CDS             399220..400026
                     /locus_tag="CAGL0A03949g"
                     /inference="similar to AA sequence:UniProtKB:Q05779"
                     /note="similar to uniprot|Q05779 Saccharomyces cerevisiae
                     YLR201c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444938.1"
                     /db_xref="GeneID:2886394"
                     /db_xref="GOA:Q6FY97"
                     /db_xref="InterPro:IPR012762"
                     /db_xref="InterPro:IPR013718"
                     /db_xref="UniProtKB/TrEMBL:Q6FY97"
                     /translation="MSLYNNLRLVTRQKQVSGLLSAVRRYHPTSNEYVNPKVWEPLTY
                     TPESPEFKLLSHTMENSVPQHGFTEKAIVNSLNAMKMPSGMLTTIGASNSATFLHSSP
                     AVMELIKFQLVEKRHRMVEGITEIAEASKLPSLESLLLKRLKMDVPIASHLTQMTAQL
                     MVPSSFMTNVSLPELERLADDMIYYSNEKDHHDFAWYTKRAALATTYLASKAFMAQDK
                     SHNFMETMEFAQDKLHKVMTLGDYYNNVEEFGWFTLMSAVNLTKSQMARV"
     gene            complement(<400291..>400611)
                     /locus_tag="CAGL0A03971g"
                     /db_xref="GeneID:2886387"
     mRNA            complement(<400291..>400611)
                     /locus_tag="CAGL0A03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444939.1"
                     /db_xref="GeneID:2886387"
     CDS             complement(400291..400611)
                     /locus_tag="CAGL0A03971g"
                     /inference="similar to AA sequence:UniProtKB:P52553"
                     /note="similar to uniprot|P52553 Saccharomyces cerevisiae
                     YLR200w YKE2 Gim complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444939.1"
                     /db_xref="GeneID:2886387"
                     /db_xref="GOA:Q6FY96"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q6FY96"
                     /translation="MSAELGAKYQSLQNELEELVTARQKLETQLQENKIVNEEFATLK
                     EDTVVYKLTGNVLLPVEHDDAKNNVDKRLEFIGEEIKRCEDNIRSKQQELETIRGQLI
                     SQQK"
     gene            <400841..>401804
                     /locus_tag="CAGL0A03993g"
                     /db_xref="GeneID:2886398"
     mRNA            join(<400841..400846,400992..>401804)
                     /locus_tag="CAGL0A03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444940.2"
                     /db_xref="GeneID:2886398"
     CDS             join(400841..400846,400992..401804)
                     /locus_tag="CAGL0A03993g"
                     /inference="similar to AA sequence:UniProtKB:Q05778"
                     /note="similar to uniprot|Q05778 Saccharomyces cerevisiae
                     YLR199c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444940.2"
                     /db_xref="GeneID:2886398"
                     /db_xref="GOA:Q6FY95"
                     /db_xref="InterPro:IPR018855"
                     /db_xref="UniProtKB/TrEMBL:Q6FY95"
                     /translation="MLFKQWNELSEPRNHLDAPNLVNNTESLQLLPLPDVHIPDELFE
                     GGNVKRVILTTKTMDTFFLLDKTMKVKKLADITCSLEIPKNLQTHEATHTWDFGENFP
                     NEVEPLQDEEQRTFSLRFPIYLLEDQTLYVSIDENFLTVSPIFTAQISDVISKKLNRG
                     HEIVILGCSDRIEDTKICTNNNCSLVPPEFVTGFLGSLMSDLTKTNDQLFTAAIFPSE
                     GPQGFEKLSSTTVDSIIDFCSQLVSTDKSRYTEECYKRWKRNASSNGAQSGLYL"
     gene            complement(<402070..>403596)
                     /locus_tag="CAGL0A04015g"
                     /db_xref="GeneID:2886436"
     mRNA            complement(<402070..>403596)
                     /locus_tag="CAGL0A04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444941.1"
                     /db_xref="GeneID:2886436"
     CDS             complement(402070..403596)
                     /locus_tag="CAGL0A04015g"
                     /inference="similar to AA sequence:UniProtKB:Q12460"
                     /note="similar to uniprot|Q12460 Saccharomyces cerevisiae
                     YLR197w SIK1 involved in pre-rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444941.1"
                     /db_xref="GeneID:2886436"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:Q6FY94"
                     /translation="MAIEYLLFEEPTGYAVFKVKLNQDNIGSKLKEVQEQINDFGGFT
                     KLVELVSFAPFKGAAEALENANDISEGLVSESLKNVLELNLPKGSAKSTVTLAISDKN
                     LGPSIKEAFPYVDCIANELAQDLIRGVRLHGEKLLKGLQSGDLERAQLGLGHAYSRAK
                     VKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKLV
                     LFIKDKASLNEESLHDLAAVVNEDAGIAERIIDNARISMGQDLSETDMENVCVFAQRV
                     VSLVDYRKQLYDYLCEKMHTVAPNLSGLIGEVIGARLISHAGSLTSLSKQAASTVQIL
                     GAEKALFRALKTKGNTPKYGLIYHSGFIAKASAKNKGRISRYLANKCSMASRIDNYSD
                     EPTNVFGSVLKKQVEQRLEFYATGKPTLKNELAIHEAMELFNKDKPVSEEPKADSKKR
                     KLEESESESEEEEEKKEKKEKKAKKEKKEKKEKKEKKEKKEKKEKKDKKEKKEKKSKK
                     "
     gene            complement(<404063..>405814)
                     /locus_tag="CAGL0A04037g"
                     /db_xref="GeneID:2886378"
     mRNA            complement(<404063..>405814)
                     /locus_tag="CAGL0A04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444942.1"
                     /db_xref="GeneID:2886378"
     CDS             complement(404063..405814)
                     /locus_tag="CAGL0A04037g"
                     /note="highly similar to uniprot|P21304 Saccharomyces
                     cerevisiae YLR196w PWP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444942.1"
                     /db_xref="GeneID:2886378"
                     /db_xref="GOA:Q6FY93"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FY93"
                     /translation="MISATAWVPRGFPSQFPEKYVLDDEEMERINQMAQLNLEDAKED
                     LADAQDAQAGAESEEAGEEAGDVAQPNTDRLKDQAEVDDDLKEFDMEHYDDEDGAEGA
                     EMSMFPGLSDEVKFHAGEGDEDAYISMPHEKETEEDKEELQVYPTDNMILATRTEDDI
                     SYLDVYVYDDGAGFHSDEIPVEEGDEYDPDVARGMVRDSALYVHHDLMLPAFPLCVEW
                     IDYKVGSSSEEPGNFAAIGTFDPQIEIWNLDSVDKAFPDLILDEPEENSAASLGKSKK
                     KKGKKKGHVTTHHTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNATAARSMANIHS
                     NKNVSSSQWHMQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFAS
                     ENIILCGTDAGNVYSFDIRNNEGSKPVWTLKAHDAGISSLSCNRFISGMMATGAMGEK
                     QVKLWKFPTEATAGSSGPGMVLSRDFDVGNVLTSSFAPDIEVAGNIVIGGVSKGLKLW
                     DVFSNRSVRRVFQDELQQVQEAAKAEAKSLGRSSRIARKYIKNDNPDTVLTIEDKNED
                     EDEDDEGEEDWEDEDEE"
     gene            <406133..>407488
                     /locus_tag="CAGL0A04059g"
                     /db_xref="GeneID:2886412"
     mRNA            <406133..>407488
                     /locus_tag="CAGL0A04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444943.1"
                     /db_xref="GeneID:2886412"
     CDS             406133..407488
                     /locus_tag="CAGL0A04059g"
                     /note="highly similar to uniprot|P14743 Saccharomyces
                     cerevisiae YLR195c NMT1 N-myristoyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444943.1"
                     /db_xref="GeneID:2886412"
                     /db_xref="GOA:O74234"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /translation="MSEKKIEELLKLLSMNNGDMSKLTANQRKEMKEYKFWKTQPVTK
                     FDEEVKEEGPIHEEKTPADIPDEPLPLLPDFEWCAIDVDDEKQLEDVFVLLNENYVED
                     RDASFRFNYTREFFNWALKSPGWTPDWHIGVRVKASKKLIAFISAIPVRLRVRAKVID
                     SVEINFLCVHKQLRSKRLTPVLIKEITRRVNKRNIWHALYTAGVVLPAPVSTCRYAHR
                     PLNWDKLYEVQFTDLPPNATKAEMVAKYTLPKATKTAGLRELRLEDVDQALALFNRYQ
                     SRFDIVQEFTKEEFIHWFINDKNVVEQDKRVVFSYVVESEGKVTDFFSFYSLPFTILN
                     NSRYKDLGIGYLYYYASDADFKFEDRFDKEGTSLLKQRLSTLVQDACIIAAQNKMDVF
                     NALSSQDNTLFLEDLKFGPGDGFLNFYLFNYRTFPITGGLTEDQHFDTEHRSNVGVVM
                     L"
     gene            <408064..>409188
                     /locus_tag="CAGL0A04081g"
                     /db_xref="GeneID:2886450"
     mRNA            <408064..>409188
                     /locus_tag="CAGL0A04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444944.1"
                     /db_xref="GeneID:2886450"
     CDS             408064..409188
                     /locus_tag="CAGL0A04081g"
                     /note="weakly similar to uniprot|Q05777 Saccharomyces
                     cerevisiae YLR194c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444944.1"
                     /db_xref="GeneID:2886450"
                     /db_xref="UniProtKB/TrEMBL:Q6FY91"
                     /translation="MKLTQVALICSIASVNASTGGLDDNFGGKADSSKESPSGSQAAD
                     SDSPSSQVEAQVPSANAAAQLPSSKAVSQVPTQSVVQNSNVVSSAKGKDGFAVEPSTT
                     ITTTDANGNPTTKYLWWIPEATPSVSAKSAPTSVEDSESSSSSAVVSSTVSPSAVSSA
                     SVVSSSHKSIVSDSALLQNSDFSSVVSSSVSSSASSSASSSASKGKKGKDSDASSSVS
                     SHSRRPDEPITVLTYLDSEGHTVTSKVWWTPTGVTSSNTASVSVSSSIESKENKAVSS
                     VHGKKDKKSKHQKSHSSTTVETTTASSSKEHTSKHKGKGKSKSTVETVHTSVSHSASH
                     STSQSVSEVAKRAVHFENAGVVDKYPLVLAAGSLAIALLL"
     gene            <409523..>410077
                     /locus_tag="CAGL0A04103g"
                     /db_xref="GeneID:2886400"
     mRNA            <409523..>410077
                     /locus_tag="CAGL0A04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444945.1"
                     /db_xref="GeneID:2886400"
     CDS             409523..410077
                     /locus_tag="CAGL0A04103g"
                     /inference="similar to AA sequence:UniProtKB:Q05776"
                     /note="similar to uniprot|Q05776 Saccharomyces cerevisiae
                     YLR193c MSF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444945.1"
                     /db_xref="GeneID:2886400"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:Q6FY90"
                     /translation="MVLVHRSVHVFENDFASVSCAFFNRYPNPYSRTVKSIDTLNQQV
                     LDGKLHTTRLLRKTGNMPVWARPFLGRISESWVIEVSVVDPQRGRMETFTKNLDHTRI
                     MQVEEYSTYDYNFETRKTSVVSRVKFSSGFTTGLRERLENWSRSIFDENVKYSRQGML
                     FVMKKIEEKRNKRSLLQQIQNIEP"
     gene            <410626..>411423
                     /locus_tag="CAGL0A04125g"
                     /db_xref="GeneID:2886445"
     mRNA            <410626..>411423
                     /locus_tag="CAGL0A04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444946.1"
                     /db_xref="GeneID:2886445"
     CDS             410626..411423
                     /locus_tag="CAGL0A04125g"
                     /note="highly similar to uniprot|Q05775 Saccharomyces
                     cerevisiae YLR192c HCR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444946.1"
                     /db_xref="GeneID:2886445"
                     /db_xref="GOA:Q6FY89"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /translation="MSWDDAGNDDAVLMDSWDAEVDFAGDEPILDSWDEEPKAKKEAA
                     KPKPKPKAGGKKNAKGEEKKEQVLAIDELDPQTRKELMKKAELESDLNNAADLLGDLE
                     MAEEHPRARAMQKEQELAAQAALLRPAMTKDTPIEDHPLFKAETKKEYQDLRKALATA
                     IVTMHEKSSLNYSSSLAIDLIRDVSKPMSIENIRQTVATLNILIKDKEKAERQARLAR
                     VKGGTATGGAGKKKAKAKTNLGGAFKKDQDFDVDDINYDDFGADDFM"
     gene            complement(<411674..>412849)
                     /locus_tag="CAGL0A04147g"
                     /db_xref="GeneID:2886406"
     mRNA            complement(<411674..>412849)
                     /locus_tag="CAGL0A04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444947.1"
                     /db_xref="GeneID:2886406"
     CDS             complement(411674..412849)
                     /locus_tag="CAGL0A04147g"
                     /inference="similar to AA sequence:UniProtKB:P80667"
                     /note="similar to uniprot|P80667 Saccharomyces cerevisiae
                     YLR191w PAS20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444947.1"
                     /db_xref="GeneID:2886406"
                     /db_xref="GOA:Q6FY88"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:Q6FY88"
                     /translation="MTYTETRPKPWETNGGTTAAVDRAFDIENEANNSLMSTRDTTTQ
                     ESHEQGTREGSEPPEVVPRPPGLTNTMNGGVGTGMYNSGGYGYDSGIYGGGMYGNNGG
                     MFGSMYSGAMNRYGGMYGGGYGNYGSFYNNGYNYGGAYGDMGGNGLEQIGESTRATFQ
                     LIESLIGAVTGFAQMLESTYMATHNSFFTMISVAEQFNYLKEVLGSAFGIFAIMKFLK
                     RLLYFVTNGRLGSAPKRIQGGGNSGNSRLLEEFSRFGLNNDKAPARKITLKPLLFFLS
                     AVFGFPYLLNKFIQKLQEVQQRNSIAMGKDGDGTIDPSKLEFARALYDFTPENPQIEI
                     TLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGYAPYNYLEIIKRVKKQESKTPPA"
     gene            complement(<413588..>415297)
                     /locus_tag="CAGL0A04169g"
                     /db_xref="GeneID:2886393"
     mRNA            complement(<413588..>415297)
                     /locus_tag="CAGL0A04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444948.1"
                     /db_xref="GeneID:2886393"
     CDS             complement(413588..415297)
                     /locus_tag="CAGL0A04169g"
                     /inference="similar to AA sequence:UniProtKB:Q06324"
                     /note="similar to uniprot|Q06324 Saccharomyces cerevisiae
                     YLR190w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444948.1"
                     /db_xref="GeneID:2886393"
                     /db_xref="GOA:Q6FY87"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:Q6FY87"
                     /translation="MNSPHFNELSPSMSPIAFGFDDKTLLSPTKLKLDQHAPMNSLLY
                     PTSLSKLSELSRTGRSQQRSRRDSDTLRSLSPLRLQFQNTGGANPGPNFSMGAPKMLK
                     PEFLQKSSTSTSTLPLLSALLMKTGNGKAGSQQQGSASNENNSQTTSMSGFEQVSMIK
                     ESLDQLRQEVIVPKRNKNRDSTSTRRDRATTTKDETLAVSDDKDARKVSDANSEKTLY
                     EEQHLRKQVPASHSKEVGSSRIFSTETATSAKDVDSQQLRDGLDVEALPTDRNGFVQI
                     DHKNINTNRYSFISATSTDYDMEWYESQNNIAKHANSHRHGHLSSNRMMSVIQDDLRN
                     QVNLESQSSQSSTSYEAQKLDLKIKQLELEISELKLQNEKLIHSITTNRIVEDRLLMD
                     FIGNNENAPIAKPTQQRDMEKKVKQLEKRFDSYQKVLKQLKVISNSPPPKKSNSKHGH
                     RHSHGHRKSCDNIQLTDNRGRILRISSTELRKLDEQQDSSSSSPSSFSDSPSSTSVIA
                     EDEIEQIDLEDPTEEKIIVKKRQNAASSVASATSSKKGFQLNFQVQLDDMEKIPKTPS
                     PEL"
     gene            complement(<415933..>416202)
                     /locus_tag="CAGL0A04191g"
                     /db_xref="GeneID:2886397"
     mRNA            complement(<415933..>416202)
                     /locus_tag="CAGL0A04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444949.1"
                     /db_xref="GeneID:2886397"
     CDS             complement(415933..416202)
                     /locus_tag="CAGL0A04191g"
                     /inference="similar to AA sequence:UniProtKB:P52871"
                     /note="similar to uniprot|P52871 Saccharomyces cerevisiae
                     YER019ca SEB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444949.1"
                     /db_xref="GeneID:2886397"
                     /db_xref="GOA:Q6FY86"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:Q6FY86"
                     /translation="MSTPPPPGGHRTLQRRRQAQAVKEKQQTQTPTSARAAGFGGSSS
                     SILKIFTDEADGLRVDPLVVLFLAAGFIFTVMSMHFVAKMTGQVF"
     gene            <416929..>418848
                     /locus_tag="CAGL0A04213g"
                     /db_xref="GeneID:2886395"
     mRNA            <416929..>418848
                     /locus_tag="CAGL0A04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444950.1"
                     /db_xref="GeneID:2886395"
     CDS             416929..418848
                     /locus_tag="CAGL0A04213g"
                     /inference="similar to AA sequence:UniProtKB:P34217"
                     /note="similar to uniprot|P34217 Saccharomyces cerevisiae
                     YBL051c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444950.1"
                     /db_xref="GeneID:2886395"
                     /db_xref="GOA:Q6FY85"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FY85"
                     /translation="MDTDSNPEAGVNNGAANGAANAASLTNDTATPPTTTTTTATTNN
                     DYEANDEDVIPNAIVIKNIPFAIKKEQLLDIIQEMGLPLPYAFNYHFDNGIFRGLAFA
                     NFSTPEDTSRVISDLNGKEINGRKLKVEYKKMLPQAERERIEREKREKRGQLEEQHRS
                     MSNLSLSSMNRNSNNTNNSNVTPAANTTNLLSQQLFSPNLGSLSTMQNSNIVQPMANQ
                     STSGSMYSARNSAYQNDPNTSANMVQQQSAVTERYYAPLPAAYSLPLPPQQLDLNDPD
                     TLEIYSQLLLFKDREKTYYELAYPVGVSANHKRIINVLCSYLNLVEVYDPRFIIIRRK
                     VLNQNDLQSHILQNQQSPQVGTTENNAMMHPLQASSTGGSMNRSHSYTNLLQTHAAAA
                     AVGTTTASYGLGVTAASSTGTPKITQLAQQMVANQQSQQQNASAQGHVASTSSPVISV
                     QSNPLFSGEQQQSLLRQTSGLTASSRIPSGYSSNQMYNNVNPLLRNNGISPPAGQTAL
                     NMTSIHNNQRIPQGFPASASQLQQQQQQQQQTYGQNSNPLIPQHTNESAHSNYSLQSL
                     HDDLMNQQSNTSVLGNSISATNTANASDMIYRTLSQSRYEDGLEQGLNRSLSALDLTG
                     KDQENSSNDKNAGWP"
     gene            <419951..>422110
                     /locus_tag="CAGL0A04235g"
                     /db_xref="GeneID:2886335"
     mRNA            <419951..>422110
                     /locus_tag="CAGL0A04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444951.1"
                     /db_xref="GeneID:2886335"
     CDS             419951..422110
                     /locus_tag="CAGL0A04235g"
                     /inference="similar to AA sequence:UniProtKB:P34218"
                     /note="similar to uniprot|P34218 Saccharomyces cerevisiae
                     YBL052c SAS3 silencing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444951.1"
                     /db_xref="GeneID:2886335"
                     /db_xref="GOA:Q6FY84"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FY84"
                     /translation="MNRATRSRKPDQLPSQPQRYDYNTINDLGATHMTNGGTNVASIT
                     TNLSTNPNVEIHEEVFENNARKLGPLKIRYDSKKLLNFKRLLEVRSENAIKDSEASIR
                     EFDPNGDSDALQIPEVDDDIPYRGVVVGKKNYSTHRTIPSSTDREFFRRLFLESSTAA
                     FYNGNVLLGNHDINDNDTSQPPNKKLKNVKAVKENPKTIEYVYIRDSEVKTWYTAPYP
                     EEFNKNKILYVCEYCLKYMNSRFVYYRHTLKCKDHRPPGNEIYRDENVSVWEIDGREN
                     VVYCQNLCLLAKLFLNSKTLYYDVEPFVFYVLTEREVSEDGRTVKNHFVGYFSKEKLN
                     SSGYNLSCIITLPLYQRRGYGHFLMDFSYLLSKREFSQGTPEKPLSDLGLITYRNFWK
                     LKCAETLLYLKNELNLEDSESDDKFPLVSIEDLANLTGMLPTDVILGLEELGVFYRCP
                     DPNQNTTSYCIKIDSWNRIKAIRENWLRKGYQSLKPENLIWKPLIYGPSGGVNALGMV
                     EPPSLPEDRKTSISSEPNFQNNPVDFFGSHITMVKKFMTDDIEDPRDLEILTIDNIKK
                     RKLSVGKNNMLQQSWEIAYQDPRPVDKKDTTARKAPSLLSSKTTRKESLMSAETEDVL
                     PYENQEMDDTSVVLETEESDPDDNDYDEEDINEKVISSDSSSLVVSSEEENTDETIPV
                     RRFPRRHASGLDDALDDDRDELIDLTTSRQKRQLRRM"
     gene            complement(<422355..>424289)
                     /locus_tag="CAGL0A04257g"
                     /db_xref="GeneID:2886442"
     mRNA            complement(<422355..>424289)
                     /locus_tag="CAGL0A04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444952.1"
                     /db_xref="GeneID:2886442"
     CDS             complement(422355..424289)
                     /locus_tag="CAGL0A04257g"
                     /note="some similarities with uniprot|P40059 Saccharomyces
                     cerevisiae YER088c DOT6 or uniprot|P34219 Saccharomyces
                     cerevisiae YBL054w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444952.1"
                     /db_xref="GeneID:2886442"
                     /db_xref="GOA:Q6FY83"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6FY83"
                     /translation="MISALMMDVGEKHGESESESDGVAAIRDKSAAAASISTPLSSNN
                     NSDVGSPELDKVGSDGVPEPNSVSNSVSNSVSNSVSDSVSNSVSNSVSNSSNSASASQ
                     DNANAKNPSSWDPEDDILLRHLKEIKNLGWKEIALYFENRTPNACQFRWRRLKSGNLK
                     SNKTATVDISEYNVVVKRLSEIENAQLSRSASEQPFRPPVDNNDKLANNIPVSYPGSA
                     NGNGTPLGSEMDTKLNKVVSGASPAPVAATAMLTSSSHGSVTPNGTNGTQKGKRASLH
                     FPIIPLSRRTSVATIPSNAISGSTQSITGSVTPGSTQRSHTSLAKNKFPKARSYSHTL
                     GPSPQLHSLKGIKFKETKTRESHGSAINDDIENENFGFIPKIIVKSRRNSFTHPPMPV
                     GNSTNSSANTKYNPGPSGLSISPPSTFNGGSGGQYLQNASFSSNLANALNTTLITSKS
                     RKNSFSVNSRRSSFNISSTSNSRRPSIISAPNSITNNFVINHSNSASNLHAAPKMQRK
                     NSNVKREATSSQSLNTISSPNGKTSTENGTYENSYNTFKVQYMDNPVGHSSAFQKKAM
                     DYASHSLDGMEPKDEGVTSCSNNSGNNSRFMPWSLEEDQLLTENKLRNLSLMELSILL
                     PNRSENEIKWRLDTFSRNYL"
     gene            <425058..>426212
                     /locus_tag="CAGL0A04279g"
                     /db_xref="GeneID:2886481"
     mRNA            <425058..>426212
                     /locus_tag="CAGL0A04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444953.1"
                     /db_xref="GeneID:2886481"
     CDS             425058..426212
                     /locus_tag="CAGL0A04279g"
                     /inference="similar to AA sequence:UniProtKB:P34220"
                     /note="similar to uniprot|P34220 Saccharomyces cerevisiae
                     YBL055c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444953.1"
                     /db_xref="GeneID:2886481"
                     /db_xref="GOA:Q6FXT6"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT6"
                     /translation="MSIARRMRFYDIALNLTDPMFFGVYRGKQKHEPDTYELLHRAYD
                     AGVHASMVTGSSIEGSIDAISLVKRLSHKDHIQMKLFYTVGVHPCTVNEFMAHTMDGA
                     FNIHEASNDSDHNDRLYRQVIENPQLAVPKLRELHLLQEKAMHDPHFRAVGEIGLDYD
                     RLNYSSKEMQMLFFEEQLKIACMAAPSKPLFLHMRNCAADFISILRKFINGFTDTEDT
                     FNWIQIAPHRNIKHGSTYYKLDPTVKFVVHSFTDSLEDMKELLALSPNCYIGINGCSL
                     RDQTNIESVRQLPLERLLLETDAPWCEIRPSHASSAYLQGYDGSRYKHVKKEKLDECL
                     RKDETNVLVKSRNEPCNMEQVAVVIANIKELPVEEVAERAWENSCDIYGL"
     gene            complement(<426571..>427929)
                     /locus_tag="CAGL0A04301g"
                     /db_xref="GeneID:2886337"
     mRNA            complement(<426571..>427929)
                     /locus_tag="CAGL0A04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444954.1"
                     /db_xref="GeneID:2886337"
     CDS             complement(426571..427929)
                     /locus_tag="CAGL0A04301g"
                     /inference="similar to AA sequence:UniProtKB:P34221"
                     /note="similar to uniprot|P34221 Saccharomyces cerevisiae
                     YBL056w PTC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444954.1"
                     /db_xref="GeneID:2886337"
                     /db_xref="GOA:Q6FXT5"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT5"
                     /translation="MGQILSNPVIDKETESGSDKWTAYAVCAMQGWRMSMEDTHIAQL
                     NLNADESSGHVALYSVFDGHGGSYVANFCGERMEKIVKSQKSYETGDLAQVLTDAYLA
                     ADEQLATQSSISDDHSGCTATSVLISKEKGVIICGNAGDSRTVLSSGGLAKALSFDHK
                     PTLPGETARITAANGFVQMSRVNGNLALSRAIGDFEYKSNPKLLPHEQMVTCVPDVIE
                     HKLDFENDEFVILACDGIWDCLSSQECVDMVHYGIQKTELSLLEITSRIVDICCAPST
                     EGSGIGCDNMSIIVVALLKDSETLEQWFERMRAKNYSYSTTFEQKRKEVFSFYNFAKN
                     QETGDEDVFAITAPRSAPGSKLNGNQERGVTAKGPVDTSKNGKSPGVIDFTSLESLLE
                     AGIKISQSPNNVQHFQGSALADMLASLSEAAAGETSPSEKNDDIEFTESTHANPEESI
                     GH"
     gene            <429121..>429771
                     /locus_tag="CAGL0A04323g"
                     /db_xref="GeneID:2886444"
     mRNA            <429121..>429771
                     /locus_tag="CAGL0A04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444955.1"
                     /db_xref="GeneID:2886444"
     CDS             429121..429771
                     /locus_tag="CAGL0A04323g"
                     /inference="similar to AA sequence:UniProtKB:P34222"
                     /note="similar to uniprot|P34222 Saccharomyces cerevisiae
                     YBL057c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444955.1"
                     /db_xref="GeneID:2886444"
                     /db_xref="GOA:Q6FXT4"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT4"
                     /translation="MGSNIIPSFFGIAVASLATGYYLGTLSNGDLLSRKKKENRKPTK
                     DEILKKCKETAEATANAESEDEEETDDEDYDEGELSDEEIESLSLNDIPGEVRMALVI
                     RQDLGMQKGKVAAQCAHAALSCFRLIATDPNKMSYNPELTKRWLRHGQAKITLKCPDK
                     EKMDELYAMAISLGVNAAVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGELKLY"
     gene            complement(<429936..>431114)
                     /locus_tag="CAGL0A04345g"
                     /db_xref="GeneID:2886448"
     mRNA            complement(<429936..>431114)
                     /locus_tag="CAGL0A04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444956.1"
                     /db_xref="GeneID:2886448"
     CDS             complement(429936..431114)
                     /locus_tag="CAGL0A04345g"
                     /inference="similar to AA sequence:UniProtKB:P34223"
                     /note="similar to uniprot|P34223 Saccharomyces cerevisiae
                     YBL058w SHP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444956.1"
                     /db_xref="GeneID:2886448"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT3"
                     /translation="MSDSDKVIQQFMTLTDRSIDVAREYLEQYDNDLGGALNAYYASQ
                     MESEEEQRENDERWGPTRESPRPSSAEGTSSRALSQSSEPVKYDSKKNSKFMSFSQMV
                     KSNGGSGDDDDDDDKRNTFAGGEVSGLEVTDPNDSNNIIKDLLEKAKRGGESLSQEES
                     ENKRSAQHFIGKGYRLGSSVGETNQVVEDNTESGRRTPERVTRDITFWKEGFQVGEGE
                     LYRYDDPANSFYLNELNQGRAPLKLLNVEFGQEVDVNVHKKLDESYKPPKRKIEGFHG
                     RGQRLGSPVPGDAPEPAVATATQAVPKTETKAEKTEEVPKGDSSIQIRYASGKREIFR
                     CNATDSVRSLYEYVSSNTTDKSRQFTLNHAFPVKPIENSDISVEEAGLVNAVVVQRWK
                     "
     gene            complement(<431519..>431881)
                     /locus_tag="CAGL0A04367g"
                     /db_xref="GeneID:2886447"
     mRNA            complement(<431519..>431881)
                     /locus_tag="CAGL0A04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444957.1"
                     /db_xref="GeneID:2886447"
     CDS             complement(431519..431881)
                     /locus_tag="CAGL0A04367g"
                     /inference="similar to AA sequence:UniProtKB:P34224"
                     /note="similar to uniprot|P34224 Saccharomyces cerevisiae
                     YBL059w and similar to uniprot|P87275 Saccharomyces
                     cerevisiae YER093C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444957.1"
                     /db_xref="GeneID:2886447"
                     /db_xref="GOA:Q6FXT2"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT2"
                     /translation="MVEQQVPLRYQDRRKTEMLRFFGATMVTLVSCRLLMGKVAPKKV
                     DSSLLRRTNFMSNHKPFTGTTSEKTGKDISMGLLYTTGMITGLISMGITGSCWNNDIT
                     TVDEFRERFRLDKEYLND"
     gene            <432158..>432625
                     /locus_tag="CAGL0A04389g"
                     /db_xref="GeneID:2886336"
     mRNA            join(<432158..432191,432354..>432625)
                     /locus_tag="CAGL0A04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444958.2"
                     /db_xref="GeneID:2886336"
     CDS             join(432158..432191,432354..432625)
                     /locus_tag="CAGL0A04389g"
                     /note="highly similar to uniprot|Q3E7A4 Saccharomyces
                     cerevisiae YBL059C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444958.2"
                     /db_xref="GeneID:2886336"
                     /db_xref="GOA:Q6FXT1"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT1"
                     /translation="MHPQLEAQRFHSCLDYIEALDKCHQKEYYKRMLGLCNNEKDALT
                     QCLKQASAETKKKAIQENKLKRDKLESKWRKIEEEEYGEDAILKMILDRELKKREGK"
     gene            <433577..>435544
                     /locus_tag="CAGL0A04411g"
                     /db_xref="GeneID:2886390"
     mRNA            <433577..>435544
                     /locus_tag="CAGL0A04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444959.1"
                     /db_xref="GeneID:2886390"
     CDS             433577..435544
                     /locus_tag="CAGL0A04411g"
                     /note="some similarities with uniprot|P34226 Saccharomyces
                     cerevisiae YBL061c SKT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444959.1"
                     /db_xref="GeneID:2886390"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT0"
                     /translation="MSHPYRQQLGEYGSRTSFDNSGQSLGIDISKIKDDIISTSSSLP
                     RRPELFDDDEEYSSSNNVAAEDNNFDQSFNSTISSGARNMSSTSLSGNNVRKIRSKSV
                     DLSHMYLLNGSHDTQLTFTNESVADLSHKVVSQYLSSGNNDPDTNPLVPRLKTIEMYR
                     ENVKKSKDPNVLFQYAQYMLQTALTMDPECMNSTGKDEDAAELKKKFLKDAHHYLKKL
                     STKGYVDAQYLLGDALASGAFGKKDNKEAYTLFQAAAKHGHVESAYRTAHCLEEGLGT
                     TRDARKALNFLKFAASRNHPSAMYKLGVYSFYGRMGLPSDVNTKQNGIKWLSRAAARA
                     NELTCAAPYELAKIYEVGFLDILIPDNKYALELYVQAATLGHVPSCTLLGQRYETGDE
                     FLPQDTSLSVHYYTQAALKGDPVAMLGLCAWYLVGAEPAFDKDENEAFEWALRAANLK
                     YPKAQYTLGYFYEHGKGCEKNAEIAWKWYARAAANNDKRAINKMNSKSKDDVTSTFKK
                     GHQKSRSVNTLNLFAKMDDEPEYKPQESTFNNEFNTNSRDDLDGGRHNLSKSNDNYGS
                     LPTPQINYFSAPNSAEQSPAISKQSANGKASNNTGRLHRSTPQNDIRVIQNTQFKSEE
                     DHLNKELPSHSQEQNSKEKKKKKNKKDCIIM"
     gene            <436143..>436925
                     /locus_tag="CAGL0A04433g"
                     /db_xref="GeneID:2886338"
     mRNA            <436143..>436925
                     /locus_tag="CAGL0A04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444960.1"
                     /db_xref="GeneID:2886338"
     CDS             436143..436925
                     /locus_tag="CAGL0A04433g"
                     /note="highly similar to uniprot|P34227 Saccharomyces
                     cerevisiae YBL064c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444960.1"
                     /db_xref="GeneID:2886338"
                     /db_xref="GOA:Q6FXS9"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS9"
                     /translation="MSTFMRQYARNMARVPVSTRLNAQRFACANYRFYSEKTNYKQAD
                     QPRLRINSSAPNFDADTSHGKINLYDYLGDSWGILFSHPADFTPVCTTEMGAFAKMKP
                     QFDKRGVKLLGLSVEDAESHRKWIKDIEEINGIDKFGFPIIADTKRHVAFLYDMCDEE
                     GFGNINDGSLTTVRSVYVIDPAKKIRVIFTYPSQVGRNTAEVLRVIDALQTADKHGVV
                     TPGNWSPNDDVIIPPKVSDAEASEKFGDFKTVKSYLRYTKLK"
     gene            <437546..>440842
                     /locus_tag="CAGL0A04455g"
                     /db_xref="GeneID:2886438"
     mRNA            <437546..>440842
                     /locus_tag="CAGL0A04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444961.1"
                     /db_xref="GeneID:2886438"
     CDS             437546..440842
                     /locus_tag="CAGL0A04455g"
                     /inference="similar to AA sequence:UniProtKB:P34228"
                     /note="similar to uniprot|P34228 Saccharomyces cerevisiae
                     YBL066c SEF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444961.1"
                     /db_xref="GeneID:2886438"
                     /db_xref="GOA:Q6FXS8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS8"
                     /translation="MSTAASNDHPDGGGKQSTTKKATKRASKSEESGQKKKVKKESTS
                     KISSPDDNHSVTSTSTVLSQHMNGSMSSNGANLGTTHRPVTSCTHCRQHKIKCDASQN
                     FPAPCTRCAKNGFHCEINPQFRPKKGSMMQMLAHEVDELKYKVSYLIRNDGLIAKALA
                     NHKEGQDILRVLNTNPPGYYQEGKSEINTNSPSVNHALTPNHETNSNSSPNTKISVQT
                     YLAGDHPLVSQDTKSPTASGNAVPTQAMNMNRNDIIGTKYTTSVNKPILPPILNDSTP
                     TNNSSKAQINSGLLQMAFHRNSSTTGSPSTSRPLSPLVPNGATSHGMINNDIGLQQAG
                     QVGAKKSPIIATTTTMDPLPSPQANIDEFVLGDIRLSINKADELHSTFLTKYLPYFPI
                     MSSNSATELFGQSQLLFWTVMLTASMSEPEPTLYMKLSTLIKQLAIETCWIRTPRSTH
                     ISQALLILCNWPLPNQKVLDDCSYRFVGLAKSLSYQLGLHRGEFIYEFTRTQTSMPDA
                     EKWRTRTWLGIFFSENCWSSILGLPPNSKPDYLTEKAKKAEIYEDNVDKTSEITSKES
                     NKGKAKETNGHANEISDNKMTLPKRFKQMLILADFQGKLCNIMGTSVTSPDGLMEPSY
                     RSDALSVLDKELEELNTTYKFDTDDVVNIYYLYIRLMIYCFAFLPGTPAQDQLVYVNP
                     AYTAATKIVTLLTQLLKDQQLIELPIYIRQSASYASLILFKLQLSPALSDKCFESARQ
                     SIVTIHRCYRNQLSAWATVVENDISRTASMLEKLNFVLITHPEVLVEEAGIISRMRSH
                     MTGSLFYDLVWCVHEARRREVDPEYNRQVLEDVKKSHEKDGSKQSYHIPASKLYPLPL
                     YNQISKEDFKTVTKTTPNGTTVTTLVPTRSALRQAESNSNNDGGAVAINGIPLAMLDE
                     NGSLDMDNLFSLQNIAPVNGDGAIYPRMIDSIIRPEDIPDRPNSAMATIAPSDRQDFG
                     NKGDVNSSTQQGVNPPNDFMMERQASFPPTQNPRTTGSSLASLPEIPKNGKSFKDFAN
                     IAQWGNFASNPTSGPNKNNKNDIPSANSRLQLNQLSDFFQQQSAGWIEGNLGNDDFFG
                     WLDMNMEPKF"
     gene            <442089..>444401
                     /locus_tag="CAGL0A04477g"
                     /db_xref="GeneID:2886392"
     mRNA            <442089..>444401
                     /locus_tag="CAGL0A04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444962.1"
                     /db_xref="GeneID:2886392"
     CDS             442089..444401
                     /locus_tag="CAGL0A04477g"
                     /inference="similar to AA sequence:UniProtKB:P38187"
                     /note="similar to uniprot|P38187 Saccharomyces cerevisiae
                     YBL067c UBP13 or uniprot|P39967 Saccharomyces cerevisiae
                     YER098w UBP9 ubiquitin carboxyl-terminal hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444962.1"
                     /db_xref="GeneID:2886392"
                     /db_xref="GOA:Q6FXS7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS7"
                     /translation="MLKKWLPSSKKKQSSKGSAGGSSAPVTPLKGNNHLNVGNKKGST
                     PTITRSAPNNAMRSSPSLPESNNDRLRVNNNNDARKDSFGNAQGPNLKLNIVEPQDVG
                     TQLQKLNGGFNTTNSSNESLPSEHLHNPILNTERTELTPYGDGSNKIFGYENFGNTCY
                     CNSVLQCLYNLPEFRNDMLRYPLGQPKSGKSRKLEMPGLKPRMFLPEHFEPRPTQEVP
                     KKSSSFIKSTFSAVTSSQSNLLEDKASQQTERPLPINLSTKSSTNSLNHDAVKMRSNS
                     EINVGTTNASISNDIPNTEINDNGDSHRRESWVPRKHSTDHPDLTVEGQPNIDKHHSK
                     RVIVGRNYPKLYSAENSDQILQNNIHLKSEHLTNEQRKKSALINGPIVNVDHQIDSSA
                     ESNLYNGLKDIFECITEHSYLTGVVTPSAFIEMLKRENVLFSSMMHQDAHEFLIFLLN
                     EISDFLDKQNKNALNSKIYDSSQGRRNSGTVKNFVSDIFQGTLTNRIKCLTCDNTTAR
                     DEPFLDFPIEVQENVDIDIQEILESFHQKEMLHGPNKFYCDECCGLQEAERVVGLKQL
                     PKTLALHLKRFKYSEQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSGIVVHMGG
                     GPQHGHYISLCKNEKFGWLLFDDETVEAISEQAVLQYTGDKDTMTTAYVLFYQESQKE
                     GISVDHDTNINKLIEYDDWLRTRPPTIIKEEEEEDTPSSGEVIETGRSVTNEDTKKNK
                     TDVIIDKENDKEKKNKSSRRKSKLFGFMKG"
     gene            complement(<445085..>445333)
                     /locus_tag="CAGL0A04499g"
                     /db_xref="GeneID:2886339"
     mRNA            complement(<445085..>445333)
                     /locus_tag="CAGL0A04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444963.1"
                     /db_xref="GeneID:2886339"
     CDS             complement(445085..445333)
                     /locus_tag="CAGL0A04499g"
                     /note="highly similar to uniprot|Q3E840 Saccharomyces
                     cerevisiae YBL071W-A KTI11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444963.1"
                     /db_xref="GeneID:2886339"
                     /db_xref="GOA:Q6FXS6"
                     /db_xref="InterPro:IPR007872"
                     /translation="MSTYDQIEIEDMTFHPDSQMFTYPCPCGDRFQILLDDMFDGEAI
                     AVCPSCSLMIDVIFEKEDLDEYYEEAGIAPPQPIAAAA"
     gene            <447271..>447876
                     /locus_tag="CAGL0A04521g"
                     /db_xref="GeneID:2886292"
     mRNA            <447271..>447876
                     /locus_tag="CAGL0A04521g"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_444964.1"
                     /db_xref="GeneID:2886292"
     CDS             447271..447876
                     /locus_tag="CAGL0A04521g"
                     /note="highly similar to uniprot|P05754 Saccharomyces
                     cerevisiae YER102w RPS8B and highly similar to
                     uniprot|P05754 Saccharomyces cerevisiae YBL072c RPS8A"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_444964.1"
                     /db_xref="GeneID:2886292"
                     /db_xref="GOA:Q6FXS5"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS5"
                     /translation="MGISRDSRHKRAATGAKRAQFRKKRKFELGRQPANTKIGGKRIH
                     AVRTRGGNQKFRALRIETGNFSWASEGVAKKTRIVGVVYHPSNNELVRTNTLTKAAIV
                     QIDATPFRQWYEAHYGQTLGKKKNAKTEEEVAKPSKSAERKWAARAASAKVESAVDSQ
                     FSAGRLYACISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            <448806..>449897
                     /locus_tag="CAGL0A04543g"
                     /db_xref="GeneID:2886353"
     mRNA            <448806..>449897
                     /locus_tag="CAGL0A04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444965.1"
                     /db_xref="GeneID:2886353"
     CDS             448806..449897
                     /locus_tag="CAGL0A04543g"
                     /inference="similar to AA sequence:UniProtKB:P32357"
                     /note="similar to uniprot|P32357 Saccharomyces cerevisiae
                     YBL074c AAR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444965.1"
                     /db_xref="GeneID:2886353"
                     /db_xref="GOA:Q6FXS4"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS4"
                     /translation="MYNVLFSSIERDVDVGINHFSFHLQKGQPFGGIKGIVSGSREVD
                     LIHFISEGSLRYGYWITPGLKYYCVYNSDAELYEIHIDSNGAGYEEKLRRYESQSMLV
                     QYPRLDENDTWYSLTSEIRWYNVSKLFSLTTDDKIAYMDSSMTTIEEAKILQDRLQQT
                     VGHSGHDNKALRYAYINFKSREAIRDTHKMEDFYDKSHYLFDVVLPQQFRDSMSAYMG
                     ELQMSFINAMFFASYGSSMQWHNLLQLLCDSNRFEQYKRLDEVVSVQINNIPEEYFDT
                     LINRECWTKLLKAHHSQLPNTYNSMQTRFPELIPATAGHNDYDCDSDPGTGPVPDPML
                     GSDSEIEMNATSDEEDTPTVVSQVHHRHI"
     gene            <450575..>453700
                     /locus_tag="CAGL0A04565g"
                     /db_xref="GeneID:2886354"
     mRNA            <450575..>453700
                     /locus_tag="CAGL0A04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444966.1"
                     /db_xref="GeneID:2886354"
     CDS             450575..453700
                     /locus_tag="CAGL0A04565g"
                     /inference="similar to AA sequence:UniProtKB:P25302"
                     /note="similar to uniprot|P25302 Saccharomyces cerevisiae
                     YER111c SWI4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444966.1"
                     /db_xref="GeneID:2886354"
                     /db_xref="GOA:Q6FXS3"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS3"
                     /translation="MNRDTADPNYLMIGTHPMSNVPSSLAAAVDTSSGMAPIIEIATY
                     ADTDVYECYIRGQESNIVMRRTMDDWVNVTQVFKIAQFSKTQRTKILEKESTNMKHEK
                     VQGGYGRFQGTWVPLEAAKFMTTKYNIDNPVVNTILSFILNPNNPPPKRHKNSVLRKT
                     SPGTKITSPSSYKKTPKKPNANSASKLSTSYTKRKKNSTQPNPSPLQNMVFRTPQQSH
                     LASIPTSELNMNQHGDTDATINAAYSAMSHSKTNETPLSQGYLATQKPLQFYPVPTNV
                     GQQQEKSRRGFTSFVPFVPEGQDNSHVNNKSDIPAITVDDMSKSQKNVKKRIKKSKFK
                     ESNEVEYMENIPEEGRDQQYGNGNYQSEPVKRQYRKRKVKEQDAYGMYKNKDQYEQDQ
                     AKNYNLHTDAFSYPNGAVADPYNFNDGNALQYNMTIQNDGDEAIKIESYKETLLKVLS
                     SEEDTTRPDYALPAELYHPPANLNINFQIDDQGHTPLHWTAAMANIPLVKLLIGLNAN
                     ALHCNSQGFNCITKAVFYNNCHKNGAFPELISLLKICLITPDKNGRLPLHYLVELSVN
                     KTKDPNVIMTYLDDIVKNLGQGDESLLRMCLNYQDNVGNTPLHLAALNLNLQLCNKLC
                     QLGASMTVSNFNNETPALILTRFNLVPPTNPSMSLPTAPTSSSSNDKNRYYRGESMQE
                     QVYGVNNSLGNPVSVPKSNMMKNSSKTKKVNTRKQQNSQSEDTKFTTMDAGTPNSIIR
                     NVNDKNEEFSTPKINHIHDSNLLDTQDTTGLHTIMDDLSHMESLVTSSVIKDTKMTPS
                     KVLGGSPISPKKHQMHPVGGSYISSNLKNPVPLMDIMASPSGTLMNEDGASEKDGHIL
                     ENIEKFGSASSTLFEGLKSQFQSLQTDVEVSESALSEIASHLESISHQRQALLHSMKE
                     TEGLQSESELHHSTEQLREVVNQTNEMFTQGMENSQALRLAMLIQREESKVETERNNG
                     VSIQESLDYAVELSVLQFKRRLIMHKIREQRCKSTSSTKINKYKRLIGLNVTDINAKL
                     DEIERELTTKA"
     gene            <454151..>455479
                     /locus_tag="CAGL0A04587g"
                     /db_xref="GeneID:2886386"
     mRNA            <454151..>455479
                     /locus_tag="CAGL0A04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444967.1"
                     /db_xref="GeneID:2886386"
     CDS             454151..455479
                     /locus_tag="CAGL0A04587g"
                     /inference="similar to AA sequence:UniProtKB:P38179"
                     /note="similar to uniprot|P38179 Saccharomyces cerevisiae
                     YBL082c RHK1 mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444967.1"
                     /db_xref="GeneID:2886386"
                     /db_xref="GOA:Q6FXS2"
                     /db_xref="InterPro:IPR007873"
                     /translation="MQTVRSEDNPPKKEEFKRPPIDLLQDLKDGINHVVYNPLGNKIV
                     MPLMFLLESVLLKYVIAAIPYTEIDYKAYMEQVEMIYEEGNYNYLEITGGTGPLVYPA
                     GHVLIFRVLNYFTEGMNHIEVGQKIFRYLYLITLLMQYTCYYQLRLPPWCVVLASLSK
                     RLHSIYVLRLFNDCFTTFFMVLFVLLYTLRSNNSTKMSMVISTFGSLVYSMAISVKMN
                     ALLYLPGYLVSTYLINEGKLINCLISASVILFWQVIVSLRFLRSYPVEYLAGAFDFSR
                     QFMFKWSVNWQFLDEDAFQDRVFHTTLLGSQFVAVVAMTLCLYPRLPLDAWKSLKAPF
                     TQVVIADLRFIVPFLLMTSNFIGVLFSRSLHYQFLSWYHWTLPCLIYWSKLPMPLGFI
                     WYICHEYCWNSYPPNEKASILLFTLNASLLCLLAINCMRPVIVNIKRKQQ"
     gene            <456156..>457241
                     /locus_tag="CAGL0A04631g"
                     /db_xref="GeneID:2886407"
     mRNA            <456156..>457241
                     /locus_tag="CAGL0A04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444969.1"
                     /db_xref="GeneID:2886407"
     CDS             456156..457241
                     /locus_tag="CAGL0A04631g"
                     /note="weakly similar to uniprot|P38180 Saccharomyces
                     cerevisiae YBL081w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444969.1"
                     /db_xref="GeneID:2886407"
                     /db_xref="GOA:Q6FXS0"
                     /db_xref="UniProtKB/TrEMBL:Q6FXS0"
                     /translation="MPGKIISIPFLAQNEDMDRYLVKYNENRKTNENSNASNAANNSR
                     SRHNGYNNFHRFHYAKNGPGNSMVDSLSYFNNRNFNAPVSSSTNNEMGNKIRLNGNSM
                     KYNQYKVNDPGQQSNLLMATTQLKQAYSQLYYNVANKGGNEANVASGRAFLPNNQDTF
                     FQSGSFQGNAEFSDKAPIDSLFSSSDARVTGGSAMFSNPTSSPTLDNGFETLSRSNGS
                     LNTNYSRNEALMPNFLDDLLSNSNKSPYPFGKTDLDMDITKGMKNLNIEHGNTSLPPF
                     PFTSNQLPLSSSLAFDLEDKSIPASNEGQQSSLFGIESFKGPLTDNGSLLMSGASSLN
                     WDNNNIPSSSTSSNHLGIWNNDMSVWS"
     gene            complement(<457590..>459218)
                     /locus_tag="CAGL0A04653g"
                     /db_xref="GeneID:2886409"
     mRNA            complement(<457590..>459218)
                     /locus_tag="CAGL0A04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444970.1"
                     /db_xref="GeneID:2886409"
     CDS             complement(457590..459218)
                     /locus_tag="CAGL0A04653g"
                     /inference="similar to AA sequence:UniProtKB:P33893"
                     /note="similar to uniprot|P33893 Saccharomyces cerevisiae
                     YBL080c PET112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444970.1"
                     /db_xref="GeneID:2886409"
                     /db_xref="GOA:Q6FXR9"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR017959"
                     /db_xref="InterPro:IPR018027"
                     /translation="MYKNSIRTRPLKRFISNHAKGKFALDPAYKLKCGLEIHTQLNTR
                     YKLFSYTSNEAENLTISPNTSTSHYDISLPGTQPRLNYEAVLYATKLALSLDSDINLI
                     SQFDRKHYFYGDQPQGYQVTQHYKPFAKNGKLTLYGAYEDINENEKTIRIEQLQIEQD
                     TGKSLYASGADMTTMIDLNRSNVPLIELVTKPDFEDLKQVRAFIKKYQDLVRRLNICT
                     GNLETGSMRIDVNLSVNDFARVELKNLPNTSSIMNAIKFEYERQLHIIKNGEGERLLR
                     DTETRGWTGSETVKLRSKETSIDYRYMPDPEIPFITIADDVVHKVKSTLPVSADALLR
                     EFMNKPYNLPIKHAKILCISGNQNEMYDHEQLRKYYKDVCVHYQKEYPDDNLKIPSNW
                     ILNEFIGNLNKLETKLNEIYEILTPSTFFELIRLMKQGVITGNSSKLLLFHIVNNVKT
                     GVFTKSSQINLKQLINEYELQAADQINEHELEEICRSIIDDIKDEKLLQNLISGKKKT
                     SLKFLVGQGMRLSQGRLNPNELEKMFRQVLDIKW"
     gene            complement(<460159..>460515)
                     /locus_tag="CAGL0A04675g"
                     /db_xref="GeneID:2886410"
     mRNA            complement(<460159..>460515)
                     /locus_tag="CAGL0A04675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444971.1"
                     /db_xref="GeneID:2886410"
     CDS             complement(460159..460515)
                     /locus_tag="CAGL0A04675g"
                     /note="highly similar to uniprot|P38182 Saccharomyces
                     cerevisiae YBL078c AUT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444971.1"
                     /db_xref="GeneID:2886410"
                     /db_xref="GOA:Q6FXR8"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /translation="MKSSFKSEYPFEKRKAESERISEKFQNRIPVICEKAEKSDIPEV
                     DKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTASLMSQVYQEHKDKD
                     GFLYVTYSGENTFGYQ"
     gene            <461930..>462304
                     /locus_tag="CAGL0A04697g"
                     /db_xref="GeneID:2886401"
     mRNA            <461930..>462304
                     /locus_tag="CAGL0A04697g"
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /transcript_id="XM_444972.1"
                     /db_xref="GeneID:2886401"
     CDS             461930..462304
                     /locus_tag="CAGL0A04697g"
                     /inference="similar to AA sequence:UniProtKB:P19955"
                     /note="similar to uniprot|P19955 Saccharomyces cerevisiae
                     YFR049w YMR31"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YMR31"
                     /protein_id="XP_444972.1"
                     /db_xref="GeneID:2886401"
                     /db_xref="GOA:Q6FXR7"
                     /db_xref="InterPro:IPR020373"
                     /db_xref="UniProtKB/TrEMBL:Q6FXR7"
                     /translation="MNPTAAKLAKAYEPMIKFVGTKHPILKHNTDKILPHPCTVNGLI
                     PGGAETVQVADFMKNYTPFQVVPYKNSKANSSTAGSSKYQFTDRALKADEVSSINDLP
                     LRFHYKPIDEAELEVINGGGAY"
     gene            complement(<462716..>463513)
                     /locus_tag="CAGL0A04719g"
                     /db_xref="GeneID:2886405"
     mRNA            complement(<462716..>463513)
                     /locus_tag="CAGL0A04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444973.1"
                     /db_xref="GeneID:2886405"
     CDS             complement(462716..463513)
                     /locus_tag="CAGL0A04719g"
                     /note="highly similar to uniprot|P30657 Saccharomyces
                     cerevisiae YFR050c PRE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444973.1"
                     /db_xref="GeneID:2886405"
                     /db_xref="GOA:Q6FXR6"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR016295"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FXR6"
                     /translation="MNHDPFSWGRPSEQTYGQYDHSIAQASIPKMNTQDPIVTGTSVI
                     SMKYNNGVVIAADNLAAYGSLLRFNGVERLIPVGENTIVGVSGDVSDMQHIEYLLDEM
                     KIENNYDNSSPDDEEALQPSYVFEYLAAVMYQRRSKMDPLWNAVIVAGIEKDGSPFLR
                     YVNLLGVTYSSPTLATGFGAHLAIPLLRRVIDKETDIEKTDLALAEQTIRESMKVLFY
                     RDARSSKKYSLAIIDKDKGLMFKQNQEVENMSWKFAKDIKGYGTQKI"
     gene            complement(<464302..>465912)
                     /locus_tag="CAGL0A04741g"
                     /db_xref="GeneID:2886396"
     mRNA            complement(<464302..>465912)
                     /locus_tag="CAGL0A04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444974.1"
                     /db_xref="GeneID:2886396"
     CDS             complement(464302..465912)
                     /locus_tag="CAGL0A04741g"
                     /inference="similar to AA sequence:UniProtKB:P43621"
                     /note="similar to uniprot|P43621 Saccharomyces cerevisiae
                     YFR051c RET2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444974.1"
                     /db_xref="GeneID:2886396"
                     /db_xref="GOA:Q6FXR5"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FXR5"
                     /translation="MVVLAASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNIS
                     SDHTFLEDEHVRYVYRPFDNYYIILITNRQSNIIQDLSTLNLFSSTVNSYLASYDELE
                     IFDNSFEILSSFDEIVTMGYKENLSISQVETYLAMESHEERIQEIIERNKEIEATEER
                     KRRAKEIARKEQERKLGIYGGEFETANLVANSQNRFMASNDPNVANALNSYYSHASPA
                     AQQSYSKQQHPQSFQNLDNDVASTTRGMKGMKLGGGAQPAMSRKISTPSRPSRGQTAE
                     PEEDKPQNNGILITIKETINAEITRDGVISSSELKGVMELRINDPELAQAKIKLADSM
                     DVKDHSYQFKTHPNIDKNVFTSSKTIGLRDSSKSFPSNDNSLGVLRWRKVGLPDDKAL
                     IPLDVSTWVSPSSDNDGLFEVTIEYESRKDLENILFKVPVYTENVKINEDSDDSNAEI
                     IAIDDEEGITIKVDSCPNGSSGVVSLLVEAEFEDALFPLSIGFTGKAQGSASMVGVDI
                     SAVVGSETAEELPFDKITVIKPEQYVVV"
     gene            <467238..>469040
                     /locus_tag="CAGL0A04785g"
                     /db_xref="GeneID:2886411"
     mRNA            <467238..>469040
                     /locus_tag="CAGL0A04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444976.1"
                     /db_xref="GeneID:2886411"
     CDS             467238..469040
                     /locus_tag="CAGL0A04785g"
                     /inference="similar to AA sequence:UniProtKB:P32608"
                     /note="similar to uniprot|P32608 Saccharomyces cerevisiae
                     YGL252c RTG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444976.1"
                     /db_xref="GeneID:2886411"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="UniProtKB/TrEMBL:Q6FXU0"
                     /translation="MSVLSDSDTEAEVVSRNLCGVVDIGSNGIRFSISSKAQHHARIM
                     PCVFKDRLGISLYEIQYESDTGKQIPIPDDIIDEIVSAMKRFKLICEDFGVPQSGVRV
                     IATEATRLALNCDQFIDAIESSTGWDVELLSREEEEKIDVYGVVSSFYFVNGLYLDLG
                     GGTVNLSWLQTVDGEIKRSSTSVALPYGASALTRRSNTEDRRALFLEIKEAFRKAVDE
                     IQIPNDMIQEAKRTGGFTLMARGGGLRGMGHLLISQNPDYPVQTIINGYSCSYDEFDA
                     LTDYLFLKKRLPSNNKIFKVSEKRRSQLPAVALLMSAVFDVLPRITTIYFSEGGVREG
                     TLYSILPREIRAQDPLLISTRPYAPLLADKYLQLLQTALPEHQIPEIVYQRVAPALCN
                     LAFIHASYPKELQPTAALHVATRGIIAGCHGLSHRIRALIGIALCNRWGGNIPEPEEK
                     YMKALEDVVLNDHNKIEARRAVWWTKYVGTIMYVICGVHPGGNIRDNVFNFAVLKKRP
                     QQGQTTEQSSSHLKRSNSRTIDETLENQMESLSIQSGGNANREFEVVVRISKDDLKTS
                     ASVRSRIITLQKKIRKLSRGSPEKVRISVQFSDN"
     gene            <469655..>470452
                     /locus_tag="CAGL0A04807g"
                     /db_xref="GeneID:2886402"
     mRNA            <469655..>470452
                     /locus_tag="CAGL0A04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444977.1"
                     /db_xref="GeneID:2886402"
     CDS             469655..470452
                     /locus_tag="CAGL0A04807g"
                     /inference="similar to AA sequence:UniProtKB:P32496"
                     /note="similar to uniprot|P32496 Saccharomyces cerevisiae
                     YFR052w NIN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444977.1"
                     /db_xref="GeneID:2886402"
                     /db_xref="GOA:Q6FXT9"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT9"
                     /translation="MAPTLTDLVAKINQSYNSKDFSTCKKLLPAVKIELIKNNILIPD
                     VNNTNEQYLQDILFTRKIFEIGALVSIYTLDFEQFYSYFAQLRTFYFSKNEKLSQSED
                     KSKIISLYLLTLLSEGDVTKFHSELEYFDKHIQNIEEDQLLSYPIKVDRWLMEGSYQK
                     AWGLLEAGSKVPEFDVFTKTLMNAIRDEIARNTELAYKNLPLTSIKALLFINNEKETE
                     LFAKERGWKISRGTIYFHEENANELDEEKLDIVDKALDYAINIESIV"
     gene            complement(<470791..>472251)
                     /locus_tag="CAGL0A04829g"
                     /db_xref="GeneID:2886356"
     mRNA            complement(<470791..>472251)
                     /locus_tag="CAGL0A04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_444978.1"
                     /db_xref="GeneID:2886356"
     CDS             complement(470791..472251)
                     /locus_tag="CAGL0A04829g"
                     /note="highly similar to uniprot|P04807 Saccharomyces
                     cerevisiae YGL253w HXK2 or uniprot|P04806 Saccharomyces
                     cerevisiae YFR053c HXK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_444978.1"
                     /db_xref="GeneID:2886356"
                     /db_xref="GOA:Q6FXT8"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:Q6FXT8"
                     /translation="MVHLGPKKPPTRKGSMVDMPQQLLDQIKVFEEMYTVDGETLRKV
                     TKHFITELDKGLSKKGGNIPMIPGWVMEYPSGKEKGDYLAIDLGGTNLRVVLVKLGGD
                     RTFDTTQSKYKLPEAMRTTKNHEELWSFIADSLQAFLEDQFPEGVKGKLPLGFTFSYP
                     ASQDRINQGVLQRWTKGFDIPNVEGHDVVPMLQKQIEKRNLPIDIVALINDTTGTLVA
                     SLYTDGETKMGVIFGTGVNGAYYDVVSDIPKLEGKLADDIPNDSPMAINCEYGSFDNE
                     HVVLPRNKYDLIIDEESPRPGQQAFEKMSSGYYLGEMLRLALLDLYDQGLILKGQDIS
                     KLKKPYVMDTSYPSKIEDDPFENLEDTDELLQKNLGIQTTVQERKLIRRLCELIGTRS
                     ARLSVCGIAAICQKRGYETAHIAADGSVFKMYPGFKEKAAQGLADIYGWEHKDPKDCP
                     IVIVDAEDGSGAGAAIIAALAEKRIAEGKSLGVLGA"
CONTIG      join(CR380947.2:1..491328)
//
DBGET integrated database retrieval system