GenomeNet

Database: RefSeq
Entry: NC_006026
LinkDB: NC_006026
Original site: NC_006026 
LOCUS       NC_006026             558804 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome C complete sequence.
ACCESSION   NC_006026
VERSION     NC_006026.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 558804)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 558804)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380949.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..558804
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="C"
     gene            complement(<2137..>4284)
                     /locus_tag="CAGL0C00110g"
                     /db_xref="GeneID:2886912"
     mRNA            complement(<2137..>4284)
                     /locus_tag="CAGL0C00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445189.1"
                     /db_xref="GeneID:2886912"
     CDS             complement(2137..4284)
                     /locus_tag="CAGL0C00110g"
                     /note="some similarities with uniprot|P36170 Saccharomyces
                     cerevisiae YKR102w FLO10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445189.1"
                     /db_xref="GeneID:2886912"
                     /db_xref="GOA:Q6FX55"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6FX55"
                     /translation="MNLSSFTPSLRWLIIWTSLIPLLLAKDDYSSSLSNNNLGWTDPT
                     EFPLGCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKV
                     ENVAGNINFYYHAPMGCTSLFDTLPQAYNYRTPLTMTNFTMLLYGYFKPKVTGYHTFT
                     ISADDLLFVNFGAGNAFDCCKRESSADDFGNYQAYAVWGSQTAKDDLTVHLDAGLYYP
                     IRIFFNNRDNDGALSLTLKTESDPNPVIDFSDYFYSFDDTKDGCPGLVSYDTSCASVD
                     SSTIIGVDYLTETPNKNLVPITKTIYHLGIPCTLSTTGKLCSTGFYDPLADSCVPTTI
                     LSTLITSEPSSESSSETLYYSSSRSPSSSVSYSEHTSINSSSPISSITNSTPSLSSQY
                     TSTKFSSITNSTKSPYSPSRSSSSSDISSETNSDSSVYTLPSSSKPITSKTYQKNSTG
                     VMSTSTDVKSTTLCSSVPTSKFGSSRSLESSVIDSTSSFVNNTNHQSFTTESGTTSVN
                     SSNLSTQISRMSSFSTFAKATTKISSSVQTSSHILQSPTTVSYMDHTRNRTEASCSLD
                     ITNKLLFQQCAFNSVPEFHSKTQMSRSQIPFATYTTSSDKSVYYSSSGSASGIMVSIE
                     SSIGFSISKTNSENTKNPHSIILQIQSEEAFTNYATTTETSSKSKLADNNDSTNVGNI
                     QIETIIQGSGSDLVTMSGATVLFFFIVQLFGMF"
     gap             11452..11551
                     /estimated_length=unknown
     gene            complement(<11626..>12939)
                     /locus_tag="CAGL0C00209g"
                     /db_xref="GeneID:2886748"
     mRNA            complement(<11626..>12939)
                     /locus_tag="CAGL0C00209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445190.1"
                     /db_xref="GeneID:2886748"
     CDS             complement(11626..12939)
                     /locus_tag="CAGL0C00209g"
                     /note="some similarities with uniprot|P47179 Saccharomyces
                     cerevisiae YJR151c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445190.1"
                     /db_xref="GeneID:2886748"
                     /db_xref="GOA:Q6FX54"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FX54"
                     /translation="MKLSKSLVAVYALIGVNAIDPTTTLAPTDFRVNMIELQAYLADI
                     KGHMMQYLSFQGAHPDQPYPSQMIGAVMFGNTSPLSEIAPETITMMITGVPWYSERLI
                     GAIASRLADEGIATAWPTSSSSTKTTTTMSTSNSSPTSISSSDSTASSDSTFSSSVSS
                     SSSTSVTSSTSASSSTSVTSSTSASSSTSASSSTSASSSTSASSSTSASSSTSASSST
                     SASSSTSASSSSLYVSALSSVSASSSPSSHTSSVVASNSSSFPTLMSTVSSTESVTSH
                     QEASLSSSVTISSSSVALTSKQTSSQNSAFANKTVSIPSPSTSIFTDTVGKTITKVIT
                     YCSETDNQGNVGTRTSSYTIDASNANLDATGSLVVSRETTTKSRRQDASEAITGKSHS
                     LTSSVSVVELHSSAVISQYAGSAANLSCLSRIGALATLLALLLLS"
     gene            <15916..>17538
                     /locus_tag="CAGL0C00231g"
                     /db_xref="GeneID:2886753"
     mRNA            <15916..>17538
                     /locus_tag="CAGL0C00231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445191.1"
                     /db_xref="GeneID:2886753"
     CDS             15916..17538
                     /locus_tag="CAGL0C00231g"
                     /inference="similar to AA sequence:UniProtKB:P40039"
                     /note="similar to uniprot|P40039 Saccharomyces cerevisiae
                     YER060w or uniprot|P17064 Saccharomyces cerevisiae
                     YER056c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445191.1"
                     /db_xref="GeneID:2886753"
                     /db_xref="GOA:Q6FX53"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:Q6FX53"
                     /translation="MLTLNYSDIESNISDNIFTAETVTDRLGNNHYEDLELKDITFKE
                     KFNELDNKSTETDKDETCFKSPFIIWLKRTLNAETKGVEPINENEKNDTNIFGSSFVW
                     FSANLVLAAYGVGSLGPTVYHLNFAISVLTIVFFNILGLVSVSFFSVFGAELGLRQMI
                     ISRYLVGNVTARIFAALNCIGCVGWDVLNIYLAAKLFAIIKTGGNHLPLWGGCIVIVG
                     STVFIAALGYKFIHIYEKWSWIPNLAVFLIIISRIKISREFSNGPWTSGSTTAGNVLS
                     FGSAIFGSAAGWVTYSADYTVYMPRRTNKFRIFFFNSIGLAFSLIFTMIVGAAAGICA
                     VNNSKWMELYNEFQIGGVTYALLVPNSLHGFGKFCCVILAMSTVANNVPSMYTIALSV
                     QALWEPLTSVPRAIWTIFANIVVLGISIPACYFFQSFMQNFMGSIGYFYALYIGISLA
                     EHCVFRRKFGNYNVNDHSNWEKLPIGFAGCIALIVGSFGVALGMAQTYWVGEIARKIG
                     TYGGDIGFELGMSWAFLTYIIIRPIEIKYYGR"
     gene            complement(<18884..>23710)
                     /locus_tag="CAGL0C00253g"
                     /db_xref="GeneID:2886763"
     mRNA            complement(<18884..>23710)
                     /locus_tag="CAGL0C00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445192.1"
                     /db_xref="GeneID:2886763"
     CDS             complement(18884..23710)
                     /locus_tag="CAGL0C00253g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445192.1"
                     /db_xref="GeneID:2886763"
                     /db_xref="GOA:Q6FX52"
                     /db_xref="UniProtKB/TrEMBL:Q6FX52"
                     /translation="MNYGLIYAFIFWITIWQTVSATKYTDKEIVFDGSSTGTENPVFT
                     DATVLSLVNSKVTIKNYAKVALPAGFFLQNHSTLTIIPIPGIDIPFSLDVNGDAQFNT
                     GSKFIFDGSKTSYSSSIQAINSFHFSFDLGAGGLIVLQDDSFTATLPTYGSYTLGSKR
                     PSIKIGSTITDTLKYSPVLIYGSLTIDQTDRTHLYQIDFGPNKPVVAPGNAPALSVIN
                     TKIYGITNLYANIFQNTIGGSLSTSGLHAYVPQNAFTLNLLYQPTFTNPNEEPYDILF
                     TADQTALITIKNMIQYPSDIYQLQGPFPAIRVLSNGAGVLSSSFSDPNQLLNLAIGSA
                     NVRFRLPKPERKFDLLAIGSNRDLSPNYAIPSYSNVLTIALIGDLVIRPPFTTTHTDP
                     KTTEILLISDYSSSDAANHQWVIGHSTITLYNQPQGDTKIIDLGNGVTEYQVLSYEPS
                     QIQNPANPLKPYATVTRTVLYSPPPVTTLSIDQNHEHIEEVVSYFITTDSNSKIITDS
                     KVISITTKYDPAPDPETNIIDLGNEVTEYVVISYWTTINDQGKVFTTSKVQTYSPPPV
                     TITATTAADYVETDWISFFITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAE
                     TKTVDLGNEVTEYLVISYWTTTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWI
                     SFFITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVI
                     SYWTTTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDS
                     TLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWTTTNEFGGLITTS
                     STRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDSTLFNATRDYNLPEAPH
                     TSFGPAPPAETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSSTRTYSPPPVTITATT
                     AADYVETDWISFFITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDL
                     GNEVTEYLVISYWTTTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFFITT
                     NDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWTTT
                     NEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDSTLFNAT
                     REYIDAEELYISSSSPSSSLSSSLSSSLLLSSSDINYLPSDTYVSTSSISSNISNSVD
                     LSSSISSSSSNFSSDKSTMPSSSALGSDFIPSSSIIESVSMIRSSTVVSDIVTGLGSP
                     TYSLAHSPSSDMSSINSYDSSKLIPEGGFSGSTVHHSSVYSTSKSNVNVTVSESSIIG
                     MGTYDPHSTSTEQQDINEVITSSSLQSTYTGSSLSSKITSSDYLINSQPDTNASHILS
                     HYFATSEDGVVVTSVATISTVSHSHFPAFNEADNSGSSRGNTVVTASNSVINNSETNN
                     TEQSTNIENNNSLTTSNNNQSEIYGTATTLTNSIKHTNDALHENSAISVQTSTSTLPN
                     VSSKSILPTSSIQRTSQRVSEGTFSIDTLYEASGSHHKKSTTLLESMMLIFIIFFI"
     gene            <28113..>28823
                     /locus_tag="CAGL0C00275g"
                     /db_xref="GeneID:2886921"
     mRNA            <28113..>28823
                     /locus_tag="CAGL0C00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445193.1"
                     /db_xref="GeneID:2886921"
     CDS             28113..28823
                     /locus_tag="CAGL0C00275g"
                     /note="highly similar to uniprot|Q04432 Saccharomyces
                     cerevisiae YDR533c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445193.1"
                     /db_xref="GeneID:2886921"
                     /db_xref="GOA:Q6FX51"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FX51"
                     /translation="MAAKKVLLALTSYNGDFYEDGAKTGVFVVEAMHPFNLFTEKGFE
                     VDFVSETGKYGWDEHSLIPDFLSGKDKEDFDNENSSFHKALKNVKAAKDVKASDYDIF
                     FASAGHGTLFDYPKAKELQGLAEDIYANGGVVAAVCHGPAIFDGLKDKKTGKPLIEGK
                     AITGFTDIGEVVLNVDKIMKDKGLLSVEDIAKKYGAKYLAPIGPWDDFSITDGKLVTG
                     VNPASAHSTAQRAIDALN"
     gene            <29470..>31620
                     /locus_tag="CAGL0C00297g"
                     /db_xref="GeneID:2886766"
     mRNA            <29470..>31620
                     /locus_tag="CAGL0C00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445194.1"
                     /db_xref="GeneID:2886766"
     CDS             29470..31620
                     /locus_tag="CAGL0C00297g"
                     /inference="similar to AA sequence:UniProtKB:P46995"
                     /note="similar to uniprot|P46995 Saccharomyces cerevisiae
                     YJL168c EZL1 enhancer of zeste-like"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445194.1"
                     /db_xref="GeneID:2886766"
                     /db_xref="GOA:Q6FX50"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /translation="MSDISLAESIELNSSVPKDDQVFDDEIPDAEVQSEPSEEPPKLK
                     RRLYLEEEDKTDEALSTFVNLEDCLYSNKHVGNCNSNDFMECDCYEDFQNGKNHACGE
                     DSDCINRLTLIECVNDLCGTCGNDCANQRFQKKEYANIAVFKTKMKGYGVRAESDIEI
                     NDFIYEYKGEVIEEEEFRDRLVDYDQKKFRHFYFMMLQSGEFIDATIKGSLARFCNHS
                     CNPNAYVNKWVVAGKLRMGIFAKRKILKGEEITFDYNVDRYGAAAQKCYCEEPNCIGF
                     LGGKTQTDAASLLPQNVAEALGVKASEEKKWIKLKKAEGQKIEKSEAENINIEFLESI
                     TINPCNTATDVQKVMSVLLQIENKTVAQKLLQRLYLSSNEELLHHVIKLHGYTCFTKL
                     LQLFALEEDELKKILYFLERLPKTTKNGIISSHIDFQVKSVCKNHSSLSSIGDSLIEK
                     WKAYEEYKRITKLDINNSTKTKLQDIRRIKLPPGWEIVFENGRPMYYNAEKKTKLLYP
                     PTGASKTFASQKSSSPIPKFKNKRDQNNGIKRKLTDEEYEERKRKRIELEQENIKKAK
                     EEELQRLKAKFNQEREQKQILENIIAEANRKKEEERQNQLKIEKEKKDKKESKKQLSQ
                     ISKMEHKWTKFFASVVPNILKKYESDKKIDHDNMKQCARDIVKILAAKEMKKDSSKEP
                     EATVSKEKRHKIKQFVHGYMEKFLEKLDKKKQRH"
     gene            complement(<32335..>34077)
                     /locus_tag="CAGL0C00319g"
                     /db_xref="GeneID:2886851"
     mRNA            complement(<32335..>34077)
                     /locus_tag="CAGL0C00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445195.1"
                     /db_xref="GeneID:2886851"
     CDS             complement(32335..34077)
                     /locus_tag="CAGL0C00319g"
                     /inference="similar to AA sequence:UniProtKB:P27614"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172w CPS1 Gly-X carboxypeptidase YSCS precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445195.1"
                     /db_xref="GeneID:2886851"
                     /db_xref="GOA:Q6FX49"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:Q6FX49"
                     /translation="MAEVDVEKQRMVAVKSSRRKFWGKLLLVLYIVFIGFDNTYLGSS
                     FSPFSFIPGFFNSEETGLNCPANKPLTPDFKNSLDTILFDPEYKDKSIKRLSNAVRIP
                     TVVQDINPDPKEDIEYYNNFFKLHDYFKDTFPLVHKNLKLEKVNEVGLLYTWEGSNKE
                     LKPLLFMAHQDVVPVNNDTLDQWTYPPFEGHYDEENDFVWGRGSNDCKNLVIAQFEAI
                     EQLLEDGFKPNRTVLLSFGFDEEAGGQLGAGPLAQFIRERYGDDSLYAILDEGEGLTK
                     IDDNTYIAAPVNAEKGYVDVEITVMGKGGHSSVPPDHTNIGIAAKIVTLIEDNKSPFK
                     MTLDNPLYGTLVCAAEHSTKIDAQFRKTILAARKCKSAMKRLTRVIAGIPILRDLIRT
                     TTAVDIFQGGVKANALPESAKFLVNHRIDLKSSVEETLQEDIKMVQKIAEKYNFGVTR
                     DGEQIIRPITENGSIDVSISKALEPAPRSPTSGKVWDILAGTVVDVFENNFFKKDNGS
                     VYVTSGLFSGNTDTKHYWVLSPNIYRFIGSVIDPELAKTLHSVNEHVDMPGHLSAVAF
                     VYEYILNVDQYGDE"
     gene            <34815..>35165
                     /locus_tag="CAGL0C00341g"
                     /db_xref="GeneID:2886867"
     mRNA            <34815..>35165
                     /locus_tag="CAGL0C00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445196.1"
                     /db_xref="GeneID:2886867"
     CDS             34815..35165
                     /locus_tag="CAGL0C00341g"
                     /note="highly similar to uniprot|P26755 Saccharomyces
                     cerevisiae YJL173c RFA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445196.1"
                     /db_xref="GeneID:2886867"
                     /db_xref="GOA:Q6FX48"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="InterPro:IPR016588"
                     /db_xref="UniProtKB/TrEMBL:Q6FX48"
                     /translation="MASETPRIDPSEITSNTSPVFRIIAQVKSQPSENTLILASPTTG
                     GEMITLDSVRVSMNKTFDVDSWYEFVCRSSDNGDVGFLVLDAVKCVLNENEEISVNGI
                     IALQQLTKKFPEIY"
     gene            complement(<35769..>36599)
                     /locus_tag="CAGL0C00363g"
                     /db_xref="GeneID:2886951"
     mRNA            complement(<35769..>36599)
                     /locus_tag="CAGL0C00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445197.1"
                     /db_xref="GeneID:2886951"
     CDS             complement(35769..36599)
                     /locus_tag="CAGL0C00363g"
                     /inference="similar to AA sequence:UniProtKB:P39005"
                     /note="similar to uniprot|P39005 Saccharomyces cerevisiae
                     YJL174w KRE9 cell wall synthesis protein or uniprot|P50112
                     Saccharomyces cerevisiae YDL049c KNH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445197.1"
                     /db_xref="GeneID:2886951"
                     /db_xref="GOA:O74683"
                     /db_xref="InterPro:IPR008659"
                     /translation="MLLLAILLSLFALIRADVNIVEPGPGDTFSGADGTVSINLKWVD
                     NGAYPPLDKVAYYLFSLCYGPNTKIQCVYKPDTKITPDDLDKDDAGTYSYKFDIQSSV
                     VGSGQFYVQVFAWVDGQGYTLHYTPRIELTNMGGPTTFELLTYTDTIQPVPQTSIRTG
                     TDTNTQSFDASSVYSLPYTEQTLKTRVAPIQQQPGTKVTATTWSRRYPTSAVTFYSTF
                     RSSLDQLSTLTPAWNYTVSSAVNYATPAAMPSDNGGWYNPIKRQSLSTRKLNVRYLSS
                     "
     gene            <37253..>39814
                     /locus_tag="CAGL0C00385g"
                     /db_xref="GeneID:2886904"
     mRNA            <37253..>39814
                     /locus_tag="CAGL0C00385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445198.1"
                     /db_xref="GeneID:2886904"
     CDS             37253..39814
                     /locus_tag="CAGL0C00385g"
                     /inference="similar to AA sequence:UniProtKB:Q12072"
                     /note="similar to uniprot|Q12072 Saccharomyces cerevisiae
                     YLR095c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445198.1"
                     /db_xref="GeneID:2886904"
                     /db_xref="UniProtKB/TrEMBL:Q6FX46"
                     /translation="MRRSRRVASAASAEVVEPVEPVEPVQSTQSVRTKRKASDDPVPI
                     EDWQQYISEDTLRVYYKQVRPKVEIPYELLADDEDREALVHSWEYQYVLSWLYNVCES
                     FRTQHSSIAEYIIDTTGPIRTYWKDLKFDENLLWIDFHRVFPHIRLNLLKNVANNKSI
                     TMDQWDELLENHVGITDKFDDMRLPDQFNVLYRMIKFIEARNLPFRNYLSNYLDLFDF
                     YHTELDEHRYLIALPAIGVLIERQLTRDDNDKELAVPIKLKNCTVQNKTDKSIELIHL
                     DYSKEIDDYMHSVKFETTVLTTDFESFLEYWRNHKKNKQINEFCTSMIPDLIEHILYA
                     SKSMTMKEKEDSLAELMTRRKRSSRLVAKEKEVEKEEEQHKWLDKVTDRDQFIKHRNR
                     VVGKFAKKVKDVIRNEIWYKFEQELKTEKLRRRNDPRLNTDSFGPSDEDPLGPMDWQI
                     INDNPVFKENVVSMPPSHITDELKEVLPNLTELPSNLCITNEDIEERKKEGLPTDNEQ
                     LDIQDWLFDCPGETEPVTTLVSHEKEPEDPRIVNHSLVCCAECFRWQHWAHQPSKITE
                     ILTYASLKPSMLNDNIDHQLTEKDLAAVSYASTAPLPSILPSRRSVRARTADSREESR
                     EPEVQYNRPVDKRKPLGEFTLFVCGWCMENFESSIRSSFIPELQAIRLKQKKQFEYRM
                     KKKREKEELKKAQAQLSNNDSNGNTSSFKTKVTNPTSTIDNGMHNSFATHQPVSNQLP
                     QVSPVVNPITQEEALNSNQQLPIMNAQQVPMDNIQQASMYNSPQLPINNVQPEVPTIT
                     HNVNAMPNNFVGHTQMNGFQAVSATQLEIHPTTEHPITDAQSQAHQRFAPPSDSL"
     gene            <40815..>42467
                     /locus_tag="CAGL0C00407g"
                     /db_xref="GeneID:2886906"
     mRNA            <40815..>42467
                     /locus_tag="CAGL0C00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445199.1"
                     /db_xref="GeneID:2886906"
     CDS             40815..42467
                     /locus_tag="CAGL0C00407g"
                     /inference="similar to AA sequence:UniProtKB:Q12418"
                     /note="similar to uniprot|Q12418 Saccharomyces cerevisiae
                     YLR094c GIS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445199.1"
                     /db_xref="GeneID:2886906"
                     /db_xref="GOA:Q6FX45"
                     /db_xref="UniProtKB/TrEMBL:Q6FX45"
                     /translation="MYYPRVHIDSTTAIMSHPLLHTRRCKSTSSLSSTRHLSFSGTRR
                     QSFNMFDDHDNNTPSISGCKVRYTRRKRSIKRNKTETPTLNNNKNKDSEENVVFTTNI
                     TPSLNSVLSQIKNSNNLSNKASVDLLAKSENTGSTSPHLKPTDSGILLKRKLSDETHN
                     CNINTDSGFNFRESLKLDTLSDAEDLSFSRDEDISNLSIATMEIHPLTEEMTPDKMNS
                     HNEDNSTDIGKIIDDNLAPKLKIINIDDLDLNDHWKVDELSEVLPPIFHRSYGYVKPV
                     SSLERITDNDSISISHRVQENGRRNSLDLSFTGMKPTQGQMTIKTSPYSAASNIIYGK
                     DSVELESWPEANFAPSSKSNKLTRDNMEKSSNQQHDLVPLLLSDKRVRANSLNGNFLK
                     LYSIKTSATYKSLIPEVNVDESVLQQLSYKDIWNLDIHETDVAPKDIKIALITKKKLW
                     SDLLHQTRRDLYGEHTPWNMKFVVQDTDPVANIDNSTEERRVSLVRLKSEVKPWTTNE
                     DLSSELSGTRMLKPCGKLKLTSKGPNKEIQYVVKGWCDSRFQ"
     gene            <43086..>43790
                     /locus_tag="CAGL0C00429g"
                     /db_xref="GeneID:2886913"
     mRNA            <43086..>43790
                     /locus_tag="CAGL0C00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445200.1"
                     /db_xref="GeneID:2886913"
     CDS             43086..43790
                     /locus_tag="CAGL0C00429g"
                     /inference="similar to AA sequence:UniProtKB:Q12255"
                     /note="similar to uniprot|Q12255 Saccharomyces cerevisiae
                     YLR093c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445200.1"
                     /db_xref="GeneID:2886913"
                     /db_xref="GOA:Q6FX44"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR019005"
                     /db_xref="UniProtKB/TrEMBL:Q6FX44"
                     /translation="MKRFNISYVEIIKNGVSVSSCYENDSSTYGATNEGACRPDIFHS
                     LVVDMVVPKVIPVSGNKVTKMSTPLIDGFDCYYTTRDDDANTVLVCFTREDIPKILPI
                     RVLSELKHNEAHEIDNDNKLSACVGNILDNFHNELIQYKNQNGIKGGNEAEDDMQEVI
                     QIMNDNIDKFLERQERVSLLVDKTSHLNSNSRSFKRKAIKLKERMWWRRMKNYTLMIF
                     AIILCVSAISMFFYLW"
     gene            complement(<44179..>44712)
                     /locus_tag="CAGL0C00451g"
                     /db_xref="GeneID:2886725"
     mRNA            complement(<44179..>44712)
                     /locus_tag="CAGL0C00451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445201.1"
                     /db_xref="GeneID:2886725"
     CDS             complement(44179..44712)
                     /locus_tag="CAGL0C00451g"
                     /inference="similar to AA sequence:UniProtKB:P38276"
                     /note="similar to uniprot|P38276 Saccharomyces cerevisiae
                     YBR137w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445201.1"
                     /db_xref="GeneID:2886725"
                     /db_xref="GOA:Q6FX43"
                     /db_xref="InterPro:IPR005624"
                     /db_xref="InterPro:IPR010371"
                     /db_xref="UniProtKB/TrEMBL:Q6FX43"
                     /translation="MKLDGTLLTKLEKGKLSLEEIDKLEKKCFLSKFDSEDAYELGQF
                     VRREVAETFPNKAVAINISLVNDHVLYHTVVGVASNDNDYWISRKKKTALRFGHSSYY
                     MRIAKGDKTPQEKFFVDPKDYAFHGGAVPIFLENSDYPIAILTVSGLKQHEDHLFAVT
                     SIIEYANKSREATLNLD"
     gene            complement(<45221..>52360)
                     /locus_tag="CAGL0C00473g"
                     /db_xref="GeneID:2886754"
     mRNA            complement(<45221..>52360)
                     /locus_tag="CAGL0C00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445202.1"
                     /db_xref="GeneID:2886754"
     CDS             complement(45221..52360)
                     /locus_tag="CAGL0C00473g"
                     /inference="similar to AA sequence:UniProtKB:P38111"
                     /note="similar to uniprot|P38111 Saccharomyces cerevisiae
                     YBR136w ESR1 cell cycle checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445202.1"
                     /db_xref="GeneID:2886754"
                     /db_xref="GOA:Q6FX42"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012993"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR027011"
                     /translation="MESQIRYIDELIAGFNGSCKIERVNEGNCAAQSSNTEERKLIQA
                     VQALLRILNDLNHNSADLIFQKCLGGLDRILHHNPYIMALSISSEDSGNLMIMDLIDK
                     MLGLTERCSYNIHRMWYIRRNIIRWITSSTRLFGSDFKRIINLKIKKILNELETKCKL
                     FLFTHQNVEPQEFISTLTLLHTILYWISADSNKLGDYFYWIQGSSSLNEWDLHFQKYI
                     RIAMYLFTSFQIKIDANSSYFEKFNLLQANFIMLVANYQTSRTLSGGFNSIAISIQHL
                     KFTLEVISEFMRNRSFLSKNETLITKSLLKIYYLSVCKASSNKNDILSIFLDYIPVVE
                     CINSKHQFNENYDSELERSLLLLYFDMKRRYADPDELQFIDSFDIWSHPDCIDEVSII
                     TQPIKKNSKQIEKLQRSILKSYTVNIKQIHSFLFKELNSLEPGILDRNGDHYKAVVKE
                     ISISIKRSLKIRDSKKIITWLRVLSRMACIEDKLINTKQNISEFFHTTNDFCNYCDSI
                     HDGNFLNNIEPSRPLAQDQSEIFSMINKYFILNPDLKKFSMSIKCGLFIVIERIFAHF
                     QPTALMNENNQIAPLFSFIEDSFIDSDRHVRLLICKILPLWNTSNHNNSEDEMSMHLI
                     QFLQKVNSPLLLETVVLSWSKITLTTHGDVFDTLLLKLIDLFNSNNFTLHIMMKEQLI
                     RMSSLLNKTPYQLLSPVLPIILRQLSKNLNEKKLSFQRLCDLVGYTGKVILDIFQKYV
                     IPYATVQYKSDVFSEVAKIMCDDDTSMLLQQKHNLLTKNSRQIFAVALVKHGFFSLDT
                     METLFLNRVPSYDRRYIGAYLPDYKTLAEVTKLYKNNEITDSSDIENENMVLCSLRYL
                     ITNFESDKRHGTEYKDINKWSDKKENQFQNNLQDNILGIFQVFSSDMHDVEGKTTYYE
                     KLRVINGISFLVKHASNKCIISALAQLSICLQSGLEIPEVRYLSMRCWFLLIQRLNEE
                     ELTTVIDAPVAFILRKWPTFNKKLQLKALEVLTALIRTKNSLLMKMKPYISISLLSNE
                     SIPILDIDTNFSRQAARLRNTIDLVPIFVKNLQSNNKFVIEQNLDDIKFHLKRRQGEL
                     LQYDKYGNLQLNAVPSLIGALLEVAHKYRTIDHEICKKCAKCISMVGVPDIRRIDLRG
                     DRKEKWKVFDFNDYSKTTEFLIWLIDDILVPSFWQSENPNKQLFFALVMQESLKYCGL
                     SSQSWDINEPDKFPEQLELWNKFNSISKTTLYPLLSSLYLAQSWKEYVPIKYPSLNFR
                     DGYKTWIKNFTLDLLKTGTTEDHPLHVFSSLIREDDGSLSSFLLPYIAQDIIIKAQSG
                     TEYESLMDNILIELQSVVTYEIDGLNHLQRDSLKMCYEAVFSILEYCKKWATMFRQDY
                     NNANGTFLIKEDKYLKMLKRIDYFINSIPLDLLANKSLETNAFERSALYLEECYRHSD
                     IHDRNLNSTLKSLQMTYEEIGDIDSIDGLLKSFASTSFETKIEELQYSNKWQMALECF
                     DILADITKHDSTAQIMTKSMFDHHLYKNVIQTVPKLVPDNIQKLNESNTNLLIRALES
                     SILEGDLKSIEKWSSKIELMTTINDPELTLQYNLGKALLSISKGNHIKAGQFLDNCYQ
                     ITGIQYTSTSNSTTLLKTQSLLTKLHGLHDLNMLNFSKDDFELQSNMQLLDLRRGKVG
                     PDFDPNYYILSIRKTFDKIHKNPITKTDLVDTYFAIAQEARVNSRLDIASKALIFCLE
                     KGHPYSELEFAEILWKDGENDRALKLVREINQKNEKSSSVSVRNKAEVLLKYTEWLDI
                     SNNSASEQIITQYKNIFALEPEWEQPYYSIGLYFSRLLERRKAEGYVSDGKLEFKSIS
                     YFLLAFEKNTVKVRENLPKVITFWLDTAAAVITETSPNRNTILKKVTTDICKQIETAI
                     RNCPTYIWYSVLTQLLSRLLHPHLSSAKLIMHILLSLAVEYPSHILWHISVLCQSNSS
                     KRVKCGQDILEKFRAHSDNQEDIINSSIYLTSSLTRICLQEVKSSSSRSGRSLVSDFK
                     FDVNIAPTPMTVPVRKNLEMISPLSAETMKSYQPFRPTVSIAKFASSYKIFSSLKKPK
                     KITIIGSDGMLYEIMCKKEDVRQDNQYMQFAATMDFLLSKDLDSSKRDLGITVYSVLS
                     LREDCGLLEIVPDVVTLRSIFTTKYESKKIKYSMKALYEKWQGLADELKPVFFNEQTK
                     KFSPVLHEWFLENFPDPINWYRARNLYSRSYAVMAMVGYILGLGDRHCENILLDIKTG
                     KVLHVDFDCLFEKGENLPVPEIVPFRLTQNLQDALGILGTEGTFKKSSEVTLSLMRQN
                     EVALMNIIETIMYDRNMDHSIQKALRKLRNKIRGIDPRDGLLLSVSGQAETLIQEATS
                     TENLSKMYIGWLPFW"
     gene            complement(<53079..>53465)
                     /locus_tag="CAGL0C00495g"
                     /db_xref="GeneID:2886750"
     mRNA            complement(<53079..>53465)
                     /locus_tag="CAGL0C00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445203.1"
                     /db_xref="GeneID:2886750"
     CDS             complement(53079..53465)
                     /locus_tag="CAGL0C00495g"
                     /note="highly similar to uniprot|P20486 Saccharomyces
                     cerevisiae YBR135w CKS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445203.1"
                     /db_xref="GeneID:2886750"
                     /db_xref="GOA:Q6FX41"
                     /db_xref="InterPro:IPR000789"
                     /db_xref="UniProtKB/TrEMBL:Q6FX41"
                     /translation="MYNHYHTFEGRKLTEQERARVLEFQESIHYSPRYSDDTHEYRHV
                     MLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKR
                     PLNYEAEYRAAAAAAAASQQHQQDKE"
     gene            <54154..>56700
                     /locus_tag="CAGL0C00517g"
                     /db_xref="GeneID:2886760"
     mRNA            <54154..>56700
                     /locus_tag="CAGL0C00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445204.1"
                     /db_xref="GeneID:2886760"
     CDS             54154..56700
                     /locus_tag="CAGL0C00517g"
                     /inference="similar to AA sequence:UniProtKB:P38274"
                     /note="similar to uniprot|P38274 Saccharomyces cerevisiae
                     YBR133c HSL7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445204.1"
                     /db_xref="GeneID:2886760"
                     /db_xref="GOA:Q6FX40"
                     /db_xref="InterPro:IPR007857"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FX40"
                     /translation="MKSNVFVGVKPMVGTVNGTETDLKDDVDYILAPVTNGRYREIVS
                     RVISENRKSGDPLDHYSIDVPEPQLQEIGIPPFNDDPKQYIGLLASWLDLETADPVLR
                     DVAFQVLLNECKYSRFIGVSKLIVAPPKNVLEIQKYARMVADLLNDPVVTEMPQLTLS
                     ISLPLCELSDPLATWELWNTIKNLCGAHECLTVSLALPKNKTPTHVLERWLTEPVSCL
                     LLSSSIFVTNQHGFPVLQKYNQNIIFRFQEINGRNMLGQNELCIIMHGLEKFANDVKG
                     GKASFINYINFILKKGDKLILQNMSKMLKACEKLAEPRILPQLKPHSEDLSNQTYALF
                     EEDIVKYDLYEVAIKDAILENTKIWKNRGSSFITILVAGAGRGPLVDRVFKVLQELSI
                     LSECRVIAIEKNSRAYLYLQKRNFDKWQNRVTLINEDIQNWQINMAESQRTKVDLCIS
                     ELLGSFGCNELSPECLLSLQKYHSQKETVYIPQSYSSYIAPIACPVLDMQLQKMCKQD
                     LHVNVTQQPWVLHNIPYQTLSSKVNELWTFSHPMSEASNLQHDIVSEFKIKHRAEVNA
                     LIGYFSAVLYGDVILSIVPEGTIVRVPQSKNNHEGEALHSTPDKSAHTNDNKYYFKKI
                     DKTPGLTSWSPMIFPLSQPLLVSDDTELSVMMSRRHNGKYTWYEWSLESYVYMVVTST
                     STASDATMEVITPNNNAHNVTQEESKRVTSPHPYAPGWTFSANKSKDAQPLSKRKISN
                     SSPFDKQQKLYSGRVSIDNEEMHHQDFEEGDTNNQINGWTNGWTSVNDLHRATEAIVP
                     AYDIGNEPQEKIEKEKEIEKEKEKEVHIRVKTGVTMLHNSRGRCSRIELR"
     gene            <57175..>59502
                     /locus_tag="CAGL0C00539g"
                     /db_xref="GeneID:2886764"
     mRNA            join(<57175..57177,57724..>59502)
                     /locus_tag="CAGL0C00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445205.2"
                     /db_xref="GeneID:2886764"
     CDS             join(57175..57177,57724..59502)
                     /locus_tag="CAGL0C00539g"
                     /note="highly similar to uniprot|P38090 Saccharomyces
                     cerevisiae YBR132c AGP2 amino-acid permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445205.2"
                     /db_xref="GeneID:2886764"
                     /db_xref="GOA:Q6FX39"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FX39"
                     /translation="MKSIQRIILFFLETPLHAHIQMSKIDDKFPSVIKNSAFEEGIEE
                     RFFESDDVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGTALFV
                     AIGKPLYRGGPANLLLAFALWCIPILCITVSTAEMVSFMPVSSPFLRLAKKCVDESLG
                     VTASWNFWFLECVQIPYEIVSVNTIIHYWRDDYSPAIPLVIQVVLYVLISVCAVKYYG
                     EMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGESPFKKYFPDGNEGAGK
                     SAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSC
                     LCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAG
                     NAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVV
                     LNWLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVSV
                     LIMILLQGYTVFFPKLWNGRDFIFCYLMVFLDIGIYVFTKFIWYKGKDPVKSPNSIDF
                     VPELKEIEQHELEHSFDKFKYYYYDEA"
     gene            complement(<59854..>61893)
                     /locus_tag="CAGL0C00561g"
                     /db_xref="GeneID:2886768"
     mRNA            complement(<59854..>61893)
                     /locus_tag="CAGL0C00561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445206.1"
                     /db_xref="GeneID:2886768"
     CDS             complement(59854..61893)
                     /locus_tag="CAGL0C00561g"
                     /inference="similar to AA sequence:UniProtKB:P38273"
                     /note="similar to uniprot|P38273 Saccharomyces cerevisiae
                     YBR131w CCZ1 Calcium Caffeine Zinc sensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445206.1"
                     /db_xref="GeneID:2886768"
                     /db_xref="GOA:Q6FX38"
                     /db_xref="InterPro:IPR013176"
                     /translation="MSQSQSHGSGSPLKYVIVFRPGENKGEQEDSVVSEQLLLHHAFE
                     DTELITLSAKLGKIGIIQALWTLSEDTNDTCKIIETEQETMITIKVEGEFYITLAIGV
                     DPDLLAIPNPIFEGHLWNCYHFFTIKYGDFTSFEKHVLTDLLNEHFVSFWNDLYRKPE
                     SLTRNFLQYLCHDFYKVADLDPNGDKQWEATIIQDLLVQTENYLGIKDILVYNIPSTE
                     STYVGKCKYGLIRNFCNEFEDLGHFSNWLQHIHTVFGKISSHVLAENVHYELHSGQLE
                     QTNSDGIRDGNDLNLSDNNNETDSNTFSQLSTNFMHNLTLPITFAYDAIQEVGNTTGI
                     NNSVSLFMNYLPKWQNNSTASENEKNKTKARYGYLISPLAFDSLPKSYKLKKMHLKFN
                     GEERKPYHVLFWYYNDVLVVIICNESFDSIWSKEYLNELNKHLENSIKTLYDQNLYDL
                     PNTDNHSNKKNDILNFAYLITDKKRNKLYSSFPDLSWFNEQQETLYRTTLELVSNGLE
                     QLRPQITANELSITTIDSNKQWGLDIMGNILSMLPSNSPVPVTKDASIPLMKKLNFLD
                     KLNEKVLRDISIETLRAIETLSQSINSNIQEEKLLKTSDGILLYIRNDCNNLTIILKN
                     WIQDTKHQTRALKYKNHTLNSYSTSIEDSNLFKNLGPDVISWYSEYKQILQDDSS"
     gene            <62224..>63396
                     /locus_tag="CAGL0C00583g"
                     /db_xref="GeneID:2886844"
     mRNA            <62224..>63396
                     /locus_tag="CAGL0C00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445207.1"
                     /db_xref="GeneID:2886844"
     CDS             62224..63396
                     /locus_tag="CAGL0C00583g"
                     /note="weakly similar to uniprot|P38272 Saccharomyces
                     cerevisiae YBR130c SHE3 required for mother cell-specific
                     expression of HO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445207.1"
                     /db_xref="GeneID:2886844"
                     /db_xref="UniProtKB/TrEMBL:Q6FX37"
                     /translation="MAENTSPTKLGQQYNLHVMNMQSPNRFDFENEDTRNSTSGSVYG
                     TDNERDIWSANARGTPLSFSSSGNNDGDSAKADASTLPSASFGGGGSNISSKVIESLN
                     VQVDTLSNTNLQLTSQYQEVLKKLQDAVDREAEWSETVSKLQVHNREINTALEDKTAE
                     LKECDNNLLAIKKEYEQITTENSKLASDYKELSKSLGSLRGQYAKSKIRKNILQSLQE
                     EYKQACNDEIEAVRNNLDMVESKIGHYNSDEKQKLDDILDAHSVLEKEVTSRKLENET
                     AIEELETKWNDLSTKVHLESITEHYSSFKSELTELCEKMDIPVKQFPQTTRNRTPNMV
                     MERSRFRKPTPDASKRASFYGITSPMLQQGFKIPDVASSSAGKPKNSVLPGVKSKR"
     gene            <63957..>64904
                     /locus_tag="CAGL0C00605g"
                     /db_xref="GeneID:2886861"
     mRNA            <63957..>64904
                     /locus_tag="CAGL0C00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445208.1"
                     /db_xref="GeneID:2886861"
     CDS             63957..64904
                     /locus_tag="CAGL0C00605g"
                     /inference="similar to AA sequence:UniProtKB:P38271"
                     /note="similar to uniprot|P38271 Saccharomyces cerevisiae
                     YBR129c OPY1 pheromone resistant yeast 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445208.1"
                     /db_xref="GeneID:2886861"
                     /db_xref="GOA:Q6FX36"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR016609"
                     /db_xref="UniProtKB/TrEMBL:Q6FX36"
                     /translation="MVNSQEVLVSSYLKKKPTLSTTALSKKLEGNDQEHPQPSGSHHG
                     HLYSPPLRWPRHGDHVYWCVLRRGQFSYYKTKDEKEAINVLPRKDILNYRVLKNDKTL
                     LVYTKDKTLRFKCEPKILDLWEEGFKKLMEERDLKVDTRFADENTNQHAIIDENEDED
                     DEDDDEGELYLEFAHVSPTTPDNNGSTLGSKISEEDRKFFEKYDPQKPEHVIMSTTLY
                     ARIKTRFNRRKWKKFKVELSNRCIKLYSIKTGNLKNQFDLVNVIDCVEYESKDLQPVF
                     SLISVNHRIKFKAKTEQLMIDWIVNIKSVILASRKTVSK"
     gene            <65389..>66483
                     /locus_tag="CAGL0C00627g"
                     /db_xref="GeneID:2886881"
     mRNA            <65389..>66483
                     /locus_tag="CAGL0C00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445209.1"
                     /db_xref="GeneID:2886881"
     CDS             65389..66483
                     /locus_tag="CAGL0C00627g"
                     /inference="similar to AA sequence:UniProtKB:P38270"
                     /note="similar to uniprot|P38270 Saccharomyces cerevisiae
                     YBR128c APG14 required for autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445209.1"
                     /db_xref="GeneID:2886881"
                     /db_xref="GOA:Q6FX35"
                     /db_xref="InterPro:IPR018791"
                     /db_xref="InterPro:IPR023261"
                     /translation="MGMQCPICETQSHVFYCAHCINSSPDLLIRLKFDLYILGKINNA
                     LRNKVDQYLEEVDDELNTNIRNGEQLESNIGVQILKERLGKVQVLRKERQNNKIKHKI
                     SQQDRRIKEKSRYIAELRSLINGPPKNQNRFTDPQTILKAQKQLQDKLEIAKRLSIQT
                     RSEKLAMLNKWYSIRKRDSHDIPFTISYQPVISLKNFNRLPLPLIEGSLRKLIQYMNL
                     LEHIYCIKYPSAMFVHEDEMLSLQGHSAKLKRNAPELLQVLIKLIQMILVVMTRSKLI
                     DERKQNIDYAWILDQYDIDGLFYHMAMSIPIDTKSGAKNIQWSTDRLVDIVCSSLGAE
                     KEEVLLKDHKKLEPPTDKKYEVSDRWYIVG"
     gene            <66983..>68512
                     /locus_tag="CAGL0C00649g"
                     /db_xref="GeneID:2886903"
     mRNA            <66983..>68512
                     /locus_tag="CAGL0C00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445210.1"
                     /db_xref="GeneID:2886903"
     CDS             66983..68512
                     /locus_tag="CAGL0C00649g"
                     /note="highly similar to uniprot|P16140 Saccharomyces
                     cerevisiae YBR127c VMA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445210.1"
                     /db_xref="GeneID:2886903"
                     /db_xref="GOA:Q6FX34"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005723"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR022879"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FX34"
                     /translation="MTISDKELFELNKKAVENGFKIDPRVEYNTVSGVNGPLVILERV
                     KFPRYNEIVNLTLPDGSIRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGQNMRI
                     PVSEDTLGRIFDGSGRPTDNGPKVFAEDYLDINGSPINPYARIYPEEMISTGISAIDT
                     MNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVN
                     LETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLT
                     ILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPI
                     LTMPNDDITHPIPDLTGYITEGQISVDRQLYNKGVYPPINVLPSLSRLMKSAIGEGMT
                     RKDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFISQGAYE
                     NRTVFESLDQAWSLLRIYPKEMLNRISPKILDEFYDRSREVEEAEADEQDPDQREESL
                     I"
     gene            <69396..>71900
                     /locus_tag="CAGL0C00671g"
                     /db_xref="GeneID:2886905"
     mRNA            <69396..>71900
                     /locus_tag="CAGL0C00671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445211.1"
                     /db_xref="GeneID:2886905"
     CDS             69396..71900
                     /locus_tag="CAGL0C00671g"
                     /note="weakly similar to uniprot|Q05812 Saccharomyces
                     cerevisiae YLR219w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445211.1"
                     /db_xref="GeneID:2886905"
                     /db_xref="GOA:Q6FX33"
                     /translation="MGFLTKKERRVPDLSRYDYHYQNKPAVDSSKYYVPREYGGKRLS
                     ASAAAAAIYTNPNPNATGVSRSYSLMHSYNPAAARQPPAGRTYSLRSDRASSITSNSR
                     RPAAGKAQVRRASTQQRRASVDQELGTGVNQPRTNSITVTTTKVRDPQGRTKSITKKT
                     VRRINGYEVVETTTTTTTTEPLPTQNGKMPANMDLVSVEDGTDVEEEHDDGLPSPQAH
                     FDEFSGDFVAEDDLSSEVLQHQQQQYIEDIVEEETEEEEDPGHTGTKRLPGEFNEPPR
                     TNIAARRSNSLTGSLSSLGAKKTISEEVPLDQTSSVSKFSDAMEYIPPTTTTAKPKKS
                     NLRNSMTARKLAQPQQGQNQRRTVSFTQGSIDHMNTTKKKKQPLTEQEMYLQALEVAK
                     KKVYKTDDPAVVGNAANNSNKRVSTMGKRMTLRDSAPVPRSSSMMMNKFHDQGSARNN
                     VAQQQTDVRRSKSMTGSAVPPQAGKKKLTDEEMYEKALEIAQKRYNDLVSADTAAVGA
                     ASVGAASAATPVASTAPKKSGFKQRFTKTFHTDDNKSKINNASAGGMVSGGAAAVEVA
                     PGVTTTDPVVAENVNEASQIERMDNVEMASASAANEYAAPAAGFRATSAPLYQSRSAE
                     PVGAYAAPDAPISKYKIVDKILKFAQSNYGYQAHDDEEAAMVAPASAPATAPAGTSMA
                     QPVVVPVERRSSVGKHGNTTTLPVETPLADNASESSFRHTHPQEQPVPLSQIEKKISV
                     VSETGSRKAAPAATAAKTPATAPAMSYGTAKTPFIDIDAVDALSGHVPFEEATRHASV
                     ATAATAATGGTTGTAATTGTGTSKKKSFLRKLFGRK"
     gene            <72387..>73334
                     /locus_tag="CAGL0C00693g"
                     /db_xref="GeneID:2886907"
     mRNA            <72387..>73334
                     /locus_tag="CAGL0C00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445212.1"
                     /db_xref="GeneID:2886907"
     CDS             72387..73334
                     /locus_tag="CAGL0C00693g"
                     /note="highly similar to uniprot|P47818 Saccharomyces
                     cerevisiae YLR220w CCC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445212.1"
                     /db_xref="GeneID:2886907"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:Q6FX32"
                     /translation="MVSFPRQGPPEAHRDHMSVVGLKNAVAKLVSPGASKLPGTYGSM
                     DSDATRVGDVNVNGSGSGSGTKYDNGNDIEASVDGGEREGLFSNVDPRVISDLIIGLS
                     DGLTVPFALTAGLSSLGDAKLVITGGFAELISGAISMGLGGYLGAKSESDYYHAEVKS
                     EKRKFYENMTLINHEIEDILLDINPDFSDETIVSFFKDLQRKPELMVDFIIRYGRGLD
                     EPAENRQFVSAVTIGGGYLLGGLVPLVPYFFVKEVGTGLIYSIVVMAITLFWFGYIKT
                     MVSMGESCTTNKKVSEGLQMVAVGGVAAGAAWFFVKLLG"
     gene            complement(<74095..>74667)
                     /locus_tag="CAGL0C00715g"
                     /db_xref="GeneID:2886879"
     mRNA            complement(<74095..>74667)
                     /locus_tag="CAGL0C00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445213.1"
                     /db_xref="GeneID:2886879"
     CDS             complement(74095..74667)
                     /locus_tag="CAGL0C00715g"
                     /note="weakly similar to uniprot|Q05942 Saccharomyces
                     cerevisiae YLR221c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445213.1"
                     /db_xref="GeneID:2886879"
                     /db_xref="GOA:Q6FX31"
                     /db_xref="InterPro:IPR028217"
                     /translation="MPSQEIFKTKQRKSTNRRRKKRRTAESESDSDSSSSSAASDIEM
                     TNEEEKNDNNSPIISDVELSDLENESEKRDVYELDKETKNKLANIPLTRTEFTSRKDK
                     SVPINLNAVQNKLEMSEEQLKDRIATDQSKEQDAYLNLMFENFGDELNAFRTASDFNS
                     KTVNILANVLKDGTALFDNETLKSIVKSQI"
     gene            complement(<75028..>77478)
                     /locus_tag="CAGL0C00737g"
                     /db_xref="GeneID:2886797"
     mRNA            complement(<75028..>77478)
                     /locus_tag="CAGL0C00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445214.1"
                     /db_xref="GeneID:2886797"
     CDS             complement(75028..77478)
                     /locus_tag="CAGL0C00737g"
                     /inference="similar to AA sequence:UniProtKB:Q05946"
                     /note="similar to uniprot|Q05946 Saccharomyces cerevisiae
                     YLR222c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445214.1"
                     /db_xref="GeneID:2886797"
                     /db_xref="GOA:Q6FX30"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FX30"
                     /translation="MSSDLKCSYKSTSLSPIYASTGSVATISADGSLLACPVLDEINI
                     IQLIPNRKLLHSIDNADEQEITGISLTPDGKYLIYVSQSQLVKIVNVETGVITRSLKV
                     SSPSYVMTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGELGTN
                     IWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDNV
                     LNLWRFNIKGKSSKLVKTIPAHLQIEACGFITHNDETFAYTAGGDAVFQIIDLNESSV
                     VKCTKKPIEELFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEFIQIQEYIA
                     GNHGTVADLCLVTKNKDCIALATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDL
                     LNSLACTEDGQWLATASKDKTAILWHWNNTSKRFYIYATFVGHAASVSAVCLPNVMEK
                     NYPKYIITASNDLTVKKWEIPPMKNDLNEVPFIVKSSIYTRHAHEKDINAISMAPNDS
                     IFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSGDKTVKIWSL
                     ESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNLDGHSNRI
                     WALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVRVEQEQSLTNYMNNGEW
                     SNAFLLALQLDHPMRLFNVLRSSMGSQPEQANGKVIFNQELDSLIGTLNKDQLIQLMK
                     RCRDWNTNARTHMVAQKTISCIFLNHDMTEFGEIPGMVRIVETILPYSKRHYSRVDNL
                     VKESYLLDYALHDMDKLL"
     gene            complement(<78078..>80435)
                     /locus_tag="CAGL0C00759g"
                     /db_xref="GeneID:2886756"
     mRNA            complement(<78078..>80435)
                     /locus_tag="CAGL0C00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445215.1"
                     /db_xref="GeneID:2886756"
     CDS             complement(78078..80435)
                     /locus_tag="CAGL0C00759g"
                     /inference="similar to AA sequence:UniProtKB:P39520"
                     /note="similar to uniprot|P39520 Saccharomyces cerevisiae
                     YLR223c IFH1 pre-rRNA processing machinery control
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445215.1"
                     /db_xref="GeneID:2886756"
                     /db_xref="InterPro:IPR018837"
                     /db_xref="UniProtKB/TrEMBL:Q6FX29"
                     /translation="MIYQKSGKSPRKHAVPAQRTAEGVTPTNGDSSSVKPARPRRFSL
                     LYSSDSSLSDMSDRQSHSDISEEGEDDDDDDDDDDTSSSSDDDDENIDFVKLSAQRKK
                     KAMQALSLFKNKHQLNNDSQAIEEEDIGEEVDEKITTGNRPDKATKAAQIDEDLPVPQ
                     FKSDNEEDNELDKNIENDSDSVGSSKLANNSGLEEDSDQGGAISSEEESDYDIDQDAY
                     FNAIEKEDDLDSDAETGNDDEDLPMILHEEEQNIVKELGSDDNLSGWEAESTLSNFDI
                     YSGFDNDDEEENEDENDSKKLSTTSQKDSTNDDIMNELKDFKIPNLNTAKPFSHKKGV
                     TSDMSKFSIKKKRGDKTTPSKHDTLPKASSIDSDDYIFNVFFQSDDSETENNSSKKSA
                     KSADDPLKLSDFFKTNADKAKSMSNSSHNLLHDEAHLPSDDDSYLSNGTLDKGLEESP
                     DEDNFSDLEGISISSIDFDEDDDDISINNVFVDIDDLDPDSFYFKYDDDEESSGSVDV
                     ENISLYLSEGKNGGHDVIETTVYVHDDSTDEDDNLPPPEARNKTIGTKAKEIVSANVV
                     GLKPPKLGTWNTENKPFSIIDGLSTKSLHSLIQEHQQMKEQKLNDITLTKSDFSGTSS
                     PGGDELTLNELLNMSELDDDEDKSVVSHGIPSNMNNAHLNKGNIYNSLSVTDWYEKPK
                     VPLSAFRNKGISSFQEEDYMANATQIKKVPIGYMGMEKTRRKFDKMKELQKKRQEKKR
                     RLRKKKKLLKLKKEQARQLQESEIERQLSLPPVHLAQDQDLKLSI"
     gene            <81411..>82193
                     /locus_tag="CAGL0C00781g"
                     /db_xref="GeneID:2886926"
     mRNA            <81411..>82193
                     /locus_tag="CAGL0C00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445216.1"
                     /db_xref="GeneID:2886926"
     CDS             81411..82193
                     /locus_tag="CAGL0C00781g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445216.1"
                     /db_xref="GeneID:2886926"
                     /db_xref="GOA:Q6FX28"
                     /db_xref="UniProtKB/TrEMBL:Q6FX28"
                     /translation="MPRFHPSQQLHVLPLILDIYDIFRTLEHAASVRRLTEKDREGER
                     RRTRARGMPRGQDPLSQYVNHSVSGGGAQKWPEGAAYGTGSDAVRLQEGIAHAAHAAH
                     AARAEPYAHDAPFLASRVLTPPTVHTTPTVASTPSQQPLSKHLCQDMSCRCQDVPRRA
                     KTCQDIPGTCQGQIHCSLPQPATPGQIATEHKQGPVQLNSMYKKALDWTQGPVDLIYF
                     PKPINQAGQQIIITAFLQKPHMNELAGRCASRPHRTNDRSIV"
     gene            <86130..>88502
                     /locus_tag="CAGL0C00847g"
                     /db_xref="GeneID:2886801"
     mRNA            <86130..>88502
                     /locus_tag="CAGL0C00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445219.1"
                     /db_xref="GeneID:2886801"
     CDS             86130..88502
                     /locus_tag="CAGL0C00847g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445219.1"
                     /db_xref="GeneID:2886801"
                     /db_xref="GOA:Q6FX25"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6FX25"
                     /translation="MIALSLLVSQLVLYLSLADASRLEKYQNYKRDEDSSRALSDYPL
                     GCSPLLGTKLTPGLSMELYEYPLDNHGIGPHCWDPAYLNPEYPRTGFESHKLIGTAQN
                     VMSLNFEHRTQDCHVEFSNLPASFNFPDQITLTNFTMLLYGYFKPKESGRYRFHMEAD
                     DLLLMNLGAGNAFDCCAHEATRNNLGDYIAYDIWAGTRKDVEVFLEKEVFYPLRLFFN
                     NRDGRAALDFSYYLNGATEPGTDIPELLFSLPDGESCPAYIGYENSCRSINTTTTYST
                     SYITTMQAPNVLPITSTIYYVATPCADVPETPSCQIGFWDPINSSCYTPTPPGLSSSP
                     SPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKPSPSP
                     SPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSPSPSPSPSPSP
                     SPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSFSPGPKPSPSPKPSPSPSPSPSPSPSP
                     SPSPSPSPSPSPYPSPNPFPISNSSTSLSPSNISMHSYSSLYTGDPESPTNTKSIPTS
                     IDLAVGNSTTITTTVVTNDKTQTIIIVCQPTTISDGRIITASHTWTYTEPTTSSHKTI
                     DRVNSAGNNEGMNKLTSSATVSSNYSNSNSFHSSARPPSPIVTDSKPNAGVHSASKEN
                     SPSNVSNAETQPNNNEHSGSGTNLAPASSREDSKSVTNTSSRGNSGSISTANVVASSP
                     SRNAVNSISNSRPVNPTVIGTVYQGSAVNRVSSIVMSAVAGLLFALVEVL"
     gap             91153..91252
                     /estimated_length=unknown
     gene            <96914..>100018
                     /locus_tag="CAGL0C00968g"
                     /db_xref="GeneID:2886785"
     mRNA            <96914..>100018
                     /locus_tag="CAGL0C00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445221.1"
                     /db_xref="GeneID:2886785"
     CDS             96914..100018
                     /locus_tag="CAGL0C00968g"
                     /note="some similarities with uniprot|Q08294 Saccharomyces
                     cerevisiae YOL155c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445221.1"
                     /db_xref="GeneID:2886785"
                     /db_xref="GOA:Q6FX23"
                     /db_xref="UniProtKB/TrEMBL:Q6FX23"
                     /translation="MNKWSIYVLLITLISSVLSGDISGKTDDPSYVHDGDITGDAGYI
                     LYYGATVKEIAFNGNIKLPTYFSFVAIEPGSPGVLFTYHGGSIDLGHSVALYDVFATG
                     PTTVKMTGDSFSGKGQMNLTASIREGSTAYLDFKTLYSLDTYFKNFQSVTYPATSTVS
                     LSQGYLVDSDVFYEGPVSFTWIYDLSNSRMWFDDIDHATIPFNFRFPSGESGVNVKDS
                     VATSGHDILLDSSFVKGPNYVGFDTKVMSINISSNDLNNTVLEVVTSRNTYHLIIDNS
                     QLGFLRCATSKNFKIVQKTLDRNGTSVTLDAVMFNSDESFVCPDAKTSTVTDSTSFPG
                     CTKYVSYAAAYDLYGHFTSVVLGSSSTCSFFTTTVSKDRLVEVDIVTYYIASDDTGEH
                     VATKTITVKVEEPDYTTTITSDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEG
                     VFTSPEPYSQPPVVTSTVTEDDGTSKTVVISYFPSEGEDGVTRTGTTTVSTITPAEAD
                     YTTTITSDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDEGVFTSPEPYSQPPVV
                     TSTVTEDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTITPAEVDYTTTIDKGNGDFET
                     DLVSHITTKDSNGNPTTIVTTIPLKPSDGGEADYTSVFVSDGHTITKIVTHVTTSDSF
                     GHTIVLSSTYLTYDRVDDGAVFYSPSVSVSSNVSRSVDTSMVPTGGSGVSSGPSSAPS
                     SGPSSGPSSGPSSGPSSGPRSISSSISSSISSSNSRPSSNPTGSNSGSKPSSNPGGST
                     GNTNGGSNGGSNSGTNSGSNSGSNAGSNAGSNAGSNSGANSGSNAGSNSGSNPGSNSG
                     SNGGTKPGSNSGSNSGSNAGSNSGTNAGSNAGSNSGSNGGTKPGSNSGSNSGSNAGSN
                     AGSNAGSNSGSNSGTKPGSNSGSNSGSNSGSNAGSNAASNSGSNSGSNSGSNSGSNSG
                     TKPSSSSNSGSNASAVRGGSGSGAATVSVSSSYIGSVFHGDAAQRGANFVSFAIAGLV
                     MALF"
     gap             102374..102473
                     /estimated_length=unknown
     gene            <114805..>117915
                     /locus_tag="CAGL0C01133g"
                     /db_xref="GeneID:2886784"
     mRNA            <114805..>117915
                     /locus_tag="CAGL0C01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445223.1"
                     /db_xref="GeneID:2886784"
     CDS             114805..117915
                     /locus_tag="CAGL0C01133g"
                     /note="some similarities with uniprot|Q08294 Saccharomyces
                     cerevisiae YOL155c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445223.1"
                     /db_xref="GeneID:2886784"
                     /db_xref="GOA:Q6FX21"
                     /db_xref="UniProtKB/TrEMBL:Q6FX21"
                     /translation="MWSIYVLLISLISRVLSATDGSFVISDPTYVYNGDINVPDAGYI
                     LNTGGIAKEITVNGNINVATYFSVVSAGHTGGPGYFFTYHGGSISVPGNGMEISNNQA
                     TGPSTIVMTGDSFTGRGFVFSTPVKQGSTAYLDFGSIDVEESKIYDFQSLQLSPRTKH
                     KLGEFTLHNSDMFFEGAVQIDSDDTIIASDGSTLWFDSPDETKFDGAVWMGQGDRNTF
                     NAINVKDSVATKPFNVKIRSLYEYPFYMSFDTTIQSYKLGAIVPDKDIGCYLPLTIQT
                     NKNTHTFYLITNDDLDFCDTRCIGQVNFIQQKRTVNKNGTMVDLDSVYFEWAIRRNCP
                     IRSDKVITRTSLEPCSVYETYEIIYSNFEHSLHHTNLGNSTSCPFFTTTVSKDRLVEV
                     DIITYYIASDDTGQHIATKTVTVKVEEPDYTTTYTSDGHTITEVVSHITTTDSDGKTV
                     TITTTMASFDQVDEGVFTSPEPYSQPPVVTSTVTEDDGSSKTVVISYFPSEGEDGVTR
                     TGTTTISTITPAEQDYTTTITSDGHTITEVVSHITTTDSDGKTVTITTTMASFAQVDE
                     GVFTSPEPYSQLPVVTSTVTDDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTIIPEEP
                     DYTTTIDKDNGDFETDLVSHITTKDSNGKPTTIVTTIPLKPSDGGEADYTSVFVSDGH
                     TITKIVTHVTTTDSLGHTVVLSSTYLTYDRVDDGAVFYSPSVSVSSNVSRSVDTSMVP
                     TGGSGVSSGPSSGPSSAPSSAPRSISSSISSSNSRPSSNPTGSNSSSKPSSNPGGSNG
                     NTNGGSNSGSNSGTNSGSNSGSNSASNSGSNSGTKPGSNSGSNSGSNSGSNAGSNAGS
                     NAGSNAGSNAGSNAGSNSGTKPGSNSGSNSGSNAGSNSGSNSGTNSGTNSGSNSGSNS
                     GSNAGSNAGSNSGSNSGTNSGTNSGSNAGSNAGSNSGSNSGTNSGTNSGSNAGSNSGS
                     NSGSNSGSNSGSNSASAVRGGSGSGAATVSVSSSYIGSVFHGEAAQSGANFVSFAIAG
                     LVMALF"
     gene            <119007..>119954
                     /locus_tag="CAGL0C01155g"
                     /db_xref="GeneID:2886788"
     mRNA            <119007..>119954
                     /locus_tag="CAGL0C01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445224.1"
                     /db_xref="GeneID:2886788"
     CDS             119007..119954
                     /locus_tag="CAGL0C01155g"
                     /note="weakly similar to uniprot|Q05947 Saccharomyces
                     cerevisiae YLR224w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445224.1"
                     /db_xref="GeneID:2886788"
                     /db_xref="GOA:Q6FX20"
                     /db_xref="UniProtKB/TrEMBL:Q6FX20"
                     /translation="MNLPIEITLRIIDQYPCQIRTLNTYYHRLVNDIYYSKCEPYLVR
                     LSYETKNALISYVRSMDSWRKESRKLLATDRLPLGNHEYLNDSWFIIYNILICGIVKP
                     VNYCIASSGSIQLISPLSHKLSLSVAAILPGSYTVYAYFKIRQRTSLRYIPKVCTAID
                     KNHTLSAPINIHELIYSDYGDEVNGIFLVRLGQHKVSELDTPAIILESYFEDTHLQNK
                     ILENKEIEILGYKLCLFKHGSGLLARKVCLSEEMIPFNYWEQIYCLSLMRKRLQNESH
                     RDHISYEYNKEVLSVLRKRLRCGVYGISFTERRPTKDLD"
     gene            <120608..>121681
                     /locus_tag="CAGL0C01177g"
                     /db_xref="GeneID:2886787"
     mRNA            <120608..>121681
                     /locus_tag="CAGL0C01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445225.1"
                     /db_xref="GeneID:2886787"
     CDS             120608..121681
                     /locus_tag="CAGL0C01177g"
                     /inference="similar to AA sequence:UniProtKB:Q05949"
                     /note="similar to uniprot|Q05949 Saccharomyces cerevisiae
                     YLR226w BUR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445225.1"
                     /db_xref="GeneID:2886787"
                     /db_xref="GOA:Q6FX19"
                     /db_xref="InterPro:IPR013763"
                     /translation="MDEQTGTFNPRVLWPDVIRLPQNRWIFTCKEIIDRLGTDVHKTA
                     EMKKLMEKCLMYLYFMKKSLNLFDYTYVEASILFFRYWYYYGLSYNLLDSIHISQAIL
                     VTACKTMENNRPIDAYVKSTCEFVTIHKIPVGNAGPRPNMDKLKWEFRDRLVKNEKKL
                     LCQFGFDFNDGVGNARELIEEIFSGFYRFNRDDILPDEFKKTAFPKILQESRMFIVQG
                     MTQPVTLLCDGYKFVVMSLIYCGLEYKRLVDKNFRYPKNFFSRVLLPSLKFNTQELVE
                     TFMDYRILEDNFFDLKSNKGSKLHISEEMIRNITDEDNDFCHSNEELFDYEHIREGNV
                     SKEFMEHIQSKVDAMYEKYKTKV"
     gene            complement(<121944..>124712)
                     /locus_tag="CAGL0C01199g"
                     /db_xref="GeneID:2886777"
     mRNA            complement(<121944..>124712)
                     /locus_tag="CAGL0C01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445226.1"
                     /db_xref="GeneID:2886777"
     CDS             complement(121944..124712)
                     /locus_tag="CAGL0C01199g"
                     /inference="similar to AA sequence:UniProtKB:Q12151"
                     /note="similar to uniprot|Q12151 Saccharomyces cerevisiae
                     YDR213w UPC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445226.1"
                     /db_xref="GeneID:2886777"
                     /db_xref="GOA:Q6FX18"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6FX18"
                     /translation="MTADIEDTKAKAIGKRSKEIELIEVNGKRVSKTSTGKRKFHKKS
                     KTGCDNCKRRRVKCDEGKPGCKKCSNLNLVCVYSTVVDNKVAKKTTSRKGKSPGANSL
                     ENSDDNTRRSVSPQLSQSTPDTKVNTELSGVSDKNSLVQSPVLPNISNTPLSAEALLN
                     GKLGNIALQLQEHANIAASETAYPTTVNNTHGQANSTAKIVQEQRRLLEQLSPSLNLL
                     TPERNSVSSPGATTGTESNLLSQILAGLFGQQQTAAGVSSNTQQQQQQQPLQQLLQHL
                     QPPVMQQNGLQQPSNYRERLPSISMDLNGSPGLQYNTPSTTNNATTNTLLNSILASTL
                     NPISLGKGSTSAVQANSSDGLMGATSTRNEDSIGNALPFSTDAISQLTKLNLNSFPTA
                     GIGGISYDFHELFGIKYNHTNNRAIKVSSAEEALANMQEHREREQASKISEKQKQAAE
                     QETRNSENGVINKQNSIGINASSENSVSASSVSENFLNSTSTAEQQYTNLGNDVSNLI
                     NLKDVAPLNGNDNMNMMSPLIKSSLDKSAVPENPGNDLLNTKSPSTFDGISMDMVQNQ
                     TTERKNENNNGSIGRNNSSNNISMTPLNTNTTSSGISDFAGKTASPSIPHLIELSSKT
                     SLGLVDLKLFHHYCTEVWPTIIAVGISSPEVWGTYLPDLAFKYPFLMHSMLAFSATHL
                     SRTQPGLDDYVASHRLSALKLLREAVLEISDDNTDALVASSLILIMDSLANASNSNPT
                     AWIFHVKGAVTILTAVWPLPETSKFYNLISVDLSDLGEIVDKDTGTITELVCCDDDIA
                     DLYPVDLDSPYLITLAYLDKLYREKNQLDYILRVFAFPALLDRTFLTLLMTGDLGAMR
                     IMRSYYKLLRNYTTEIMDRAWFLEGVSQVLPRDVDDYSGGGGMHMMLDFLGGGLPSMT
                     TTNLSDFM"
     gene            complement(<125743..>127896)
                     /locus_tag="CAGL0C01221g"
                     /db_xref="GeneID:2886808"
     mRNA            complement(<125743..>127896)
                     /locus_tag="CAGL0C01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445227.1"
                     /db_xref="GeneID:2886808"
     CDS             complement(125743..127896)
                     /locus_tag="CAGL0C01221g"
                     /note="highly similar to uniprot|P32501 Saccharomyces
                     cerevisiae YDR211w GCD6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445227.1"
                     /db_xref="GeneID:2886808"
                     /db_xref="GOA:Q6FX17"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FX17"
                     /translation="MAGKKGKGVPPKKNDDMDVEDRLQAVVLTDSYETRFMPLTASKP
                     RCLMPLANVPLIEYTLEFLAKAGADEVFLACSAHAKQVDEYIEQSKWNLPWSPFKVTT
                     LMNPEARSIGDVMRDLDNRGIITGDFILVSGDVVTNIDFSKMLSFHKEMHAKDKDHIA
                     TMCLNKASQYYMTRTIEPACFVLEKSTNRCLYYQDMPSPNSRSRKVLDVDPELLENVD
                     SFSMRNDLIDCRIDICTPHVPPIFQDNFDYQSLRSDFLKGVISSDLLGKHIYAYITDE
                     YAVRAESWHSFDTISQDFLGRLCYPLVLESNIQEDQTYSYESGHIYKEKDVVLAQSCK
                     IGKCTAIGAGTKIGERTVVENCVIGRNCIIGENINIKNSYIWDNTVIGNGCNISHCIV
                     ASNTKMGANVILNDGCIIGFDVVIEDNKEIPAGSKISSVPVASSRSRLPASDGYDDED
                     DDEEYSETFDDTTQQALASELVGEHGVGYVYESDASDIEEYDEDECFKIVNSLRQQVE
                     DIYLSDNSISSTKRRTKKKRTMSTNSVYTDREDYLSDEEEGEDFLVEGIATVERAIEN
                     DHDLDTALLELNTLRMSMNVTYHEVRLATATALVRRVYHFIETQTLGPKEAVPKVFGQ
                     WGALFNRQVFEPEEYLDLMNILMEIIAEQKFEKPEFILFSALNTLYDNDILEEDSIYE
                     WWDNVSQDSKYDQVKTLTAKWVDWLRNAEEESDDE"
     gene            <128629..>129780
                     /locus_tag="CAGL0C01243g"
                     /db_xref="GeneID:2886805"
     mRNA            <128629..>129780
                     /locus_tag="CAGL0C01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445228.1"
                     /db_xref="GeneID:2886805"
     CDS             128629..129780
                     /locus_tag="CAGL0C01243g"
                     /note="highly similar to uniprot|P07172 Saccharomyces
                     cerevisiae YIL116w HIS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445228.1"
                     /db_xref="GeneID:2886805"
                     /db_xref="GOA:Q6FX16"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FX16"
                     /translation="MTFDLQKIVRPKIFNLEPYRCARDDFTEGILLDANENPHGPRLV
                     GHQDTNLHRYPDPHQLEFKRQMATYRNNSSSFKDLSLPPLTEDNLCLGVGSDESIDAV
                     IRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSS
                     DPLIKLVFLTSPGNPTGAKIDSNIIIKILESWDGGFVVVDEAYIDFCGGSTAPLVTKY
                     PNLITLQTLSKSFGLAGIRLGMTFATADFAAILNAMKAPYNISSITSEFATKALTKEN
                     ITLMEKTSREINKEKVRLLKELTALPLIDKHHVGGLDANFIMVRIHGGDNDMAKEVYY
                     KLATQSGVVVRFRGNEIGCKGCLRITVGTVEENTTLISEFKKCLSSYNP"
     gene            complement(<129884..>134389)
                     /locus_tag="CAGL0C01265g"
                     /db_xref="GeneID:2886814"
     mRNA            complement(<129884..>134389)
                     /locus_tag="CAGL0C01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445229.1"
                     /db_xref="GeneID:2886814"
     CDS             complement(129884..134389)
                     /locus_tag="CAGL0C01265g"
                     /note="weakly similar to uniprot|P40477 Saccharomyces
                     cerevisiae YIL115c NUP159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445229.1"
                     /db_xref="GeneID:2886814"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FX15"
                     /translation="MSSLGEELETKISEEVGFKPLGIKRILPAASTKLPFASLDNFAI
                     DNHNNKYAAASGELLICGDLQKLREYVTNDNEEDNYEPEYKHEISNIIALKFMNGKLI
                     LVTKSGRICEYSTENLNQELMNHELKLDLVSVKTLPSKIIMLDSSNVLKGLSLSNLNL
                     ENIAENISSFDVLYDKLVYISVLKDIYVSDTISNGVNKEIILPESLSEELDDGYEALD
                     IKILSENEYFVVFGNNVSPDESDPSYDHKTYVVSQKEESVVYQETFDIAPAFASVLRY
                     PCYYNVILPGIFEEDKNVNIIGSATSSEISVWDSVNVVQPDQDSERAVFPISKETDED
                     TTPIGMCLDFSTVGEIPEPCPGVDNTDSLPLVYSLTNEGFLQINGFYHTGLIKAGKYD
                     IKLLGERIYSIYEQDGGEVEEGKNDEPIGDFQPTISEDKEEELKNSNNFELSKKSPFS
                     GLDKLSKKPSFSSMTLQIDDEVKKNDTNKTFEFGKTSFGKPGFGTNSSNNFGSVSLDS
                     ADNKSIFSKTSTETNSTEPAFGKPAFGKPAFGALSDIKLSPSNEPVINDNTTPPSNIS
                     KNDAGSSAFAKPTFGNTAFGSLSSSANSENNNINNSPFGKPAFGSTGFGSSSSIDKPT
                     FGSTAFASTNTNSTSFGNPSFANIGSDNNSFGKPAFGSTAFGTPAFSIKTEKNDTDSS
                     PFGKPAFGSTGFGSSSSIDKPTFGSTTFGSSNTNSTSFGNPSFGSTAFAATTNATSPF
                     AKLASNSFRSETPKLDSLNLSSDNEKPSSDDENSESVSDREKSIEEEHDSEFHKVTDS
                     KPDLEKPVEVVDKNLKSDTASPIVDNIEAAQSNSSNILNLSNSPFAKSAFEKSTGQSP
                     FSNSFSNLNCDSKRESQVDNASSSPFAKLSTNTHEKSKVDNGSEKEGVHEVQNSDEAE
                     FSDSTVEQTPLADLDESKGQVASPSISSLTERIKQKAQISAEDLKSPTLTSFNSSNAN
                     AGSPFSSYASKLGQVPASTPIFKFTNNTAHKDSREVTTEDGVSDDNNNNNNNNNNKRN
                     SEIADCVTTSSSSQDTKESSAERKASGEGDNEPLDDKDIGISESEKSQTSEEEQWEVV
                     STDSDAHKSVNDTKKNNNDEADTECDNLRKEDDIQKDKELDQQVKVQDFTSSDIVSAT
                     EDVSVSAQPKNDGSGQLLSCPQNVIEADNKSEYNDFDNEKGNTGLLSTTAMDKTSETS
                     TSTQTANILHCDFEVESFEDDELYLSIQNKPNFDTRYYVGANTKGMSITSEDKTVQLM
                     EKTVQLIDAELSVLFDNIDILDRNFKDQSTNVMHKTSRSLELSNIWRMSEYQTFMTIL
                     DDLVEKQQIYSADRLGESDEINAFKLRDENVIKERCDAVVSKLARYSILMTSQSAALP
                     LSRSQEALRNTIRQKMQSAVNKLERLQTILDTMKISISRAQGNSVKPMIANIEEKYLS
                     HIELLDTINRVEKKIQSLQLGELRSKKTAVDTNAEVDTNIGKIDITSLSMKVDTRKQI
                     GDYFKHS"
     gene            complement(<134970..>135794)
                     /locus_tag="CAGL0C01287g"
                     /db_xref="GeneID:2886811"
     mRNA            complement(<134970..>135794)
                     /locus_tag="CAGL0C01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445230.1"
                     /db_xref="GeneID:2886811"
     CDS             complement(134970..135794)
                     /locus_tag="CAGL0C01287g"
                     /inference="similar to AA sequence:UniProtKB:P40478"
                     /note="similar to uniprot|P40478 Saccharomyces cerevisiae
                     YIL114c POR2 or uniprot|P04840 Saccharomyces cerevisiae
                     YNL055c POR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445230.1"
                     /db_xref="GeneID:2886811"
                     /db_xref="GOA:Q6FX14"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:Q6FX14"
                     /translation="MIPVEFGEISRNAQGVLNRDFFHGTGGVIQVSTSSDDFRFNSRG
                     KFSDGNFGANLSGRHAIKGTGIAVSQSLDNKNQFSTKFEYNNSQLRSDVTTNWVPGTV
                     NIKSSRLGFNYFNALMNSKMSVDLFNPTKVVGSMTMGYGKMVGGSEVTCDIAQNKFTR
                     YALSMGIYAGKRNLTFLINDAHVMTLTLYQKLSPQFEAAAKTTTRFNESNKTSVEVAT
                     AYRHNSAQYKLKLNDAGLACLSYKVPFQKNISLGLGISMDVCNPTVKKFGWSLNFQ"
     gene            <136270..>139602
                     /locus_tag="CAGL0C01309g"
                     /db_xref="GeneID:2886810"
     mRNA            <136270..>139602
                     /locus_tag="CAGL0C01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445231.1"
                     /db_xref="GeneID:2886810"
     CDS             136270..139602
                     /locus_tag="CAGL0C01309g"
                     /inference="similar to AA sequence:UniProtKB:P40480"
                     /note="similar to uniprot|P40480 Saccharomyces cerevisiae
                     YIL112w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445231.1"
                     /db_xref="GeneID:2886810"
                     /db_xref="GOA:Q6FX13"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FX13"
                     /translation="MSEKQVKKRSLSSYLSNVNSRREELERIAKKKAEEEERLKREQA
                     EKLKREEEEKLKRQQEEQRKLEDERRKVEEEKIRKQQEIEALKKQHEEQLKKYEEEKA
                     LKEATNKDELTNTASSFSSTGIIKPEPVPLKKSDDNTIFKAPSPKKHLPQQSTTPSNM
                     KTEDAEHKKLDSTDNNPKLNLGESLSREKLKDMLKTKNPRNYDEVKDDELSDTPTEPA
                     SPPKPRRGRLVRGDQIERSSSLHKDGASSFAGSSDSELSDIDDIKSVPLSSSVFLEGG
                     LSPDRKAPKRKENLLPSSPIANQSEGKTNQNKHVSSDEDDEDFEEESGEESTYSNKMK
                     SNDNQKPRHSNSKISKQKKGIYRDSGGRTRLQIACDKGKYDVAKRLIEEEDYDVNDQD
                     NAGNSALHEAALNGHLSIVKLLISHGANVNIQSYEMFKDTPLVDASANGHLDIVRYLL
                     RHGADPTIPNAKGLTAYESIEEDSDLDENEIKVVQDIKKSLTEATRKWNTKHGIHESI
                     NTSDNSGQSSPMNKHIEESTTAFSDEFYWTDISSSGGKKKLFRASKEGYLPYVGSYLE
                     NGGVPDFNAFLEAVKFGHEDIASLFLAFGAKINKFNKEGMTPLMIAVGRNHLGTVKLL
                     LEAGANPTLKDNKGQTAIYHSKHNIFNSINDEEIKLLETAVTKWHEKDNGEQVNNTYD
                     SHSDTEQRISKKRSRNRRRAKFESEESSEDDLSEEEEEEFNVPKKRHQTTQRSSASST
                     RHNSEAGLHKHTHGDDLKGRSSSISDSLHDNDNRKTLKFKSSSNTDISTALNQEQGHM
                     AGDRADEHRRPKFQTHLSESQVHKEEEMIKETPEEREKRLKAEEEYIQKRLQQKKKKE
                     MELLHKMEIVQQKREKEKEKQRIEEEKRQEELLKQQEIELAKRKEAEELDRRKAIRAL
                     YPLGLKLISYTNKDDYHRYLPLYYYVDDADGTRYVLDIQMSVILKDDELTNREYDRKH
                     KVGKQETRQLWNLLKFIYLYGGNFTSDDRQRYVVNFDGVDIETRLGFETLEYTKFANL
                     PMHWIPLDAIQMDSHIRDTLQNNMVQIDLSPRTRLGDNSATTPGQPQPQPQPQPQPQP
                     QSQSQPPRPLRFRQIPRPQRMW"
     gene            <140060..>140509
                     /locus_tag="CAGL0C01325g"
                     /db_xref="GeneID:9487969"
     mRNA            <140060..>140509
                     /locus_tag="CAGL0C01325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999475.1"
                     /db_xref="GeneID:9487969"
     CDS             140060..140509
                     /locus_tag="CAGL0C01325g"
                     /note="highly similar to uniprot|P00425 Saccharomyces
                     cerevisiae YIL111w COX5B or uniprot|P00424 Saccharomyces
                     cerevisiae YNL052w COX5A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999521.1"
                     /db_xref="GeneID:9487969"
                     /db_xref="GOA:B4UMY0"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:B4UMY0"
                     /translation="MLRTLPKVCRVTPVRFAQSAAISKASIMDLPSRWESMPSTEQQN
                     IVSKLAERQKLPWNQLTETEKQAAWYISYGEWGPRRPVHGKGDVAYITKGVILGLGIS
                     IGLFAFIRQFAGDYPKSMNKEWQLKSDEYLKSKNANPWGGYSQVQSK"
     gene            <141275..>142399
                     /locus_tag="CAGL0C01331g"
                     /db_xref="GeneID:2886929"
     mRNA            <141275..>142399
                     /locus_tag="CAGL0C01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445232.1"
                     /db_xref="GeneID:2886929"
     CDS             141275..142399
                     /locus_tag="CAGL0C01331g"
                     /inference="similar to AA sequence:UniProtKB:P40481"
                     /note="similar to uniprot|P40481 Saccharomyces cerevisiae
                     YIL110w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445232.1"
                     /db_xref="GeneID:2886929"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FX12"
                     /translation="MSFSFGFTSESFSDDELNDDIVNVQQSQSDAQNSLAINPLDDPR
                     LVSPEVIQPEVLDFSSVVRSLKDVRLTFETLSLFDGQIQLYRRELFDVKHQLMSESNV
                     EQTTTNENGDPILEILLGDTAEDVRKNVYEGGLKSWECSIDIIELLNNHGKDFSTEQI
                     FDMGCGTALPSTFVFGKYLQSKLDSGLNLILADYNKSVLELVTLPNLIITWAKTVLTE
                     DEWISLQRSSDENVAIVGDELLLTTILLQAFMDDLSARKIKINLISGSWGRVFSNLVR
                     HHVTPTRPLLVFSSETIYQPENLPVVAETLLDLYQGDNRTSTKALVAAKDIYFGVGGS
                     VIEFESYLRKRLTESNLPITFDTFKVNSNLKRSIVALQST"
     gene            complement(<142575..>145268)
                     /locus_tag="CAGL0C01353g"
                     /db_xref="GeneID:2886812"
     mRNA            complement(<142575..>145268)
                     /locus_tag="CAGL0C01353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445233.1"
                     /db_xref="GeneID:2886812"
     CDS             complement(142575..145268)
                     /locus_tag="CAGL0C01353g"
                     /inference="similar to AA sequence:UniProtKB:P40482"
                     /note="similar to uniprot|P40482 Saccharomyces cerevisiae
                     YIL109c SEC24 or uniprot|P53953 Saccharomyces cerevisiae
                     YNL049c SFB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445233.1"
                     /db_xref="GeneID:2886812"
                     /db_xref="GOA:Q6FX11"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MSHHKRRVYPQAQFGLAQAGQTGYQDVQQPGVLPSQANYQEPVP
                     LVTPIQEVLNNQIDQTADSLHNMQLHNVPDFNQPLQGQLNGPQSPALYQNYNENGMNN
                     YNAAFGNGGTSVKQVNQLYPIDLLSDLPPPIKDLGLPPPPINLSPDIMSVPSDKSNAS
                     PDYIRSTLNAVPKTNSLLKKTKLPFALVIKPYQHLNDDVNAPPLNEECLIVRCRRCRS
                     YINPFAKFIEQGRRWRCNFCRLANDLPMQFDQSSIDTNIVNRLDRTEIKNAVMEYVAP
                     KEYTVRPPPPSIYTFIIDVSQNAIKNGLFVSTIETLKQQLEYLPNRDNRTKISIILVD
                     HALHILSIPADDVSNKFRILDVADIDEPYIPLPNSLVVSLSRCKQNVQLALEKIKQLF
                     EINVSTKFALGPALRTAQKLIGGVGGKLIVISASLPNAGIGSLQRRNESGVSGTTKES
                     SQLLSCQDSFYKTFTVECSKTQITIDLFLASDDYVDVATLSNLPRYTAGQTHFYPGYN
                     ASNISDFNKFTTEFSKHITMDISFETVMRARGSTGLKTSAFYGHFFNRSSDLCAFSTM
                     PRDQSYVFDISIEDTITTDYCYFQVAVLLSLNNGQRRIRVITLALPTTQSISEVFACV
                     DQQAVAAQITQRAVQKANSSSIDDARDLIQKTTLDILSTYKKELVVTNTGGVVPLKLS
                     TNLRILPLLMHALMKHMAFRAGVVPSDHRAYSLNVLESVPIKSLITSIYPSIYSMHDM
                     GDDCGYTDETGNVILPECINDTAILMEKYGLYLIDNGSELFLWVGGEAVPELLSDVFG
                     VPEMSQVPVGKHDLFRVEGSQFNERVCNIIDQLRTSDDTTVYKTLYIVSGPTINDSFS
                     QGTRELASLRMWAATAFVEDNIMKTLSYREFLEKMKKEVSK"
     gene            <146471..>148522
                     /locus_tag="CAGL0C01375g"
                     /db_xref="GeneID:2886939"
     mRNA            <146471..>148522
                     /locus_tag="CAGL0C01375g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445234.1"
                     /db_xref="GeneID:2886939"
     CDS             146471..148522
                     /locus_tag="CAGL0C01375g"
                     /inference="similar to AA sequence:UniProtKB:P40483"
                     /note="similar to uniprot|P40483 Saccharomyces cerevisiae
                     YIL108w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445234.1"
                     /db_xref="GeneID:2886939"
                     /db_xref="GOA:Q6FX10"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:Q6FX10"
                     /translation="MSKESIELFNLRPNEELFSPCVIIHGSIGKGQTASNIQVQHPQL
                     PPLTFPVHDSHFKATIILTPGANRLTFITDTNVSKVVDCFYSPLDQNVPVHLCLIVAK
                     DSPLEFDSPASQKAKEGGNGLDLAIKKMRVGARLMQAFTNEQMLRNGFGHRTIRFVEE
                     YTWDTQFAQRIAMRNTVKIHIVRSDKTTKEIRDPDVAQQNDKAKDQGGLFGIAMDALK
                     KYGGPFTQNEKPVQAACVFLDTHWDGKLIRGHAALGGGDADIKLAIFGSHGMYSWPTC
                     MEQLIPYFTDETRASTKEVANDCNECGTHWECLNITLGAFMHEIGHLLGSPHQVNGVM
                     LRDYVRFNRSFLTKESYSLRTNSNGAKPPIFPKEECTWNRLDLLRYLYHPTFTVPQDY
                     YDASFMRPGRLGNFDYPKPSVYNQGNNIFTLTSKTGIYLIEIICGDLAKAHIEYLPLS
                     LGGTGPQKEVTLSLDELRSRIPPNDVPEHSNSFALRVLAVNTSDLFIENFPKSLSGGD
                     INMSKYGYPSSVVGHKSAVSGRLENSQETGIIPVDMRTVTKVTVYYAHALMGLVFTCS
                     DPVAIPAIPPRTYEGQKQAPMTTSNKKSKNVVFGKQEGNKLDFVLQPNEEIVGFNLRC
                     GWWIDAIQIVTNTGRMSPMLGNSGGGLSEVQPPAGQRILGIYGSVGGWVDAFGIVYGA
                     I"
     gene            complement(<148889..>151177)
                     /locus_tag="CAGL0C01397g"
                     /db_xref="GeneID:2886826"
     mRNA            complement(<148889..>151177)
                     /locus_tag="CAGL0C01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445235.1"
                     /db_xref="GeneID:2886826"
     CDS             complement(148889..151177)
                     /locus_tag="CAGL0C01397g"
                     /inference="similar to AA sequence:UniProtKB:P40433"
                     /note="similar to uniprot|P40433 Saccharomyces cerevisiae
                     YIL107c PFK26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445235.1"
                     /db_xref="GeneID:2886826"
                     /db_xref="GOA:Q6FX09"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FX09"
                     /translation="MFKSVDYTDPVGAPSDSDVEPTERKNEKHVSIHQEAVAESLKRE
                     ALPKFERRPLSDTPITSAWNSPGLSEENTPTDSPENRSALDLTKFSQLNIAHDDDEEQ
                     GAGDNDTGKSSDHNSDSETVKLSTKSKGSFRDLLAANSLEYSSKKVSTIDVPGLTRSK
                     DSPDGMISSKDAGSKLIIVMVGLPATGKSFITNKLSRYLNYLMYYCKVFNVGNTRRQY
                     SKEHSLHEQDSKFFDPSNEEYKKLRDKWALDTLDELLDYLLNGMGSVGIFDATNSTVA
                     RRKAILDKIRKRNPNLKVLFLESICTNRELVERNVRLKVFGPDYKGKDPEKSLRDFKE
                     RLANYLTAYEPIDDSEDICYIKMVDVGKKVIAYNIEGFLASQTVYYLLNFNLRERQIW
                     ITRSGESEDNVSGKIGGDSHLTERGKRYAKALSNFINEQRIAFYNREIENAKRQRDQY
                     EKDKRRREAALKNNLTNGEQSTMGTGTPEPQPYQCNDFFVWTSMRSRTIETAHWFADE
                     DYPKKEMRMLDELGVGDFNGMTYPMIQENFPVEFEKRKIDKLRYRYPGIGGESYMDVI
                     NRVRPVITELERIEDNVLIITHRVVARVLLGYYMNLRTDIIANLDVPLHCVYCLEPKP
                     YGMEWSLWEYDEDKDLFFKVPESDLNTTKVREIGLVHKERRYSEVPTAPPSANSNPND
                     FLLRRNSVDVASPPSETSKDHENISGSQQAMGSSRPIKNDFNQPTLMNSMNTVGPSGR
                     YDPRIQDKVINKPKKSILMNDD"
     gene            complement(<153063..>154982)
                     /locus_tag="CAGL0C01419g"
                     /db_xref="GeneID:2886941"
     mRNA            complement(<153063..>154982)
                     /locus_tag="CAGL0C01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445236.1"
                     /db_xref="GeneID:2886941"
     CDS             complement(153063..154982)
                     /locus_tag="CAGL0C01419g"
                     /inference="similar to AA sequence:UniProtKB:Q08925"
                     /note="similar to uniprot|Q08925 Saccharomyces cerevisiae
                     YPL184c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445236.1"
                     /db_xref="GeneID:2886941"
                     /db_xref="GOA:Q6FX08"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FX08"
                     /translation="MSSFPDHTQAYTAKSIFLDEPNLNSHLYYDNNKIPVSNGGLFSN
                     SNTIPANGMMMGNGMLQMPRENVMPHEAQLLANQNMAAQNWPRDLNSKFIQPVQRPMF
                     NNENILNQQNITNSRMTGISPLQQSKHQITSLGLNGTLTADSDDYSLSQVSSLSSLSA
                     PTDHMFHNQQSTNGTISSVANLGMTQNNTLAAASAFTQANAPASIMINNQKNNNPLDF
                     TSAPSRTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHS
                     DAILKRLNIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNNDRSSKENKEP
                     LTEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKNPFYQEKKIF
                     YGKDRCAFITKTQQHNAAQFLGVQPEMEHLMRYTDREFISNALLQQSAAAAAIATSAG
                     GPNNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQF
                     YAMSSLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDFEADSKKEQ
                     PIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSNPHFKSLKI
                     NFGKDRCGNVPHQIR"
     gene            <156370..>156618
                     /locus_tag="CAGL0C01435g"
                     /db_xref="GeneID:9487970"
     mRNA            <156370..>156618
                     /locus_tag="CAGL0C01435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999476.1"
                     /db_xref="GeneID:9487970"
     CDS             156370..156618
                     /locus_tag="CAGL0C01435g"
                     /inference="similar to AA sequence:UniProtKB:O14464"
                     /note="similar to uniprot|O14464 Saccharomyces cerevisiae
                     YPL183wa GON5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999522.1"
                     /db_xref="GeneID:9487970"
                     /db_xref="GOA:B4UMY1"
                     /db_xref="InterPro:IPR000473"
                     /db_xref="UniProtKB/TrEMBL:B4UMY1"
                     /translation="MFPFQLLNRSISSVVRNSVLRPLPMMAATKPLMAPRMLLLFNRG
                     FKVRTSVKKMCSDCYIVRRKGRVYVYCKSNKKHKQRQG"
     gene            complement(<156930..>159947)
                     /locus_tag="CAGL0C01441g"
                     /db_xref="GeneID:2886933"
     mRNA            complement(<156930..>159947)
                     /locus_tag="CAGL0C01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445237.1"
                     /db_xref="GeneID:2886933"
     CDS             complement(156930..159947)
                     /locus_tag="CAGL0C01441g"
                     /inference="similar to AA sequence:UniProtKB:Q08924"
                     /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
                     YPL183c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445237.1"
                     /db_xref="GeneID:2886933"
                     /db_xref="GOA:Q6FX07"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FX07"
                     /translation="MDEYTHIGPALCVKFHKDSLLTCYGPYLQEYDYKHNELMNKCKL
                     FNRNKIHGICISSEGKICAYGGSSISILKLEDINQRREYLSNELVLDENITAIEFSKD
                     GSKLYILTNYNKVLITDLTGKVVEEKKLVGERSILYSGSIKVISESEVQINAGTVMGG
                     AIVWDLYKEELIHNLTGHEGSIFYIQSSEHNKLIASCSDDRSIRLWDRETGKELSIGW
                     SHTARIWNLKFFNNDENLVSVSEDCTCRVWNIIPNDISGYELQISNIFEGHLLKNVWG
                     VDVNDEKRIIATSGNDGRINVIDLNTDTNSGDEVIGYEIADIEKAAGISFEKDEIIKG
                     FYWFKFGLVCITSQGRVLAFQTETKQWRQCLLDSRFASYSITNGIYESNIVFFTNNKC
                     DILAMKFSIDGSEVKVTKQYKEDSLSKLSNSLAISAGYHILLLESPNPTDKLCFWSFD
                     DNLEIKKREAFEKPANIVSSCFEIYDSYYLVGSRFSSIAVFDTKKENNNSTVLKNLTN
                     GDTITSIQLSDLGPMFEPIFAITNRDGYYKFIKCDFKNLGNDGFYEVLHSNKITKGFL
                     EGSYLDSRLNFITYGFKSSLFYIYDETECLEIASEVCGGAHRQWHFCKENVEDLVLTY
                     IKASKLFIRHFKKSIYPHVLEPGLHGREIRDVTIMPDNKDFKGYFFCTGSEDTTIKLS
                     YYDPNSRKIKTYWTERRHVSGLQKCRAISNSMVISSSAREELFLWKVNYNRIRPYMMC
                     KQVLPTSNDNPDLRIMDFSVSFVNSNEQDFLLSTVYSDSMIKLWYYSSEANTFTLLVS
                     GLYKTCCLLGTELLTVKDNLLLLASATDGHLFGYNVTDQVLKAGFSIENNKIYMKSSL
                     NTDSSVSLSNERIFDVIAHQSGIKTMTLLQESDKKFRIFTGGDDNALALTSVQCNPDM
                     SFVAAVKSTIAKAAASTITGTALCSIDNHERLVSCSVDQIVRVWSFECDELKLESEKY
                     TTIADTGCIDTIEDKEGKANIVIGGVGLSIWAI"
     gene            complement(<160384..>162501)
                     /locus_tag="CAGL0C01463g"
                     /db_xref="GeneID:2886942"
     mRNA            complement(<160384..>162501)
                     /locus_tag="CAGL0C01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445238.1"
                     /db_xref="GeneID:2886942"
     CDS             complement(160384..162501)
                     /locus_tag="CAGL0C01463g"
                     /inference="similar to AA sequence:UniProtKB:Q08921"
                     /note="similar to uniprot|Q08921 Saccharomyces cerevisiae
                     YPL180w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445238.1"
                     /db_xref="GeneID:2886942"
                     /db_xref="GOA:Q6FX06"
                     /db_xref="InterPro:IPR018857"
                     /db_xref="UniProtKB/TrEMBL:Q6FX06"
                     /translation="MGSKNKPCKGEYDMPNLTSPTQVHGKSHMRQFSTKSKAKGSASF
                     KGLRRVLTHDGTFEGDGLLNRHGSFKKSKSSDALYRRRAISGLNMTALVGEKPTNRVS
                     RSQGNSRLSSPIQSLSKSHSSSNVAHSLASAIGGSGLRPRRTRSTHSVLTLRQGQEFY
                     DNESTTDEEVEHFTDEEAQNSDSSDNIHHTRPKSSRMFSDDRVRDQQLSVIQSSPEDI
                     ITLNGNPNQGKGDSYSTLRAHNSIDHSKNTNKDFDGNSSDDKIEAMLDDVHLSKASNK
                     SIDHLNVKDDHEDHIGEVDPNSLSFDSHSLVRQERKPRTLAKVTEGEESIADDMNKNR
                     SPIEEFTKKDREYQSKSDEPYIPDMILSQSTGVERKFENPSSIQNSLAKEIQNTKYLE
                     DSDNTTDAPSKPIKNISGFDKDEIENARLNDTKHSMLNQQVNAKSELTNNLQKVNPDN
                     NPPRSSLTNTIFQKSRNQYASRTDTTEKGPTSLLKTDRDSNSTTKINNFSQFLKSENI
                     DGNSRTQRKMLLQRESSILDLNSQTDSAEAIFMTGHIEQKREYEKITHEYTTLRRYTN
                     PLDKSLLRLKNSKNSGKTNSTYGNSGLEGSSISTYSNQVKELDDFLPKAQQSKLNSIL
                     ASIWRSESQSFNKDVNPLNRNKSSMEEQSNHYSSLKNSLKSNIPGSGTGLHQQRVPKM
                     QPTTRAVHRRMENSNTNLAAHFR"
     gene            complement(<162991..>164613)
                     /locus_tag="CAGL0C01485g"
                     /db_xref="GeneID:2886946"
     mRNA            complement(<162991..>164613)
                     /locus_tag="CAGL0C01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445239.1"
                     /db_xref="GeneID:2886946"
     CDS             complement(162991..164613)
                     /locus_tag="CAGL0C01485g"
                     /note="some similarities with uniprot|Q08923 Saccharomyces
                     cerevisiae YPL181w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445239.1"
                     /db_xref="GeneID:2886946"
                     /db_xref="GOA:Q6FX05"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FX05"
                     /translation="MRREIVEEEVEDEGETRCICGELEPPDDSGFFIQCETCNVWQHG
                     VCVGISNSNGDKPPDKYWCEQCRPELHRLYYTNDTGELRSAYKLVQPTKRKNRRHPSG
                     SRARRNNKRDSTEYDTSTDNLAEEESKLDPEEDSESTAASATSNTGTGQRKRRKTSNT
                     SDTTDDLKNNGAIEEEDTLQAGSPANETEDTTNQDHPQAQDDDDQSRETQQEENDAVK
                     QEPDLGDEEDETGLTNDTTINETADDSTTTIAAEATTEAVKEEAEAETNADDTTDDHV
                     TNATKAETDNNEGADVSKIISDRKRATLVAREEKHYQWMLEKALQESRKTSNQEEGNK
                     QESRPVPTSKENSPTPDSNTSRSSSRNKDEAAKELSNEKETQDKVSDDLQPNETNTVS
                     SEDDNKAKNLRRSQRSGNTPRNSGKGRNSRKQNSKASSANGSDNDKNKTADIGINKPV
                     KPRLPPPRTTLNEMRRRVTAIMEFLSRTQWELEAEIRNKEDLTKFVENEQFVKETEVI
                     FDNTNKNLSLMNDLTKKLINWETKYSVNEALE"
     gene            <165241..>166932
                     /locus_tag="CAGL0C01507g"
                     /db_xref="GeneID:2886854"
     mRNA            <165241..>166932
                     /locus_tag="CAGL0C01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445240.1"
                     /db_xref="GeneID:2886854"
     CDS             165241..166932
                     /locus_tag="CAGL0C01507g"
                     /inference="similar to AA sequence:UniProtKB:P32945"
                     /note="similar to uniprot|P32945 Saccharomyces cerevisiae
                     YPL179w PPQ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445240.1"
                     /db_xref="GeneID:2886854"
                     /db_xref="GOA:Q6FX04"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FX04"
                     /translation="MGRRKRSPSNNNHNQNFEVPKLGADANTINGEQSQSDETAEPVD
                     PDDSSKLPPNISIRNSTTSTTSTTRTTRTTRTTATYYDKDADKAAKLDIDISVARAFA
                     ATPFPRTSGRPAQNSNSSFSSSSSSSSSSTPSFSSSSPLSYLSPSSSVTTANVQPSTG
                     ATPQYLKPSSAPCGVLSMSSLMRKHTSASYNVSQTTATGTTHYAKTVSKSRLSSSLAT
                     ENPATRSTLLNTPPPHLLLKRYPSDNSSSDILDVDLVIEKLLKMGTQPNGTAPTTTKS
                     KRDFPFRSWEIQLICSHAREIFLEEPSLLRLQAPIKVVGDVHGQFNDLLRILKLSGAP
                     PDTNYLFLGDYVDRGKQSLETILLLLCYKLKYRNNFFMLRGNHESANVTKIYGFYDEC
                     KRRMGSKSWRFFVDVFNTLPIAATIQDRIFCVHGGVSPELKELNQINQIMRPTDIPDQ
                     GLLTDLLWSDPDPQIQDWSLNDRGVSYTFSKRNVYDICSRFKFDLIIRGHMVVEDGYE
                     FFAKKKLVTVFSAPNYCGEFQNWGAVMSVTTGLMCSFELLKPHSLKNKKTRKTRR"
     gene            <167802..>168512
                     /locus_tag="CAGL0C01529g"
                     /db_xref="GeneID:2886869"
     mRNA            <167802..>168512
                     /locus_tag="CAGL0C01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445241.1"
                     /db_xref="GeneID:2886869"
     CDS             167802..168512
                     /locus_tag="CAGL0C01529g"
                     /inference="similar to AA sequence:UniProtKB:Q08920"
                     /note="similar to uniprot|Q08920 Saccharomyces cerevisiae
                     YPL178w SAE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445241.1"
                     /db_xref="GeneID:2886869"
                     /db_xref="GOA:Q6FX03"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR027157"
                     /db_xref="UniProtKB/TrEMBL:Q6FX03"
                     /translation="MSLAEFDEIKYDHSVKRLDSPSKYLLRKARRNPNGLNDLRQSLK
                     SSTIYVGNLSFYTSEEQIYELFSKCGFIKRIIMGLDRFKFTPCGFCFIIYNTPQEALN
                     AVKYLGDTKLDDKSITIDLDPGFEDGRQFGRGKSGGQVSDELRFEFDASRGGYGVPFA
                     DRVGTTSGAGRGFHGQRFNQHNDYERHPVQFQPQNEVPSMPHQITSNFGEVHSFEPQY
                     PPQEQGMEEDEEDNYVPE"
     gene            complement(<169232..>169897)
                     /locus_tag="CAGL0C01551g"
                     /db_xref="GeneID:2886956"
     mRNA            complement(<169232..>169897)
                     /locus_tag="CAGL0C01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445242.1"
                     /db_xref="GeneID:2886956"
     CDS             complement(169232..169897)
                     /locus_tag="CAGL0C01551g"
                     /inference="similar to AA sequence:UniProtKB:P41817"
                     /note="similar to uniprot|P41817 Saccharomyces cerevisiae
                     YPL177c CUP9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445242.1"
                     /db_xref="GeneID:2886956"
                     /db_xref="GOA:Q6FX02"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q6FX02"
                     /translation="MGENVRLPSIRSLLNDDAPYPRSNAMDISNITSGNTNTSTTTTN
                     TTGTSASSISTTSTTSTTSTTTTPPINMMKKSKRRSNLPKDTIQILNQWLLDHIHNPY
                     PTQQEKRDLLIKTGLTKIQLSNWFINVRRRKIFNDYYALTSNLPPELLQSMSSQNTPP
                     TPTTTTHTPPVQDDGNPPVTIMSEDEFSKRFVQAPLTRRKKLIDRLEELKKLTNMANN
                     NNN"
     gene            <170694..>171764
                     /locus_tag="CAGL0C01573g"
                     /db_xref="GeneID:2886947"
     mRNA            <170694..>171764
                     /locus_tag="CAGL0C01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445243.1"
                     /db_xref="GeneID:2886947"
     CDS             170694..171764
                     /locus_tag="CAGL0C01573g"
                     /note="highly similar to uniprot|P32449 Saccharomyces
                     cerevisiae YBR249c ARO4 or uniprot|P14843 Saccharomyces
                     cerevisiae YDR035w ARO3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445243.1"
                     /db_xref="GeneID:2886947"
                     /db_xref="GOA:Q6FX01"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FX01"
                     /translation="MSDANANEDVRILGYDPLVSPALLQVQVPATEVSIQTARRGRKE
                     SIEIITGRDDRVLVIVGPCSVHDLDAAQEYAQRLKKLSDELQKDLCIVMRAYLEKPRT
                     TVGWKGLINDPDVNNTFNINKGLQSARQLFVNLTNTGVPIGSEMLDTISPQYLADLLS
                     FGAIGARTTESQLHRELASGLSFPIGFKNGTDGTLGVAVDACQAASHSHHFMGVTKHG
                     VAAITTTKGNEHCFVILRGGKKGTNYDAKSVAEAKKQLPEGANGLMIDYSHGNSNKDF
                     RNQPKVNDAVCEQIANGEKAIVGVMIESNINEGNQCIPPEGKAGLKYGVSITDACISW
                     ETTEDVLRKLAAAVRQRREHYK"
     gene            <172380..>174038
                     /locus_tag="CAGL0C01595g"
                     /db_xref="GeneID:2886949"
     mRNA            <172380..>174038
                     /locus_tag="CAGL0C01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445244.1"
                     /db_xref="GeneID:2886949"
     CDS             172380..174038
                     /locus_tag="CAGL0C01595g"
                     /note="highly similar to uniprot|P33734 Saccharomyces
                     cerevisiae YBR248c HIS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445244.1"
                     /db_xref="GeneID:2886949"
                     /db_xref="GOA:Q6FX00"
                     /db_xref="InterPro:IPR004651"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR010139"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014640"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FX00"
                     /translation="MSTVHVIDVESGNLQSLTNAIEYLGFRVQLIKDSQDPELLKAEK
                     LILPGVGNYGHVYENILSRGFEKPIREYIASGKPIMGICVGLQVLFNSSTESPSSGGF
                     GYVNHRLSRFNDDEKPVPEIGWNSVIPEKDLFFGLDPYKRYYFVHSYAGILDAATESS
                     LKADGWRIAKAKYGSEEFIAAVYKDNIFATQFHPEKSGLAGLHIIENFLKQAHPGLPA
                     YSEDEKSLLGNDYSNYGLTRRIIACLDVRTNDQGDLVVTKGDQYDVREKSGDNDVRNL
                     GKPVQLAQKYYEQGADEVTFLNITSFRDSPVKDTPMLEVLRQTAKKVFVPLTVGGGIK
                     DIVDPDGTHVSALEVASLYFRSGADKVSIGTDSVYAAEKYYANEGKGDGTSPIETISK
                     AYGAQAVVISVDPKRVYVNDPSETKNKTIKTKFPNEKGQDVCWYQCTIKGGRESRDIG
                     VWELARACEALGAGEILLNCIDKDGSNSGYDLELINHAKEAVKIPVIASSGAGNPAHF
                     EEGFKQSAADACLGAGMFHREEYTVNDVKEYLLKKGLKVRVDKN"
     gene            <174618..>175334
                     /locus_tag="CAGL0C01617g"
                     /db_xref="GeneID:2886895"
     mRNA            <174618..>175334
                     /locus_tag="CAGL0C01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445245.1"
                     /db_xref="GeneID:2886895"
     CDS             174618..175334
                     /locus_tag="CAGL0C01617g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445245.1"
                     /db_xref="GeneID:2886895"
                     /db_xref="GOA:Q6FWZ9"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ9"
                     /translation="MHFRNILIVLVYLASFISAITNEPKNKAIGIIIDRLEKNTETLK
                     LNGSDSSKITTFYEDIYEINELFSTLYSSFQYPQNELATKAIATLFRLRLTEKDEVTI
                     DYMEDRLFRIKNTLKYALDTKDRMPMHTIAEMQGILTRNRDWLIATSSQIFNKNQDVV
                     KAMADDFPECPPPLAVESSAPKLIALLTDGMIVLALLNSTVDTCMGGFEPLCVFALSA
                     AGTVAGVWLMNVVKYFVLCK"
     gene            <175747..>177162
                     /locus_tag="CAGL0C01639g"
                     /db_xref="GeneID:2886890"
     mRNA            <175747..>177162
                     /locus_tag="CAGL0C01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445246.1"
                     /db_xref="GeneID:2886890"
     CDS             175747..177162
                     /locus_tag="CAGL0C01639g"
                     /note="highly similar to uniprot|P38333 Saccharomyces
                     cerevisiae YBR247c ENP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445246.1"
                     /db_xref="GeneID:2886890"
                     /db_xref="InterPro:IPR007955"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ8"
                     /translation="MGKVTTSRAKKQRHDPLVKDLKEAEGRLKKVRKDEGDDNTNGEE
                     FIDDKASRKILQLAKAQQEEIEEENEKESQDAKFQNARFKVITYDNDDEEEEEEEEDF
                     GENISDFEPEEGEYVEEEEVVEIDEEDAAMFEQYFKKADDFNSVNGSYNLADKIMASI
                     REKEMELSNKGMDEDDNEGGFAEPAPRVQEGVELPEKVIRAYTTVGSILKTWTHGKLP
                     KLFKVIPSLKNWQDVLYVTNPEEWSPHIVYEATKLFVSNLQAKEAQKFINMVLLDRFR
                     ENIETTPDHSLNYHIYRAIKKSLYKPSAFFKGFLFPLVESGCNIREATIAGSVLAKVS
                     VPVLHSSAALSYLLRLPFTPATTVFIKILLDKKYALPYQTVDDCVYYFMRFRILDDGS
                     NGDDATRTLPVIWHKAFLVFAQRYKNDITQDQRDFLIETVRQRGHRDIGPEIRRELLA
                     GSSREFDSEQPPKDDIMVDVR"
     gene            complement(<177284..>178411)
                     /locus_tag="CAGL0C01661g"
                     /db_xref="GeneID:2886908"
     mRNA            complement(<177284..>178411)
                     /locus_tag="CAGL0C01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445247.1"
                     /db_xref="GeneID:2886908"
     CDS             complement(177284..178411)
                     /locus_tag="CAGL0C01661g"
                     /inference="similar to AA sequence:UniProtKB:P38332"
                     /note="similar to uniprot|P38332 Saccharomyces cerevisiae
                     YBR246w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445247.1"
                     /db_xref="GeneID:2886908"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ7"
                     /translation="MEAKILSAVKTEFPPCCLQIYDEEYIIVGTYELDKDTGYRFGSV
                     DVFDSELKLLHSYRTYGAVLDLKLSPFDDTLVATAHSTGNVELWRIVRDDGVSLERVS
                     NLQVFDPETLIASLHFSPLSPATLLLTATTGETSTIDIEYGDIGFSTDNVYKAYQKQE
                     KIEIKVQGEPQWALECESQVFDEQHSLQCWTAEFGKIHPLENVVFTGGDDATIMAHDL
                     RSKELIWSNSRIHDAGVVAIKTSSPTFRYDQPTSLITGAYDDHIRTFDLRMLEDDIYP
                     GRNIPVQNTRQLNLGGGVWRFSEKPREDNLPTNEQLVCCMYDGAKIVKIDDSTEDYFS
                     VTNYLKKGHESMCYGGQWGKKFIATCSFYDKSLQTWVKDTN"
     gene            <178695..>182042
                     /locus_tag="CAGL0C01683g"
                     /db_xref="GeneID:2886964"
     mRNA            <178695..>182042
                     /locus_tag="CAGL0C01683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445248.1"
                     /db_xref="GeneID:2886964"
     CDS             178695..182042
                     /locus_tag="CAGL0C01683g"
                     /note="highly similar to uniprot|P38144 Saccharomyces
                     cerevisiae YBR245c ISW1 and highly similar to
                     uniprot|Q08773 Saccharomyces cerevisiae YOR304w ISW2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445248.1"
                     /db_xref="GeneID:2886964"
                     /db_xref="GOA:Q6FWZ6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ6"
                     /translation="MGNSGTSGLDGPYNWRKLLCVSRKYYSISIKELARGTMSDLTEY
                     WARLKPLQEDMPSADLESKKERYLVKDAGKPKFDVEATTKRFEHLLSLSGLFRHFIEG
                     KAAKDPKFKQVLDILDKPGKKGQKKGGHEDARRRKTEREEDAELLKEEEDVEDDADDI
                     EYLFRESPAYINGQLRDYQVQGLNWLVSLDKNRIAGILADEMGLGKTLQTISFLGYLR
                     YIKKIPGPFLVIAPKSTLNNWLREINKWTPEVNAFILQGDKEERARLIQDKFMACDFD
                     VVIASYEIIIREKAAFRKMNWEYIMIDEAHRIKNEESMLSQVLREFHSKNRLLITGTP
                     LQNNLHELWALLNFLLPDIFSDSQDFDEWFSKETDEEDQEKIVKQLHTVLQPFLLRRI
                     KSDVETSLLPKKELNVYVGMSPMQKKWYRQILEKDIDAVNADSGSKESKTRLLNIVMQ
                     LRKCCNHPYLFDGAEPGPPYTTDEHLVYNSEKLKVLDKLLRKLKEAGSRVLIFSQMSR
                     VLDILEDYCYFREYEYCRIDGSTAHEDRIEAIDEYNAPDSKKFLFLLTTRAGGLGINL
                     TTADVVVLFDSDWNPQADLQAMDRAHRIGQKKQVRVFRFVTDNSVEEKILERATQKLR
                     LDQLVIQQNRPTNKKKENKNDSKDALLSMIQHGAADVFKSNTTSERGTPQPDDDKGED
                     VDLDELLAQSESKTQSLNAKYESLGLDDLQKFNQDSAYEWNGTDFKKKVQKDIISPLW
                     IEPTKRERKENYSIDGYYKDVLNTGKHSTPLQPRMPKPKVFYSHQLQPPQLKVIYEKE
                     RMWTAKRTNYTPTLEDVRATYGEIADEEEKKQKLELLKVSISNAEPLTEEEEQLKSQW
                     ENEGFTNWTKTDFRKFITACGKYGRNSIQAITMELAPGKTEEEVRRYATAFWSNLERI
                     DDYEKYLKMIENEEEKVKRVKLQQEALRRKLSQYKNPFFDLKLKHPPSTNNKRTFSDE
                     EDRYILIMLFKYGLDRENVYEMIRDEIRDCPLFELDFYFRSRTPMELARRGNTLLGCI
                     EKEFNAGIELTPEVKERMEEEDKQGKRAREEFEKDKEQDDNDSETKMPKIENDDEAKI
                     TSEEPVSDIATDDAEVKEELKEETVEA"
     gene            complement(<182305..>182799)
                     /locus_tag="CAGL0C01705g"
                     /db_xref="GeneID:2886954"
     mRNA            complement(<182305..>182799)
                     /locus_tag="CAGL0C01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445249.1"
                     /db_xref="GeneID:2886954"
     CDS             complement(182305..182799)
                     /locus_tag="CAGL0C01705g"
                     /note="highly similar to uniprot|P38143 Saccharomyces
                     cerevisiae YBR244w GPX2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445249.1"
                     /db_xref="GeneID:2886954"
                     /db_xref="GOA:Q6FWZ5"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ5"
                     /translation="MAAKSFYELECKDKKGETFKFDTLKGKVVLIVNVASKCGFTPQY
                     KDLESLYQKHKDEGLVILGFPCNQFGGQEPGSQEEIGNFCQLNYGVTFPIMHKIEVNG
                     DNTDPVYDFLKSQKSGLLGLNRVKWNFEKFLVDKHGKVHQRYSSLTKPMSIEDDIKQL
                     LAQK"
     gene            <183722..>185065
                     /locus_tag="CAGL0C01727g"
                     /db_xref="GeneID:2886834"
     mRNA            <183722..>185065
                     /locus_tag="CAGL0C01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445250.1"
                     /db_xref="GeneID:2886834"
     CDS             183722..185065
                     /locus_tag="CAGL0C01727g"
                     /note="highly similar to uniprot|P07286 Saccharomyces
                     cerevisiae YBR243c ALG7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445250.1"
                     /db_xref="GeneID:2886834"
                     /db_xref="GOA:Q6FWZ4"
                     /db_xref="InterPro:IPR000715"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ4"
                     /translation="MGSQKVLFVAALGLLYLSSQYSPILSAVAFAIIGFVCTNALIPR
                     VGDSFIKIGLFGKDMSKPGKPVIPETIGSVAAVVYLFVMMFFIPFIFYRYMVIGTSGG
                     GHRDVAREETARESFFPHNKLSEYLSAILCLESQVMLGVADDLFDLRWRHKFFLPAVA
                     AIPLLIVYYVDFGVTYVLVPQFLQKYVHFTSIDLGALYYIYMSAMGIFCPNSINILAG
                     INGLEVGQCIVLAILTLLNDAIYLTVGAEASKEAHRFSTVLILPFLGVSLALYRWNKW
                     PAKVFVGDTYCYFAGMVFAVVGILGHFSKTMLLLFLPQIVNFLYSCPQLFNIVFCPRH
                     RLPRFNESDGLLYPSRADLKENPPKGFFVPVLRLLHVLHLIDLEFDKDNNIVSCSNMT
                     MINLLLVWFGPLREDKLCNRILIIQFMFGLCALTARHAVGTLLFGNDNLSSIRLQ"
     gene            complement(<185416..>186123)
                     /locus_tag="CAGL0C01749g"
                     /db_xref="GeneID:2886922"
     mRNA            complement(<185416..>186123)
                     /locus_tag="CAGL0C01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445251.1"
                     /db_xref="GeneID:2886922"
     CDS             complement(185416..186123)
                     /locus_tag="CAGL0C01749g"
                     /inference="similar to AA sequence:UniProtKB:P38331"
                     /note="similar to uniprot|P38331 Saccharomyces cerevisiae
                     YBR242w or uniprot|P53144 Saccharomyces cerevisiae
                     YGL101w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445251.1"
                     /db_xref="GeneID:2886922"
                     /db_xref="GOA:Q6FWZ3"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ3"
                     /translation="MRQMSNTRTVSQEVVNGDIKLSTKIWAPEDYIPQDVKNMLAEDT
                     PNYMLSFMKVLEQLKVQRRTGWLDHGMTKCESIADHMYRMGIISMLIKNKEVSKDQCV
                     KIALIHDMAESLVGDITPVDPIGKEEKHRREMETINYISETLIKPFNEEAAEEIKSLW
                     YSYENITSLEARYVKDIDKYELLVQCFEYEKQHKAKLNFQSFFQAAEWVKTDEVKEWV
                     NDLIARRNRFFASLEKS"
     gene            <187030..>188487
                     /locus_tag="CAGL0C01771g"
                     /db_xref="GeneID:2886953"
     mRNA            <187030..>188487
                     /locus_tag="CAGL0C01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445252.1"
                     /db_xref="GeneID:2886953"
     CDS             187030..188487
                     /locus_tag="CAGL0C01771g"
                     /inference="similar to AA sequence:UniProtKB:P38142"
                     /note="similar to uniprot|P38142 Saccharomyces cerevisiae
                     YBR241c or uniprot|P53142 Saccharomyces cerevisiae
                     YGL104c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445252.1"
                     /db_xref="GeneID:2886953"
                     /db_xref="GOA:Q6FWZ2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ2"
                     /translation="MTATESLMGNTRRKIELTSSLILAVLVSCLGTIQFGYHIAELNA
                     PQQFLTCSEVKYPHGDPDIPYDETLFGRHGLVQCIPMTTEQFGVVTSVLSVGGLIGSY
                     IAGQLAAKYGKKKISQGTAFVYFIGSLMLTMANGYWTMIFGRLLVGMASGISIVVIPV
                     YINEITPAEYKGAMGTMNQLSINIGILFTQTIALVFTNSYYWRWILLIGTAIALVNFV
                     AWSTIDESPKWLLKRGLTSEAEMVVYKLHGGTYQDAKDQIQTWQTDMNSHHEHADFAG
                     REPTLWEFVTREEYKKPRNVIFMILCAQQFCGINSIIFYGVKVISNSLPNSAVLVNFG
                     ISVLNVLMTFVASVIIDSLGRKPLLLSSSALMAGTSFLISIGISKDVPILLVIAVFAY
                     IASFAIGVGPIPLMIISELTTHEAAAKAQSFGTICNWLATFLVGFLFPSFHEVMGGAV
                     YCIFSIVAIGFVIYIKYRVPETKNKTSYSDVWRGY"
     gene            complement(<188714..>189049)
                     /locus_tag="CAGL0C01793g"
                     /db_xref="GeneID:2886960"
     mRNA            complement(<188714..>189049)
                     /locus_tag="CAGL0C01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445253.1"
                     /db_xref="GeneID:2886960"
     CDS             complement(188714..189049)
                     /locus_tag="CAGL0C01793g"
                     /inference="similar to AA sequence:UniProtKB:P38325"
                     /note="similar to uniprot|P38325 Saccharomyces cerevisiae
                     YBR230c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445253.1"
                     /db_xref="GeneID:2886960"
                     /db_xref="GOA:Q6FWZ1"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ1"
                     /translation="MSEHNEEKKCSCLSFEQLKSCAVEKTNYVIARAQTLAVKLYREL
                     QNPVVLVNVILGSSVVVTLLQSYAKYEHRFLQGKSDGQILATAGAAAAILTLDGFLSQ
                     KYYKKFDKQ"
     gene            complement(<189501..>190973)
                     /locus_tag="CAGL0C01815g"
                     /db_xref="GeneID:2886959"
     mRNA            complement(<189501..>190973)
                     /locus_tag="CAGL0C01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445254.1"
                     /db_xref="GeneID:2886959"
     CDS             complement(189501..190973)
                     /locus_tag="CAGL0C01815g"
                     /inference="similar to AA sequence:UniProtKB:P38177"
                     /note="similar to uniprot|P38177 Saccharomyces cerevisiae
                     YBL086c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445254.1"
                     /db_xref="GeneID:2886959"
                     /db_xref="GOA:Q6FWZ0"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:Q6FWZ0"
                     /translation="MAIGKSGKDKRPKFLLEFQIKELVNVPQSGGVCYVKWNLKDGTG
                     TSDTTVTGASGESVSVSNVHRGITNKVSVKRHRAQWNYKLEKPMHVKLHLDKYRKFVP
                     KLLYLEVYFEFTDNKPGAMSSVKRDDNGRRSRSGSGNTDSGRDSPIAGVKNAIDNQAN
                     NVANAFDLKRFSLDTNIHTLRMHPSFSSVTNGANCNSNYTQRTSGKVLLGTVKINITE
                     YIKEDESPISNRFLLNDSKVNSILNMTLKMKLTRGSYQDFIVPNAFTSGQLSTSFRGE
                     LTGILDGGSERGSPTSSPIPSTLFSNSGTGTSGVGTSMSSSTQRTRFTNTISAAMSPL
                     VDTLYQKTFQLPWDPRPGEFTPRECVDDILNGGSGWARNEKGVNLIDIEALKINEMEE
                     EYYAKRNVSRPESSTKTAYHSKDGRTCEKMSEKDLKGFNNMDTREFMEKKREWSKLSQ
                     AQRERLRNDDTEDEKGGSPENYIIEGMKEARSWTIKQPVF"
     gene            complement(<191463..>193387)
                     /locus_tag="CAGL0C01837g"
                     /db_xref="GeneID:2886963"
     mRNA            complement(join(<191463..192476,193379..>193387))
                     /locus_tag="CAGL0C01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445255.2"
                     /db_xref="GeneID:2886963"
     CDS             complement(join(191463..192476,193379..193387))
                     /locus_tag="CAGL0C01837g"
                     /note="weakly similar to uniprot|P25560 Saccharomyces
                     cerevisiae YCL001w RER1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445255.2"
                     /db_xref="GeneID:2886963"
                     /db_xref="GOA:Q6FWY9"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY9"
                     /translation="MIIISRVLKGWRIGCTLEDYKIEPAEMLSLKPGATLVQKYKNLY
                     QLCLDKCTAYTKLRWVAELSLVLLFIKFINRVVNVSFDFDVYAAFSMYVLFPSSRFVA
                     HKLDVYLQQDEGKLDVGDKPDDLHSFTKRPAEFRLWYYCIRTTAFYIFWGLLIYPIVP
                     LLPTFDLYFHGMSCFAYMFKVFVQSYTNTYHNYLHICKRHTIVRWIAEAALMVLVTFC
                     YAFEMSKVDVFFIYYTLGISMINSFNNYLRDVRVMSLQQAKDNSDLEANDSNAEFRPY
                     LKRPPELVLWCKCVKYTVITALTRLLIFLELFNPDVTVLFLYNLYWTAICVIEIILIM
                     IRQAKY"
     gene            complement(<193730..>196167)
                     /locus_tag="CAGL0C01859g"
                     /db_xref="GeneID:2886740"
     mRNA            complement(join(<193730..194815,195970..>196167))
                     /locus_tag="CAGL0C01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445256.2"
                     /db_xref="GeneID:2886740"
     CDS             complement(join(193730..194815,195970..196167))
                     /locus_tag="CAGL0C01859g"
                     /note="weakly similar to uniprot|P25560 Saccharomyces
                     cerevisiae YCL001w RER1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445256.2"
                     /db_xref="GeneID:2886740"
                     /db_xref="GOA:Q6FWY8"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY8"
                     /translation="METPCPPERRLHHMVFSRLPPKTRLDTAQLTKQKARSIVQRKAQ
                     RHKHKNTKHKTHTLRTMRTRPLISRVLKGWRIGCTLEDYKIEPDEMLSSKPDATLDHN
                     DHKYKKLYRLCLAKSTAYTKLRWVVELSLVVLFLSRFKPLPDCYVYDGKWFDDLYCFL
                     SGCTYGFVNDKVLQQYNEYLDVGEKPDVFHPILSRPSEFKFWHYCIRTTVYYILWELL
                     VSQCRPLFWPLAFVLHSTYCLAYVFKVFLRSENPTHQFYLDVCKRHTMARWISGIGLL
                     SFVLFLYRCHYAWELCYYALGISILDAFIMCLTRMHDIYSQQPKDNSQEANEASMEFR
                     PYLRNSPEFILWCICIKHTVWFLVLSLFEVRYDQEDIVVFIFFYDVYWTVICVIKAVL
                     LMNSYGTYQHRYVNEMRWLQDTMALDGVLKCPPCM"
     gene            <196299..>199298
                     /locus_tag="CAGL0C01881g"
                     /db_xref="GeneID:2886747"
     mRNA            <196299..>199298
                     /locus_tag="CAGL0C01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445257.1"
                     /db_xref="GeneID:2886747"
     CDS             196299..199298
                     /locus_tag="CAGL0C01881g"
                     /inference="similar to AA sequence:UniProtKB:P38041"
                     /note="similar to uniprot|P38041 Saccharomyces cerevisiae
                     YBL085w BOB1 BEM1 protein-binding protein or
                     uniprot|P39969 Saccharomyces cerevisiae YER114c BOI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445257.1"
                     /db_xref="GeneID:2886747"
                     /db_xref="GOA:Q6FWY7"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY7"
                     /translation="MVPVYVCVNEYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGK
                     NLRTAQVGLYPAVFTQPIGHTTRTTAKSDRRVPTPKLDHGNFVDTRMSGAGGHAVGAV
                     GAVGAASAVGAETPPLSASSVATSAVHSTLNDIDLALAELRKDSVTLSQPPQVSGESL
                     PPTPMSRDSGAGFAAGNPVSHGHASHTGHASYSVPLSRDRIIAWAPKDVAEYMLSRGF
                     DFTTASKFQKHQITGIILLEMQTNMLKEIEISSFGIRFELEKEINHLRSVVYNNSTPR
                     LHSNNWDGSRSASQNTNRDSVLISPPSQMVSSQTEKPYRSLDNLQNPARIRKSSTSNR
                     PASTIISSESYNRRPSEIHSLSSRVPTGGLSVPGSNNSSNPNFNPALYAVPVDEILKD
                     GTIFESPGRAPKPPSYPSPVQPPQSPMAKPNKGNSPYMVAPPKFESRTPSLASSASLV
                     NSSNSILTSSSDLGNNSSKFKFPANQNDKVSGLLAPSKEISPSLEMDGLSGRTSSSGT
                     RDVALGDSDTPINLPNHSRKSSGLKRNSVVYKTHKKSESGGSFVELFNRISMLSPGKD
                     EDPINGHKRSSSSATYQSHTHRRSASNATIQHHSRNSSQNLNHMRQPSIDEQRHRRNS
                     SQNLAHMRQPSMDGARHRRNSSRLSFFGGKGDNLLQTLSPNVLTSQSHSRKGSYITSP
                     FKQQFTDAVTNLESPTANSNGILSPSKAKSPQKFTSPLKSTPNTTKHDDKKTGEKPLV
                     HKNRIDNILKDEEEKKRSVSETAVKDKSSRLARPIRPANNKQQTSAFQEGLRSITVQE
                     AMKTADCSGWMSKKGSGPMGTWKERFFVLHGTRLSYFASVNDTKERGLIDITAHRVVP
                     ANEDDKLVALYAASVGKGRFCIKLLPPQPGSKKGLTFTQPKIHYLAVETKDEMRAWLS
                     ALIKATIDFDTSVPVISSYATPTVSLSKAKEMLSEARKLTQERDNERRFDETDEDKLY
                     WEEQLQQNSSSSLADSKKLDQFGQEYF"
     gene            complement(<199487..>201796)
                     /locus_tag="CAGL0C01903g"
                     /db_xref="GeneID:2886773"
     mRNA            complement(<199487..>201796)
                     /locus_tag="CAGL0C01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445258.1"
                     /db_xref="GeneID:2886773"
     CDS             complement(199487..201796)
                     /locus_tag="CAGL0C01903g"
                     /inference="similar to AA sequence:UniProtKB:P38042"
                     /note="similar to uniprot|P38042 Saccharomyces cerevisiae
                     YBL084c CDC27 subunit of anaphase-promoting complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445258.1"
                     /db_xref="GeneID:2886773"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY6"
                     /translation="MVDSNGKSVPESEEDSNSLERIQQLQDVIRSCLEDLSYDSAEFY
                     GEIMHAECSILDKSHFYLPYYEYYYCLALYLNGKHLVAMKAAEPYIERNLATCFVFAK
                     SALALSKHMDKAITSLLRFLKSSNEIEMESSERSLLKFDIIEGNEKENRNERMPLPHG
                     PTEATVHCLLGNLYYKISKMDDSKGHYQKALSYNPYLWEAMAQLNKMGTSVDLPNHYR
                     TLEKRNREWTEYYRTPLLVYNTESAINNPLSLGIPPDTITSHQQSNSKHRAKSSFQST
                     SRVKKARPFSSGSSLLFTPFKSTNSPPVVRTTNTTTSAFISTTSPSSNSGPASQNSFS
                     SAHKTPSYAVKGVSSGGPLFANSNNKITYKSNHSSVNSQAKSKTKGKLFSTPPSKLFS
                     TNENHRDTLTKTPQTIKSSNEFQDLTFREEDEIDESQLAMKLLSNNGKEMKLSDLSYI
                     FGLIAKCCSTYDAYKAIRLFHNCIPDHIVKNMPWCLAQLGKLHYEIVNYEMASIYFMQ
                     LFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPNKPETWCCVGNYLSLKKD
                     HEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYG
                     MGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQDKALEYYELACTL
                     QPNSNLARFKRANLLYAMGRYNLALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEA
                     IREFTVAMNLDPKGNQLILDALEKCHRQE"
     gene            complement(<202384..>202488)
                     /locus_tag="CAGL0C01919g"
                     /db_xref="GeneID:9487971"
     mRNA            complement(<202384..>202488)
                     /locus_tag="CAGL0C01919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999477.1"
                     /db_xref="GeneID:9487971"
     CDS             complement(202384..202488)
                     /locus_tag="CAGL0C01919g"
                     /note="highly similar to uniprot|P34166 Saccharomyces
                     cerevisiae YNL145w MFA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999523.1"
                     /db_xref="GeneID:9487971"
                     /db_xref="GOA:B4UMY2"
                     /db_xref="UniProtKB/TrEMBL:B4UMY2"
                     /translation="MQPTIEATQKDNTQEKRDNYIVKGFFWSPDCVIA"
     gene            complement(<202920..>204122)
                     /locus_tag="CAGL0C01925g"
                     /db_xref="GeneID:2886817"
     mRNA            complement(<202920..>204122)
                     /locus_tag="CAGL0C01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445259.1"
                     /db_xref="GeneID:2886817"
     CDS             complement(202920..204122)
                     /locus_tag="CAGL0C01925g"
                     /inference="similar to AA sequence:UniProtKB:P53063"
                     /note="similar to uniprot|P53063 Saccharomyces cerevisiae
                     YGL246c RAI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445259.1"
                     /db_xref="GeneID:2886817"
                     /db_xref="GOA:Q6FWY5"
                     /db_xref="InterPro:IPR013961"
                     /translation="MGISANLFVNQKGTTTALKQPKEIGYYSRNQTEEYLVSDDINLR
                     YYYLPDQEIEHGIDLSAGASKFRDVAKDFKDRCSLKGLLDTLMEYEKKKNKKSNVDII
                     TFRGIMSKLIRASMEPPNFNKVDLRIVSYDGQLFIKDVSDYNAATNESNSSGVNSRQQ
                     AGTSRQQIDTYTGYKFEGIATLDKPLPYVEREVIEKRPRKILNNGDEYITVVRTGVGE
                     CKVVLGAEIDCIFDFKEEGKDNLKHYTELKCSSQISTTNDVRRFEKKMFRAWLQCFLV
                     GVPRVIYGFRDDQYMLKTVEEFSTEEIPVIIKANNPTLGQSCLDAIKWYGLFTDWLLK
                     IIPREQSGNIRAYRLVYENNHLRLSEIEEQDGEYSRYVLEDGILTPEFKEWRESLRVP
                     SEETPKAD"
     gene            <204411..>206528
                     /locus_tag="CAGL0C01947g"
                     /db_xref="GeneID:2886802"
     mRNA            <204411..>206528
                     /locus_tag="CAGL0C01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445260.1"
                     /db_xref="GeneID:2886802"
     CDS             204411..206528
                     /locus_tag="CAGL0C01947g"
                     /note="highly similar to uniprot|P46655 Saccharomyces
                     cerevisiae YGL245w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445260.1"
                     /db_xref="GeneID:2886802"
                     /db_xref="GOA:Q6FWY4"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY4"
                     /translation="MSSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKS
                     AAATFDGKSDNALEAIVAKFPEILGANEESKPWIKLAAEELVIKNFQKLAQSLEKLDA
                     QLNFRTYINGGLKFDSADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQ
                     SHEFLTKSLQELKKAANAGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHA
                     KAALLNQYFAQAYKGKLIIRFDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYF
                     QEMYELCVKLIKEGKAYCDDTPTEKMREERMDGIASARRERSVEENLKIFTEDMKNGT
                     EEGLKNCVRAKIDYAALNKTLRDPVIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIE
                     GVTHALRTIEYRDRNAQYDWFLDNLNLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNL
                     VSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDPVA
                     PRHTAIVNPVKIHIEGAPESPKTEMKPKHKKNPAVGEKKVIYYQNVVIDKEDADSIED
                     NEEVTLMDWGNIIITKKNADGSMEAKLHLEGDFKKTKHKLTWLADTDDSVKVDLVDFD
                     HLISKDKLEEDESFEDFLTPQTEFHTEAIADLNVKDMIVGDIIQFERKGYYRLDAEAK
                     DGKPYVFFTIPDGKSVNKYGAKK"
     gene            complement(<206652..>208511)
                     /locus_tag="CAGL0C01969g"
                     /db_xref="GeneID:2886752"
     mRNA            complement(<206652..>208511)
                     /locus_tag="CAGL0C01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445261.1"
                     /db_xref="GeneID:2886752"
     CDS             complement(206652..208511)
                     /locus_tag="CAGL0C01969g"
                     /inference="similar to AA sequence:UniProtKB:P43620"
                     /note="similar to uniprot|P43620 Saccharomyces cerevisiae
                     YFR048w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445261.1"
                     /db_xref="GeneID:2886752"
                     /db_xref="GOA:Q6FWY3"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY3"
                     /translation="MSYRDTGMDKKGTGTMSKRSPSILVTDARTSKNRRSAPFAGHAA
                     GVRSASSSTGSGSSASAERGAELMKYVNGNLRGSRGQYAATGGRSSSNHGTGDLSNRG
                     TSSPPRRRASGRFSEISIDNILSDRSDVPSGRREERGSNSSFDRSMIYDRLHPQPIRK
                     MINTLPIRTSKTSQKLVLIPEDGSVPPTRGALERREQPTFVKRNPTERIPKSSRDHRL
                     SRITAYNLAEGFNLKLLSKFLKSTHEVKPRLYDECLYIAYTLPLLPGKDGFRLKSNVS
                     KKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDANNNYELDPTSVDNENNNNSNNN
                     PADSFDPSEPQYFAEETPKEQLERERSESLHINPGSKPIAVNADEDQHAEIFVFHYGV
                     IVFWNFTEEEEKNLLGDIAFSDYKNLVIRPLDEQDIEIEQFHFEYDKDTERPRIFNDI
                     ITLRSGDHIIELTLSHAIAQSSKLSRFESRISPILTTVTRLPKRLALYGTLGLKREQL
                     IKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRC
                     MVFLEFFDICVDSIAERNIVRVTWWFFVAIVITVIFSLIEVFIRYLIINRLKH"
     gene            <208793..>209806
                     /locus_tag="CAGL0C01991g"
                     /db_xref="GeneID:2886853"
     mRNA            <208793..>209806
                     /locus_tag="CAGL0C01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445262.1"
                     /db_xref="GeneID:2886853"
     CDS             208793..209806
                     /locus_tag="CAGL0C01991g"
                     /note="weakly similar to uniprot|P43618 Saccharomyces
                     cerevisiae YFR046c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445262.1"
                     /db_xref="GeneID:2886853"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY2"
                     /translation="MESKDEESSVIETPFKRRAEVLKRLKEQMLLESTPGLKKRRVFD
                     VGNLKNSPNESRMFLKELDSALASRGDGKQHGVSNLQDKLLDAEETHEDNEPDAYRDP
                     SSIQDQQQESLSVAVFSQIKDTKARKHVNLQDESFVIQDNEPNFNDIGGLDDHNDDYN
                     DVQIPSSPAQIETTIESPERIVADSSLHYIPRVHSPTGKYDERDVFHNYSTDEESINE
                     EQEIEESYKESLLQVPELRKIVESIPGLQNIDMPRRSWKALGSIIPQLIANSVQCYES
                     QNEQDMRTLNVNYANVKDMLVRYNLCRSDCTKEQVFETACNYLTLEQCNLLELEMFSE
                     FLQ"
     gene            complement(<209930..>210919)
                     /locus_tag="CAGL0C02013g"
                     /db_xref="GeneID:2886794"
     mRNA            complement(<209930..>210919)
                     /locus_tag="CAGL0C02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445263.1"
                     /db_xref="GeneID:2886794"
     CDS             complement(209930..210919)
                     /locus_tag="CAGL0C02013g"
                     /note="weakly similar to uniprot|P38152 Saccharomyces
                     cerevisiae YBR291c CTP1 or uniprot|P43617 Saccharomyces
                     cerevisiae YFR045w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445263.1"
                     /db_xref="GeneID:2886794"
                     /db_xref="GOA:Q6FWY1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY1"
                     /translation="MTQNKVNDNVTLITAGSVSGLFSATITYPFEFLKTGLQLHRNVV
                     AAKPFEVLGYQVRTYFAGCSAVNIGVVMKTSLRFLAFDKASEWLRPPALAKDAPLSGV
                     QLLMAGALTGTMESLCIIPFENVKVAMIQNSLLSHERLNTTTSNVQGQVANEVKKTFH
                     KKPTLRSSYEALFPEKLPTNVLTTAAELYRQHGLRAYFKGTMPTLMRQVGNSVVRFTT
                     FTMLKQFAPKEYQNNEYFATLLGLISSCAVVGATQPLDVIKTRMQAKDSVLLYRNSIN
                     CAYRIFVEEGFAMLWKGWLPRLMKVGLSGSVSFGIYQYTENMIALMRQERYLE"
     gene            <211507..>212958
                     /locus_tag="CAGL0C02035g"
                     /db_xref="GeneID:2886847"
     mRNA            <211507..>212958
                     /locus_tag="CAGL0C02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445264.1"
                     /db_xref="GeneID:2886847"
     CDS             211507..212958
                     /locus_tag="CAGL0C02035g"
                     /note="highly similar to uniprot|P43616 Saccharomyces
                     cerevisiae YFR044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445264.1"
                     /db_xref="GeneID:2886847"
                     /db_xref="GOA:Q6FWY0"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:Q6FWY0"
                     /translation="MSSTRAFDKVFTKIDELKPEFIGMLSKAIAIPAVSSDESLRPRV
                     VEKAHFLADHLKKLGFADIQLKELGTQPPPVSDPNLQLPPIVLARYGNDPAKKNVLVY
                     GHYDVQPAKLEDGWDSEPFELVVDEKKQVLRARGSSDDTGPLTGWLHVVQAHQAAGVE
                     LPVNLITCFEGMEESGSLGLEELIGAEKDKYFKGVDAVCISDNYWLGTRKPVLTYGLR
                     GCNYYQVTIEGPGADLHSGMFGGIIAEPMIDLVQVMSTLVDSQGKILIEGVDAMVAKE
                     TEKEQELYKTIDFSVEELNAASGSETALYTKKEDILKHRWRYPSLSIHGVEGAFYSQG
                     AKTVIPAKVIGKFSIRTVPDIDSEKLTQIVVDHCHAAFKKLNSPNRCKAELIHDGNYW
                     VSDPFNAQFQAAAKATKDVYGVEPDYTREGGSIPITLTFEEQLKTSVLLLPMGRGDDG
                     AHSINEKLDISNFVNGMKLMAAYLHYYAESPEK"
     gene            complement(<213180..>213539)
                     /locus_tag="CAGL0C02057g"
                     /db_xref="GeneID:2886886"
     mRNA            complement(<213180..>213539)
                     /locus_tag="CAGL0C02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445265.1"
                     /db_xref="GeneID:2886886"
     CDS             complement(213180..213539)
                     /locus_tag="CAGL0C02057g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445265.1"
                     /db_xref="GeneID:2886886"
                     /db_xref="GOA:Q6FWX9"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX9"
                     /translation="MIWYYKDIEKVAGTQPVFQPQEIPEYQPQAPRPVGEPVEQWINS
                     DAYAVELPIRNYSMIIHPQWQPPIEKQDEEKNQKLSILHKIGKVIWRPAVLDGIFVTI
                     CAIGIIYIIFMLFKYDI"
     gene            <213832..>214629
                     /locus_tag="CAGL0C02079g"
                     /db_xref="GeneID:2886863"
     mRNA            <213832..>214629
                     /locus_tag="CAGL0C02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445266.1"
                     /db_xref="GeneID:2886863"
     CDS             213832..214629
                     /locus_tag="CAGL0C02079g"
                     /inference="similar to AA sequence:UniProtKB:P43615"
                     /note="similar to uniprot|P43615 Saccharomyces cerevisiae
                     YFR043c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445266.1"
                     /db_xref="GeneID:2886863"
                     /db_xref="GOA:Q6FWX8"
                     /translation="MLDESSSSDESRATELPVSSEDECEEVTDAKVLPNKVLVVFEGE
                     STLFRDQLLDTVFGVQDQGNIVKQLSWDTKYYAVEYDLYVDECVDIHGWLNEVNSDDY
                     EELRDLLTMIIIVRSFDSTQDTKEYNSVLYDFIQGNSVSVISVNTNSARQVKDTYDEF
                     LELDASSIEFINYHDDRVEKETNECKGMARLKEIIDTHPWTDCKVVLKNKESTSDKVN
                     KPDLEYLIDTLKKAKIHYQKLSNGSDGFSEEAEQFALQMATDIANNL"
     gene            complement(<214712..>215305)
                     /locus_tag="CAGL0C02101g"
                     /db_xref="GeneID:2886894"
     mRNA            complement(<214712..>215305)
                     /locus_tag="CAGL0C02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445267.1"
                     /db_xref="GeneID:2886894"
     CDS             complement(214712..215305)
                     /locus_tag="CAGL0C02101g"
                     /inference="similar to AA sequence:UniProtKB:P43614"
                     /note="similar to uniprot|P43614 Saccharomyces cerevisiae
                     YFR042w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445267.1"
                     /db_xref="GeneID:2886894"
                     /db_xref="GOA:Q6FWX7"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX7"
                     /translation="MFTHKLFQLYQLQTTLLYLALFGRWLVLMPLVGSRYLPGGIHEY
                     LCYLLVIVSVFEVLWSLYFHGLRGFISQRVLKSLNYLYLVLNLHFYDDYEHAPLLKTS
                     AYSTFIIGVSLVESYQHWCRLFKRGPNYKRETRYWKFISYVMLPCLYLSEFVLLLLNR
                     QLPNHHTTEQLELVNTVVLILYFPMALTVYKRHLQVN"
     gene            <215564..>216457
                     /locus_tag="CAGL0C02123g"
                     /db_xref="GeneID:2886889"
     mRNA            <215564..>216457
                     /locus_tag="CAGL0C02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445268.1"
                     /db_xref="GeneID:2886889"
     CDS             215564..216457
                     /locus_tag="CAGL0C02123g"
                     /inference="similar to AA sequence:UniProtKB:P43613"
                     /note="similar to uniprot|P43613 Saccharomyces cerevisiae
                     YFR041c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445268.1"
                     /db_xref="GeneID:2886889"
                     /db_xref="GOA:Q6FWX6"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX6"
                     /translation="MVGISRQLVVLVCLLAVAYCFTAEEVEIFQLQKEIAKKYGDFYK
                     FLKLPNGKSSTEKQINKNLRKLARKYHPDKNPKHKKLYARLNLATKILTNHSSRKTYD
                     YYLKNGFPDYDFSKGGFFFQRAQPKTWFIIGFVLLVATAFHYIILKLQYNSNRRRIAR
                     FIQSCKEQDTTDGLGEKSLFFKQHEDDPGKELVLRFGDVFVIEEDGSESLISEDTIEE
                     PKLTDALLFKFLNAVKNRTVGKLFKSTTKKLHEETTEKIDVAEDNSNDDKKPKAEMKI
                     KPGQKKMTLPNGKVIYSRKSD"
     gene            complement(<216905..>219238)
                     /locus_tag="CAGL0C02145g"
                     /db_xref="GeneID:2886955"
     mRNA            complement(<216905..>219238)
                     /locus_tag="CAGL0C02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445269.1"
                     /db_xref="GeneID:2886955"
     CDS             complement(216905..219238)
                     /locus_tag="CAGL0C02145g"
                     /inference="similar to AA sequence:UniProtKB:P43612"
                     /note="similar to uniprot|P43612 Saccharomyces cerevisiae
                     YFR040w SAP155 SIT4P-associated protein or uniprot|P53036
                     Saccharomyces cerevisiae YGL229c SAP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445269.1"
                     /db_xref="GeneID:2886955"
                     /db_xref="GOA:Q6FWX5"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX5"
                     /translation="MTINGSELAELTVPLTGEETEQRLDSSFIDRMLKEGELLNELAA
                     QNKGLIDFICFGFFFKENEKERVENIDYLLDQLLFCVDQFKMVEADTVNVTRENSPAD
                     EGIEMDFNKVIEDNAEDEDEYLSRANLIAEIFSLDIWLITESLVKNKEHLSKIWNLLH
                     NPNFKFERSPLIPIFLKMNQNLLITRQDQYLNFIRSQSSLVDDMLMHIDIALLMDFFL
                     KLISTDKIESPTGVIELVSDQKLIDKLLKFLNNNLYSADIQACVCDFLKALIVISANA
                     PLDELSIGPNSLTRRLASPKSIDKMIKIVLNERGAALNSTISIVIELIRKNNSDYDQV
                     NLLDTTLETHPPSDRDPIFLGYLLRRFAANLPKLFEIIDDIYDNNDTNDDMLLTNQMN
                     EKFIPIGFERFKIVELIAELLHCSNMGLLNTKRAERIARVRDKVRKQVSFQLQDALND
                     LTINPSVDNKRKSDTAQQNDKHDAFDGIQSENESHDEFEHINQDENDEIDETFEIPYI
                     NENQNSKLRTNPTIGDLFKIKLYDCQIIPKIMKLFLNHPWNNFWHNVIFDIIQQIFNG
                     RMDFSYNSFLVFSLFNLEGSFQYMDSEAAKDAKLKDFSITKDFILEGYHKSYKFYEEK
                     NTNLGFMGHLVLIAEEVVKFSKLYKVELISTDIQDSLQEDDWQYYSEEVLNRTRLMYS
                     KILGGGNFVEDANGNIVPQMNDGNYLDYDDENDVSGGKLINVENLEEQLSLSTESDLH
                     LKLRDMLVVKAQQEVDAKNAANGVIILGGPEEIPDNQ"
     gene            <220619..>222061
                     /locus_tag="CAGL0C02167g"
                     /db_xref="GeneID:2886910"
     mRNA            <220619..>222061
                     /locus_tag="CAGL0C02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445270.1"
                     /db_xref="GeneID:2886910"
     CDS             220619..222061
                     /locus_tag="CAGL0C02167g"
                     /note="weakly similar to uniprot|P43611 Saccharomyces
                     cerevisiae YFR039c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445270.1"
                     /db_xref="GeneID:2886910"
                     /db_xref="GOA:Q6FWX4"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX4"
                     /translation="MARGLFLVVLVAASVLLGVLYRDPMTPGCMDMIKYTGYQSTSVP
                     YLAVLIELLLDMWGKVVEFVHRNRLCCTLHRKLGPLLQHLRIVLYYLKPFAQQASSSF
                     NDGFAILRGNLDFSRIDEGYSMLSLINNGRNVIESDEEDEDEEDGDEKSTKNKKQSKN
                     KEQAESSNVDAIVDAVLNDPTDVTLHKDTDDSAVQFPQLSELINTEVLLQEGGFNIWV
                     KSISRKFKAIENELSQEVDNTISSTVVSGVENFQKDIEELRSDMDAQISILKDTVQNI
                     NCTMIYDENTDSVFYYDHTGQKLLDTYVTRPLIMHHLKSTETRLEQLVEAVKLQVENM
                     VEQSHIALEAVRNETIEAYEEWGDTFYTEWSKYMAYRDIYDEDGEEPRPLAIDGKGKG
                     EDQGDDEVAKIYEDWFEFTLHKKDIIQFRDQLLHKQLDTKKLKQFETSLDSQLDSLEK
                     TYTAQIQSLRSQADRLLKDRDHKEAQMFKQ"
     gene            <222418..>223767
                     /locus_tag="CAGL0C02189g"
                     /db_xref="GeneID:2886930"
     mRNA            <222418..>223767
                     /locus_tag="CAGL0C02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445271.1"
                     /db_xref="GeneID:2886930"
     CDS             222418..223767
                     /locus_tag="CAGL0C02189g"
                     /note="highly similar to uniprot|P39954 Saccharomyces
                     cerevisiae YER043c SAH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445271.1"
                     /db_xref="GeneID:2886930"
                     /db_xref="GOA:Q6FWX3"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX3"
                     /translation="MSAPAQNYKIADISLAAFGRKEIELAENEMPGLMAIRKAYAEAQ
                     PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWTSCNIYSTQDHAAAAIAASGVPVFA
                     WKGETEEEYMWCIEQQLFAFKDNKKLNLILDDGGDLTSFVHEKYPEMLTDCFGLSEET
                     TTGVHHLYRMMREGKLKVPAINVNDAVTKSKFDNLYGCRESLVDGIKRATDVMLAGKV
                     AVVAGFGDVGKGCAASLRGMGARVLVTEIDPINALQAAMEGYEVTTMEDAASVGQVFV
                     TTTGCRDIIKGEHFEKMPEDAIVCNIGHFDIEIDVAWLKENAKECINIKPQVDRYLLS
                     SGRHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKSDDKAFRTKFVEFEK
                     TGPFEVGVHVLPKILDEAVAKFHLEKLGVKLTTLSDVQSEYLGIPQQGPFKADHYRY"
     gene            <225012..>226457
                     /locus_tag="CAGL0C02211g"
                     /db_xref="GeneID:2886767"
     mRNA            <225012..>226457
                     /locus_tag="CAGL0C02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445272.1"
                     /db_xref="GeneID:2886767"
     CDS             225012..226457
                     /locus_tag="CAGL0C02211g"
                     /inference="similar to AA sequence:UniProtKB:P32623"
                     /note="similar to uniprot|P32623 Saccharomyces cerevisiae
                     YEL040w UTR2 cell wall protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445272.1"
                     /db_xref="GeneID:2886767"
                     /db_xref="GOA:Q6FWX2"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX2"
                     /translation="MLFLISLLSLFANILSVEAAELTAPIYCNATSQCPEEFPCCSQF
                     GQCGTGQYCINNCNPKFSFSIDSCVPMPVCKDSSTKFDDYSSKVLNADTYLNNASAAD
                     WTYSGYLVDYPDEDSMILAMPKNSGGSVLSTTRYMWYGKVSARLKSSHLGGVVSSMIL
                     FSNVQDEIDIEFIGADLNTVQTNFYWEGTLNYTNSANMTTSNTFENYHDYEIDWHEDY
                     ITWSIDGVVGRTLYKNQTYNETTGIYEFPQTPSRIQISIWPGGNATSAPGTIAWAGGA
                     INWDAPDIQDPGYYYMMVQEANITCYDPPANVKKNGTKSYIYTSNKDFTQDSIMISDK
                     DFVLENSAWTGLNLTEGAKAKPSEAKASSKLSSSHNSTSSASSTSFHNSTSSTMHHNS
                     TLTSITSKFSNSTSQSSTKHASTTSKTSERKSTASKTDPSTLQTTTKSSQSSSTSTST
                     IRNQKDSNTGAITKLNGLCAIIVAILTALLA"
     gene            complement(<226767..>227324)
                     /locus_tag="CAGL0C02233g"
                     /db_xref="GeneID:2886770"
     mRNA            complement(<226767..>227324)
                     /locus_tag="CAGL0C02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445273.1"
                     /db_xref="GeneID:2886770"
     CDS             complement(226767..227324)
                     /locus_tag="CAGL0C02233g"
                     /inference="similar to AA sequence:UniProtKB:P40029"
                     /note="similar to uniprot|P40029 Saccharomyces cerevisiae
                     YER042w MXR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445273.1"
                     /db_xref="GeneID:2886770"
                     /db_xref="GOA:Q6FWX1"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX1"
                     /translation="MSKVIAKSIKYNPETEKLITLGAGCFWGTEHIYRKHLGDKIHDS
                     KVGYANGDESSKDLLNRVSYKRVCKGDTNFCEVLQISYDPKKVSLKELIDFFFRIHDP
                     TTVNAQGPDVGTQYRSAIFTHSPEDLKEVQKLKEEWQPKWNNKIVTEVGPIETFYEAE
                     EYHQIYLDRNPNGYACPTHFVRNLK"
     gene            complement(<228009..>229955)
                     /locus_tag="CAGL0C02255g"
                     /db_xref="GeneID:2886856"
     mRNA            complement(<228009..>229955)
                     /locus_tag="CAGL0C02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445274.1"
                     /db_xref="GeneID:2886856"
     CDS             complement(228009..229955)
                     /locus_tag="CAGL0C02255g"
                     /inference="similar to AA sequence:UniProtKB:P40028"
                     /note="similar to uniprot|P40028 Saccharomyces cerevisiae
                     YER041w YEN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445274.1"
                     /db_xref="GeneID:2886856"
                     /db_xref="GOA:Q6FWX0"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FWX0"
                     /translation="MGVPAIWEFLKPYIKDRRKTLKGFVCQFRKENGRSPRIAIDGHN
                     WLFECGFYHNDARAEPFSFTKDSHDDDTLYAKPYMNMIHKLKELSLLDVSFVIVFDGP
                     LKPKFKRQKETLRSITGTADVDTYLTSYVDSYRSFQTERPEGMMKKYMSQYTLKKVQE
                     LLNLLKVNYTFAYGEGESHCAWLQISDHVDYVMSNDSDTLMFGATRVLRNLSKNLEDK
                     SPSSRQGNNSTSSEAEYYITEVNLQEINQKYGLQLSSASLLFFSLIIGGDYNSGLSGL
                     GKTKALTLMNLQSPNFVKRLMEIFHDIELDVALINSEYEKFQKEVYEYCQDNGRELFG
                     RNYRILLSKENFRGWPEPYIVFHYIYPIIDKNVPSNFLTPDFFTSVEGSSLFRSLDFV
                     ELMSYLERHGLPSFCNFTTWYHKTIHEYFLLKQLKLFPDESVNSDLIKITEIKSDLDR
                     SCMMDIKKYKVRYRTFIKTINEPVALESNELINENTGGLSPKKLSQRQVDVRHYPYYL
                     WVPCDLVEEHNPLIIRYNQLQRQLEEKSPTKRSKSESPRKRKSVYKQNNTLDGFLSKH
                     ASPVKPTQHTIEPPVLLQKDTEVKRRLFVGDDSSNEENQTDPDTEDSLIIVEERDVSP
                     RRTIEYLLSTSPLKRNYTSFSEKD"
     gene            complement(<230496..>232967)
                     /locus_tag="CAGL0C02277g"
                     /db_xref="GeneID:2886732"
     mRNA            complement(<230496..>232967)
                     /locus_tag="CAGL0C02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445275.1"
                     /db_xref="GeneID:2886732"
     CDS             complement(230496..232967)
                     /locus_tag="CAGL0C02277g"
                     /note="weakly similar to uniprot|P18494 Saccharomyces
                     cerevisiae YER040w GLN3 transcription factor for positive
                     nitrogen regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445275.1"
                     /db_xref="GeneID:2886732"
                     /db_xref="GOA:Q6FWW9"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW9"
                     /translation="MEGFQDDLDGMGVLNSFLKDGSGESKSGAEKSSTTKPQAENVVP
                     FVNDNYDSMLEALPDELNLDFTSLLSPFPAPGQGNDDDITVNVNPYIGQSNNDFYKID
                     EVPEEDLQQGSEIINSTTQLQPITINNSKQQNYNQINVDSSNQQNGEIAQFWDFNVDT
                     LNITPSNSSGSATISAPNSYNSEIPLGVTTGFNNNNNNHLFAHGVLGGGSSIGNSNII
                     NNTSLTYSNQQNSFPGSSLHSKPTTATTVTYTNTPPIKENQSIIANSSLKASQFTGKR
                     PISVVGSNNSYSENPYILSAANTSNSVRKNSLPRQLSSTSLNNYRKSVSSSERPPDPD
                     AVHCDNCKTYKTPLWRRSPEGKVLCNACGLFQKLHGTMRPLSLKTDVIRKRNSKKRTK
                     IQMNPQQTQSQQRQHIQYQTQQNSMQKLLSNHSSPTDTFSSGKSRRKLSSTRLNQDMT
                     TIRYSREGGSLTKQGFTTTPTYNSRSPNYSNSAAASNTRKSKSRRSSTSSVNSNSSRS
                     SSRSNVPILPKISGHSSSGNSPMNIQSTTPGGGPQTSNSVGNFLAMGAYSNSLTSSPR
                     NASIYGTNAPSRNLSSSASKYGVSMPGRKLSRNASYSSSFINTNPQQTQDIGNFNDDQ
                     SIQGNGTGVNSQNIRRINSNYDSPQPNFDLFRLDSNKDSPENIPDVLRSDSRLSQKSQ
                     VSHTSLLSQQIQNQQRMRGEKSISQENLQFKQTPTMQGQTERNIPSRTTSSASYSESV
                     FQQRGMQPNNSNSQFFENQHQANSNTDQRQFLEGMSYDLHNGDNTIKTVILGQEQNFA
                     NPEANGNEAKKSALEQDLDWLKFGI"
     gene            <233339..>234424
                     /locus_tag="CAGL0C02299g"
                     /db_xref="GeneID:2886803"
     mRNA            <233339..>234424
                     /locus_tag="CAGL0C02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445276.1"
                     /db_xref="GeneID:2886803"
     CDS             233339..234424
                     /locus_tag="CAGL0C02299g"
                     /inference="similar to AA sequence:UniProtKB:P40026"
                     /note="similar to uniprot|P40026 Saccharomyces cerevisiae
                     YER038c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445276.1"
                     /db_xref="GeneID:2886803"
                     /db_xref="GOA:Q6FWW8"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW8"
                     /translation="METVFDSENDEPLVELSDVDDFEFEDGDDPILKKMKLDVKPESS
                     SDSEGEVVLQETDVHPYMDFLQKLNKIQAGEVGEKRDIKRDKSIVELQHEELVKQLKS
                     AGTFTSVPDRLIDHISSEVLSDKFRDWHFITQECRDIDNTTLSSMLDAFGVGNSADLL
                     NLKIIASEYTKKYDSLSTIYPVGYMLEELVDYYRRTLPRAETPLEYCHAFFLFVLDIK
                     IYDSHECDTSWCEEVLDILTQRFRQEEIFDVYLKVVELNDYYMHYRVTKLIPRMKSYI
                     LAKLFGTVDTVTIVNEFNTLLDDKRYKELLYFLLLVLGTRYVPRGKNETIKYFISCVT
                     DVYDDSQSNPEISIIKNYLLVLQVLDF"
     gene            complement(<234788..>235732)
                     /locus_tag="CAGL0C02321g"
                     /db_xref="GeneID:2886850"
     mRNA            complement(<234788..>235732)
                     /locus_tag="CAGL0C02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445277.1"
                     /db_xref="GeneID:2886850"
     CDS             complement(234788..235732)
                     /locus_tag="CAGL0C02321g"
                     /inference="similar to AA sequence:UniProtKB:P40025"
                     /note="similar to uniprot|P40025 Saccharomyces cerevisiae
                     YER037w PHM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445277.1"
                     /db_xref="GeneID:2886850"
                     /db_xref="GOA:Q6FWW7"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW7"
                     /translation="MTNYKTVYRDAIKRQLELNREHLESLDYEGSQLSPNFQIDNYTY
                     SKTNVITTNDLLGSSTSLKTLNNPVPVEEEEGITVFFDIDNTLYSKYTGVQRMMQESI
                     QRYCVHELDLEPEYAHALMEQYYQEYGLSIRGIMQDFPDTDPLMFNAMVDDSLPLQDA
                     IKGPDLKLRRILLNLKQNKNVTKLWLFTNAYKTHAIRCIRILGIADLFDGITYCYYSA
                     PPDSIICKPDPRSFEMAKLQSGISSFEKAWFIDDSFPNIQTALNVGLNHCIFIDYEAK
                     HINKYEDTSENLNAKSTVMATYSIPNIHELQSVELTTL"
     gene            <236112..>238672
                     /locus_tag="CAGL0C02343g"
                     /db_xref="GeneID:2886858"
     mRNA            join(<236112..236391,236790..>238672)
                     /locus_tag="CAGL0C02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445278.2"
                     /db_xref="GeneID:2886858"
     CDS             join(236112..236391,236790..238672)
                     /locus_tag="CAGL0C02343g"
                     /note="highly similar to uniprot|P40024 Saccharomyces
                     cerevisiae YER036c ARB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445278.2"
                     /db_xref="GeneID:2886858"
                     /db_xref="GOA:Q6FWW6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW6"
                     /translation="MKIYDVIFGKTTPRSIFNRQSCSSPLPPLAHLRHLQLPPPSPRS
                     RIIPLFRIPALLCFSASLLLLLSPLQSNSATMTYFCIGVRYDHMFYILIHYGQLSWKR
                     SPTPTRNTMPPVSASKAKRDAKKAEREAKKKSEGKTIRKLGKKKEAGTEEDAAEAAAR
                     EIEQLKLQTDKDGLSDRVTTGVLDSLETSRDIKMSSVSLLFHGKVLIQDSNLELNYGR
                     RYGLLGENGCGKSTFLKALATREYPIPDHIDVYLLDEPAAPTEYSALEYVVREAQNEL
                     KRVEDLVEKIILEDGPESELLDPLYERMDGMDPSTFESRAAVILIGLGFNSQTILKKT
                     KDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLVSHS
                     QDFLNGVCTNMIDMRMQKLMQYGGNYDSYIKTRTELETNQMKQYNKQQEEIAHIKKFI
                     ASAGTYANLVKQAKSRQKILDKMEADGLIQPVVPDRVFSFRFPPVERLPPPVLAFDDI
                     SFAYDGNPENNLYEHLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELMPQSGRVSRHT
                     HVKLGVYSQHSQDQLDLTKSALEFVRDKYSNISQDFQYWRGQLGRYGLTGDAQKVQMG
                     TLSEGQRSRVVFALLALENPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVSHDF
                     RLLDKIAKDIFVVEDKTATRWDGSILDYKKKLAKNVVL"
     gene            complement(<238940..>239122)
                     /locus_tag="CAGL0C02365g"
                     /db_xref="GeneID:2886865"
     mRNA            complement(<238940..>239122)
                     /locus_tag="CAGL0C02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445279.1"
                     /db_xref="GeneID:2886865"
     CDS             complement(238940..239122)
                     /locus_tag="CAGL0C02365g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445279.1"
                     /db_xref="GeneID:2886865"
                     /db_xref="GOA:Q6FWW5"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW5"
                     /translation="MTTPNARRSRTQKISNESKRCSKSKPKAKAKTQSKAKSRAYAGP
                     TFVAPDVSDLPRPTLI"
     gene            complement(<239595..>240083)
                     /locus_tag="CAGL0C02387g"
                     /db_xref="GeneID:2886900"
     mRNA            complement(<239595..>240083)
                     /locus_tag="CAGL0C02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445280.1"
                     /db_xref="GeneID:2886900"
     CDS             complement(239595..240083)
                     /locus_tag="CAGL0C02387g"
                     /inference="similar to AA sequence:UniProtKB:P40022"
                     /note="similar to uniprot|P40022 Saccharomyces cerevisiae
                     YER034w YEM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445280.1"
                     /db_xref="GeneID:2886900"
                     /db_xref="GOA:Q6FWW4"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW4"
                     /translation="MDQKSENRRRFQDKQRLKRAHQTPSDRKYRKPVEQVREEKVLPS
                     NHERYVDIPIDQGEDITKYTELTKKVRATTEPHTAGPEHQQYTSRQIQSMGTDELNAL
                     LRNNVVHNVENDDNSHVPAEHKRERPGTPQAKETVSVSVNKPSLVPEELAGDEYFLDS
                     IL"
     gene            <240649..>243621
                     /locus_tag="CAGL0C02409g"
                     /db_xref="GeneID:2886735"
     mRNA            <240649..>243621
                     /locus_tag="CAGL0C02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445281.1"
                     /db_xref="GeneID:2886735"
     CDS             240649..243621
                     /locus_tag="CAGL0C02409g"
                     /inference="similar to AA sequence:UniProtKB:P40021"
                     /note="similar to uniprot|P40021 Saccharomyces cerevisiae
                     YER033c ZRG8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445281.1"
                     /db_xref="GeneID:2886735"
                     /db_xref="GOA:Q6FWW3"
                     /translation="MRSFIKSHRKSNSLESDSDIDFKQLKRKNASTSQLSPPRYNTDY
                     YDPVTSSPKTPTHSHTTSDSLPQKHSPGFESLHRLFNNKLFKKASNSSLNSYLANTDS
                     QSRRSSKDQDPLAPSFHVLKTSSNPASQDSELPVIKGVITHTWGNHSKHNDPHVIVLN
                     DPKTSFETLRSSDLEPPPRLTSKTTRSSVSSERSWSTRDHSMSPPLTSINQDIDIPED
                     MATRSKNTLINKKKMENRQARIHSNDDLIAMRKNSSDTLPQTAEFFASDKLPGDSTPI
                     LEIPESPPPVITLEKYNSSLSDAKELSRSKNVRSNRTSVVSMTQSEESRWSNHLMVNS
                     NHNQNKLRDSDDSDYSNAIDEEDDDDADDDDEASQFSFEYSNLSGRTPSVKYYSKPEP
                     KQMVYIDDLYDDEDFDEDMNYYDENEVSEFLQEEMASNKNNINTDTSVLKDLSSPSIN
                     DHSNEKPIYKPTIQMRVNKPKVHRYNDLFALSDEDDPSFNDDDEFDEDEEEGGDDNDE
                     EDEIDEEYDQKVSDECGQSIELQSDDIHSDYGVEYYNDFGGDLNLQNDVQKHHINKEQ
                     QYISDEEFDDAITDFNMAKHIIEEEVVLDKAEALRYQKDAEPVQSKTSEDVVNYVDED
                     SNLRINEKLEKGDVTYQKPTLLTEVKNKQFQKKPVASFADIFNLESDSEEDINNEDGL
                     TGLSDVGLDEDDAVSSPILQSPFESQSLAEGLVSPVICTPGKPNIINKQIIPTIKCEP
                     SSPQEKTIENNKSHTASNFKEYGLNHPLPPPARSQALKFHDLNSELDSELPALMSNLY
                     FIDETEEDAYNELNDVTRDEDEYLDEINTVPEDFNFSDTENDNNAAKRMLRRSNKGSF
                     RSTYSFTDKPQGVTTESSPIKNKLEVNNKTVTFFSSPGWSKSPGSEIGMQRSKSPVKP
                     SSGYRPFGQGSKQFPITPSHEPNYSIEEDRIASTDEILESRTPPTTYMAPSPAFIPNY
                     SLSPIQEASSSVTNSPKR"
     gene            complement(<243792..>246581)
                     /locus_tag="CAGL0C02431g"
                     /db_xref="GeneID:2886745"
     mRNA            complement(<243792..>246581)
                     /locus_tag="CAGL0C02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445282.1"
                     /db_xref="GeneID:2886745"
     CDS             complement(243792..246581)
                     /locus_tag="CAGL0C02431g"
                     /note="weakly similar to uniprot|P40020 Saccharomyces
                     cerevisiae YER032w FIR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445282.1"
                     /db_xref="GeneID:2886745"
                     /db_xref="GOA:Q6FWW2"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW2"
                     /translation="MPARSTDSDVYRARVHREPQVRFSIPDPDDTDRIVFPNTSTGDS
                     DESQVQEQEQDTTRQGQRQRQRQSKQVDNRGHLVDMHSKIMIDVPEDIWKFHRSHRKS
                     KSLDGDSSSDSIVLGHKKSKSLQSIILETVSSYQDYSRDTSTGDISSSTNNSSLSQVS
                     PLHLGPQTMMTPTKNASSNSLYLSSESPLNKYKVPVPAMISLPPFLSPENKHKKSNSV
                     VYNGSGYSAYNYDGDTSSEYTGDHTQTSTDDSIPSAKFDISFDPGAQSAQETDHILGI
                     DEDANVNLKVQNRNLRMKSLHNQIPTMIHEKSSPSRQSSPVAPILKTNDQLPIPNQQS
                     ATVPILKNNEKSPMSNQPSPVVPILKHKHKRELSMPSPQNYQFPTSHSNSEQQTILNK
                     DIAKESKSLQILSTPSKTIDIPDLSKMTTPASASSRGSLHFFDRFDDSKDDENFVPAN
                     INRVDQLDLSFKFPASNTQHAEIAPVLNPIEDSDFLKVDTSPTNPQFEKRRQMLMDQN
                     RNSAMSHQHRRSRSVHNTEDIQDLFEATSTPPKTSKEQSVPTRSPLRPKSPTLTDNLP
                     SYDPNPDVIPDIKVTESPEDDSVNSIQDSITKVTDPHYIEDTQDSYQYVGVHDISTSS
                     TIENSSEYDSTPTEITIEGTENILRQPLTTFASFSAPLNLDGINQTMNENGKLGSLPS
                     NGIMLDQNIMSNTGSVSSRTSIFSKNSGETALTSNPSTYDQEHNNINPTSASIMIKAK
                     KNSHRSPIFEKPQTQKHINNKDDAELKTVFEKINGKIVEVITIDDDVDETSKISVKVP
                     LQSNGHKLDNMIDDYNDQVRMRRNKSNDCTKKHRQSFHEAQKKYETILSLCDETAETA
                     KTVIYELNKKQHSETKGLAIRAYNSANTANNITSNISNMSANELDPRKIKYLSTFNKK
                     LRVNSYTRKEKPTTG"
     gene            <247493..>248149
                     /locus_tag="CAGL0C02453g"
                     /db_xref="GeneID:2886855"
     mRNA            <247493..>248149
                     /locus_tag="CAGL0C02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445283.1"
                     /db_xref="GeneID:2886855"
     CDS             247493..248149
                     /locus_tag="CAGL0C02453g"
                     /note="highly similar to uniprot|P38555 Saccharomyces
                     cerevisiae YER031c YPT31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445283.1"
                     /db_xref="GeneID:2886855"
                     /db_xref="GOA:Q6FWW1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWW1"
                     /translation="MSNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNEFNIDSKS
                     TIGVEFATRTIDVDGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYE
                     NCHHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEEAKQFASENQLLFTETSALNS
                     DNVDLAFKELITAIHQKVSKHQVELSNANKPGAGPNGPTISLTPAPNEKKKSSSNNCC
                     "
     gene            complement(<248397..>248843)
                     /locus_tag="CAGL0C02475g"
                     /db_xref="GeneID:2886809"
     mRNA            complement(<248397..>248843)
                     /locus_tag="CAGL0C02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445284.1"
                     /db_xref="GeneID:2886809"
     CDS             complement(248397..248843)
                     /locus_tag="CAGL0C02475g"
                     /inference="similar to AA sequence:UniProtKB:P40019"
                     /note="similar to uniprot|P40019 Saccharomyces cerevisiae
                     YER030w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445284.1"
                     /db_xref="GeneID:2886809"
                     /db_xref="GOA:Q6FWW0"
                     /db_xref="InterPro:IPR019098"
                     /translation="MSEEKEVKPVVAENAEVPAKVEKKKRRRRNYDDYDAEVTESEKK
                     KSKPSEASGKAGAAAAGDSDSESDIDDAKLDRLESNEDEEEDDLAEIDTSNIITTGRR
                     TRGKIIDYKKTAKELDASEQKTDSAATEAAPGAADDEEDDDADFKE"
     gene            <249146..>249643
                     /locus_tag="CAGL0C02497g"
                     /db_xref="GeneID:2886849"
     mRNA            <249146..>249643
                     /locus_tag="CAGL0C02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445285.1"
                     /db_xref="GeneID:2886849"
     CDS             249146..249643
                     /locus_tag="CAGL0C02497g"
                     /note="highly similar to uniprot|P40018 Saccharomyces
                     cerevisiae YER029c SMB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445285.1"
                     /db_xref="GeneID:2886849"
                     /db_xref="GOA:Q6FWV9"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV9"
                     /translation="MVGVQVKHNSRLADLINYKLRVITQDGRVYIGILLAFDKHMNVV
                     LSDCVEERVLKKQIDDIKNKGSVDRDNLKVEKRVLGLVILRGEQILSTVVEDKPLLSK
                     AERLVVDSKQQKQLAKERNKRKKNTTTNGGKVAKSNSKDVKPNERTIQQPVRKFQPPP
                     GFKRK"
     gene            <253051..>254007
                     /locus_tag="CAGL0C02519g"
                     /db_xref="GeneID:2886957"
     mRNA            <253051..>254007
                     /locus_tag="CAGL0C02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445286.1"
                     /db_xref="GeneID:2886957"
     CDS             253051..254007
                     /locus_tag="CAGL0C02519g"
                     /note="some similarities with uniprot|P39943 Saccharomyces
                     cerevisiae YER028c or uniprot|P53035 Saccharomyces
                     cerevisiae YGL209w MIG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445286.1"
                     /db_xref="GeneID:2886957"
                     /db_xref="GOA:Q6FWV8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV8"
                     /translation="MFGKIKNQDSYPPDNFKRPFRCEICSRGFHRLEHKKRHFRTHTG
                     EKPHKCKFPSCPKSFSRADELKRHSRTHMSVNNKAKGKKKNKKNNANDTSKKEGSEPQ
                     FRVIEGKVMNPVTTPAIPTTIQTRSQISDRGIPVVPTESTGSFGSGTSIRDPARMYIL
                     PPLSGLSSEVSSRSHSAVSLTTLAMSTNPSTYGSLDRSTSGSNLLGYGMGATTPSLIN
                     SSTSPVSPYFDKRHSRSLMSALHRLTPFQEDGSVSMGSTTPVFSMCDSKPLSASSSVV
                     SMASLKDRNDYLEHPQGISHKTEDRVTLPPVRDILKDVMAYK"
     gene            <255821..>257752
                     /locus_tag="CAGL0C02541g"
                     /db_xref="GeneID:2886866"
     mRNA            <255821..>257752
                     /locus_tag="CAGL0C02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445287.1"
                     /db_xref="GeneID:2886866"
     CDS             255821..257752
                     /locus_tag="CAGL0C02541g"
                     /inference="similar to AA sequence:UniProtKB:P35817"
                     /note="similar to uniprot|P35817 Saccharomyces cerevisiae
                     YLR399c BDF1 sporulation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445287.1"
                     /db_xref="GeneID:2886866"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027353"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV7"
                     /translation="MVEDAVDTHEDKKLKVEESATPTSQTEEHAHTDKVIEEEKSESK
                     VSEDKEGKEEGKEESKEAEAAEDKSEDKSEDAAETKNVVDTSNMTPAPAPPQEPDMDN
                     LPANPIPQHQQKHALMAIKAVKRLKDARPFLQPVDPVALNIPLYFNFIKRPMDLQTIE
                     RKLNANAYETPEQITEDFNLMVENSAKFNGPTAVITQMGRNIQAAFEKHMLNMPAKDL
                     PQRDPLPGTKATTGRGKKKTTDSDTPVVIRRAQTHNGRPKREIHPPKSKDIYPYEMNS
                     KPKSKSLQRAMKFCQGVVRELMSKKYASFNYPFLEPVDPVALNCPTYFDYVKEPMDLG
                     TVSKKLSNWEYENLDQAEHDIRLIFQNCYAFNPDGTIVNMMGHRLEDIFNTKWADRPL
                     YSDVESEEAESAYDDEESDESDVEIDETSITNPAIQYLEDQLERMKVELQQLKKQELE
                     KIRKERRLARGPKKTRGRRGRKKGSTKAKTGRGKKKLKSVVTYDMKKIITENINDLPT
                     AKLEKVIEIIKKSMPNIGDDEEVELDLDTLDNNTILTLYNTFFRQFEAPANDSGNDNQ
                     SVSPTNGLGRRKRSKNLSREEQSKQIEKIRNKLALLDGASPLSQNGSPVTPASFASNI
                     QNGYSSSSSDDDSSESEEE"
     gene            <259114..>262965
                     /locus_tag="CAGL0C02563g"
                     /db_xref="GeneID:2886924"
     mRNA            <259114..>262965
                     /locus_tag="CAGL0C02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445288.1"
                     /db_xref="GeneID:2886924"
     CDS             259114..262965
                     /locus_tag="CAGL0C02563g"
                     /inference="similar to AA sequence:UniProtKB:P35207"
                     /note="similar to uniprot|P35207 Saccharomyces cerevisiae
                     YLR398c SKI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445288.1"
                     /db_xref="GeneID:2886924"
                     /db_xref="GOA:Q6FWV6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV6"
                     /translation="MAFTDIEEAYTSLKEVIVSNDFDEEFLNLKAPEPKDIEKSVEEE
                     NQDIYNRFIKPTNALSWELLDLVQELPPMNFMGNKSLDVSNIAEDSYDYKKFISLPQP
                     QCKTSYFFKRRGIEGKITDYKEQVSLKDIANANASNSLSLNRSINFHGNTVRGSTAQL
                     PFTPGGVVMDAFKPDGKNNSSSTSTALKLLHKDEQGLFDIPEGFKRGIIPNVSESSYQ
                     EYDIQDMETLNEVDNESKIEEDYNKEILRTEEAVEKNTLDLINATSKKADPSLNDIDD
                     LLPMGIDFGRTIMKSNKDTKMKEWAHVVDLNHKIENFSELIPNPARTWPFELDTFQKE
                     AIYHLEQSDSVFVAAHTSAGKTVVAEYAIAMSKRNMTKTIYTSPIKALSNQKFRDFKE
                     TFEDVDIGLITGDVQINPEANCLIMTTEILRSMLYRGADLIRDVEFVIFDEVHYVNDQ
                     DRGVVWEEVIIMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEI
                     NIWAKNELKPVINEKREFSDANFKKHKSLIDGKSAKELTSKNSTATNSRGGAATRGRG
                     GSSRGNSARGGRGGRGGSRGAGAIGSNKSQFFRKGGPNKKTWPNLVDYLRKKELLPMV
                     VFVFSKKRCEEYADWLDGINFCDAKERSQIHMFIEKSITRLKKEDRDLPQIQKIRSLL
                     ERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVVFSEIQKHDG
                     NGLRDLTPGEFTQMAGRAGRRGLDTIGTVIVMAYTDPLPVTSFKEVTLGVPTKLESQF
                     RLTYNMILNLLRIEALKVEEMIKYSFSENSKQTLQPEHERKINELKEKMDKIKLNEDC
                     AYCSKDSEQLLDLIVRYQDVTSTMMTELAKTDVILKTLKVGRLVVYRDNEGFHKLGFI
                     FRLNIRETMAIVLCVSKPNGLPNGKPNYLPYLASNPRYIQKNFQSFKSCSYVAENVPL
                     EEIELVTAFTLRTSLNDLTKGDKAAQEQFNKEVSTLLKISKNLKESEAEKKANIKVHQ
                     NAIERKNISTELIKLSSIKCPNLAEHFLPIYEKYNLGKEIKNLYHLMSDQNLNLLPDY
                     EKRLTVLYKTGFIDKNHNVLLKGRVACEINSGYELVLTELILDNFLGNFEPEEIVALL
                     SVFVYEGRTREEEMPVITPRLTKGKDRIEEIYKNMLSVFEEEQIPLTKDEAEFLERKR
                     FALVNVVYEWARGMSFKEIMEISPEAEGTVVRVITWLDEICREVKTASVIIGNTNLHL
                     KMTRAQELIKRDIVFAASLYL"
     gene            <263270..>265585
                     /locus_tag="CAGL0C02585g"
                     /db_xref="GeneID:2886919"
     mRNA            <263270..>265585
                     /locus_tag="CAGL0C02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445289.1"
                     /db_xref="GeneID:2886919"
     CDS             263270..265585
                     /locus_tag="CAGL0C02585g"
                     /note="highly similar to uniprot|P32794 Saccharomyces
                     cerevisiae YLR397c AFG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445289.1"
                     /db_xref="GeneID:2886919"
                     /db_xref="GOA:Q6FWV5"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV5"
                     /translation="MAPKSASSGSKKKSSATSDEIKQPKFKLPTEYIIRPLPANSNSK
                     ESGTITVNSKVLSALEISSGSFCIISKFGENGIAAIANPSKNENHPANVILVSDTLRS
                     VSNIILGDRVEIQKLTQQPAYAKSITVGPFEEGLANEKVKLVEKLLDDCGLIMPGMRF
                     NEIATDNNEKLHFVVTDVDDDDLPDIGKLSLNADESETLEFMSKPVLFKKGLTKLKFT
                     ADKNVSKKYSLPQSLSYDAVGGLKCEIDLLKKAIDLPLHRPEIFADFGISPPKGILMH
                     GPPGTGKTMLLRCVANASNAHVLSIDGPSIVSKYLGETESKLREIFNEAKKYQPAIIF
                     IDEIDSIAPNRANDDSGEVESRVVATLLTLMDGTSSSGRIAVIAATNRPNAVDPALRR
                     PGRFDQEIEIGIPDVDARFDILKKQFEKISTDKHTLSEGDIKSIASKTHGYVGADLTA
                     LCRESVMKTIQKALTENSTTDMTELKVGITDVESAMLEIRPSAMREIFLEMPKVYWSD
                     IGGQEDLKRKMKEMIQLPLEAADTFAALGIKAPKGILLYGPPGCSKTLTAKALATESG
                     VNFLAVKGPEIFNKYVGESERAIREIFRKARAASPSIIFFDEIDALSPDRDGSSTSAA
                     NHVLTSLLNEIDGVEELNGVVIVAATNRPDEIDSALLRPGRLDRHVYVSPPDFNARLQ
                     ILKKCTKNFDLDNTDELLNDLATRTEGCSGAEVVLLCQEAGLAAIMDDIHTKKVDANH
                     FEVALQGISKCITPEMLEYYQEFASRSGIAS"
     gene            <265852..>267885
                     /locus_tag="CAGL0C02607g"
                     /db_xref="GeneID:2886733"
     mRNA            <265852..>267885
                     /locus_tag="CAGL0C02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445290.1"
                     /db_xref="GeneID:2886733"
     CDS             265852..267885
                     /locus_tag="CAGL0C02607g"
                     /inference="similar to AA sequence:UniProtKB:P20795"
                     /note="similar to uniprot|P20795 Saccharomyces cerevisiae
                     YLR396c VPS33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445290.1"
                     /db_xref="GeneID:2886733"
                     /db_xref="GOA:Q6FWV4"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027121"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV4"
                     /translation="MSTNWNTWKLKRISASNICQAFKEVTDNDTVLLIQSELFNYINH
                     VITFSDLIKDTPVRKILRVDNNTTNDLRSILGSMPHIEIILLIDIRASLKIPFEIRNF
                     LKEFKDLPVTIVYCSWQTEITDALIEKKDTVFLESYQLNNVRHLINHQLAITDRKIKL
                     KKCTLYPFPTLDDDVLSLDILYSADNENRYVPYLQSIENASRDVMIDNISNCILSLLK
                     EHKSIVTNFVGVGNEAQLLGQLLKSRIDRDIDEKQAFIREGLFGDKFPSGLETDLIVF
                     DRSMDPITPLLTELTYAGMVNTLFDGYLDIEIDEEKVHFDYQKDDFWDEMKFMNFGSI
                     GPRLNQSAKQLQKKYDDRHNAESLGEIKNFVDSLGHLQETQRYLKQHTITSTKILNEV
                     ENNEALQFNRIIEFEQDVLSDNLDHKACNDFIQDLIFEGDVASDLIIRLISLVSICKC
                     GLREKDFLSIKKSMVDRFGINILFDIERLTEAGILVTKNTITKNKKAGTTEDLRAPYG
                     RNVSNTIIKEYRSIAKWFATLPVGSNDDAQDISNPKEPDFAFCGVVPLSMRIIQAFYD
                     RSILSKTYNAQQPYIISKEPKVTKLETLFSQVYCNSKHISSERWVPEPKVNKLPNTTG
                     KKDNDDHPDIAIIVFLGGVTIGELATLKHLKGKLRDKGIKKRFLIITDGILKK"
     gene            <268568..>268789
                     /locus_tag="CAGL0C02623g"
                     /db_xref="GeneID:9487972"
     mRNA            <268568..>268789
                     /locus_tag="CAGL0C02623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999478.1"
                     /db_xref="GeneID:9487972"
     CDS             268568..268789
                     /locus_tag="CAGL0C02623g"
                     /inference="similar to AA sequence:UniProtKB:P04039"
                     /note="similar to uniprot|P04039 Saccharomyces cerevisiae
                     YLR395c COX8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999524.1"
                     /db_xref="GeneID:9487972"
                     /db_xref="GOA:B4UMY3"
                     /db_xref="InterPro:IPR004202"
                     /db_xref="UniProtKB/TrEMBL:B4UMY3"
                     /translation="MFSQQVMRLSTRRAFSASSIARVHFKEGVYSNLPFKIHNRKIPF
                     ALVHFGFFGVGFAVPFIACYVQMKKAGNI"
     gene            complement(<268999..>270051)
                     /locus_tag="CAGL0C02629g"
                     /db_xref="GeneID:2886920"
     mRNA            complement(<268999..>270051)
                     /locus_tag="CAGL0C02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445291.1"
                     /db_xref="GeneID:2886920"
     CDS             complement(268999..270051)
                     /locus_tag="CAGL0C02629g"
                     /inference="similar to AA sequence:UniProtKB:Q06032"
                     /note="similar to uniprot|Q06032 Saccharomyces cerevisiae
                     YLR394w CST9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445291.1"
                     /db_xref="GeneID:2886920"
                     /db_xref="GOA:Q6FWV3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q6FWV3"
                     /translation="MPENQFSQPFVHYGVCHRRHSVEDPLWLTSCAHLLCQAHLTPTK
                     VCGVCGTRDISCLRLTNDKPLPNEVDAYFQPISGLVENMYNVCQFQYVGLLDQCNYYQ
                     KISITLKEKCNRQQQLLYKAKQELDNIPRLKRRIDELESLLKEGNYGIKKSKDNWTHT
                     KRSLPQTVDLTIENTDQEEDQNFIQKLKNNTGLRKITPKVAPNNISAESSSHKMSITP
                     GIFAMAESTQLISNQTTTSSVNNNQLKFKTNIHRSPSSNIMTKDSQPSNQIMPQVLNK
                     LTMLKRNNTVSTSNLEKSNTQMATHRSYLGTYNHPNSTMLLNRRRANSQQQPKSSKQS
                     NFEMLRRVPSSNKNGR"
     gene            complement(<270564..>271385)
                     /locus_tag="CAGL0C02651g"
                     /db_xref="GeneID:2886914"
     mRNA            complement(<270564..>271385)
                     /locus_tag="CAGL0C02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445292.1"
                     /db_xref="GeneID:2886914"
     CDS             complement(270564..271385)
                     /locus_tag="CAGL0C02651g"
                     /inference="similar to AA sequence:UniProtKB:P18496"
                     /note="similar to uniprot|P18496 Saccharomyces cerevisiae
                     YLR393w ATP10 F1F0 ATPase complex assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445292.1"
                     /db_xref="GeneID:2886914"
                     /db_xref="GOA:Q6FWV2"
                     /db_xref="InterPro:IPR007849"
                     /translation="MRVVFQQCTKFSTSCNRAFLARFLKPVMNASPKEHVVKQLLKPV
                     GLNVPPRPNIKYSEGNSWLDLFDGAKTEERIKELEIEFAKSGMYEMATFRKTNGKLFL
                     SPESYWKADKALYFPHLSGRTLSSEDHGNVEDVLRGKTSVIRVFSTQVGDKISREYIK
                     NTELGIDNYENQSCQVIDINFLENKLKSWLFKLSLNNLKSTVPVQRHDNYWLCHREQI
                     PFLMRERLLINNVYSGYIFVVDPNLKIRFMACGPASADEFNKLWKVVGQLSKEKK"
     gene            <272010..>273524
                     /locus_tag="CAGL0C02673g"
                     /db_xref="GeneID:2886915"
     mRNA            <272010..>273524
                     /locus_tag="CAGL0C02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445293.1"
                     /db_xref="GeneID:2886915"
     CDS             272010..273524
                     /locus_tag="CAGL0C02673g"
                     /inference="similar to AA sequence:UniProtKB:P18634"
                     /note="similar to uniprot|P18634 Saccharomyces cerevisiae
                     YLR392c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445293.1"
                     /db_xref="GeneID:2886915"
                     /db_xref="GOA:Q6FWV1"
                     /db_xref="InterPro:IPR011021"
                     /translation="MAPKLDIILHPPENGEFYSSDDLISGTIVLDLTKSLSIKQIKVG
                     LKGFTETTTKMDSEYVFPQNGMLGPATENKSYHNLVREERRVFPPDNVWDALEGSSKP
                     FKVKPGHYEYMFQFNKLPSKPMCLKNHTKKTICFVSKSQSTMPPSFNTQWRELNKIDN
                     LDLYFYSFGKIIYVVEVEIEMGRPRTWFKPFDKMLREPKIIEFIPEPKKFASNETVTR
                     SGRNNHGVIDYISKNNSSKSLSAMQESEDGVTAIAPNGPDEKFLARNLDQLDINNDLE
                     YEIEETEENPMKRYKCRYPLGLPDGASMMWVEVRSRDIDTIYRQDFLFRQGSGNFDNV
                     YLIVKGNLSFSDFSNISVKPTRLQLNLLETVSYLSQGIGNENFSSLKLMEIDNLSKSD
                     RPLFDTNELKFISSKNHEIMECEIKLKDNPILKRLQFNEEDYKHRGNRLYSFKTCVIT
                     RLFSYQLLIDWNINGQTRQTETIIPVQVFAHKRPPPVNEALPRYVEPPSYDDHV"
     gene            complement(<273699..>275081)
                     /locus_tag="CAGL0C02695g"
                     /db_xref="GeneID:2886928"
     mRNA            complement(<273699..>275081)
                     /locus_tag="CAGL0C02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445294.1"
                     /db_xref="GeneID:2886928"
     CDS             complement(273699..275081)
                     /locus_tag="CAGL0C02695g"
                     /inference="similar to AA sequence:UniProtKB:P18409"
                     /note="similar to uniprot|P18409 Saccharomyces cerevisiae
                     YAL010c MDM10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445294.1"
                     /db_xref="GeneID:2886928"
                     /db_xref="GOA:Q6FWV0"
                     /db_xref="InterPro:IPR022197"
                     /db_xref="InterPro:IPR027539"
                     /translation="MLDYMDYVQQCFDSAGRWKRQNSYGEVTQTPRNLIDFKIPDAVN
                     LQVSNRSTKYSYNSLQLSTRQSINGSLTYLYTNLDAVEGLVKNTEELPLHDIVQTYEL
                     PAVTHHRKEKTNFHKCSLFYGKIFYPSSDVEAMMIKRFSPMNQVIVKCLSSLKENVNI
                     FTAYFQRNSEKNFQELIVSSNDLLCGYRISHHFLRTPSKLNSSLYNNSSLFFGAEFWL
                     GMISLNPGCSTSLKYCTHSANTGRPLTLTLSWNPLFGHISTTYSAMTSSSSTFCAKYD
                     FNIYSIESNLSFGIELWRKTGALFKSEDSVEANRKEYEQNFYISHDHNLLPSKYGYDH
                     EYNISDGKLSKEHKRNKIIKDLNHAFSTSLQKIDKEKTRIENFGNIIRNSHFTSVFKA
                     STSLRERNLKFLWEGEYKNFLLSAGTELRVLKAEESELRRTSGQSSNSLLNEFSLQPL
                     KFGVQIQFSS"
     gene            <275325..>276191
                     /locus_tag="CAGL0C02717g"
                     /db_xref="GeneID:2886758"
     mRNA            <275325..>276191
                     /locus_tag="CAGL0C02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445295.1"
                     /db_xref="GeneID:2886758"
     CDS             275325..276191
                     /locus_tag="CAGL0C02717g"
                     /inference="similar to AA sequence:UniProtKB:P18410"
                     /note="similar to uniprot|P18410 Saccharomyces cerevisiae
                     YAL009w SPO7 meiotic protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445295.1"
                     /db_xref="GeneID:2886758"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU9"
                     /translation="MSVEIPVVKLDEDATVFEETPTKTGRDELPRTPWLEPKQDEAHS
                     RRGSSSNDAGTGGLRKRSGSRTSSGRRSRNSSSISPASMVFRNLLILEDDLRSQSRRL
                     RVLRLQFTAFLSTLAGIAAFSFYLLYFSDEPAQGVYRFILQFSLLFIMITVVLFHLSG
                     QYKRTIIIPRRFFMSTNKGIRPFNLKLVKVHSTIDEKFTDLVRFITRKIAYLNQWFLQ
                     KILMLGETNAVVQFWVGVAIRSQPRIGAVDVKLILNPRAFNAEIREGWEIYRDEFWAR
                     EGARRRKSNNST"
     gene            <276663..>277250
                     /locus_tag="CAGL0C02739g"
                     /db_xref="GeneID:2886823"
     mRNA            <276663..>277250
                     /locus_tag="CAGL0C02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445296.1"
                     /db_xref="GeneID:2886823"
     CDS             276663..277250
                     /locus_tag="CAGL0C02739g"
                     /note="weakly similar to uniprot|P18411 Saccharomyces
                     cerevisiae YAL008w FUN14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445296.1"
                     /db_xref="GeneID:2886823"
                     /db_xref="GOA:Q6FWU8"
                     /db_xref="InterPro:IPR007014"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU8"
                     /translation="MLLLGRFTGVGARRLFSMNAMRPLRSAMPMAWRRSGNVGLKTAF
                     MGLAFAAPFSVSMLTPSRTIYNDTAVDIGANVLKQTGLSQAEVEVVKGERKVRLDYRG
                     LCLGSILGVGAGVIIGKISGVLAYFTVFAFLVLQWMKNRGLIDKNSSQLRGLYRVAKV
                     GFVDEEGNARFVNSENLCFKLSFLLTFLLAAVNTQ"
     gene            complement(<277506..>278147)
                     /locus_tag="CAGL0C02761g"
                     /db_xref="GeneID:2886836"
     mRNA            complement(<277506..>278147)
                     /locus_tag="CAGL0C02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445297.1"
                     /db_xref="GeneID:2886836"
     CDS             complement(277506..278147)
                     /locus_tag="CAGL0C02761g"
                     /inference="similar to AA sequence:UniProtKB:Q12450"
                     /note="similar to uniprot|Q12450 Saccharomyces cerevisiae
                     YOR016c ERP4 or uniprot|P39704 Saccharomyces cerevisiae
                     YAL007c ERP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445297.1"
                     /db_xref="GeneID:2886836"
                     /db_xref="GOA:Q6FWU7"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU7"
                     /translation="MHSFNLAAFCSLIALFLSLPVHAISGVHAPVAISLPAFSKECLY
                     YDMEDLSDTLLVGYQVLTGGNFEIDLQIVGPDGDVLAEEKAKKYGDFLLKSFGVGQYS
                     FCFSNSYGTALKKVEITMEKEDNSILDDPNASEEDAIANHAIEEIDRNLNKMTKIMNY
                     LRAREWRNMSTVESTESRLTWLSLLIMGVMVAISVLQALLIQFLFSSRQKNFV"
     gene            complement(<278430..>279548)
                     /locus_tag="CAGL0C02783g"
                     /db_xref="GeneID:2886804"
     mRNA            complement(<278430..>279548)
                     /locus_tag="CAGL0C02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445298.1"
                     /db_xref="GeneID:2886804"
     CDS             complement(278430..279548)
                     /locus_tag="CAGL0C02783g"
                     /inference="similar to AA sequence:UniProtKB:P23179"
                     /note="similar to uniprot|P23179 Saccharomyces cerevisiae
                     YHL022c SPO11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445298.1"
                     /db_xref="GeneID:2886804"
                     /db_xref="GOA:Q6FWU6"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013049"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU6"
                     /translation="MNFTLADIYDSADISELRARLTADKRAVFFSPVVDDNADKSQQI
                     HNKIQDILTLCKNSVGQQQQGFQLHGLFKKPIEFPLSGRLKGKLLQNKIQKLSITFTL
                     LKEIQRNIEKCTAFTSRDIFYRNVELFKSQRLVVDTVDHIQKALGLTIREDLNITATQ
                     KGLIFTAVDIIINSSDTKKIKITKGKSQLIPQFDSNAFIMVCKDDPQMILKVLVIEKD
                     AVYNTIIQKPTEGYIVVTGKGYPDMLTRKFLHRLEQCNSNLQFVILTDPDPHGINIAM
                     KYQGFTTDSIYPCASLIRKGISILELIDGHSSTIAQVLPLSTRDIKLAQNILFSGHSD
                     LYANMRTELQRQLFLTKKGEMNTTIIEHLLSNDRITNY"
     gene            <280107..>281150
                     /locus_tag="CAGL0C02805g"
                     /db_xref="GeneID:2886857"
     mRNA            <280107..>281150
                     /locus_tag="CAGL0C02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445299.1"
                     /db_xref="GeneID:2886857"
     CDS             280107..281150
                     /locus_tag="CAGL0C02805g"
                     /note="highly similar to uniprot|Q08726 Saccharomyces
                     cerevisiae YOR262w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445299.1"
                     /db_xref="GeneID:2886857"
                     /db_xref="GOA:Q6FWU5"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU5"
                     /translation="MPFGQIVIGPPGSGKSTYCNGCSQFFNAIGRHAQIVNMDPANDK
                     LPYPCAVDIRDFITLEEIMSEQQLGPNGGLMYAIESLDKSIDMFILQIKSLVEQEKAY
                     VVFDCPGQVELFTHHSALFHVFKRLERDLKIRLCVVNLIDCHYLTSPTQYISILLLAL
                     RSMLMMDLPQINVFSKIDMIKSYGELPFRLDYYTEVQDLDYLMPHIEKENNTLMAKRY
                     SKLTETISELVSDFNLVSFEVLAVDDKESMINLQSIVDKANGYIFGSSEVGGDTVWAE
                     ATREGALIANYDIQDRWIDNKEMYDKMEQERRAEILRDREMQEKEVDVDNEDEWEAAL
                     REWEEKQNTDYVR"
     gene            <282197..>283513
                     /locus_tag="CAGL0C02827g"
                     /db_xref="GeneID:2886934"
     mRNA            <282197..>283513
                     /locus_tag="CAGL0C02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445300.1"
                     /db_xref="GeneID:2886934"
     CDS             282197..283513
                     /locus_tag="CAGL0C02827g"
                     /inference="similar to AA sequence:UniProtKB:Q08729"
                     /note="similar to uniprot|Q08729 Saccharomyces cerevisiae
                     YOR264w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445300.1"
                     /db_xref="GeneID:2886934"
                     /db_xref="GOA:Q6FWU4"
                     /translation="MPRKFLGEKIDRNTDFLRPSSLTLTADDLKVIPDFKCDDDDAVL
                     SGNKTGKRLSRKFGGTMRLKQRLESVPELFLHDFRKRRGQKLQERNNDEQISRAKLPP
                     HLSGLRRPNGLPARKPLRTITEVLPPVTSYNNSIEQNEDDLYYVEKKDPKEHVVETNH
                     KEMRPLDKPLIEKVENVYLEPLIFPVQVSEPVNQMSIPMEELQKYGKSDSEILFDEII
                     SAYEPHMETTGDVSNVLNSEILSVLDRVSNAPKKNWNLMAPKVISAEAIEENKRLSIN
                     SIASSGRTPESTRNSRFCENLSSPEYSTAASVSDRWSSGDEFSDVASSNPNSHAISHD
                     GSYTTALGSIPSLAGSVDNLDILDQKDILSPTVSNEIITVKPVPQNTVETMHVTKIVI
                     KPQLFLDWESEEEDDPIDALSRQVDNIEIASVYSGSSSVYSDHFAT"
     gene            <283844..>284164
                     /locus_tag="CAGL0C02849g"
                     /db_xref="GeneID:2886896"
     mRNA            <283844..>284164
                     /locus_tag="CAGL0C02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445301.1"
                     /db_xref="GeneID:2886896"
     CDS             283844..284164
                     /locus_tag="CAGL0C02849g"
                     /inference="similar to AA sequence:UniProtKB:P48606"
                     /note="similar to uniprot|P48606 Saccharomyces cerevisiae
                     YOR265w RBL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445301.1"
                     /db_xref="GeneID:2886896"
                     /db_xref="GOA:Q6FWU3"
                     /db_xref="InterPro:IPR004226"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU3"
                     /translation="MSPTQLEIKVKALQRLVKEEKYYLQELKDQKKHVDELKADSSVD
                     KYDLKKQEEVLADTERLLPTLYVKIKEFQDNLEEYLNTYNGNEDTKEAKEAIETSKKL
                     LSKH"
     gene            <284433..>285572
                     /locus_tag="CAGL0C02871g"
                     /db_xref="GeneID:2886864"
     mRNA            <284433..>285572
                     /locus_tag="CAGL0C02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445302.1"
                     /db_xref="GeneID:2886864"
     CDS             284433..285572
                     /locus_tag="CAGL0C02871g"
                     /inference="similar to AA sequence:UniProtKB:P38969"
                     /note="similar to uniprot|P38969 Saccharomyces cerevisiae
                     YOR266w PNT1 pentamidine resistance factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445302.1"
                     /db_xref="GeneID:2886864"
                     /db_xref="GOA:Q6FWU2"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU2"
                     /translation="MQIAARNNLLWIATRHSSNTVQANRLFELYKNGKLQVVTSHTKI
                     QDDFNSTRSLPMVEFPKNRIFTEVENDTKVGNWRKPITKYYRLGISLLKFYRDGIQNT
                     YAVYRDSRRFLKGFGSQNYKDAIPSMLRIIESQELQLKRNVLTNNTNDLAFKRADLVE
                     MMRRNEIYKLPNFFIICLVFEELTAVLCYFFPQVAPRNCMTPGGYFKISNKKIEQFKK
                     LTREVITDSEQYLPPYALSNSQIYGIIKNSEMPISRGKLYLRNMFNIKDKLIQDLTIW
                     YQYIYIDDWYLVTTLLKGKELRLDRSELVNCIYERKLYQKGENLNEMMLSKEGTDTLV
                     RRLIDYWSYRFGNTIIIDGKLTFNEKWGITNLKSMLPENTLTIGR"
     gene            complement(<286017..>287966)
                     /locus_tag="CAGL0C02893g"
                     /db_xref="GeneID:2886891"
     mRNA            complement(<286017..>287966)
                     /locus_tag="CAGL0C02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445303.1"
                     /db_xref="GeneID:2886891"
     CDS             complement(286017..287966)
                     /locus_tag="CAGL0C02893g"
                     /inference="similar to AA sequence:UniProtKB:Q08732"
                     /note="similar to uniprot|Q08732 Saccharomyces cerevisiae
                     YOR267c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445303.1"
                     /db_xref="GeneID:2886891"
                     /db_xref="GOA:Q6FWU1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FWU1"
                     /translation="MPLLSRKPFHHEHHSSHSPPPSIKSSKSFLGFMSRKPSSDSLKS
                     ERSQDSLKSLNTSNNHNNASYTHLNDSMTASPKQSHSMAELKRFFRSSTKKNLSMAQL
                     RSKNASPTSSASSSTVNLASHFNLAMTSKSHTNLHDTHKGEHAGEHHHHQHKGYSSTA
                     SLSAMMHGKHHHPHGSTDHHVHTQSAIPPTSDSILSLSNNINIYHDDSILAQKYGKLG
                     KLLGSGAGGSVKILTRPTDGATFAVKEFRPRKPNESVKEYAKKCTAEFCIGSSLHHPN
                     VIETVDVFSDSKQNKYYEVMQYCPIDFFAVVMTGKMSRGEINCCLKQLTEGVRYLHSM
                     GLAHRDLKLDNCVMTADGIIKLIDFGSAVVFRYPFEDDVTMAHGIVGSDPYLAPEVIT
                     STKSYDPQCVDIWSIGIIYCCMMLKRFPWKAPRESDENFRLYCMPDEVPHDYVESARH
                     HDQLLKERRERKHKHLEPEQNPHIIDNASETKVPSHLNIVQGIADNKSSEGNGTQVQD
                     NSQKNNLPTPKVSGEDGENEQKAKENLQDQDGVVNKPHTIEHTESHDLKSIPSHKPAH
                     HRKTIRGPYRLLRLLPHASRPLLSKMLQVDPKQRATFEDIYADEWFHNIPFCTMDEKK
                     NVVRAPGHHHTIVKEVDSHMETYKI"
     gene            <290289..>291692
                     /locus_tag="CAGL0C02937g"
                     /db_xref="GeneID:2886739"
     mRNA            <290289..>291692
                     /locus_tag="CAGL0C02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445305.1"
                     /db_xref="GeneID:2886739"
     CDS             290289..291692
                     /locus_tag="CAGL0C02937g"
                     /inference="similar to AA sequence:UniProtKB:P39946"
                     /note="similar to uniprot|P39946 Saccharomyces cerevisiae
                     YOR269w PAC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445305.1"
                     /db_xref="GeneID:2886739"
                     /db_xref="GOA:Q6FWT9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017252"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MSSLTDSQVNDLHCSIYRYVQWVSQNNGSSDLLNKLQSVLDIDE
                     LQLSLDDGDQMLLPKKWGSIIRLQRAITKLEQKCDALQQELDDKTKQLETIVPKDTQI
                     ATTTDVNWLPPDHIYASIQNESPVTAIKLHPSLAIVYVGTDTGRLIAYDILNYTIPLA
                     VTTAHSKAITSIEVIEAHNFEEFIDSTTLVSTTSKDAQINVYDHSSNTGELKLIRSFN
                     AHDSTVSSQKTWQKDNDVLLASSSRDATVKVWRVNDSRCLQSFSPHSEWVKSIDVLDE
                     YILSGSLDSTLRLTHWPSGNGLSVGTGHEFPIERVLIIPFSDSKICTSPYRDQNEHSA
                     FAPLRFKYCASAARDNTIKIWEVPLPQLKPNSAPVPSTTNTTFKCVMTLRGHTSWVKD
                     LKLRGDHLFSCSDDETIKCWDLNTGNCVKTWSSIHNNFINCIDIDREATIEQFSPSLQ
                     REILVSGDMDNKVKIIR"
     gene            complement(<291780..>294449)
                     /locus_tag="CAGL0C02959g"
                     /db_xref="GeneID:2886830"
     mRNA            complement(<291780..>294449)
                     /locus_tag="CAGL0C02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445306.1"
                     /db_xref="GeneID:2886830"
     CDS             complement(291780..294449)
                     /locus_tag="CAGL0C02959g"
                     /inference="similar to AA sequence:UniProtKB:P32563"
                     /note="similar to uniprot|P32563 Saccharomyces cerevisiae
                     YOR270c VPH1 or uniprot|P37296 Saccharomyces cerevisiae
                     YMR054w STV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445306.1"
                     /db_xref="GeneID:2886830"
                     /db_xref="GOA:Q6FWT8"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT8"
                     /translation="MVRSEEEAIFRSAEMSLVQFYIPQEIARDTAYTLGQLGLVQFRD
                     LNAKKQAFQRAYVDDIRRLDNVERVYRYLYSLLQKHRIQLFENGELRDGSVGGDAVAE
                     PPSGSAIDDHVQNATFLEERLMEMEDGCDQIKRQRTDLEQYRFLLRTADEFFSQDMDA
                     PQSQANDTPQPTDEEMGNAETTRYGGANSSVNYVSGVIPSEKTHILEQILWRTLRGNL
                     LFKHVAIEKPLYDEKTGKYVKKDAFIVFSHGDLIIKRIRKIAESLDAKLYFVDSRSDL
                     RSEKLLEINRNLQDLNTVLQTAMVTLESELYAISKELNLWFHEVSKEKAVFETLNKFN
                     NDENRKTLIAEGWIPMDQIDILRAKLEEMVNRLGIDFPSTLQVLETTSTPPTYHRTNK
                     FTEAFQAICDCYGIAQYREVNPGLPTVVTFPFMFAIMFGDLGHGCIMFLAALTLVLNE
                     KALGKMKRDEIFDMAYSGRYILLLMGLFSMYTGFLYNDIFSKSMTFFKSGWEWPESWH
                     KGEAIFAKQVGTYPIGLDWAWHGAENNLLFTNSYKMKLSILMGFIHMTYSYMFSLVNH
                     LHFNSFIDIVGNFIPGLLFMQGIFGYLSICIVYKWTKDWIKDGKAAPSLLNMLINMFL
                     SPGNIDEPLYPHQAKVQMVLLVTALICVPWLLFVKPLHFKFTHSDNSGKASSNDGEYH
                     EETENLLPDVNDALDLIEEEEIAEGEESHEEHSEEFGDVMIHQVIHTIEFCLNCVSHT
                     ASYLRLWALSLAHAQLSSVLWSMTIGLSFGMSGFMGVFAVVFLFALWFILTVCVLVVM
                     EGTSAMLHSLRLHWVESMSKFFVGDGTLYEPFKLIDRDLIEESIEAGVVSTIDVDTEE
                     SVEDFSNLDEDGSPRDEPGFIRRFSGIFTRSSD"
     gene            <295005..>297008
                     /locus_tag="CAGL0C02981g"
                     /db_xref="GeneID:2886771"
     mRNA            <295005..>297008
                     /locus_tag="CAGL0C02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445307.1"
                     /db_xref="GeneID:2886771"
     CDS             295005..297008
                     /locus_tag="CAGL0C02981g"
                     /inference="similar to AA sequence:UniProtKB:P25628"
                     /note="similar to uniprot|P25628 Saccharomyces cerevisiae
                     YCR048w ARE1 or uniprot|P53629 Saccharomyces cerevisiae
                     YNR019w ARE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445307.1"
                     /db_xref="GeneID:2886771"
                     /db_xref="GOA:Q6FWT7"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT7"
                     /translation="MADDLLNDEDFIKIQKLNSVDGERRHSIVFDSTVVVKEGRQSQS
                     QSQSDSDNDNVSGVDVLSVDPATNGKGGDSRTDYDYDSNDKDVLDSHVMVDKQDGSVA
                     FTVAQESDTPADGDRDGDADATGDVAANAGASVKHTKDVDATIKRYMKHMHQKEVGRF
                     NKKSQEYISYFGDVDFDKRPTILDFAVSEPYRTQFKGPILEKEIKEKEKLKKIIAYRS
                     NPSYKPDFDINIKTSSKGKENEAPTFSGVYVLMWMIFGFASIQSCINYYIDHGNSFKD
                     AILFKFMLTDLHRVFAFDALLYCATYFVLFIQYLCCYNVINWNKTGVPVIVTYEILYV
                     TAALYIPAHVLNFNWIARIYIFLHSVVQIMKMHSFSFYNGYLWNILNELNFSKRAVAK
                     LKDRKDIDSEVMATLHRSIDFCSFELNYQCQGENFPNNISIKNYFMYTLFPTLIYQIN
                     YPRTNKIRIGYLIEKTCATFGCIYLMVVDAQIFMLPITEKAIKLKELPIGLEFTAKFF
                     LIWAELIPPMTVLYMLAFYLIWDAILNFFAELTMFADRYFYGDWWNCVSFIEFSRIWN
                     VPVHKFILRHIYHSVINRFRLSKLQATLFTFLLSAVFHELAMYAIVKRWRGFLFAFQL
                     GQFFFAGISNIPYLRKRPVLSNALFWFEMCTGPSVILLLYVVF"
     gene            <297244..>297864
                     /locus_tag="CAGL0C03003g"
                     /db_xref="GeneID:2886726"
     mRNA            <297244..>297864
                     /locus_tag="CAGL0C03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445308.1"
                     /db_xref="GeneID:2886726"
     CDS             297244..297864
                     /locus_tag="CAGL0C03003g"
                     /inference="similar to AA sequence:UniProtKB:P25631"
                     /note="similar to uniprot|P25631 Saccharomyces cerevisiae
                     YCR051w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445308.1"
                     /db_xref="GeneID:2886726"
                     /db_xref="GOA:Q6FWT6"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT6"
                     /translation="MNIWIAASDGRGDIVEKFLADGLSANSKDPNGYTPVHAAAAYGH
                     LDLLRKLCQEHGGDINVRDSDGDTPLHHCEDVRVAQLIVEELGGDYTLTNDEGKTALQ
                     VFEEDAEFPELIQYMRVKSGLNKDEDSLGIDQDQLAQFKDSVRYTLEQEPDELTDPES
                     IERRKRLEKIVMGENPEQELEAYIREMVRSQMMNQDQDQEPSKRRK"
     gene            <298152..>299600
                     /locus_tag="CAGL0C03025g"
                     /db_xref="GeneID:2886728"
     mRNA            <298152..>299600
                     /locus_tag="CAGL0C03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445309.1"
                     /db_xref="GeneID:2886728"
     CDS             298152..299600
                     /locus_tag="CAGL0C03025g"
                     /inference="similar to AA sequence:UniProtKB:P25632"
                     /note="similar to uniprot|P25632 Saccharomyces cerevisiae
                     YCR052w RSC6 or uniprot|P53628 Saccharomyces cerevisiae
                     YNR023w SNF12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445309.1"
                     /db_xref="GeneID:2886728"
                     /db_xref="GOA:Q6FWT5"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT5"
                     /translation="MPENSDAVKTAPIPTSAPTYTYIPFELKEDVPELALLQKLVEKE
                     KQLDISVREKENQLSLDATSGGLYPQNTSDSGRLLRVYVYNTAHHQPWQDEKTDDKPH
                     WLLRVEGKLLNRDGSEVQGESRPFSSYLQAVAVDFKKFKPRRQDNRPEIVSNGDITMT
                     DGDNTTQQLAENANSTNMATNDNDDDDDEDEDAEDDSEIIDAVEWHYDSVAGSEFDGI
                     DVKRPGTQNINCTITIQPRGCTGEEVEYSPELSQILGINVGSVQGAVYGLYKYILNNN
                     LLNNEGKTNDNQHMSSNNSESTKVTLDSALHKLLPKRDITEQAMANTEELKVGLKEAM
                     SLVNDHFQPLPAKKINYTIRTDVETTYGQTVFDIEIGNESPEVKETPLSRFRELAKTT
                     DQEVEDIDEQINMLQLQLNALATKHQFFKETEKNPLAVLKEYALISKNATEVLASDLQ
                     FTEDSVRLSDFYKENEALLFENLATYIANSRL"
     gene            <300099..>303182
                     /locus_tag="CAGL0C03047g"
                     /db_xref="GeneID:2886759"
     mRNA            <300099..>303182
                     /locus_tag="CAGL0C03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445310.1"
                     /db_xref="GeneID:2886759"
     CDS             300099..303182
                     /locus_tag="CAGL0C03047g"
                     /note="highly similar to uniprot|P32558 Saccharomyces
                     cerevisiae YGL207w SPT16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445310.1"
                     /db_xref="GeneID:2886759"
                     /db_xref="GOA:Q6FWT4"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="InterPro:IPR029148"
                     /db_xref="InterPro:IPR029149"
                     /translation="MSELNIDAEAFKARVELLHGKYREFENEPNSMVFALGSSNPENP
                     YQKTTALHYWLMGYEFPATLIVFTPGKVVIITSGPKAKHLEKVVELFKNNNNGVELEI
                     WQRNNKDVEHSQKLFKDIIELINTAGKTVGIPEKDVYEGKFMKEWKPIWDAAIKEHEF
                     KLVDISAGLSSTWEVKDDKEKAYISIASKCSDRFMNLLSDEMVRAVDDELKITNSKLS
                     DKIENKIDDLKFLKKITNDLSAMCPPNHKFTLDLLDWTYSPIIQSGNKFDLRVSAHSN
                     NDQLHGNGCILASCGIRYNNYCSNTTRTFLIDPSEEMVNNYVFLLDLQKHIIENELKA
                     GRTGKEVYESVVEFIKKVRPELAGNFTKNIGSLIGLEFRDSFFVLNSKNDKRKIQVGD
                     CFNISFGFNALKDMKTNTNYALQLADTVILNEDGPKILTEYTKSKSQVSFYFNNDEVE
                     KEKKPAASTKIPTNLDGNSKILRSKLRGDARGESQDAQKEQIRKENQRKLHEKLQKEG
                     LLRFTAEDATTEGSETRQYFKKYESYVRESQIPNNVRDLRIHVDWRSQTIIVPIYGRP
                     VPFHINSYKNGSKNEEGEYTYLRLNFHSPGSAGGISKNVVELPYDDSPDNQFMRSITL
                     RSKDGDRMSETFKQITDLKKESTKREQERKALADVVQQDKLIENKTGRTKRLDQIFVR
                     PSPDTKRVPSTVFIHENGIRYQSPLRTDSRIDILFSNIKNLIFQSCKGELIVIIHIHL
                     KNPIMMGKKKIQDVQFYREASDVSVDETGTGRRNQNKFRKYGDEDELEQEQEERRKRA
                     MLDKEFKYFADAIAEASNGLVSVESTFRDLGFQGVPNRSAVFCMPTTDCLVQLIEPPF
                     LVVNLEEIEVAILERVQFGLKNFDLVFVYKDFKKPVTHINTIPIESLDFLKQWLTDMD
                     IPYAISTINLKWSTIMQSLQEDPHQFFLDGGWSFLNANSDEEGSDESEEEISEYEASE
                     EEPEDESAYSDEDDYSEDISDGSYSGADSEEEEGEDWDELEKKAAKADRTAGLRD"
     gene            <303460..>304296
                     /locus_tag="CAGL0C03069g"
                     /db_xref="GeneID:2886782"
     mRNA            <303460..>304296
                     /locus_tag="CAGL0C03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445311.1"
                     /db_xref="GeneID:2886782"
     CDS             303460..304296
                     /locus_tag="CAGL0C03069g"
                     /note="highly similar to uniprot|P08456 Saccharomyces
                     cerevisiae YER026c CHO1 CDP-diacylglycerol serine
                     O-phosphatidyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445311.1"
                     /db_xref="GeneID:2886782"
                     /db_xref="GOA:Q6FWT3"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR004533"
                     /db_xref="InterPro:IPR016271"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT3"
                     /translation="MVSTRRGKPAFEEMSEGREEFPVIEENGENGEDYMDNDEERPTL
                     SRRASSIFSIDTTPLAPPNKTDIEMFTSDAYHFSMIRNLHLADYITMLNGFCGFYSIV
                     SCLRFTLTGKPHYVQRAHFFIFLGMCFDFFDGRVARLRNRSSLMGQELDSLADLVSFG
                     VAPAAIAFAIGFQTTLDVFVLSFFVLCALARLARFNVTVGQLPKDVKGKSKFFEGLPM
                     PTTLLLVLGMACLVRQNRIFDNIPLGIVREGLAFEFHPIIFIFFLHGCGMISKSLKIP
                     KP"
     gene            complement(304563..304634)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0C03091r"
                     /db_xref="GeneID:2886806"
     tRNA            complement(304563..304634)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0C03091r"
                     /product="tRNA-His"
                     /db_xref="GeneID:2886806"
     gene            <305020..>306099
                     /locus_tag="CAGL0C03113g"
                     /db_xref="GeneID:2886807"
     mRNA            <305020..>306099
                     /locus_tag="CAGL0C03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445312.1"
                     /db_xref="GeneID:2886807"
     CDS             305020..306099
                     /locus_tag="CAGL0C03113g"
                     /note="highly similar to uniprot|Q06151 Saccharomyces
                     cerevisiae YLR270w or uniprot|Q12123 Saccharomyces
                     cerevisiae YOR173w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445312.1"
                     /db_xref="GeneID:2886807"
                     /db_xref="GOA:Q6FWT2"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="InterPro:IPR011145"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT2"
                     /translation="MASKAQDKVSTMAESEDFSTLIERFQFVKVLDSNPQTKVISLLG
                     TIDGKDAIITAEKTHFVFDETVHKTASDENATPIFYHCENEYSCVNGIEELKQITNND
                     IYYWGLSVLRQSMDYNPTAKLNLIWPATPVHVKKYEQQNFHLIKETPEAYKRIVEPYI
                     EEMHNKGRLAWVNNILYGEAEADRVVYKDYQEDNKKDSFIVLPDMKWDGNNLESLYLV
                     AISYRDDIRSLRDLKMEDRDWLKNIYNKIRSIIPACYNYAVHPDELRVFIHYQPSYYH
                     FHIHIVNIKHPGLGNGISTGKAILLDEIIDMLQYLGPEGYMRKTITYVIGENHDLWKR
                     GLEEEVSKQLEADGIPKLPNIVEGF"
     gene            complement(<306271..>309744)
                     /locus_tag="CAGL0C03135g"
                     /db_xref="GeneID:2886859"
     mRNA            complement(<306271..>309744)
                     /locus_tag="CAGL0C03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445313.1"
                     /db_xref="GeneID:2886859"
     CDS             complement(306271..309744)
                     /locus_tag="CAGL0C03135g"
                     /note="highly similar to uniprot|Q06156 Saccharomyces
                     cerevisiae YLR272c YCS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445313.1"
                     /db_xref="GeneID:2886859"
                     /db_xref="GOA:Q6FWT1"
                     /db_xref="InterPro:IPR007673"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024324"
                     /db_xref="InterPro:IPR026971"
                     /db_xref="UniProtKB/TrEMBL:Q6FWT1"
                     /translation="MSDFNLAEYTTRFQTSDKESYTEVNNANNELNIVTDRLAVSSEQ
                     IDADPETLESFIDLCHGFQYLSSKLQKQLTYLISSSLNHLVRDVNAQLSSNSDYNEVN
                     SLIPQWKRHLEEYGYLTHVVLTFLQITVHDAASKSSNASKKKSANSETVQKFKNCCNQ
                     IECLLEPVIMLLEINLSRIFQTTPERDLFISLFVRPLNVLIEAEAVIKLPSLKMFIQR
                     VIALSVKNHGQVRIAQNTIMTNLTYFIHLSNFNAELLQLLDDEYDFPQLTEDLLKEIS
                     TRVFSAKDTNGPKAISNFLIKLSELSPNIMLRQMSLVVQLLNNSSITLRCSVVEACGN
                     IVVRLAKEPSTLEHYHQQIAILLELLQERFQDSNPYVRTKAIQGCVKVCELKSKFRKE
                     RYEITKLAVRSLEDRSSLVRRNSLKLLSKLLLTHPFVAVHGTQLKLSNWKKYQALALA
                     SLEKYEKETDNNEIENEDDDGNMEIDRELSSNGYVPTGNELADIENEAEQSETPAAET
                     VMKLKLIALYYKEAIAFINLIHKAIYSASGLLFSRNRNEVLECMDFIVLSDAYGIECS
                     NVGIKKMLHLVWMKGNSDEGTSVSSHLIACYQQLFLTTPENITAKEKALYIAKNLIQL
                     TVDATVSDLTSLEQLLGMMYEHKLINEIVINTLWAIYNTASNADNGTEKSFVKNQIHG
                     AIIVLGMLANVNSDIILKGIDSILNIGLGSAGFDDLILCRYSCIALGRVVPKKSLFLD
                     SILSEDQEMQAVQKLGQHIIFATTNPNYFAMAENAINALFNISSKPDIVIADLIKEKT
                     MMTFGKPENDSSITSTDISRTDSLSQLLFIVGQAAIKTLVYLEKCEAEFKKRKIEAES
                     KIGQEKSKNEGPTDPNATANETKDNELEMIGGTNEDDFADAINYVKETELLFGPESLF
                     GKFCPIVEEIVSNSTRFQDVVLQRSAALCLEKLMCISSKYCEKSLPLLITVMEKSKDP
                     VIRSNAVLGLGDMAVCFNNLIDENTGFLYRRLHDKNLMVERTCLMTVTFLILAGQVKV
                     KGQLSEMAKCLINPDQNISDMSRLFFSELATKDNAVYNSFIDIFSNLSADTDITQESF
                     KKIMKFLTSFIEKERHQKQLVDKLIGRLANCDDQKQWDDIAYVLNTLPYKDDRVAPLL
                     EAGFKMVEAKE"
     gene            complement(309980..310053)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0C03157r"
                     /db_xref="GeneID:2886887"
     tRNA            complement(309980..310053)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0C03157r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2886887"
     gene            complement(<310371..>311018)
                     /locus_tag="CAGL0C03179g"
                     /db_xref="GeneID:2886888"
     mRNA            complement(<310371..>311018)
                     /locus_tag="CAGL0C03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445314.1"
                     /db_xref="GeneID:2886888"
     CDS             complement(310371..311018)
                     /locus_tag="CAGL0C03179g"
                     /note="highly similar to uniprot|P22214 Saccharomyces
                     cerevisiae YLR268w SEC22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445314.1"
                     /db_xref="GeneID:2886888"
                     /db_xref="GOA:Q6FWT0"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /translation="MIKSTVVYRDDGLPLCSSVDDDISDLSLNEQKKRIKMVVSRMTP
                     QSANEATLESKDSEIHYIRQQGVIYFVICEAGYPRNLAFSYLNDVAVEFQHSYSNELS
                     KPTIRPYAFASFDTFLQRTKKAYSDKKVQDNLDQLNQELVGVKQIMSKNIEDLLYRGD
                     SLEKMDDMSNSLKISSKKYRKSAQKINFDLLISQYAPIVMVAFFFVFLFWWVFLR"
     gene            <311804..>321130
                     /locus_tag="CAGL0C03201g"
                     /db_xref="GeneID:2886943"
     mRNA            <311804..>321130
                     /locus_tag="CAGL0C03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445315.1"
                     /db_xref="GeneID:2886943"
     CDS             311804..321130
                     /locus_tag="CAGL0C03201g"
                     /inference="similar to AA sequence:UniProtKB:Q07878"
                     /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
                     YLL040c VPS13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445315.1"
                     /db_xref="GeneID:2886943"
                     /db_xref="GOA:Q6FWS9"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR017148"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS9"
                     /translation="MLESLAASVLNRVLGSYVQNFDPAQLNVGIWSGDVKLKNLKLRQ
                     DCLDSLNLPIDVKFGVLNDLSLVVPWSSLKNNPVKIIIEDCFLLCTPRDFKTTTPDED
                     IARELRHKLNKLAEWELTNQAKQSLSADNADDGKNSTFMQSLTTKIIENLQITIKNIH
                     LRYEDKSCLFSKYPCALGVALKEFSAVSTDDQWVPKFIETAQALSHKLFKMDSLCCYW
                     NTNSTFLLDYLDPESDLYDPTHEKLILQFQRTIASAESVETPQHQYIIRPISGEGHLT
                     LNKKGSSDSQPHVDMQLIFEEFTVGIDDAEYNDFLFTLSNLTAKANKSISQVERPSVS
                     VQENPQEWFKYVVSRVKERMRKKNEMWTWDAIQKKCQDRRKYIELWEKKLNLPSLESD
                     LPIEEEAKLNELTESLSYEELILFRTVAKRQFTESRAVSKASNKAIENSKNNNGGWLS
                     SWWGSKDTTSDALELTDEQRKEFYDAIEFDENEEETEEISVPRERVTLNISSILKKGS
                     FVLKKKNNVILSEVIFEDCELQFSQRSDSYIGKFSLADFRVEDGSETSIYKHIVSGRD
                     LHKSSITDTGDIKENLLNLIYESNPLDGISDSKLDIKLNGMTIFYNVLFVSEILQFFN
                     MPDEHKDTIDAIISAAEATVEGWTTYSRMGIETILEDHKTINLSLDLQAPLIILPLHD
                     YTWDTPCAIVDAGHISVSSDVIPKEKIKEIIGMSPEDYDKLNPNDKNRLMFDRYKLEL
                     QDTQILVGANIHNTLSSLKDSESFENLSVLEKMKLVLVLDSLIAPKAFRLPKFKLTGH
                     LPTIRFAFNDFQYKTAIEILQNCLPSSFIIENNDGTQNTPEENATRFSDLEQKQLRDM
                     KAYIATLSESQLDQKFLDVHFDIDQVMVGISKCENSETMTCNKLVDIKGENFQFDFYK
                     RTKDMKVNLQIHSLNMEDHISKSSKEFSNLITSEFSGSVKNSDLFSLQYSRTQRIVSH
                     ENSLIEVYDQDVLIDMEKLQIVLTPLSILTLMNFMMLTFSDPNAPEAPADVLRHNNSD
                     NEDAPQKIKMKINMGGVNVILNDDSIKIATLVFNAANLKLVMLPEKLKFDMRMDGLDL
                     TEEISEALDRCSPLRKLIQMEGDELVELSYETFDSQTNSANFDSLLKYTTGSMVINFV
                     EAPINRIANYLNKFQKMKTFFDRAREAAYNQAPSMDTVNNMKLDILIKSPTINFPNTS
                     NLDSLGDRIQLFLGEFFIQNSFTGETSQNKVNHVKMGLRQTELISYIQNEKVSILHGM
                     SLLFSIIHSPLSVKDEPTFKIISDFNPTTIAISEHQANELLKCWSTFSNAFTIENDNE
                     EQLYLMVNSTPSVESVLTTTPSTADNALKDSDGEELGDKINFDFVFNSPSLSLVLSDS
                     SSREKTSNGLIAEFGLQDMGTSFKLGYDGTLDGEAHISAFTVKDKRSDKQNKFAELVP
                     KSNENDYQFVAKYSTRKLSDHTVTNVSTNINSPHVILAMDFLFALKNFVGGLNFEEPT
                     VQLETDDSSINSDIISESNEPSPETKNVIQYSLNIVDTAFILLADPSNENTEAVVFNI
                     GQILLTDQNIISFATNNVNVFLTQMNTNSSDKVRLLDDFSTTLTIDKRESTKNLQVTD
                     IQISIQPLLMRISLRDIRLAMMIFERTIALANNSKNDIEVQNEESGDKIEAFSKEFEK
                     KLSKYVPSILSTLSDTQSLKRATSRRSASPIRMQIKESLSADFGGLRLILIGDVHEMP
                     VLDMSATSLFVSGKNWSSNLKIETSVTTYVNIFNYSRSCWEPFIENTNFIISFLKKSN
                     TSSVYELNVNSDVLTDITLSTRSLEMLTGIPKALSGELALKPRGYQKPYRLVNQTGLD
                     IDVWILTDNIEDRKGLTRLENEGNIPWEFEDWQSVRERLSTDQVSSVICASIPNSNYK
                     SILKVDATDIGDNIHVLKPSVGKYHNRIITTCDCGPDNIKTITFRSTLVVENITRQKV
                     LVSVNPPQNSKREYLEFSILPNEVKSIPVEYCYDSNLKIKPAAISNDNGFNWSSENIY
                     WKTLINGSRSVSCQSQNNDGSDYNFEVSGFFDNNEPLSKVYPKMKIVISPSLIIENGL
                     PYDINFLLYERKDMRGGYRYLKRESSLEIHDVSLRNFVLMRVLPLIENDNLSKPTIIH
                     TPPNNTLQPEKSIHLTLASGQKLRLLIHYQNLDGTPTKILKIYSPYILFNKTDRELFA
                     KSDMMNVAKSTVYDSDNGRFSKPLLFSFEKPSEKNNKAQIKFRESDWCLPFSIDAIGQ
                     AFDTSVPVPNKEQEFDVGIYISDGVGPYMLSKIVEVAPRYIIRNELDYEIEVCEVGSI
                     DSIQIPKNDSKPLYKLSSMVEKQLILKFLGMDSEWSAPFHLNEVGSTFLKVLRKGSSH
                     KLLKIDILLENATLFIVVKDGKNHWPYSIRNFSDYEFIFYQRDPSLIDDLYDEKNEDY
                     EALTYKPLYYRIPPMSVMPYAWDYPSAKQKKLIITSKNRNREIDLGAIGNLKPMRLPG
                     VDEGEKMHLVDLHVVADGPTQALLITNYNPEVSLYKLRNKKKASSLSLNESGEVFVAD
                     ENDEEFQTRLVFSFNGIGVSLIDANLREILYLNMQGIEMRYNESDLYKTFSWNIKWLQ
                     ADNQLFTSNSQNIIYPTTVKKTEEELKEHPVLSGSISKVKDDSHGIPYYKHVTLLMQE
                     LSIQLDEDFMYAILEFSRFPGAPWITEPKIPDMDHVRLPEFEDITSEDDLYFEVLHIQ
                     PTMLHFSFSRSDRIEETKDVIISDTNKNSVSPMYYVHMLSLTLGNVNDAPIKLNSLLM
                     DNVRVPLPMLMNSMKMYYGQQVFYQVHKILGSADCFGNPVGLFNTISSGVVDLFYEPY
                     LGYMMNDSPQEIGAQIARGGVSFAKKTVYGLSDSMARLTGSLAKGLSVTQDSSFQESR
                     RLQQRLNRSGKNVFANSAQSFAATIGSGFSGIALDPYKGAQKDGAAGLIKGLGKGLLG
                     LPAKTAIGFLDLTSNLSQGLRVSTNDIMAYQARIRLPRYIGNDQIIKPYDESHSLGQY
                     WLKTVNGGQFVDDEYLAHVILPGNELVVIVSMQRICELNIKELEVMWGVEYDSIQGIV
                     LERGGIHVKLKSQAEYFIPIADPHERRYIYKNIAIAVKKYNQYCEVVL"
     gene            <321831..>322592
                     /locus_tag="CAGL0C03223g"
                     /db_xref="GeneID:2886893"
     mRNA            <321831..>322592
                     /locus_tag="CAGL0C03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445316.1"
                     /db_xref="GeneID:2886893"
     CDS             321831..322592
                     /locus_tag="CAGL0C03223g"
                     /note="highly similar to uniprot|P21801 Saccharomyces
                     cerevisiae YLL041c SDH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445316.1"
                     /db_xref="GeneID:2886893"
                     /db_xref="GOA:Q6FWS8"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /translation="MFMLRVSRRGLATATSVPRLKTFKIYRWNPDKPTEKPHLQEYKV
                     DLEDCGPMVLDALLKIKNEQDATLTFRRSCREGICGSCAMNIGGANTLACLCKIDQDE
                     SKTTKIYPLPHMFIVKDLVPDLTGFYQQYKSIQPYLQRTDYPADGKEVLQSIDDRKKL
                     DGLYECILCACCSTSCPSYWWNQEEYLGPAVLMQAYRWLIDSRDQATKARRTMLQNSM
                     SLYRCHTIMNCTRTCPKGLNPGRSIAEIKKQLAFD"
     gene            <323072..>323551
                     /locus_tag="CAGL0C03245g"
                     /db_xref="GeneID:2886871"
     mRNA            <323072..>323551
                     /locus_tag="CAGL0C03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445317.1"
                     /db_xref="GeneID:2886871"
     CDS             323072..323551
                     /locus_tag="CAGL0C03245g"
                     /note="weakly similar to uniprot|Q07879 Saccharomyces
                     cerevisiae YLL042c APG10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445317.1"
                     /db_xref="GeneID:2886871"
                     /db_xref="GOA:Q6FWS7"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR016524"
                     /translation="MTLEYEQFVQQLTRLAESRELYKKLPLLRHDLVHSPCCLHLTVP
                     NSTRNTGGHIELLITFSRVYREPLLLIRVWATTALDGIETSQLAHSAETMATLRIPSY
                     LTLGLDTILDAQYPHALQGAWYSVHPCDTRDIVGDDVTVRDTYLDRWVSVFLLWVCR"
     gene            complement(<323832..>325790)
                     /locus_tag="CAGL0C03267g"
                     /db_xref="GeneID:2886899"
     mRNA            complement(<323832..>325790)
                     /locus_tag="CAGL0C03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445318.1"
                     /db_xref="GeneID:2886899"
     CDS             complement(323832..325790)
                     /locus_tag="CAGL0C03267g"
                     /inference="similar to AA sequence:UniProtKB:P23900"
                     /note="similar to uniprot|P23900 Saccharomyces cerevisiae
                     YLL043w FPS1 glycerol channel"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445318.1"
                     /db_xref="GeneID:2886899"
                     /db_xref="GOA:Q6FWS6"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS6"
                     /translation="MSHQQGGSKNPNAMSDLNEYLSNEDRNSQERNDRDDFDVEMQEY
                     TPQPFKRPTASYIPEYIGTSNQFPIQEVVPNTNIPIHQLMENHSAAQSPNRPSSPVNN
                     SNMNNLSGDMSTAAATSVNVNTTSNTDHLRARDHTTVSANVLNLGHLYKNNYGNNNDD
                     GDHISVQEGVTNDSESKQYGTRRDRATSFISRLAGGGDDGSPNDPNPGNASVPIIVKP
                     KTLYQNPQTPTVLPSTYHPINRWSLVKSGVLKEFLAEFMGTMVMIIFGSAVVIQVLSG
                     GKAQQDSYLAAMDALSQSDLSAGEKMAFENLTKLVSSVSAGTFDDIALGWAAAVVMGY
                     FCAGGSAISGGHLNPIITLANFVYRGFPAKKIPFYFFGQLFGAYVGGLIAYGYYKKVI
                     SETFPDHFNSETVVSMFCVVPKPYLSSARQFVSEFLCGAMLVACTFALTDPYTSLSGD
                     VFPLMLFLLIFMCNSGLGYQTGTAMNMARDLGPRMALYTVGFSRKLLWTSHHHFFWVP
                     ICAPFIGALTGGLVYDIFIYQGHESPVNWPFSLYKETFQRWWFKRPGWQRRNKARRMS
                     DLSEISYAEDEDLDNTYTGTRFPRVTKTKSYHSSHNTDEKKVQFKSVQRDKPHNQNMA
                     AVLDDESSLETASLGDSYIEQYSSKNSN"
     gene            <328799..>333745
                     /locus_tag="CAGL0C03289g"
                     /db_xref="GeneID:2886961"
     mRNA            <328799..>333745
                     /locus_tag="CAGL0C03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445319.1"
                     /db_xref="GeneID:2886961"
     CDS             328799..333745
                     /locus_tag="CAGL0C03289g"
                     /inference="similar to AA sequence:UniProtKB:P32386"
                     /note="similar to uniprot|P32386 Saccharomyces cerevisiae
                     YLL048c YBT1 yeast bile transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445319.1"
                     /db_xref="GeneID:2886961"
                     /db_xref="GOA:Q6FWS5"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS5"
                     /translation="MVVEAMSSCQFWYFDDITKYGRIEVLNNYVPTTLVTISILILLH
                     NFFIRFYKYDIKKETPTPSLSLKLSSLNLSESDEEMPLTMHAQHNYGSHPSPSELNTD
                     SSALYDRHFSINNIDSGEVNDPTKYHLIKRNMFEKFRVVIEFVIVAFQLLLHCYLSIE
                     KSNLNGDLQKFHFKPHVLLWTILFTLATLRVLNLNQNNKFVNKYSGNIWLVSFANYTV
                     IFLAHILPFRSALIGHVNDYGSSQYYKSQFWLNLVLMALLLTSPIGNNLPVLYQPQQD
                     RAPSPEPYVSLLTFFSFHWVQPFINKAYKNNSLSHSDLWSLKLEDYSINVMKSFLEFR
                     NRPSMRSSRFGISLLRYFLNLFMFQWCFTTISAFSIFVPTILLKKLLDFIEHKDKGSM
                     NLAWFYVFGMFISRFIVAICDHCNLFLGRRVCVRMKSIIISEIYSKALKRKITKQSKP
                     ADENNENDMIKHDEVSPQEVNDTTHVNADEESYSSNLGSIINLMSVDAFKISELCAYL
                     HYFLETAIMLTVSLILLYKVIGTAAFVGILITIIIIPINSKLYAVVGTLQAGNLACTD
                     KRVEKLNESFQAIRIIKYFSWEDKFKEGIMLVREKELALLLKRCMVWCVLAFSWFITP
                     TLITGCTFAYSILIEKKQLTTPVAFTALSLFTLLRDPLDRISDMLSYLIQSKISLDRV
                     QRFLETEETDKYDQLTVDKNGKRLAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIV
                     GATGSGKTSILMGLLGEMQLSEGKIIVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLN
                     DTVRNNILFNAPFDQARYDAVVEACSLKRDFQILKAGDSTEIGEKGITLSGGQKQRVS
                     LARALYSSAGHLLLDDCLSAVDSHTALWIYDKCISGPLMEGRTCILVTHNIALTMKNA
                     DFVVMIEDGKVKEKGTPIELLAKGLLGEDENMKKSIISRSASSASLKGKSERSLGTTP
                     APVEIVQDSTPVNDDGKLIEEEGKAMGFVGKEIYKWYIKMYGGWYTIVALASVFTAIL
                     CLQITQAWWIRNWTVKRFSDVDESNYNLPASTFIVESRNRVLLTNEAGKKESENQNAG
                     IAKFLVVYCLIGVMSSIIGSIKTFVNSLFGIRASKLIFDSLLDRVLHARVRFFDSTPI
                     GRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISYITPAFFPVAIIIVLGYS
                     IVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQN
                     SMPFFYLWVVNRWLSFRIDLIGALVIFSSGVFILLNINNIDAGLAGISLTYAISFTEA
                     ALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTPPPQWPDSGKVEVNNLS
                     LKYAPHLPYVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIKLDGVN
                     IANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEME
                     ASTSEIQSNSSKNVNKFLNLESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILLDEAT
                     ASIDYNSDAKIQETIRQEFNNSTVLTIAHRLRSIVDYDKILVMDAGEVKEFDHPYSLL
                     LEKKSIFYNMCEDSGELDVLIDLAKKSFISRLNSDSKK"
     gene            complement(<333898..>334443)
                     /locus_tag="CAGL0C03311g"
                     /db_xref="GeneID:2886962"
     mRNA            complement(<333898..>334443)
                     /locus_tag="CAGL0C03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445320.2"
                     /db_xref="GeneID:2886962"
     CDS             complement(333898..334443)
                     /locus_tag="CAGL0C03311g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445320.2"
                     /db_xref="GeneID:2886962"
                     /db_xref="GOA:Q6FWS4"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS4"
                     /translation="MLHTRESPEDVSLGARLAHLESLIGTEAIDLDKFSHSNTTLSAI
                     LDAVTLKLNSWINTATVESRLLMELLMNHQESALLAKQQQDEGDNPYEIVVIERLEVM
                     ARSLIQLETLYRDSLRLDTTESLALDTDIISQINQLFTNCNVCIKRTIVLAYRLKLRH
                     RKHQQYVKYLEDRLMIRDDQR"
     gene            <335372..>337555
                     /locus_tag="CAGL0C03333g"
                     /db_xref="GeneID:2886742"
     mRNA            <335372..>337555
                     /locus_tag="CAGL0C03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445321.1"
                     /db_xref="GeneID:2886742"
     CDS             335372..337555
                     /locus_tag="CAGL0C03333g"
                     /inference="similar to AA sequence:UniProtKB:Q12473"
                     /note="similar to uniprot|Q12473 Saccharomyces cerevisiae
                     YLL051c FRE6 or uniprot|P53746 Saccharomyces cerevisiae
                     YNR060w FRE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445321.1"
                     /db_xref="GeneID:2886742"
                     /db_xref="GOA:Q6FWS3"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS3"
                     /translation="MMIAVLIVPFCMGLTLALQGGFQKRDVWEVNAVMSCGTYVTRLG
                     WEYTSMGPSFYEPICNYEPAMGTWVGCIHDVIFEDRKMDARAFERSFNAVQKICKLVS
                     FTNTTSQFPMIADKFTNITEFYQTLTNASLFLNNNRSDRPVGSIDRLTYPITIDESIR
                     TKNLFAYHAHSYNLDRSNTFGAVINYYFLIVMALLAIGNFFNHIGLDQRRNLFFKFFN
                     KIKGSYLVPAIFKGKHAQYLRGKKFCVSYCALLPSRIEFIILLGYAILHTVLLSYDYI
                     IDPNNVLFKSKNLQLVRYFADRTGILAFAHFPIIIIFSTRNNIFESLTGLHYSSFIAF
                     HKWLGRFMTLDAILHSVFYVIYSLCYHTFENSRKQAYWQFGTFAIVALISICIFSLAY
                     MRIHYYETFLILHIILAVLLFICCWKHVEKIGWGQWLCFAIFFWVVEKLTRVYKLCTF
                     GVRTAKLKLFFDDVGAPEYVQVTIYKGEKLKNWNAKAGQYGFVYFLIPRFFWQSHPFT
                     IEDDGDYLRIVIRPKDGLTNKLVNYVLKNGVDGEMSVWLSIEGPYGCSLPLKHYDDVI
                     LVSGGSGIPGPLAHAIECLPMVKTSASKFVELVIIARDTNILKAYAKDLLKLKNSPVT
                     VTLYLTTKYNNHRIQKFDVPDSSTPLLQESSSMLVELLSFIPIHYGRPNIAKIIDGHC
                     KEKTRSLAVVTCGPPVLVDNIRSHCAERMANSETTIGYFEEFQCW"
     gene            <337923..>338852
                     /locus_tag="CAGL0C03355g"
                     /db_xref="GeneID:2886775"
     mRNA            <337923..>338852
                     /locus_tag="CAGL0C03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445322.1"
                     /db_xref="GeneID:2886775"
     CDS             337923..338852
                     /locus_tag="CAGL0C03355g"
                     /inference="similar to AA sequence:UniProtKB:P53743"
                     /note="similar to uniprot|P53743 Saccharomyces cerevisiae
                     YNR054c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445322.1"
                     /db_xref="GeneID:2886775"
                     /db_xref="GOA:Q6FWS2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MVSNKHDDFSEDDFSDQEDGILLQKKKVVRDAFSKEDSDVEEGI
                     SDEEADVAEQPHSEDKEESAEAQLEQNKAEQTNEQQAGVAEPVSEEKRKQSKIDKIIQ
                     RKAGQKLKHKTGVVYLSRIPPYMKPAKMRQILSRFGEIDRLFLKREDEAKHKQRTRGG
                     GNKKIMYEEGWAEFIRKRDAKLCAETLNGNIIGGKKGSFYHDDILNVKYLPGFKWADL
                     TEQIARENDVRQAKLELEISQSNKLNAEYIRNVEQSKMLQNMRKRKDHEDRDQDARRQ
                     FKQHKVSTNRADAPSSIKNKSETSVKDVLSSLL"
     gene            <339146..>341203
                     /locus_tag="CAGL0C03369g"
                     /db_xref="GeneID:2886741"
     mRNA            join(<339146..339955,340529..>341203)
                     /locus_tag="CAGL0C03369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445323.1"
                     /db_xref="GeneID:2886741"
     CDS             join(339146..339955,340529..341203)
                     /locus_tag="CAGL0C03369g"
                     /note="highly similar to uniprot|P53742 Saccharomyces
                     cerevisiae YNR053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445323.1"
                     /db_xref="GeneID:2886741"
                     /db_xref="GOA:Q6FWS1"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGTGKKEKQRRIREGTTKDGNIRVKGENFYRDSKRVQFLNMYKS
                     GKAIKNKHGDVIRAADYQDTTIPDARVQPDRRWFGNTRVISQDALQHFRDALGETQKD
                     TYQVLLRRNKLPMSLLDEKDSTESPRARILETESFDQTFGPKAQRKKPRVAASSLEEL
                     VQATEEENKTYEEKEELKATLGLMGKQEDEENGWTQVTKEAIFSKGQSKRIWNELYKV
                     IDSSDVVIHVLDARDPLGTRCKSVEEYMKKETPHKHLIYVLNKCDLVPTWVAAAWVKH
                     LSKDRPTLAFHASITNSFGKGSLIQLLRQFSQLHTDRKQISVGFIGYPNTGKSSIINT
                     LRKKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSTKDSEEDILFRGVVRVEH
                     VSHPEQYIPGVLKRCQTKHLERTYEISGWKDATDFIEMLARKQGRLLKGGEPDESGVS
                     KQILNDFNRGKIPWFVIPPEKEEDKKRKLDEEEVKSAKMQKVKD"
     gene            <341755..>343191
                     /locus_tag="CAGL0C03399g"
                     /db_xref="GeneID:2886744"
     mRNA            <341755..>343191
                     /locus_tag="CAGL0C03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445324.1"
                     /db_xref="GeneID:2886744"
     CDS             341755..343191
                     /locus_tag="CAGL0C03399g"
                     /inference="similar to AA sequence:UniProtKB:P39008"
                     /note="similar to uniprot|P39008 Saccharomyces cerevisiae
                     YNR052c POP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445324.1"
                     /db_xref="GeneID:2886744"
                     /db_xref="GOA:Q6FWS0"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q6FWS0"
                     /translation="MQSMNVQHQVMPGHEQMMPQRDPQNMNMMQNYSPHMGRARMNVQ
                     QPNFPMQSMMQDVGNPYLNAQEQDMNKRQMQQNMPMNIQPQLQMQHQNQNFNISTPVN
                     ASMPPGLNLYQQQQQQQQQQQQQQQQQQQQQQQQQRQGQGQGQQNQQNQQQQQQQQLG
                     QQQIPQQSQNQGSIGVNPALTNVPKQMGAAANALPGAASALPPMILPPPNHLFVRDVW
                     KGNLYREFASIRRLVQQYNHISISTEFVGTTARPIGNFRSKADYHYQTMRANVDFLNP
                     IQLGLSLSDENGNKPDNGPSTWQFNFEFNPEKEMVSKDSLELLTKSGINFEQHQTMGI
                     DQLEFGQLLMDSGLVLDPEVTWVTYHAAYDLGFLINILMNNSMPNNKDDFEWWVHKYL
                     PNFYDLNLVYKAIQDFKQPNQQQQYTLTSLADDLGIPRFSIFTTTGGQSLLMLLSFCQ
                     LAKVSLNKLPNGADLISYRNIIYGIDGE"
     gene            <343814..>345310
                     /locus_tag="CAGL0C03421g"
                     /db_xref="GeneID:2886723"
     mRNA            <343814..>345310
                     /locus_tag="CAGL0C03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445325.1"
                     /db_xref="GeneID:2886723"
     CDS             343814..345310
                     /locus_tag="CAGL0C03421g"
                     /inference="similar to AA sequence:UniProtKB:P53741"
                     /note="similar to uniprot|P53741 Saccharomyces cerevisiae
                     YNR051c BRE5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445325.1"
                     /db_xref="GeneID:2886723"
                     /db_xref="GOA:Q6FWR9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR9"
                     /translation="MGTPTIQEISYAFVRTYYERMNNNPSKMSNLYSNTAELTHIGYQ
                     QKVDENSDVLATVKLTGKENISKFFVRNEAKVNDLKVKLDSCDFQTTGVNHKSIFIVV
                     TGELFWTGTPTYRFCQSFILTPTSPSSDSYDITNDIIRFLGDNFQSIKAARQNSGHKK
                     EENKSVEKSKESQPAKEKKVEEKPKEEPKEQEKIAPVSPKAAKEAPAPAPAPTSASEP
                     SVPKPVTPVLKKETTHPVTNNVTKEAQTQASPEKEEIDATKKESATTKETVKENNKAV
                     KEVTEPKPVQENNSVSSRPSSSSTTPSQTPNQEQSSGPVKMTWASKLSQDTAVNTKAG
                     FVKNEPIQTVKIEPSEEQEPSSSKKSSNGDRKFELAGRRENSSSTKTKKKPIFCTVNE
                     DGFFPIYIRGTAGLKEDRLRNTLETNYGPVKKITMAENFSVVDFELQKSQTEAIETKK
                     ITIDGIEIYMERKTIKKSPTSTASSSSSSQGFTNVSKVYKKHAVKKKD"
     gene            <346533..>347873
                     /locus_tag="CAGL0C03443g"
                     /db_xref="GeneID:2886722"
     mRNA            <346533..>347873
                     /locus_tag="CAGL0C03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445326.1"
                     /db_xref="GeneID:2886722"
     CDS             346533..347873
                     /locus_tag="CAGL0C03443g"
                     /note="highly similar to uniprot|P38999 Saccharomyces
                     cerevisiae YNR050c LYS9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445326.1"
                     /db_xref="GeneID:2886722"
                     /db_xref="GOA:Q6FWR8"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR8"
                     /translation="MTKRVLLLGSGFVAQPVIDTLAATEGIEVTVACRTLANAKQLAS
                     ASGSDAISLDVTDDSALDAALGQHDLVISLIPYTFHPNVVRSAIRLKKDVVTSSYISP
                     ALRELEPEINKAGITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKIKSFLSYCGGLPAP
                     EDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETISSEDLMASAKPYFIYPGYAFV
                     CYPNRDSTLFKELYHIPEADTVIRGTLRYQGFPEFVKALVDMGMLKDDENAIFSSAIP
                     WNDALKQYLGAKSTSREDLVASIDSKTNWKSQEDRDRILSGFAWLGLFSDTKITPRGN
                     ALDTLCARLEELMQYEDGERDMVALQHKFGIEWADGTTEVRTSTMIDYGKVGGYSSMA
                     ATVGYPVAIATKFVLNGTIKGPGLLAPYSPEINDPIMKELKDKYGLYLKEKTIA"
     gene            <348408..>349031
                     /locus_tag="CAGL0C03465g"
                     /db_xref="GeneID:2886727"
     mRNA            <348408..>349031
                     /locus_tag="CAGL0C03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445327.1"
                     /db_xref="GeneID:2886727"
     CDS             348408..349031
                     /locus_tag="CAGL0C03465g"
                     /inference="similar to AA sequence:UniProtKB:P53604"
                     /note="similar to uniprot|P53604 Saccharomyces cerevisiae
                     YNR049c MSO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445327.1"
                     /db_xref="GeneID:2886727"
                     /db_xref="GOA:Q6FWR7"
                     /db_xref="InterPro:IPR028095"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR7"
                     /translation="MSASSEHGSTRMWDKFKTSTKSLSSSLSQLSIKPETDGSTPTST
                     VVHKALVKFYKHQEPFQGFPGWLGHKEDLPDEQKILKKQQNHQSKSSRTGDSITSKFD
                     SLRGGFSEKREERPDAASQRTTAGMSFHSIYDKPTSSTDLSSMASPSVRSPLRARSTW
                     SSEADSAKISSAGTNSTAESNNGSAMDPQNMMRARLLRRNTRPLNNI"
     gene            complement(<349219..>350385)
                     /locus_tag="CAGL0C03487g"
                     /db_xref="GeneID:2886724"
     mRNA            complement(<349219..>350385)
                     /locus_tag="CAGL0C03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445328.1"
                     /db_xref="GeneID:2886724"
     CDS             complement(349219..350385)
                     /locus_tag="CAGL0C03487g"
                     /inference="similar to AA sequence:UniProtKB:P53740"
                     /note="similar to uniprot|P53740 Saccharomyces cerevisiae
                     YNR048w or uniprot|P25656 Saccharomyces cerevisiae YCR094w
                     CDC50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445328.1"
                     /db_xref="GeneID:2886724"
                     /db_xref="GOA:Q6FWR6"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR6"
                     /translation="MVLWWRRIKKVSESKKTSRKPKNTAFRQQRLKAWQPILSPQSVL
                     PLLIMVACIFAPIGVGLLVSAFNVQKLEIDYTDCDQLVAGNDYTFIPHDKVKHQFKRK
                     LSVYPQWKLESGTDGDVCKLQFEVPHQMKKSIYMYYKMTRYHQNHRKMVEAFDKKQLK
                     GKAISGSKLDKKCDPLRTIGDKIVYPCGLTANALFNDTFSETLAGVKGSSDYEMTKNG
                     TAWGTDRHRYGKTEYDASEIVPPPNWAHMFPNGYTNDNIPNLGQWPEFQIWMRTAALP
                     SFYKLYMKNDDDNLPRGTYEISIGMNYLVRSFGGTKSILLTDNSIIGATNIALGIIYL
                     VVAVIATLFAVIFLLKVLIQPTNVKGHMYLDFDSIDQSSFYSRNSANTPLREIL"
     gene            complement(<350846..>353533)
                     /locus_tag="CAGL0C03509g"
                     /db_xref="GeneID:2886729"
     mRNA            complement(<350846..>353533)
                     /locus_tag="CAGL0C03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445329.1"
                     /db_xref="GeneID:2886729"
     CDS             complement(350846..353533)
                     /locus_tag="CAGL0C03509g"
                     /inference="similar to AA sequence:UniProtKB:P53739"
                     /note="similar to uniprot|P53739 Saccharomyces cerevisiae
                     YNR047w or uniprot|P25341 Saccharomyces cerevisiae YCR091w
                     KIN82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445329.1"
                     /db_xref="GeneID:2886729"
                     /db_xref="GOA:Q6FWR5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR5"
                     /translation="MEQQGVLAPPSINERNRSLSFSKLLSRSWRKNSTSAVASDNSTD
                     TENNAANPNMIALQKKILSSKTDSWSEAVDDEPVPSGGSQSRFTKLKNIFNNNNSNHN
                     TSNSTRSGSSCASTVSGKSSFEKLPKDISQVRSNSIPSPQKSPYSDKKGHNATSDVEI
                     GLVSPVSDKMNIDLPQVPTSVHASTLTGEHLKELHEYEIAKPKQEAYALNSGKNANRR
                     RSPSTPIKPSPSLVSSQSANGQFSSTNPFNTGTGYANYKERGTVQTTNSYFNYQGLPP
                     HARNENDSNLNAFQNGSKYAAVQEMLSLPTTPSSMNTSLTTHNKEGRNLSNVSLNEIK
                     ENEEVSEFYGMDEVPNLDSMGNKKMASSSPLRARSGSPKASNVMDSAQPFPSIVVGYD
                     DADAETDEQSANPSRGSHISSEQKGKPELNPPKNAKFPLRRAASETDAIDLNILKSVK
                     AASGDLSDTTDQHTKLEEIKEPRRSSRLRNKSFSNKFQDITVGPQSFEKIRLLGQGDV
                     GKVYLVKEKRTNRLYALKIFSKSEMIKRKKIKRILAEQEILATSNHPFVVTLYHSFQS
                     EDYLYLCMEYCMGGEFFRALQTRKSKCISEEDAKFYASEVTAALEYLHLLGFIYRDLK
                     PENILLHQSGHIMLSDFDLSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTE
                     EYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFPNN
                     NEVSRNCKDLIKKLLIKNESKRLGSKMGAADIKKHPFFKKVNWTLLRNQEPPLIPVLT
                     ENGYDFTKLSSNKNKNRANGTEKDSIDEQERIMFEERVEYDDEVSEDDPFHDFNSMSL
                     MKQDNNSLIYGDNNSYGKIAYTPNANRSRSNSHRAFFKR"
     gene            complement(<354137..>354541)
                     /locus_tag="CAGL0C03531g"
                     /db_xref="GeneID:2886876"
     mRNA            complement(<354137..>354541)
                     /locus_tag="CAGL0C03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445330.1"
                     /db_xref="GeneID:2886876"
     CDS             complement(354137..354541)
                     /locus_tag="CAGL0C03531g"
                     /note="highly similar to uniprot|P53738 Saccharomyces
                     cerevisiae YNR046w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445330.1"
                     /db_xref="GeneID:2886876"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR4"
                     /translation="MKFLTTNFLKCSVKGCDTSNDNFPLAYGECQLVQDESIEFNPEF
                     LINILDRVDWPAVVRVAHDLGNDALPMEKPEFQVNSEGEFDADQVAVLRDLHTLLLQT
                     SIVEGQMSCRNCGHIYYIKNSIPNLLLPPHLA"
     gene            complement(<354713..>356035)
                     /locus_tag="CAGL0C03553g"
                     /db_xref="GeneID:2886730"
     mRNA            complement(<354713..>356035)
                     /locus_tag="CAGL0C03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445331.1"
                     /db_xref="GeneID:2886730"
     CDS             complement(354713..356035)
                     /locus_tag="CAGL0C03553g"
                     /inference="similar to AA sequence:UniProtKB:P07390"
                     /note="similar to uniprot|P07390 Saccharomyces cerevisiae
                     YNR045w PET494 translational activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445331.1"
                     /db_xref="GeneID:2886730"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR3"
                     /translation="MKKYNICKFWTRFYSSPQFFNARVRAGGLLNESQPRGNLWSFFR
                     TPGNITFVTTNIVTFVGIVTYDTFVSANEERIFEERLAVARLSVEKSGREGIILEDTV
                     PMLPQRRPSGEEYMDKQAQDKELAKLDDQIEILRKELEERKKLDLQLRQMEANIKEEA
                     VDSPLQTYTASEVTLRDKGKVKNLVSQRVKMSLFQMVYSFYSYKSALLSQNKDIEPEM
                     DEFYHFWSEKYGQVNCDMEKVKEFKLPDWQKYPNLMKKFCYQLYDREIRRLSDFEHIY
                     YSADSRELKQLLRLWLYDNWYLLKPTLRSDEVLQRRDGRFFKDLVRDSRGDHALFSKY
                     MSIVTQDNPRSVLFFQQDKFNLPSISLATYVSLLETSERTHHNLTTVRLIQLLKTNCY
                     LDKNQHVRILLAPPDGLQTPQMAKSRRICYRYLSKDRRLTALLDTISK"
     gene            complement(<356203..>358209)
                     /locus_tag="CAGL0C03575g"
                     /db_xref="GeneID:2886731"
     mRNA            complement(<356203..>358209)
                     /locus_tag="CAGL0C03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445332.1"
                     /db_xref="GeneID:2886731"
     CDS             complement(356203..358209)
                     /locus_tag="CAGL0C03575g"
                     /note="some similarities with uniprot|P47179 Saccharomyces
                     cerevisiae YJR151c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445332.1"
                     /db_xref="GeneID:2886731"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR2"
                     /translation="MKAIALAYYLVAVMTLVAAQYTNSSAKLEAPTIQTENTILQALG
                     IELTSIVAGTERPFPSITSEGKPSLTESNTIDLPHIPIANSSQGEMSDSTSSTTTITL
                     TTTVTHPWRSSKVSETTILYTTSLAPEESLIIDTSVPDTHFNEEYDDIELIQLADENH
                     TIVTPTSTRIASSQPNIREAYITTVDITTKDLQGNLVPSRTSYLISYTTETRGNIVTV
                     YTTWCPIETTITPPLSLSVSASSTLVLSTVTTTTRGVITIYTTWCPYTDTKSITTSSK
                     TTTYSTSSPSSVLSTVTTTTNGKTTVYTTWCPPTSNLPTSSLPTTTKKITTVFTSKVC
                     LLCSTTTTTSQKSSTVSISSSIHTPTTSISSVTSSKSSSSKSSISSSSSSRPSTVTTT
                     IICSTCHRNSVSSSTISSSSTSIRPQISSSHTSSHSSSRSSSNSSAPTTTIRSTSTQT
                     ISICHSCLIPTTTTYFTLSTVTTTTQGIVTIYTTYCPITSTMITWNTSITTVPPAIEH
                     TQSTAHNSSYSSSIESRNIPSTALTPTLTTVVATTLTTTPAQSNEPPLSTIPSLTMSS
                     GTTSPYPSPASMPQPPTVATTPVILQPLSSAITTTIQPSSSLKAVEACATCSPIPSQD
                     STSYTTVTSRVTSYLPSHTMPHYTAAANTLTNSRLLLAVLLVLL"
     gene            complement(<358731..>360473)
                     /locus_tag="CAGL0C03597g"
                     /db_xref="GeneID:2886746"
     mRNA            complement(<358731..>360473)
                     /locus_tag="CAGL0C03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445333.1"
                     /db_xref="GeneID:2886746"
     CDS             complement(358731..360473)
                     /locus_tag="CAGL0C03597g"
                     /inference="similar to AA sequence:UniProtKB:P15891"
                     /note="similar to uniprot|P15891 Saccharomyces cerevisiae
                     YCR088w ABP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445333.1"
                     /db_xref="GeneID:2886746"
                     /db_xref="GOA:Q6FWR1"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR1"
                     /translation="MALEPVKYGAFGSEIESAWQGVVRGGEEWVVLSARGDGELEPRV
                     GDGFGAFLGEFGDQVAYGLARVTPPGSDVEKLLLVGWCPDTAPMKARASFAANFGTVA
                     NNVLKGYHVQVTARDEDDLDEQELLMKISNAAGARYSIQAQPSATPKAAPPKAAPKAA
                     PKATPKAAPKAIATPAKTSATPATPATPAASANAKNGGDDDDWSEPELKERDFDSEPL
                     KPNQSTFKPIGKVDLQKHIAEEAAKEDPRLVNKIDPASDIKHLKEQSKMQRDSEMNKF
                     IGGTKPPMGSTQFKDDDKVIKGFKNEKTPAQLWAEKKAKQQGNAPAEKPAAEVSKSNA
                     EDEDDEDDKQEDIKDIKSKFESLSTNSEPPIIQPRKIVQRTTEPEIEAPSMKKDPKKF
                     GNPLPGMHSEEPEPEADEDNDDDWDDDEEESKPAQRSLPPLPSRDQEKDASPAPILPS
                     RSVDKEDSPAPPSLPSRAKEEEQEQEEEEEEPEQEQEEEEEAPAPSLPTRETNAVPPP
                     PPRRATEEKKEEKPWATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGE
                     KGLFPSNYVSLGNQ"
     gene            <360681..>362612
                     /locus_tag="CAGL0C03608g"
                     /db_xref="GeneID:2886749"
     mRNA            <360681..>362612
                     /locus_tag="CAGL0C03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445334.1"
                     /db_xref="GeneID:2886749"
     CDS             360681..362612
                     /locus_tag="CAGL0C03608g"
                     /inference="similar to AA sequence:UniProtKB:P16649"
                     /note="similar to uniprot|P16649 Saccharomyces cerevisiae
                     YCR084c TUP1 general transcription repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445334.1"
                     /db_xref="GeneID:2886749"
                     /db_xref="GOA:Q6FWR0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FWR0"
                     /translation="MAKEKDVIGGHAAKLEELLGAVRREFEAVSQEVSSYQQQNQKNY
                     DFKINQQLAEMQQIRNTVYELELTHRKMKDVYEEEIGRLKAEIEKRDQQLSEFGAHSA
                     APPQPALPAPQITAEGTHLQDSKAGLTPLVSVLSSQNQAQAQAQAQAQAQAQAQAQAQ
                     AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAVHAAQVAQQTPAAQYQMTLPPMQQP
                     QQYQQGYQLNSMSPQQAKTEPVDKKPETQVATTTATAEKQETAYNQWANQAKPIPPFL
                     LDLDAENTSAEFKKQTEDYYVLYNPTQPKDIDIELHRTLLHDSVVCCVKFSNNGEYLA
                     TGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGA
                     EDKLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCS
                     LTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDS
                     VYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLS
                     VTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVF
                     ATGSGDCKAKIWKFQTIRK"
     gene            complement(<363172..>364362)
                     /locus_tag="CAGL0C03630g"
                     /db_xref="GeneID:2886751"
     mRNA            complement(<363172..>364362)
                     /locus_tag="CAGL0C03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445335.1"
                     /db_xref="GeneID:2886751"
     CDS             complement(363172..364362)
                     /locus_tag="CAGL0C03630g"
                     /inference="similar to AA sequence:UniProtKB:P32377"
                     /note="similar to uniprot|P32377 Saccharomyces cerevisiae
                     YNR043w MVD1 mevalonate pyrophosphate decarboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445335.1"
                     /db_xref="GeneID:2886751"
                     /db_xref="GOA:Q6FWQ9"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ9"
                     /translation="MTYVASTTAPVNIATLKYWGKRDAKLNLPTNSSISVTLAQEDLR
                     TLTSAATSSEFKEDKLWLNGKEESLSSERTQNCLADLRALRRQLEEKDSSLPPMSQWK
                     LHIVSENNFPTAAGLASSAAGFAALVMAIAKLYELPQSASDISKIARKGSGSACRSLF
                     GGYVAWEMGEKADGSDSKAVEVAPLEHWPNMKAAVLVVSADKKDTPSTSGMQLTVNTS
                     DLFKERITNVVPKRFEAMKKAILDKDFPTFAELTMKDSNSFHATCLDSFPPIFYINDT
                     SKKIIKLCHLINEFYGETIVAYTYDAGPNSVLYYLEENEEKLFAFIYTLFSKVDGWQS
                     KYNSEELSKFTSTFNNQVKGKFQFDLDDTIQENVSRVILTRVGPGPQDTKECLINEET
                     GLPK"
     gene            <364698..>365789
                     /locus_tag="CAGL0C03652g"
                     /db_xref="GeneID:2886755"
     mRNA            <364698..>365789
                     /locus_tag="CAGL0C03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445336.1"
                     /db_xref="GeneID:2886755"
     CDS             364698..365789
                     /locus_tag="CAGL0C03652g"
                     /inference="similar to AA sequence:UniProtKB:P32378"
                     /note="similar to uniprot|P32378 Saccharomyces cerevisiae
                     YNR041c COQ2 para-hydroxybenzoate--polyprenyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445336.1"
                     /db_xref="GeneID:2886755"
                     /db_xref="GOA:Q6FWQ8"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ8"
                     /translation="MSLLLNIGNQGVRNLMQRRLQLAVSSSISRNLRTTRLLNMGKPF
                     TEQELKQAREDRLKGLGPYVSKLPTKWIPYAELMRLEKPVGTWLLYLPGSWAIIMAAM
                     ETSASLGSTAWMLGLFGVGSLIMRGAGCTINDLLDRNLDNKVIRSVERPIAAGRVSPK
                     NAVLFLGAQTAVGMGILTQLPAQCWWLGLASLPIVFTYPLFKRFTYYPQAALSACFTW
                     GALLGYPAMGLTNWSAMIPLYVGSFLWCMTYDTIYAHQDKMFDIKAGIKSTALAWGDK
                     TKAICNTMSVAQFSLYALAGINSGLFWGPGFIGGLSLFAYRVFKMIRTVDLNNPKDCW
                     KHFISNINTGLYFSYALFFDYLLRLMGWL"
     gene            complement(<365996..>366862)
                     /locus_tag="CAGL0C03674g"
                     /db_xref="GeneID:2886769"
     mRNA            complement(<365996..>366862)
                     /locus_tag="CAGL0C03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445337.1"
                     /db_xref="GeneID:2886769"
     CDS             complement(365996..366862)
                     /locus_tag="CAGL0C03674g"
                     /note="weakly similar to uniprot|P53736 Saccharomyces
                     cerevisiae YNR040w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445337.1"
                     /db_xref="GeneID:2886769"
                     /db_xref="GOA:Q6FWQ7"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ7"
                     /translation="MAKVSFSKLIASLVSKGRPEVIYSYKTSPLVKYGSKGLSLVFFL
                     YGVSFTDFTVSSSTKILNSASEEQKSDAWFMFKTVGPIGLCVLPFALSAASLYVTSRV
                     VNKVIYIPKHNATPSCQLIRKSMFLGREIKLTRSLKYINRPKKPRVFTGKGIQGIDDN
                     GSFVFYLTDNHPDVRTRLQKFYLLPRSGHVWGSDGRIIDAMFGGESIKELDLLDFENS
                     DKEGNTSGDLSKQRNIELEKDSSILDELIRVNAEKVKFHSDDIKMSSSKIIDIVNSKN
                     THKNNHKITKSN"
     gene            complement(<367135..>369630)
                     /locus_tag="CAGL0C03696g"
                     /db_xref="GeneID:2886765"
     mRNA            complement(<367135..>369630)
                     /locus_tag="CAGL0C03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445338.1"
                     /db_xref="GeneID:2886765"
     CDS             complement(367135..369630)
                     /locus_tag="CAGL0C03696g"
                     /inference="similar to AA sequence:UniProtKB:P38966"
                     /note="similar to uniprot|P38966 Saccharomyces cerevisiae
                     YDR089w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445338.1"
                     /db_xref="GeneID:2886765"
                     /db_xref="GOA:Q6FWQ6"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ6"
                     /translation="MKFGSQILDKSVPDWKLNNIDYEELKKIIKQVTSKKTAPNSNDF
                     EGLEVSFKQNIVQINLFVSLKLKEISSKLVSIEHSITKLLDNEINDNRKVLRRIKTIK
                     NYLETCNDLLQKLSRFVIVQRIALRKLFKKITKHYGDKKIAQQFISSIQNCNELRDGY
                     EGVSFKNLDLQSYLVEVSLIMDILTDMTNAIKSTGNFKDLPSELFEKSKLITNATDNK
                     KPLVSFTTNQQFDQVLWDKGELIQSLLVRSDNNEQLKFLLITLGFQVFDQNLQGISRD
                     IIASEPNSEVRSLRSKKSFYESDRPALKRLHTSSTEYLNNAEEMEQSKCKAVMLTPSG
                     KVDSSIYDSKKITSYPSVLLEYEKNNVIANECIVICHVGGLRGKVVTDKLHINEISEY
                     LKNSNKQAISDPLAKIALDWICDHGMKECGIEIGFKRTRYFCNKHSNLYMITIDEEFT
                     LSDSNGQTEKLMDHSIIDLRVVTTNFSSDNKSLAKKSQEIYEKIISSKIQCFPFQPDF
                     HPVKLLLSIHENNGSKDVIHRLMLENIYELNENNKITEDEFFGIGFDLLLDICSSEFK
                     DNYYQKVESPTRTPNDWKKNNLLSKNKNTENNKPAIRYWNEFDDLEEENGGGGFYIQD
                     RTDDLESNELQQERDYGFIHFSKDFIESTYSSLQSFRDFLGFKDNNRTAIDPALLDLS
                     ERFGNSNYGSISSKGSILSNSVEDIRKLIEHQMKEIENSESVYVYKHDQVLSLMYLFA
                     LLMACATSGICMGIVLSVFNGDNSDIEIDVGKTLIITVILSLGISLGLITLCLLLLFS
                     RYTYAPIWHYALSFAIFIMIMSTVCYGLVEIFL"
     gene            370244..370315
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0C03718r"
                     /db_xref="GeneID:2886815"
     tRNA            370244..370315
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0C03718r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2886815"
     gene            complement(<370762..>372123)
                     /locus_tag="CAGL0C03740g"
                     /db_xref="GeneID:2886816"
     mRNA            complement(<370762..>372123)
                     /locus_tag="CAGL0C03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445339.1"
                     /db_xref="GeneID:2886816"
     CDS             complement(370762..372123)
                     /locus_tag="CAGL0C03740g"
                     /note="weakly similar to uniprot|P40002 Saccharomyces
                     cerevisiae YEL007w TOS9 or uniprot|P38867 Saccharomyces
                     cerevisiae YHR177w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445339.1"
                     /db_xref="GeneID:2886816"
                     /db_xref="GOA:Q6FWQ5"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ5"
                     /translation="MHIAPTFKGYLESEMDALIVLQGCLDGKLKFVNRRPSDIERPYL
                     IAPGNIFVFRETQSGIKRWTDGITWSPSRISGRFLIYKELNKRAPRLSMGMGADPSMM
                     SGAMPGRFDEKAILPVVYTGFVKKTFSFKMKIEKLDKETDSSVSGNEKNKKANNGTET
                     FHIVSYYFENDVKDKLMVRPTQTALNDEVTVDEEILKVVDSLPQNNGKSGHSNSPHTS
                     NISSPNVTNNSSALSSGMGSPITTNSSISHLKRKSRSEENGNGMPDGYDYSKRFKYEP
                     NALSQPLTTATTVATTPVYNHLQAPMIKRSPYFVDVGNNNVPSAGVLEKSYSDSNIIY
                     LPKPISSNQHENNQNRVLLLPCYESIIPPQMKKAPHPEQLYMPFNGHERVINMTQQYE
                     PLEKCYDSQYRNITDSVNLAIPKDVVTQGTDLCLPRFIPPLSVARGKGDQNSQLFMQS
                     QSS"
     gene            <374122..>374820
                     /locus_tag="CAGL0C03762g"
                     /db_xref="GeneID:2886820"
     mRNA            <374122..>374820
                     /locus_tag="CAGL0C03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445340.1"
                     /db_xref="GeneID:2886820"
     CDS             374122..374820
                     /locus_tag="CAGL0C03762g"
                     /inference="similar to AA sequence:UniProtKB:P40555"
                     /note="similar to uniprot|P40555 Saccharomyces cerevisiae
                     YIL007c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445340.1"
                     /db_xref="GeneID:2886820"
                     /db_xref="GOA:Q6FWQ4"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ4"
                     /translation="MSDINDVSRIAIDPLLQKQIDDYQQLPLPQLMQCKDSIEAEIEK
                     FLTVLANDLNSDMTSPLLTGDGFPRNDIDVYQVRYVRQKVNMLRNDLVKVMDQLHTAL
                     SSHFVSRSIDSKLNAMTMDGNDGRTPDQGNGNIDAAARAVPFARVTEVTPESPVSVAG
                     INVGDLLCTIGTIDATNHNSLKAIPGLIASCENSDVKITLKRGEAQQLHNVTLRPSRN
                     WPGQGLLGCRLQEI"
     gene            complement(<374953..>375249)
                     /locus_tag="CAGL0C03784g"
                     /db_xref="GeneID:2886829"
     mRNA            complement(<374953..>375249)
                     /locus_tag="CAGL0C03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445341.1"
                     /db_xref="GeneID:2886829"
     CDS             complement(374953..375249)
                     /locus_tag="CAGL0C03784g"
                     /note="highly similar to uniprot|P40554 Saccharomyces
                     cerevisiae YIL008w URM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445341.1"
                     /db_xref="GeneID:2886829"
                     /db_xref="GOA:Q6FWQ3"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015221"
                     /db_xref="InterPro:IPR016155"
                     /translation="MVKVRVEFLGGLDVIVNKQRVYDLDVPSQVENVGDLIDYIIENL
                     ITNKKDVEVFIENDSIRPGIITLINDTDWELENEKEYVIEDGDVISFTSTLHGG"
     gene            376932..377003
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0C03806r"
                     /db_xref="GeneID:2886936"
     tRNA            376932..377003
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0C03806r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2886936"
     gene            <377164..>377707
                     /locus_tag="CAGL0C03828g"
                     /db_xref="GeneID:2886937"
     mRNA            join(<377164..377430,377432..>377707)
                     /locus_tag="CAGL0C03828g"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_445342.1"
                     /db_xref="GeneID:2886937"
     CDS             join(377164..377430,377432..377707)
                     /locus_tag="CAGL0C03828g"
                     /inference="similar to AA sequence:UniProtKB:Q03096"
                     /artificial_location="low-quality sequence region"
                     /note="similar to uniprot|Q03096 Saccharomyces cerevisiae
                     YIL009ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445342.1"
                     /db_xref="GeneID:2886937"
                     /db_xref="GOA:Q6FWQ2"
                     /translation="MPPFIPKSRSNAVESVYLHGWVRDMLLESKTSQNIAVIPRVDPD
                     EASIPLLSRRIYANRRHFVKITKFFQVHNYSVYASVKDSQHQILSQFTPKCVSEFESR
                     NRSRITSDTVNTLFMIGDAKLGIMVVDELRHYFGEKIVSLFNGLDMPYIPYLIINQAF
                     ILDYDQVEAFKMTPFVYQYI"
     gene            complement(<377957..>378586)
                     /locus_tag="CAGL0C03850g"
                     /db_xref="GeneID:2886901"
     mRNA            complement(<377957..>378586)
                     /locus_tag="CAGL0C03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445343.1"
                     /db_xref="GeneID:2886901"
     CDS             complement(377957..378586)
                     /locus_tag="CAGL0C03850g"
                     /inference="similar to AA sequence:UniProtKB:P40553"
                     /note="similar to uniprot|P40553 Saccharomyces cerevisiae
                     YIL010w DOT5 involved in derepression of telomeric
                     silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445343.1"
                     /db_xref="GeneID:2886901"
                     /db_xref="GOA:Q6FWQ1"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ1"
                     /translation="MELRRSTRLSAKHGNEVKDEGPIKKKAKSVLKEKVNTKEPVKKP
                     NTKEEKVSSDEAILEVGDDIPDITLQNQDGKDVSLKALAKENKVIIIFLYPKASTPGC
                     TRQACGFRDNFDDLKEHGLVLGLSHDTPAAQLKFKEKYSLPYDLLCDPTREFIGMLGA
                     KKTPASGSIRSHFVFADGKLKFKRLKISPEISVADGKKEVLELAKQYSN"
     gene            complement(<379501..>380268)
                     /locus_tag="CAGL0C03872g"
                     /db_xref="GeneID:2886958"
     mRNA            complement(<379501..>380268)
                     /locus_tag="CAGL0C03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445344.1"
                     /db_xref="GeneID:2886958"
     CDS             complement(379501..380268)
                     /locus_tag="CAGL0C03872g"
                     /inference="similar to AA sequence:UniProtKB:P40552"
                     /note="similar to uniprot|P40552 Saccharomyces cerevisiae
                     YIL011w TIR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445344.1"
                     /db_xref="GeneID:2886958"
                     /db_xref="GOA:Q6FWQ0"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FWQ0"
                     /translation="MAYNKVALILSAAIAATKVAAISNNEISEFNVILSDVMGHLTDY
                     ISYAENDPNFTLPDHVLDLYMAMTTATDDSYTTMYDQINFSQVTDAMTRLPWYSSRIL
                     PNVSPFLEDNAASAAASSAASSASSSAASSVSSEASEASSSVSSASSASVSSSSAASS
                     SASSASSAASSEASSASSEASSRASSVSSAASSAASSISASASRAASSASSSASSASA
                     ARNGTSTSSHKNAAGKEYGSAAAGMGAMFVGAAALLL"
     gene            complement(<381514..>383397)
                     /locus_tag="CAGL0C03894g"
                     /db_xref="GeneID:2886734"
     mRNA            complement(<381514..>383397)
                     /locus_tag="CAGL0C03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445345.1"
                     /db_xref="GeneID:2886734"
     CDS             complement(381514..383397)
                     /locus_tag="CAGL0C03894g"
                     /note="weakly similar to uniprot|P40549 Saccharomyces
                     cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
                     cerevisiae YGL257c MNT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445345.1"
                     /db_xref="GeneID:2886734"
                     /db_xref="GOA:Q6FWP9"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP9"
                     /translation="MLSKLSMIQGRLPVSRRPIVLVLTLLGAIFLLTQFNKDDEIVLQ
                     PEQLGLGKYKGARKALPNSVYKKTATILKRNRGNDQNTKSQYEIDWEEGRISRVEMCR
                     TMIHEIYNIGINNKPHVLSSPMKNFASVAAMAESIRLYNFCFIDGNINSFELYGQENN
                     AGATVLLNDFFPFLKAHTDGEHMWPEVTHLNKDKIILPNFDLEAVDTFNANFWINWKK
                     HARGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIE
                     KKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFF
                     EKKGYRTTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFLYSPYFARED
                     DYTTASARAYYKLFNNWTLHQAESVLVVINKKQKLGGLLMSFMLNTQIALKQCFLGDK
                     EFFWIGQLMNNSPYYIDERPATIVGPLSSPTDEQSNYYKICSAQLGHLGEDGKLDWVN
                     GGMQVCKFKNAAMKDFTDDPEFFKSRHKDAAVLQNFYDSTVTLDGYMTADPPSCQWMN
                     IRECQKYMYCIICDKKPSLGTAAPGDMTPSVQFTDKYHAQVNDIARIWSEESTSDTNA
                     FGV"
     gene            complement(<383989..>385875)
                     /locus_tag="CAGL0C03916g"
                     /db_xref="GeneID:2886911"
     mRNA            complement(<383989..>385875)
                     /locus_tag="CAGL0C03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445346.1"
                     /db_xref="GeneID:2886911"
     CDS             complement(383989..385875)
                     /locus_tag="CAGL0C03916g"
                     /note="weakly similar to uniprot|P40549 Saccharomyces
                     cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
                     cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
                     cerevisiae YER001w MNN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445346.1"
                     /db_xref="GeneID:2886911"
                     /db_xref="GOA:Q6FWP8"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP8"
                     /translation="MSLLARYLLQRRVKRYSVLFVLFVGLFIFIARHLTNEEESDNGI
                     YKDDKFPYEDGLLHSSSNSAYTFITDAMNKLTKKKKNSFLSPKGLSYFKDDERILKNW
                     NTSSRVDKCKWLIRGIYADPNWNNRDILIGSDETNDKNKFHLSSERIRIHNYCFMKER
                     IDPVQMFNELNISSTDAYDFQGRMFMFLRNVTSTDEAYIYPIIKNVRNGQVTTKPHTK
                     LSPMQYNSNFMAYWKQESKGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGG
                     EMSPTMESLIKDYAIETNQNVFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVM
                     LIDADVVIYTEPESFFNLDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHR
                     LLGTVQKYRLTGPSLETHDEPEAETLFDFFHRRIVTIIDSGVVIYNKKQKLHGLILAE
                     YFHNSKQFAGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGYHPPREKYYVCSGQ
                     MGHVDRNNNLLWSNGGLKNCKSDCAEADFEKMPKYFKAKYGTLKAVKEYYNGLMDIQG
                     FVLPDVQKQKWVQYPDCQQFLYCAFITDPPEPDNKGKLVRFSDEEKMRYNEIGKAWYS
                     GAND"
     gene            complement(<386673..>388586)
                     /locus_tag="CAGL0C03938g"
                     /db_xref="GeneID:2886892"
     mRNA            complement(<386673..>388586)
                     /locus_tag="CAGL0C03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445347.1"
                     /db_xref="GeneID:2886892"
     CDS             complement(386673..388586)
                     /locus_tag="CAGL0C03938g"
                     /note="weakly similar to uniprot|P40549 Saccharomyces
                     cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
                     cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
                     cerevisiae YER001w MNN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445347.1"
                     /db_xref="GeneID:2886892"
                     /db_xref="GOA:Q6FWP7"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP7"
                     /translation="MPLKLRFISMILQLRRLVGAKVNTRHRLYLIPLVAVLLFFVNWP
                     RSTTPPVVSIYEGEYPFNEDLLHSSAESAFTVISDKINNLKDEYANRSLKQKLFSFFD
                     KDEKILKNWESSSLNDKCRWLVRGIYSSSAWNNFDITKNYKFETAYEKFQAVTERVRI
                     YNYCFMNGNIDPVEVFDELNIPFADPYDFQSRMFMFLKKVNRNDKAYMYPLIKNVRNG
                     DIIAKPRTKMSAKEYNANFMGHWKAEARGRGITLTVAPDDIKLLRSLFKVLEKLGNEY
                     PVEVVHKGGEMTPKMEDLIRQYAEETNQEVYVINLSPILDPDFASQNIKSFKNKWFAA
                     MFNTFEEAILLDVDVVLYASPEYFFELDGYKKTGLMLWKDREYTEVETSDRCASMAPY
                     FEPSEEEHELLGTIQKYRLTGPDLETHNESEATTLNDFFNNKLATIIDSGVVLINKKQ
                     KLNALLLAAYYHMSKYFGGCTYGDKELFEIAALAAGEDYYVDPNKAGAIGPIGYHPPR
                     EKYYVCSAQMGHPDENNNLLWSNGGLKNCKLDSAEADFKKLPKYFKAKYGSLDTVKLY
                     YKGRSEIQGFIVPDIVKQKWIQYPDCQHYLYCAFITDPPEDDNTGKLVRFSEEEMEKY
                     NEIGRAWYAGTIY"
     gene            complement(<389250..>391121)
                     /locus_tag="CAGL0C03960g"
                     /db_xref="GeneID:2886882"
     mRNA            complement(<389250..>391121)
                     /locus_tag="CAGL0C03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445348.1"
                     /db_xref="GeneID:2886882"
     CDS             complement(389250..391121)
                     /locus_tag="CAGL0C03960g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
                     YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
                     YER001w MNN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445348.1"
                     /db_xref="GeneID:2886882"
                     /db_xref="GOA:Q6FWP6"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP6"
                     /translation="MHLFHLQNNKRLRYSIIFLAFTSLLLLLYRSNSIEPLPKSIYVD
                     DQYPYAEGLLRSGHNSAFTLISNEMNKNQSRDKQSLSDGLTRFFDRDSKVLKNWDNSS
                     RKDKCKWLIRGIYTDSNWTNIDILEWTNDATDKNKFQVCSERVRIYNYCFMNGNIDPV
                     EVFDELNIPFADPYDFQSRMFMFLKKVNRNDKAYMYPLIKNVRNGDIIAKPRTKMSAK
                     EYNANFMGHWKAEARGRGITLTVAPDDIKLLRSLFKVLEKLGNEYPVEVVHKGGEMTP
                     KMEDLIRQYAEETNQEVYVINLSPILDPDFAEENIKRFSNKWLAAMFNTFEEVMLLDA
                     DVVLYNHPDHFFELKGYQDTGLMLWKDREITDTDVYDKCTAMAPFFEPSLEEHKLLGT
                     TQKYRLTGPSLEAHNESEATTLIDYFRKKRLNVIDSGVVIFNKKQKLHALVLSNYYHI
                     NRKFLGCVHGDKEFFEFGVLAAGEDYHIAPQRAAALGPIGFHPGRQKYYVCSTQMGHP
                     DENNNILWSNGGLKNCKLDKAEADFKRHPEYFKAKYGNVATAKVYYTYRVEIQGFIIP
                     DVKKQEWFQYPDCAHYWYCAFLEDTPDSLSTGKLVKFTEKEIERYNDIGKAWYHGTK"
     gene            complement(<391909..>393798)
                     /locus_tag="CAGL0C03982g"
                     /db_xref="GeneID:2886873"
     mRNA            complement(<391909..>393798)
                     /locus_tag="CAGL0C03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445349.1"
                     /db_xref="GeneID:2886873"
     CDS             complement(391909..393798)
                     /locus_tag="CAGL0C03982g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
                     YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
                     YNR059w MNT4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445349.1"
                     /db_xref="GeneID:2886873"
                     /db_xref="GOA:Q6FWP5"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP5"
                     /translation="MSLLARYLLQRRVKRYSILFVLFLGLFMFIARHTQRRNDTSISV
                     FAEEKFPYNEGLLHSEGNSAYTFMSQKLQRVSENWDKDPIYKRIFSSVDYDYKILMHW
                     NTSSRQDKCKWLISSLYSDPNWDNRDIFEYSKNGQYNNTFKVAAENLRIYNYCFLNGN
                     INPLQFFDDLSIPFTDAYDFQKRMVIFLRKTSSDDEAYLYPLIKNVRNGEIIAKPPTK
                     LSPREYNSNFMGHWKRESKGKGITLTIAPGDIKLLRSLFKVLQRQGNEYPVQIIQKGG
                     EMTPKMESLIKKYALETEQDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEAL
                     LLDADVVLYTEPEHFFKMKGYQDTGLLLWRDRELTALETPDRCAALAPHLEPSVEEYS
                     LLGTRQKYRLTESSLKIHNEPEARTLYEYFHKKIVTIIDSGVVVYNKRQKLHALMTAE
                     YFHISRKFAGCVYGDKEYFEFGAFAAGEDYHIEKDKASAIGSIEYHSAKDKYYICSAQ
                     MGHADENNNLLWSNGGLMNCKANSAADDFNENPKYFKAKYGDVKTLEAHYSKPIDIQG
                     FIIPDISKHNWIQYPECKRYVYCAFVADPPVDSNTGKLVRFSRKNRQIYKDIASVWFE
                     GTSYS"
     gene            complement(<394614..>396512)
                     /locus_tag="CAGL0C04004g"
                     /db_xref="GeneID:2886835"
     mRNA            complement(<394614..>396512)
                     /locus_tag="CAGL0C04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445350.1"
                     /db_xref="GeneID:2886835"
     CDS             complement(394614..396512)
                     /locus_tag="CAGL0C04004g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
                     YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
                     YER001w MNN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445350.1"
                     /db_xref="GeneID:2886835"
                     /db_xref="GOA:Q6FWP4"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP4"
                     /translation="MQPIMKFRLRRQSRKYVLIFLAACTLIFILYPTKQTFQEQHSTS
                     DSRKKSTSSDYSLKLKQVFDKSPFSDLSKRIEIAEEEANSFSLLKLIPFLGNGKDARE
                     RKVLAHWAQANRKDQCPQLIKGLYATPDWSNNEIVAAHKKVRVDEINMQVSVERIRIY
                     NYCFLEGGLDVTEVLKDAGLSSYDAFDFQSRMFIFLKQVTKTDAKYLYPIIQNLNTEE
                     IISEPTTTKSPQDFNANFMANWRQLANGKGIAITVNPDDVEFMIRLFRVLKELGNTYP
                     IQVIQKGGELTSPLIEQIKKTAIETNQAVSIVDLSPILDEKFAREQITSFHNKFFAAM
                     FNTFEEVLLLDADVVPYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLE
                     PSLEEHNLLGTELKFRINSLAKKKVRSSEERAFHRFFNELKVHNIDSGIIVLNKKQKL
                     HSLIMGEIFYTNGRFGRCAYGDKEMFMMGAFATGADFIIDPRDAGIIGPIGYNIDQRV
                     NFICSAQMGHLDENNRVLWSNGGLRFCKFPDFAKKDYTPKNQDYFIQKYQSYDNMARI
                     YKTKVEITGFIIPEVEKNEWMQIPDCQSYMYCGLAKKVDTKALILKFEGEEKERLNRI
                     SDVWNNPI"
     gene            complement(<397303..>399213)
                     /locus_tag="CAGL0C04026g"
                     /db_xref="GeneID:2886860"
     mRNA            complement(<397303..>399213)
                     /locus_tag="CAGL0C04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445351.1"
                     /db_xref="GeneID:2886860"
     CDS             complement(397303..399213)
                     /locus_tag="CAGL0C04026g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445351.1"
                     /db_xref="GeneID:2886860"
                     /db_xref="GOA:Q6FWP3"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FWP3"
                     /translation="MEKLYMKKSLLVYRTKKVLRQHCVTISLCVSLLFIIFTVFGGSS
                     VDDRQGYDLLNLSLEQGSTFASKYSVFKYVSSRIYENEKKPGRLMFLKKLFPFGNNGR
                     DLHERSVLSNWDKASKADQCALLLQGFYLDPKWDNADILTEREEKEDYRNMQLAIERM
                     RTYKYCFMDEDIDILDTFKAAGFSPNEAYVFQKKLFMFLKQTDGSTTEYLYPRIENLR
                     TGVITEEPTTDLSVSEYNAKFIPTWRNMAKGKGIAVSVSPKEIRMLHSLFAVLNQQGN
                     KLPIQIIDKGETLTLADKELIKSYAVKTNQDVSVVDLSPIIDAEYADENIIGMHNKWF
                     AAMFNTFEEVLLLDVDVIPFVGTEKFFQLEPYTSRHILFWRNRDIKKKNPKYCPEAAI
                     FLEPTTEEHQVLKTDLHHKLFTKQVRNPATSEDKALSEFCFQRKSNHVDPGLIVFNKK
                     LRFQTFAITELLHQHDTFRACVGTGADALILGAFAAGETFRLDPRDAGIVGSISYSEA
                     DKMNFVCGTQIAHNDDKDNLLWISGGGRTCKNPDLLVEDFAADEEYYEVRYGNYGNAE
                     TIYKSKIRIDGYLAPKVSQKEWVVIPDCGNTMRCAFVDSNVKDFSGRSIKYNDETKSR
                     VTNLIDIWYNAE"
     gene            complement(<399734..>401596)
                     /locus_tag="CAGL0C04048g"
                     /db_xref="GeneID:2886935"
     mRNA            complement(<399734..>401596)
                     /locus_tag="CAGL0C04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445352.1"
                     /db_xref="GeneID:2886935"
     CDS             complement(399734..401596)
                     /locus_tag="CAGL0C04048g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
                     YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
                     YER001w MNN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445352.1"
                     /db_xref="GeneID:2886935"
                     /db_xref="GOA:F2Z665"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:F2Z665"
                     /translation="MNRRTKSLLRRYILAIIVILSLTFVFYSNTLTTVVSTVNVADTQ
                     DYTSGLKHASPVSPFSYVNNYLLNSEKTRSSTVKKLLPFLNKPKDGLVDWNSSSKYQK
                     CLLLVKSMYKAHPHWSNRDIMTAYDNESVEDLNLQLAGERIKIYKQCFLDNDIEPIEF
                     FKRLSIPDVDAYDFQKRMFYFFRDITASNTDYFHPAIKNVKSGEVVSKPKTKLTPQEY
                     NANIIGNWRKLSRGKGIVLTVSQSDVPLLRQQFRVWKELGNKLPIQVVHKGTEINAEL
                     EQKIKEYAIEMEQDVYVVDLSPVIDPDFAENSIQNFHNKWYAAIFNTFEELILIDADA
                     IPYVPAEDFLKSKSYKKTGLRLWRDRDITHERTLHFCVEMAPYFEPTLEEHNLIGTTL
                     SYRLTDSGLKDAKDSEGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIMSEILHSHT
                     RFGRCTYGDKELFMLGAYMVGESYTLEAQSAAIIGTVGYEKEFSRHYICATQMGHSDE
                     DNRLLWSNGGLRTCKFDCAEEDFNKDEEYYKKRYQNVDNLKAVYSSRLNIDGFIIPDT
                     TVNKWLQLSECRQYMYCAHVDDNREKDKGTLVRLTDEEKQKVNRISEFWNSAKI"
     gene            complement(402124..402196)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0C04070r"
                     /db_xref="GeneID:2886848"
     tRNA            complement(402124..402196)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0C04070r"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:2886848"
     gene            complement(<403729..>404382)
                     /locus_tag="CAGL0C04092g"
                     /db_xref="GeneID:2886909"
     mRNA            complement(<403729..>404382)
                     /locus_tag="CAGL0C04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445353.1"
                     /db_xref="GeneID:2886909"
     CDS             complement(403729..404382)
                     /locus_tag="CAGL0C04092g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445353.1"
                     /db_xref="GeneID:2886909"
                     /db_xref="GOA:P50857"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /translation="MSFDSLLDKNDKLVKVCGIQTVEAAETALQAGADLIGIICVPNR
                     KRTIESAVAREISKLIHKSGTTKLVGVFRNQSVEDVHRLSEEYDLDIIQLHGDESWPE
                     YYNVIKKPIIKRVIFPRDVDVVTQVCQRKPLVCLPLFDSEAGGTGEKLDWSSISSWAS
                     EQNNVFYILAGGLTAENVMEAVGLPGVIGVDVSGGVETDGVKDNDKIIKYVQNAKKQ"
     gene            complement(<404740..>405150)
                     /locus_tag="CAGL0C04114g"
                     /db_xref="GeneID:2886846"
     mRNA            complement(<404740..>405150)
                     /locus_tag="CAGL0C04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445354.1"
                     /db_xref="GeneID:2886846"
     CDS             complement(404740..405150)
                     /locus_tag="CAGL0C04114g"
                     /note="highly similar to uniprot|P02303 Saccharomyces
                     cerevisiae YNL031c HHT2 and highly similar to
                     uniprot|P02303 Saccharomyces cerevisiae YBR010w HHT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445354.1"
                     /db_xref="GeneID:2886846"
                     /db_xref="GOA:P61833"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <406014..>406325
                     /locus_tag="CAGL0C04136g"
                     /db_xref="GeneID:2886845"
     mRNA            <406014..>406325
                     /locus_tag="CAGL0C04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445355.1"
                     /db_xref="GeneID:2886845"
     CDS             406014..406325
                     /locus_tag="CAGL0C04136g"
                     /note="highly similar to uniprot|P02309 Saccharomyces
                     cerevisiae YNL030w HHF2 and highly similar to
                     uniprot|P02309 Saccharomyces cerevisiae YBR009c HHF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445355.1"
                     /db_xref="GeneID:2886845"
                     /db_xref="GOA:Q8NIG3"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <407265..>409343
                     /locus_tag="CAGL0C04169g"
                     /db_xref="GeneID:2886837"
     mRNA            <407265..>409343
                     /locus_tag="CAGL0C04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445357.1"
                     /db_xref="GeneID:2886837"
     CDS             407265..409343
                     /locus_tag="CAGL0C04169g"
                     /inference="similar to AA sequence:UniProtKB:P38213"
                     /note="similar to uniprot|P38213 Saccharomyces cerevisiae
                     YBR007c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445357.1"
                     /db_xref="GeneID:2886837"
                     /db_xref="GOA:F2Z663"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:F2Z663"
                     /translation="MPLLSGKPSPLERVGGDYFKESFRLSNHSALSLESTQTAERLLD
                     RLELSDGDEQLIKQAMEADDKVRVENTQSGPVVCLPANAFPSLRSSRIHQRHGSESTM
                     RDTLGLEKASMSASVGEPLRGNTCATAVERHIPEHYRYSYIVEEDTDIESLLSMSTTE
                     NTSTEQQKNRHHFHNLMAKTNDTKYHFPRKETALRTESNNVRSNAREKEKNALNFERY
                     RIDNSTLMTDFPHLANKQRKLHYYHELLAKPQNGVRNDKDRQKSNDSQQSIEGKHQDS
                     SNLYKPKTSSSGESMLSDRRDKYPPTPKKSSSNSTLDLSMDTELSQPPTPSYKDHQKK
                     SSLSSLKSFFKSPKSYKSKNRSEDKLDATSTNPKSKKFSHMSSNDSLTKSFKIYPSSR
                     PSKKEEYTYPNKTQKDYISTPIRKPSHNRSYSDYSTIKSLQKGMTDADNSLKTLRLQN
                     LLGKPPMRQLTHRRAKSDDFLSITSHSDSTVNENLHTYASSYAQYDRLTSSHNLDQAS
                     ALINEALSLRSQEKYYEASKKLQQACIEGSKTAYLLYGIALRKGEGVKCNYTESLRYL
                     NRATGIHNCNEFVMRCNIDPLTLEKSGSIPIIPPQPLAPALYECGLSYLKGYGVPSAN
                     SPLGLKYLEYAGSLGHVDAMCLSGIILSKNKDKSPEDVIRAASWFRIAEKRGANLIGS
                     EWIHKQDYQM"
     gene            complement(<409544..>411019)
                     /locus_tag="CAGL0C04191g"
                     /db_xref="GeneID:2886813"
     mRNA            complement(<409544..>411019)
                     /locus_tag="CAGL0C04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445358.1"
                     /db_xref="GeneID:2886813"
     CDS             complement(409544..411019)
                     /locus_tag="CAGL0C04191g"
                     /note="highly similar to uniprot|P38067 Saccharomyces
                     cerevisiae YBR006w UGA2 succinate semialdehyde
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445358.1"
                     /db_xref="GeneID:2886813"
                     /db_xref="GOA:F2Z679"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:F2Z679"
                     /translation="MKPELKNPDLIKGLGYINGEWVKDSNEFFEVDDPSTGEIIAKLP
                     EHDIAVVDRAVDAAYDAFQKYKNTLPRQRATWLRNLFNLMTENAEDLAKIITWENGKS
                     LPDSRAEIKYAASYYEWYAEEAPRIYGATIQPSIPNNRVITKRQPVGVCGIICPWNFP
                     SAMITRKVGAALAAGCTVVVKPDSHTPLSALAMTVLVEKAGFPKGVFNVVLSQHNTPK
                     LGKRLCEHPKVKKVTFTGSTRIGKTLMEQASSTLKKCSFELGGNAPFIVFDDADLDLA
                     VDQAIASKFRGMGQTCVCTNRFYVQDTIADEFAEKLVTKVKQFKIGDGMKEGVTHGCL
                     TNAKQADKVDEHKKDAIEKGAKVLLEGGRMPDLGKNFYAPVVLKNVPQSAMVAKEETF
                     GPLCPIFTFKTVEEVLGYANDTELGLASYVFTKNVNTLFTVSEALEAGMVSCNTGLFS
                     DSSVPFGGVKESGFGREGSLYGIDDYTTVKSIIIGNLPDSL"
     gene            complement(<411409..>412104)
                     /locus_tag="CAGL0C04213g"
                     /db_xref="GeneID:2886792"
     mRNA            complement(<411409..>412104)
                     /locus_tag="CAGL0C04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445359.1"
                     /db_xref="GeneID:2886792"
     CDS             complement(411409..412104)
                     /locus_tag="CAGL0C04213g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445359.1"
                     /db_xref="GeneID:2886792"
                     /db_xref="GOA:F2Z6J1"
                     /db_xref="UniProtKB/TrEMBL:F2Z6J1"
                     /translation="MLIKRGHQQLCDALFGAESKGLGGNSSDMSNITLAEENIIVAQE
                     PEKLIISNSGLMFLNASTDCYQLGTCEDRKYPKQNIELSKPITWVKISGTFAGILLLG
                     FIIALAIKLNMERQRIKHFRGSGDISIITRDDPESLPLRERYRESMENQPVPQYTRTA
                     GENSNDLGYYDSNGMFHFKQGRQNRPDDSIPGILRRNIAIPNYGPLNDNEVEVYLHAP
                     PPTYQPTYQLSSV"
     gene            <412698..>413999
                     /locus_tag="CAGL0C04235g"
                     /db_xref="GeneID:2886825"
     mRNA            <412698..>413999
                     /locus_tag="CAGL0C04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445360.1"
                     /db_xref="GeneID:2886825"
     CDS             412698..413999
                     /locus_tag="CAGL0C04235g"
                     /inference="similar to AA sequence:UniProtKB:P38211"
                     /note="similar to uniprot|P38211 Saccharomyces cerevisiae
                     YBR004c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445360.1"
                     /db_xref="GeneID:2886825"
                     /db_xref="GOA:Q6FWN4"
                     /db_xref="InterPro:IPR007315"
                     /translation="MHSLVKPVLFFVVVRIVQYAIISLSPNKQFDLSTNLLLAKYCSE
                     QETQQFWHRHLFNKLLSWDSVFFIKTAMTMDGYPEYEHEWAFSVIWSSLIRSVSPSNN
                     FYTVLKTAVILENLIYFMAMITLFYLTRITFGKLDKSKTHLSDKLATFTAILFSCNSG
                     SGFFTGPYSEPLSFLFSFLGILAREFSVTPIIPYGLEFKSSKIFYYTIVSSFCFTIAT
                     LNRSNCILLGFYYVFDSIYLIRRQKYKKALLFPVLAGCIVALFFVRQQFYIPYKNFCE
                     LRGEWCNESLINFKPLHFLTRKSLYSYIQSEHWNLGLFNYWTPNNIPNFLFGLPTFVI
                     LFSSTFYFSRVYPNYKLKPLIFITRAFTIIILLFAHVQIINRISTFIPLHLWYISDRF
                     VKFEANKKMTGDDWIVKGYIYWLIFWVPIQTSLFVFFLPPA"
     gene            complement(<414187..>415602)
                     /locus_tag="CAGL0C04257g"
                     /db_xref="GeneID:2886824"
     mRNA            complement(<414187..>415602)
                     /locus_tag="CAGL0C04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445361.1"
                     /db_xref="GeneID:2886824"
     CDS             complement(414187..415602)
                     /locus_tag="CAGL0C04257g"
                     /note="highly similar to uniprot|P18900 Saccharomyces
                     cerevisiae YBR003w COQ1 hexaprenyl pyrophosphate
                     synthetase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445361.1"
                     /db_xref="GeneID:2886824"
                     /db_xref="GOA:Q6FWN3"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:Q6FWN3"
                     /translation="MFASTTRCVTLKCRTVRYKSSFAVALETASKLVSPRLLWNNPIS
                     LVSNEMNTLAKNIMALIGSGHPTLNRVTSYYFETEGKKVRPLLVLLLSRALSEIPLKE
                     RDNIPIDTTDVPEDPMYSKLSSNSSLFDVPVKSISPLHILHGIKPLNPLTKGPEPITQ
                     PEFDQERGILPKQRRLAEIVEMIHTASLLHDDVIDYSDTRRGRPSGNVAFSNKMAVLA
                     GDFLLGRATVAISRLKNPEVVELMSNSIANLVEGEFMQLKNMAVEDQPLVGSKNDKIL
                     PPPSKKLELKEHDYRVATPEATGSFSHEEVINIAFEYYLHKTYLKTAALISKSSRAAA
                     ILSGARDPVIEECYSFGRNIGICFQLVDDLLDFSVSAKDLGKPAGADLKLGIATAPVL
                     FAWKEDPSLGPLIKRNFSEPGDVEKTVKSVQDHDGVGKTMEFAKEYRNKALQNLKNAL
                     PESDCRSALEFLTNSIVTRKK"
     gene            <416100..>416924
                     /locus_tag="CAGL0C04279g"
                     /db_xref="GeneID:2886821"
     mRNA            <416100..>416924
                     /locus_tag="CAGL0C04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445362.1"
                     /db_xref="GeneID:2886821"
     CDS             416100..416924
                     /locus_tag="CAGL0C04279g"
                     /inference="similar to AA sequence:UniProtKB:P35196"
                     /note="similar to uniprot|P35196 Saccharomyces cerevisiae
                     YBR002c RER2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445362.1"
                     /db_xref="GeneID:2886821"
                     /db_xref="GOA:Q6FWN2"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:Q6FWN2"
                     /translation="MAEDGYNYMAVLAKNLISRTLSVSNCVPRHIGFIMDGNRRYAKK
                     KQMESKEGHEAGFRSMSKILELCYEAGVDTATVFAFSIENFKRSAYEVDAIMSLARER
                     IRQIREHGELAQKYGVRIRVIGDISLLDKDLLKEIKNTMELTRNNTRATLNICMPYTG
                     REEIYHSMKTVLDDDSYSSKNISEEIIDEHLYTAGQPPLDLLIRTSGVTRLSDFMLWQ
                     TCSNDVMIEFIDCLWPEFGPFRMAWILLKFAFHKNFSSGRKPSEDDEFENKNKKAD"
     gene            complement(<417270..>417857)
                     /locus_tag="CAGL0C04301g"
                     /db_xref="GeneID:2886819"
     mRNA            complement(<417270..>417857)
                     /locus_tag="CAGL0C04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445363.1"
                     /db_xref="GeneID:2886819"
     CDS             complement(417270..417857)
                     /locus_tag="CAGL0C04301g"
                     /note="highly similar to uniprot|P41920 Saccharomyces
                     cerevisiae YDR002w YRB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445363.1"
                     /db_xref="GeneID:2886819"
                     /db_xref="GOA:Q6FWN1"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FWN1"
                     /translation="MSDKSATEQKPPSSSVFSMFGGKKAEEPKKEEAVEKKEEEEKKE
                     EKKDDEEEPESPEVHFEPIVHLEKVDVKTNEENEDVLFKVRAKLFRFDADAKEWKERG
                     TGDCKFLQNKETKKVRLLMRRDKTLKVCANHLIAPEYVLKPNVGSDRSWVYACTADIA
                     EGEAEAFTFAIRFGNKENADKFKEEFEKAQEINKK"
     gene            <419263..>421515
                     /locus_tag="CAGL0C04323g"
                     /db_xref="GeneID:2886818"
     mRNA            <419263..>421515
                     /locus_tag="CAGL0C04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445364.1"
                     /db_xref="GeneID:2886818"
     CDS             419263..421515
                     /locus_tag="CAGL0C04323g"
                     /inference="similar to AA sequence:UniProtKB:P32356"
                     /note="similar to uniprot|P32356 Saccharomyces cerevisiae
                     YDR001c NTH1 neutral trehalase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445364.1"
                     /db_xref="GeneID:2886818"
                     /db_xref="GOA:Q6FWN0"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:Q6FWN0"
                     /translation="MPTLTFYLGADDAVDGGVKSKSMAFSDPFHKNVKVQSPEPEPVD
                     AKEKKKLNRTRTMSVFYNVADFKDDEEIRKHKLKRRASEDDTYISSKGTRRLFVKDVD
                     WTLKELLQNEDTDQNFQITVEDTGPKVIKLGTANSAGYNHIDIRGTYMLSNLLQELTI
                     AHNFGQRQLYLPESRLNENPVHRLKRVIETHFWDGLTRRLDLNTIGEAAQEKKIDTPE
                     AKNPRVYVPYDCPEMYEYFIQASQMNPSVKLEVEYLPKDITPEYVQSLNETPGLLAIA
                     MDKHVNPTTGETSLVGFPYVFPGGRFNELYGWDSYLITLGLLASKRTDLARGMVEHFI
                     FEIEHYGKILNANRTYYLCRSQPPFLTDMANVTFNGMGGNKNPIAVDLLRRAFRAAIK
                     EYKTVWMAKPRLDEKTGLSCYHPDGVGIPPETEPEHFDTKLRPYAKKYNVTIPEFRRM
                     YNAKEVHEPELDEFFLHDRGVRESGHDTTYRLEGVCAYLATIDLNSLLYKYEVDIANF
                     IKEFCNDKYVDPYDKSVTTSEDWMNLANKRKERIKFYMWDEEAGFFFDYNVKTEKRTS
                     YESATTFWAMWAGVASPQEAEIMVKKAVPKLETLGGIVACTESSRGPIAIDRPYRQWD
                     YPFGWAPHQILAWKGFSNYGYDNIARRLVYRWLYMMTKAFVDYNGIVVEKYDVTKVTD
                     PHKITAEYGNQGVDFKGYAREGFGWVNSSFLLGLQYLDNHAIRALGACIPPKPFLNGL
                     RAKEKARYGL"
     misc_feature    422097..422206
                     /note="Centromere Cen0C"
     gene            <423677..>423997
                     /locus_tag="CAGL0C04367g"
                     /db_xref="GeneID:2886762"
     mRNA            <423677..>423997
                     /locus_tag="CAGL0C04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445365.1"
                     /db_xref="GeneID:2886762"
     CDS             423677..423997
                     /locus_tag="CAGL0C04367g"
                     /note="highly similar to uniprot|P35195 Saccharomyces
                     cerevisiae YBL001c ECM15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445365.1"
                     /db_xref="GeneID:2886762"
                     /db_xref="GOA:Q6FWM9"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM9"
                     /translation="MPKVFCLADVCMVPIGTGSASISDFVAAIESKIRESHLKSTLHS
                     AGTTIEGPWDEVMGLIGEIHEYAHELGYVRLQTTMRVGTRTDKHQTAQDKVDVVLKKM
                     GNDN"
     gene            complement(<424507..>424896)
                     /locus_tag="CAGL0C04389g"
                     /db_xref="GeneID:2886743"
     mRNA            complement(<424507..>424896)
                     /locus_tag="CAGL0C04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445366.1"
                     /db_xref="GeneID:2886743"
     CDS             complement(424507..424896)
                     /locus_tag="CAGL0C04389g"
                     /note="highly similar to uniprot|P02293 Saccharomyces
                     cerevisiae YDR224c HTB1 or uniprot|P02294 Saccharomyces
                     cerevisiae YBL002w HTB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445366.1"
                     /db_xref="GeneID:2886743"
                     /db_xref="GOA:Q6FWM8"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSAEKKPASKAPAEKKPAAKKTAPSADGKKRTKARKETYSSYIY
                     KVLKQTHPDTGISQKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAVRL
                     ILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <426015..>426410
                     /locus_tag="CAGL0C04411g"
                     /db_xref="GeneID:2886776"
     mRNA            <426015..>426410
                     /locus_tag="CAGL0C04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445367.1"
                     /db_xref="GeneID:2886776"
     CDS             426015..426410
                     /locus_tag="CAGL0C04411g"
                     /note="highly similar to uniprot|P04911 Saccharomyces
                     cerevisiae YDR225w HTA1 or uniprot|P04912 Saccharomyces
                     cerevisiae YBL003c HTA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445367.1"
                     /db_xref="GeneID:2886776"
                     /db_xref="GOA:Q6FWM7"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSGGKGGKAGSAAKASQTRSAKAGLTFPVGRVHRLLRRGNYAQR
                     IGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPSASQEL"
     gene            complement(<426906..>428657)
                     /locus_tag="CAGL0C04433g"
                     /db_xref="GeneID:2886772"
     mRNA            complement(<426906..>428657)
                     /locus_tag="CAGL0C04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445368.1"
                     /db_xref="GeneID:2886772"
     CDS             complement(426906..428657)
                     /locus_tag="CAGL0C04433g"
                     /inference="similar to AA sequence:UniProtKB:Q12158"
                     /note="similar to uniprot|Q12158 Saccharomyces cerevisiae
                     YDL003w RHC21 Mitotic Chromosome Determinant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445368.1"
                     /db_xref="GeneID:2886772"
                     /db_xref="GOA:Q6FWM6"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM6"
                     /translation="MEQRQNLNAVLGLSTKNGPLAQIWLASNMGNLTRNTVLQTNIAD
                     TAEEVAKVTGCAEDGSQYPVEHITLRTSGELLHGIVRVYSKQAAFLLTDIKDTLTKIS
                     SLFRTNQRLGATISKYSTITRLEFLVLDDTVTERDVLSVPSLDFLNETSSLRNHSIMN
                     DSMDRRMTGAKSYDLSIEVGRRFAGDEELQYNEDSTLNLDFDLGHPNDSKAPLSSSKS
                     WDEGTRQSGDVTAQSNYINMEDDEFLAEGEPEELHLDLGLDTADADRSIELGRRAEPV
                     EDAHETTDFGFDLDIGKDPINMEEDNESAEELELEGLQADNEPLRKAASSKNPSLVNT
                     HPLQTDRETELSDEVIKSNPDRNLVETGNLQTRSNEEKLTAKRLWSEMAQSMAYLPHS
                     IFNDFMKLQPSKKQRTEDDNQGDVTPEMDISLGMNDDLISDNDAEVPMDHEINEPDLE
                     IAGNIGELPEQTSTQNAEGTLDVMQTQTSSSYSSVSSVESVTQKLASIATATTAKILK
                     ETVTDGQSDFSTLLQEYHKHEEGDQEPVTRKDASAVFFSMLSLASADCVDLQQEEAYG
                     EINIITKDNLFQDGITA"
     gene            complement(<429564..>430028)
                     /locus_tag="CAGL0C04455g"
                     /db_xref="GeneID:2886917"
     mRNA            complement(<429564..>430028)
                     /locus_tag="CAGL0C04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445369.1"
                     /db_xref="GeneID:2886917"
     CDS             complement(429564..430028)
                     /locus_tag="CAGL0C04455g"
                     /inference="similar to AA sequence:UniProtKB:Q12165"
                     /note="similar to uniprot|Q12165 Saccharomyces cerevisiae
                     YDL004w ATP16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445369.1"
                     /db_xref="GeneID:2886917"
                     /db_xref="GOA:Q6FWM5"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM5"
                     /translation="MFRLVTRSVIARRCYADAAKSAASGLKLRFALPHETLFNGEEVV
                     QVNLPAKSGSIGILANHVPTVEQLTPGVVEVVKANETKKYFVSGGFAAVQPDSTLCVT
                     AVEAFPLDSFSQDSVRSLLAEAEKNSKSQDEKTAGVASIQLEVLEKLQAALK"
     gene            <430892..>431998
                     /locus_tag="CAGL0C04477g"
                     /db_xref="GeneID:2886897"
     mRNA            <430892..>431998
                     /locus_tag="CAGL0C04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445370.1"
                     /db_xref="GeneID:2886897"
     CDS             430892..431998
                     /locus_tag="CAGL0C04477g"
                     /inference="similar to AA sequence:UniProtKB:Q12124"
                     /note="similar to uniprot|Q12124 Saccharomyces cerevisiae
                     YDL005c MED2 transcriptional regulation mediator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445370.1"
                     /db_xref="GeneID:2886897"
                     /db_xref="GOA:Q6FWM4"
                     /db_xref="InterPro:IPR021017"
                     /translation="MSYKNRLTACFDDILKVSAEMMMQQQLKNVQLDPYMVNGFSAQQ
                     QNTLKEKIHMFHGILDDLENMLSKSTYYVDTLANLGKESKRQKELELEKQREQEEEEK
                     KQKLLELERKKKEQEEEEEKKKKQKEEEEKRKKELEEQERKKKEQEEEEKRRRQQEQD
                     GDKQQSMFDGLDFTNADLDTSQPGTSGQNDIKSPTMGAGPQTAGTDKPNTADGPDKTN
                     PPIAAFGLGDSQSGGLYNDLNTMDLSMFSELDGGGFDASGFDTANTSNANATTNSVPN
                     NNNPATNDSNMNNDPTAAINAFDGTAAGNNETLGQGEKLEFDQSNPSAMLGNDINMGD
                     NGEDYLTLNDFNDLNIDWSAAGEGGDLDLNGFNI"
     gene            complement(<432406..>433236)
                     /locus_tag="CAGL0C04499g"
                     /db_xref="GeneID:2886736"
     mRNA            complement(<432406..>433236)
                     /locus_tag="CAGL0C04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445371.1"
                     /db_xref="GeneID:2886736"
     CDS             complement(432406..433236)
                     /locus_tag="CAGL0C04499g"
                     /note="highly similar to uniprot|P35182 Saccharomyces
                     cerevisiae YDL006w PTC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445371.1"
                     /db_xref="GeneID:2886736"
                     /db_xref="GOA:Q6FWM3"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM3"
                     /translation="MEEAAADAYKLSYKVGVAENKNAKFRRTMEDVHTYVKNFASRLD
                     WGYFAIFDGHAGIQASKWCGSNLHTIIENKLMADETKDVRDVLNESFVMIDKQINKDL
                     QGNSGCTAAVCVLRWELPDGCTEQEEMDLTKHKRKLYTANVGDSRIVLFRNGQSIRLT
                     YDHKASDPLEMQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITP
                     ADQFLIIACDGLWDVIDDQEACEMIQDIEDPHEAARALVRNALERGTTDNVTVMVVTL
                     "
     gene            complement(433699..433780)
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0C04521r"
                     /db_xref="GeneID:2886898"
     tRNA            complement(433699..433780)
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0C04521r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2886898"
     gene            <434137..>435000
                     /locus_tag="CAGL0C04543g"
                     /db_xref="GeneID:2886902"
     mRNA            <434137..>435000
                     /locus_tag="CAGL0C04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445372.1"
                     /db_xref="GeneID:2886902"
     CDS             434137..435000
                     /locus_tag="CAGL0C04543g"
                     /note="highly similar to uniprot|P47137 Saccharomyces
                     cerevisiae YJR096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445372.1"
                     /db_xref="GeneID:2886902"
                     /db_xref="GOA:Q6FWM2"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM2"
                     /translation="MSVTVDVPKYYELQDGRKIPSLALGTYDIPNSVTAKVVTEALKC
                     GYRHFDTAVLYGNEREVGQGIVNWINEDKAHNKREDVFYTTKLWNSQNGYNEAKRAIK
                     ECMQKVSGLGYIDMLLIHSPLSGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEE
                     LLGWDELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAHGYKMNDPGLREI
                     SKETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVYNHKLTLDQVKRMDHPEAY
                     DPTDWECTDAP"
     gene            <435373..>435900
                     /locus_tag="CAGL0C04565g"
                     /db_xref="GeneID:2886952"
     mRNA            <435373..>435900
                     /locus_tag="CAGL0C04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445373.1"
                     /db_xref="GeneID:2886952"
     CDS             435373..435900
                     /locus_tag="CAGL0C04565g"
                     /inference="similar to AA sequence:UniProtKB:P47138"
                     /note="similar to uniprot|P47138 Saccharomyces cerevisiae
                     YJR097w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445373.1"
                     /db_xref="GeneID:2886952"
                     /db_xref="GOA:Q6FWM1"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007872"
                     /translation="MTVKSKSRISHYEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKT
                     VPIDSTIKIRSGVSINQIQEAYRVLSNDQLRAAYNRALNDSNKLAGFNNFGDGLDEFN
                     LDEFEFNEEKLEYVMTCPRCQSGGGFVLSEDMLEECIEDGLTESEEQGYQVLTQCTAC
                     SLWLKVNFFINDEEE"
     gene            complement(<436255..>438381)
                     /locus_tag="CAGL0C04587g"
                     /db_xref="GeneID:2886950"
     mRNA            complement(<436255..>438381)
                     /locus_tag="CAGL0C04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445374.1"
                     /db_xref="GeneID:2886950"
     CDS             complement(436255..438381)
                     /locus_tag="CAGL0C04587g"
                     /inference="similar to AA sequence:UniProtKB:P47139"
                     /note="similar to uniprot|P47139 Saccharomyces cerevisiae
                     YJR098c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445374.1"
                     /db_xref="GeneID:2886950"
                     /db_xref="GOA:Q6FWM0"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FWM0"
                     /translation="MGIEDKISGFFKGKQDKKISPTSKTTTTKAQAQQEKKASQQYAP
                     ASTGLTSEAMEKANLEKQKRDQELAAQRAKYPAESLVRQDSNTSMPSLDSLDRDDSNY
                     VYQGVETDWDFDIMEADALIGGNNIADTELSDQLSPEEKERVLESQKEYAAKRVISFD
                     NDDEEIDKVKEYGQAHHYNSSQKVFAFSLPLGANTNAAPMTVVNSVSEERKNELREKL
                     KRNESITSLEEYELYKDEKGMTNTRTEAVMKSFQVDGLKTSFAKMTMDGDKKTHDGYS
                     YSRLLSIYDELEGDIVILGGYRGSNLRDAKTGKRVWVPLKAGLNMTKASLVIGPKDED
                     EIEAQKVLKPDGMLTHVGPVDISKKLIQKFAQNPKVRIRDFGYDWRLSHDITSEHLAK
                     FLQKIYDRQKEKKGIYVIAHSMGGLVAHRVLQQHTHLIRGLVYVGSPSQCANILGPIR
                     YGDELMWNKTLLSKEANFFMRSSMHFLPFDGRCFVDKNTLERYDLDFFDVNTWKEYGL
                     SPLVNEKRRKLAEAVQKEKESSFTNNAVVGAVTGTVGGTAKFLVNTIPGVNTKKKVIS
                     ERDEIPDEVFQTSYEDSLDYLERTLKRTKKNLESLEYIPGKEYPPLVIVYGNRVPTIR
                     GAKVNGLQGIKDGEFGEFYYGPGDGVVHHKWLLPEKRGFPVVAKVATDCGHVALMTDF
                     KAMAKAFVSLVDAEKERASAKGKTTA"
     gene            <439306..>440046
                     /locus_tag="CAGL0C04609g"
                     /db_xref="GeneID:2886948"
     mRNA            <439306..>440046
                     /locus_tag="CAGL0C04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445375.1"
                     /db_xref="GeneID:2886948"
     CDS             439306..440046
                     /locus_tag="CAGL0C04609g"
                     /inference="similar to AA sequence:UniProtKB:P35127"
                     /note="similar to uniprot|P35127 Saccharomyces cerevisiae
                     YJR099w YUH1 ubiquitin-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445375.1"
                     /db_xref="GeneID:2886948"
                     /db_xref="GOA:Q6FWL9"
                     /db_xref="InterPro:IPR001578"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL9"
                     /translation="MAAVVPMESSPEVFNHVAHLLGLDNAHAFVDVYSLDDPDLLAMV
                     PRPVSAIVLLFPLTEGLREPIASGDAGKGRDNGSDNGSEAGNGSGVSWFRQSIKNACG
                     LYAVLHALSNNKEILEPTSVLGNFLESHSAMRFDDEQTNKFVLDAADKYRETFTMGST
                     SYPQDVDPSQIEVNLHFVTYVVQNGHVYELDGRRAGPLDLGTADDSASDILAQPLLKS
                     RIQELMSAAQNSQDSLNFSILGLTEAWD"
     gene            complement(<440142..>441140)
                     /locus_tag="CAGL0C04631g"
                     /db_xref="GeneID:2886884"
     mRNA            complement(<440142..>441140)
                     /locus_tag="CAGL0C04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445376.1"
                     /db_xref="GeneID:2886884"
     CDS             complement(440142..441140)
                     /locus_tag="CAGL0C04631g"
                     /inference="similar to AA sequence:UniProtKB:P47140"
                     /note="similar to uniprot|P47140 Saccharomyces cerevisiae
                     YJR100c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445376.1"
                     /db_xref="GeneID:2886884"
                     /db_xref="GOA:Q6FWL8"
                     /db_xref="InterPro:IPR005552"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL8"
                     /translation="MLPLRLRLIPRVRAARLFSTSAATRQVIRNGSFRRHARRNQVAG
                     QGYDYNDTMSLNRGSSIITINHPIATTILNEPTIIVERQLELMNVFLGYEQANKYAIM
                     DAMGNKIGYMMERDFSIGKAIMRQFYRLHRPFIVDVFDNWGNILMSIRRPFSFINSHI
                     KAIIPSQVTQVIRNGKDVTQDLNVLEDNGTMVGETIQRWHVWRRKYDLFQKDPNTSDD
                     EVLNQFGEINAPFLSFEFPVLDQSGKIMGGVDRNWVGLGREFFTDTGVYIIRFDAQRS
                     YMNNDGTMIYPPEIMSNEIMNFDQRAVLLANAVSIDFDYFSRHSNHGGFVSFGSYE"
     gene            441493..441601
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0C04653r"
                     /db_xref="GeneID:2886885"
     tRNA            join(441493..441531,441557..441601)
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0C04653r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2886885"
     gene            <441768..>442580
                     /locus_tag="CAGL0C04697g"
                     /db_xref="GeneID:2886883"
     mRNA            <441768..>442580
                     /locus_tag="CAGL0C04697g"
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /transcript_id="XM_445377.1"
                     /db_xref="GeneID:2886883"
     CDS             441768..442580
                     /locus_tag="CAGL0C04697g"
                     /inference="similar to AA sequence:UniProtKB:P47141"
                     /note="similar to uniprot|P47141 Saccharomyces cerevisiae
                     YJR101w RSM26"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM26"
                     /protein_id="XP_445377.1"
                     /db_xref="GeneID:2886883"
                     /db_xref="GOA:Q6FWL7"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019831"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL7"
                     /translation="MLRVGKRLIWKGVRGIHVVPKLPNGQELSRRGIPKVLSKDGFDL
                     VWSQQQGYVCDKLTLATAGTSLESYLPFHILLKTAKNQHQSHIFNLASAAHNNHLFIE
                     NILPVTEEGSALSETNKPSRLLEARLVDSFGHGWDQVKEEMVKSATDNVIGEGWLFLV
                     ENSNKELHILTIQNNGTPYYFPRNQLFDMNSAIRPEEYQHTKSVKELVDKASELGKKV
                     DDWTMPLICVNLWDHAYLADYGVQNRAKYVRNVLDNLNWSVVNNRLFTDPVA"
     gene            complement(<442734..>443318)
                     /locus_tag="CAGL0C04719g"
                     /db_xref="GeneID:2886872"
     mRNA            complement(<442734..>443318)
                     /locus_tag="CAGL0C04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445378.1"
                     /db_xref="GeneID:2886872"
     CDS             complement(442734..443318)
                     /locus_tag="CAGL0C04719g"
                     /inference="similar to AA sequence:UniProtKB:P47142"
                     /note="similar to uniprot|P47142 Saccharomyces cerevisiae
                     YJR102c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445378.1"
                     /db_xref="GeneID:2886872"
                     /db_xref="InterPro:IPR008570"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014041"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL6"
                     /translation="MPSIYAFPPLYTRQPNSLVRKQQIDTWIDILTEWCKSHRVFELG
                     KDGVPVRESDASDADDGADGGTTTGNEAGRSLFKNEEINRAVPPLFIDEIWSVMATRG
                     VALVTEGRASYYVLWRTLDSWASLILQWFETVGKLNQVVTLYELTESDETADWEFHSM
                     PLPLLHRCLKPLCNRNRATLMKDEHGTPVALKVV"
     gene            complement(<443733..>444197)
                     /locus_tag="CAGL0C04741g"
                     /db_xref="GeneID:2886862"
     mRNA            complement(<443733..>444197)
                     /locus_tag="CAGL0C04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445379.1"
                     /db_xref="GeneID:2886862"
     CDS             complement(443733..444197)
                     /locus_tag="CAGL0C04741g"
                     /note="highly similar to uniprot|P00445 Saccharomyces
                     cerevisiae YJR104c SOD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445379.1"
                     /db_xref="GeneID:2886862"
                     /db_xref="GOA:Q6FWL5"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR018152"
                     /translation="MVKAVAVLRGSAGVSGVVTLEQASEQDPTTITYEIAGNDPNAER
                     GFHIHEFGDVTNGCVSAGPHFNPFKKTHGAPQDENRHVGDLGNIKTDAQGVAKGVITD
                     SLVKLIGPTSVVGRSVVVHAGTDDLGKGGNEESLKTGNAGPRPACGVIGLTN"
     gene            complement(<444934..>445881)
                     /locus_tag="CAGL0C04763g"
                     /db_xref="GeneID:2886940"
     mRNA            complement(<444934..>445881)
                     /locus_tag="CAGL0C04763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445380.1"
                     /db_xref="GeneID:2886940"
     CDS             complement(444934..445881)
                     /locus_tag="CAGL0C04763g"
                     /note="some similarities with uniprot|P25560 Saccharomyces
                     cerevisiae YCL001w RER1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445380.1"
                     /db_xref="GeneID:2886940"
                     /db_xref="GOA:Q6FWL4"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL4"
                     /translation="MLSLKPGATLVQKYKNLYQLCLDKCTAYTKVRWVAELSLVVLFL
                     NRFVPLLDCYVYDSKLFDDLLIIFSCFTWGFLYDKLLQQEEGNLDVGEKLDDIHPILS
                     RPPEFRIWYYCIGTTVYYILWELLIPPLPNWVGSLAFFLHSTYCLAYMFKVILQGENP
                     THQFYLDVCKRHTMARWISGIVLLFFVAFLYRCHYAWELCYYALGISILDAFIKYLRR
                     MRDMYLQQCKDKSDQEANEAFREFRPYLRNSPEFILWCSCIKYTVWFLVLSLFNCLHD
                     PDLFGLYVLIYDICWTVICVIKAILLMISYSTYQHRHVD"
     gene            complement(<447029..>447874)
                     /locus_tag="CAGL0C04785g"
                     /db_xref="GeneID:2886938"
     mRNA            complement(<447029..>447874)
                     /locus_tag="CAGL0C04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445381.1"
                     /db_xref="GeneID:2886938"
     CDS             complement(447029..447874)
                     /locus_tag="CAGL0C04785g"
                     /note="weakly similar to uniprot|P47152 Saccharomyces
                     cerevisiae YJR115w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445381.1"
                     /db_xref="GeneID:2886938"
                     /db_xref="GOA:Q6FWL3"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL3"
                     /translation="MQYVSIPQQILLANRARTKLMDCAMVKEHNKDYDLRRMVAHANM
                     LDSLLRDVPTSAQPQQTQRPEPQAQVYRAQAHEYDEELMFDMDDKEYHTSTECSNMIS
                     QCRRYEDSLSDQSQYDQYSDQYHEQYSDQFGTLRGSLRGSVRDSLGDSLDCDNAVEEN
                     KDDVTTTTMTTTIDENGELHTCNRVPLLYQTLRDENTPRDLRDHIIDNEREDDYGDDP
                     RDDEENLLESGESPDEMDGCGLLAEVVYTNPVSMRYNKWQHPADTSTELYKPRYIDAY
                     IRPLN"
     gene            <450190..>451014
                     /locus_tag="CAGL0C04807g"
                     /db_xref="GeneID:2886932"
     mRNA            <450190..>451014
                     /locus_tag="CAGL0C04807g"
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /transcript_id="XM_445382.1"
                     /db_xref="GeneID:2886932"
     CDS             450190..451014
                     /locus_tag="CAGL0C04807g"
                     /note="some similarities with uniprot|P47150 Saccharomyces
                     cerevisiae YJR113c RSM7"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM7"
                     /protein_id="XP_445382.1"
                     /db_xref="GeneID:2886932"
                     /db_xref="GOA:Q6FWL2"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL2"
                     /translation="MLTRVRGNALAVLRSRAVSARPVLPMASQHRLVAMRKLTTNRVL
                     LQEQKQDKSTSAVVDENLSFTDEEVDEWLKDIEELKTEFSEREFLPEVSLAPPGQARI
                     DLVEEAIKSSQEFEPSQEQLEEWEALKDQPMPQLKDPTVQHVTNMIMRHGKKDRAQKI
                     ISRALYFLHCKTRKDPVELLKKALDDMAPLMMVKTFNTGVAKAAVIPVPLSQRQRNRI
                     AWKWIVEGANKRVSNDFAVRLGEELVAVYEGKSSGFEKRDQMHKTAIAHRSYIQLR"
     gene            complement(<451151..>451489)
                     /locus_tag="CAGL0C04829g"
                     /db_xref="GeneID:2886827"
     mRNA            complement(<451151..>451489)
                     /locus_tag="CAGL0C04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445383.1"
                     /db_xref="GeneID:2886827"
     CDS             complement(451151..451489)
                     /locus_tag="CAGL0C04829g"
                     /inference="similar to AA sequence:UniProtKB:Q3E743"
                     /note="similar to uniprot|Q3E743 Saccharomyces cerevisiae
                     YJR112W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445383.1"
                     /db_xref="GeneID:2886827"
                     /db_xref="GOA:Q6FWL1"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL1"
                     /translation="MMVASKYIHLPRFRTIQSPNDDIEMVTNRIPLENGTTNAESTTY
                     YQVNKYIIATVICCGFAGIASELFQKIASHNKRSFDVYDIYFDMMGSGCGIIAAYLHE
                     SYSNRISIEG"
     gene            complement(<452035..>452697)
                     /locus_tag="CAGL0C04851g"
                     /db_xref="GeneID:2886831"
     mRNA            complement(<452035..>452697)
                     /locus_tag="CAGL0C04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445384.1"
                     /db_xref="GeneID:2886831"
     CDS             complement(452035..452697)
                     /locus_tag="CAGL0C04851g"
                     /inference="similar to AA sequence:UniProtKB:P47149"
                     /note="similar to uniprot|P47149 Saccharomyces cerevisiae
                     YJR112w NNF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445384.1"
                     /db_xref="GeneID:2886831"
                     /db_xref="GOA:Q6FWL0"
                     /db_xref="InterPro:IPR007128"
                     /db_xref="InterPro:IPR016851"
                     /db_xref="UniProtKB/TrEMBL:Q6FWL0"
                     /translation="MVSAERVRYQRLNQVFDRALAQTVHKLESKERVVSCFPRYSSTL
                     EGSSHLENCQAQLIEFMVRYCEREFQAILEERNVKVKLDELDDLISLAQSRLEERKRQ
                     ALVTAKRKEGNARPINRDLEQGLSAVDQLSSKKLLAAHLYTLRKDTVAKIDNRLQKVN
                     ALNNKIKDEITELEEEIEKSKSNINSLLDDTMGSTALRDQDETLVQGLHDMVLELKEN
                     LI"
     gene            <453303..>454178
                     /locus_tag="CAGL0C04873g"
                     /db_xref="GeneID:2886832"
     mRNA            <453303..>454178
                     /locus_tag="CAGL0C04873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445385.1"
                     /db_xref="GeneID:2886832"
     CDS             453303..454178
                     /locus_tag="CAGL0C04873g"
                     /inference="similar to AA sequence:UniProtKB:P47148"
                     /note="similar to uniprot|P47148 Saccharomyces cerevisiae
                     YJR111c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445385.1"
                     /db_xref="GeneID:2886832"
                     /db_xref="GOA:Q6FWK9"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK9"
                     /translation="MKSVLNAQRLIQLSQFHPKLQNIWYLVAAVTFSVCNHPQELPKL
                     YHYALALSNENADIHRITLAGKCNDMVDNCMRRPDLRESIINEGFQQPSILHSTITRK
                     FRESILKSGPLAGLPKAINGLHSLKEYTPLSLLPSVSREIDPWHASVNNCRPYMSNEE
                     SKTGTGRVEEDFEDREVAMQRGLKHWNSIYNKVSQRIINNMNSSYPDLWYYTLVHVYG
                     PLLSNDEVLSAQETSFIVIAALVPQDVNPQLKGHLRGALNIGCDREAIEAARSLAILV
                     AKWCGVTWHADIVKL"
     gene            complement(<454291..>456360)
                     /locus_tag="CAGL0C04895g"
                     /db_xref="GeneID:2886833"
     mRNA            complement(<454291..>456360)
                     /locus_tag="CAGL0C04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445386.1"
                     /db_xref="GeneID:2886833"
     CDS             complement(454291..456360)
                     /locus_tag="CAGL0C04895g"
                     /inference="similar to AA sequence:UniProtKB:P47147"
                     /note="similar to uniprot|P47147 Saccharomyces cerevisiae
                     YJR110w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445386.1"
                     /db_xref="GeneID:2886833"
                     /db_xref="GOA:Q6FWK8"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK8"
                     /translation="MEYIKISKVDDVTLHRRGKSAVGTLHLTTHHLIFESPSLKTEFW
                     FAHHLIGSVFKNYGSALLSVPGYDINATVGDKDLWSMTNVKIIGKDFTVFSLDFLMEL
                     EANEFYDSLINLTVLEDPHKLYAYIYKPNELETKLTRKGWDIYDLKSEFLRQGLDLDG
                     SKEGQPTWRVSNINANHEAIPTYPAQFVVPALASDPLLLHAMKFRSQNRLPVLAYYYK
                     KSQCCLLRSSQPLTGVTKQRSLQDEKLIQTFFKASNKCKKNLIVDARPTANALAQMAL
                     GGGTESMDNYNFNKTVQRLFLGIDNIHVMSDTLNSLVDNVLADGDIYLPISDAYLSTG
                     KSANWLKYVKLLLSSTDMMVKSMVFNQSNILLHCSDGWDRTTQVASLVQICLDPYFRT
                     LEGFMVLIEKDWVSFGHKFKERLGHLSSTAVFHDNTSGLKTNVTLSYKKLTGKSKAAT
                     GTTEQEPDRTLEDSTSLFGNGSAKDNLNKSVMMLSNSATDFFNKTIKTSIPYGDSSAE
                     VDTSGTAANAKTKKKASTKFVSPVFMQFLDCVYQLLLQNPEKFEYNERFLRRLLYHAY
                     SCQYGTFLYNNEKERMEDTQRNNTNSVWDYFNSRKLEFTNVSYQGIPEGSDDWILPDL
                     GKVRWWWQLFGRRNSEMNGYLDKVQVESKVTVDENSNEDTNESTDNVKTLGEKIAAFS
                     FDFFGKK"
     gene            <457506..>460847
                     /locus_tag="CAGL0C04917g"
                     /db_xref="GeneID:2886783"
     mRNA            <457506..>460847
                     /locus_tag="CAGL0C04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445387.1"
                     /db_xref="GeneID:2886783"
     CDS             457506..460847
                     /locus_tag="CAGL0C04917g"
                     /note="highly similar to uniprot|P03965 Saccharomyces
                     cerevisiae YJR109c CPA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445387.1"
                     /db_xref="GeneID:2886783"
                     /db_xref="GOA:Q6FWK7"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK7"
                     /translation="MTITAQENSISAFTLKDKYNPQLVQGVNKVLIVGSGGLSIGQAG
                     EFDYSGSQAIKALKESKIETILINPNIATNQTSHSLADKIYYLPVTPEYITYIIEKDR
                     PDAILLTFGGQTALNCGIHLDETGILAKFNVKVLGTPIKTLITSEDRDLFASALKEID
                     IPIAESIACENIDDVLSAASTIGYPVIIRSAYALGGLGSGFANNPEELKELASQSLSL
                     APQVLVEKSLRGWKEVEYEVVRDRENNCITVCNMENFDPLGVHTGDSIVFAPSQTLSD
                     EEFHMLRSAAIKIIRHLGVVGECNVQYALSPNSLDYRVIEVNARLSRSSALASKATGY
                     PLAYTAAKIALGYTLPELPNPITKTTVANFEPSLDYIVAKIPKWDLSKFQYVNRSIGS
                     AMKSVGEVMAIGRNYEEAFQKALRQVDPSIIGFQGSDEFGDQLDDVLANPTDRRIFAV
                     GQALIFENYSVDKVHDLSKIDKWFLYKCMNIVNIYKELMKLVDISQLLENSLLLRAKK
                     LGFSDKQIAITLTKYAGISSKELDIRTLRKAHNITPYVKRIDTLAAEFPAQTNYLYTT
                     YNATKHDITFDDHGMLVLGSGVYRIGSSVEFDWCAVNTAKALREQNYKTIMINYNPET
                     VSTDFDEVDRLYFEELSYERVLDIYELEQSEGCIVSMGGQLPQNIALSLYEYGCKILG
                     TSPKDIDNAENRHKFSSILDSINVGQPEWKELTSVEEAKTFANKVSYPVLIRPSYVLS
                     GAAMSVVNNEHELEDKLTLASDVSPDHPVVMSKFIQGAQEIDVDAVACNGELLVHAIS
                     EHVEDAGVHSGDATLILPPQHLSENVKSQLKTIAKKVAKAWNITGPFNMQVIKAGEND
                     LKVIECNIRASRSFPFVSKVLGVNFIEVAVKSYLGGEHVPEPVDLMAKHYDYVATKAP
                     QFSFTRLAGADPYLGVEMASTGEVASFGRNELESYWTAIQSTMNFQVPLPPCGILLGG
                     DLSNDKLGNVAKVIAPLGYNLYCTHKESQIYFKKFNVDTAIIEFPKNDKKRLGELFQK
                     YKIKTVVNLAAKRADNTDDEDYIMRRNAIDFGIPLFNEPNTSALFAKALSAKLSEKIT
                     TLTSKDIAIPTEVQSWDEFVGFKVM"
     gene            <461278..>461520
                     /locus_tag="CAGL0C04933g"
                     /db_xref="GeneID:9487973"
     mRNA            <461278..>461520
                     /locus_tag="CAGL0C04933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999479.1"
                     /db_xref="GeneID:9487973"
     CDS             461278..461520
                     /locus_tag="CAGL0C04933g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999525.1"
                     /db_xref="GeneID:9487973"
                     /db_xref="GOA:B4UMY4"
                     /db_xref="UniProtKB/TrEMBL:B4UMY4"
                     /translation="MTATNDYCNDDPYETFYLDQQENQPTANTVCEDHASLIYERSLQ
                     PEKYPVLAPIAKNPNALNGKRSNASDASEDMKRKRP"
     gene            complement(<461628..>462740)
                     /locus_tag="CAGL0C04939g"
                     /db_xref="GeneID:2886757"
     mRNA            complement(<461628..>462740)
                     /locus_tag="CAGL0C04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445388.1"
                     /db_xref="GeneID:2886757"
     CDS             complement(461628..462740)
                     /locus_tag="CAGL0C04939g"
                     /inference="similar to AA sequence:UniProtKB:P47145"
                     /note="similar to uniprot|P47145 Saccharomyces cerevisiae
                     YJR107w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445388.1"
                     /db_xref="GeneID:2886757"
                     /db_xref="GOA:Q6FWK6"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK6"
                     /translation="MKTVLLWHILTLAQRLWFGTWIIVEASSLNDYNSPIEVATKTAA
                     LENEAEQIHIGEEVYERFVYFSKACGLCNCIDKKLLRENKTLDDEGCPSYLNFCSDPS
                     QNPTYNQTRIVLVLEAEENELGTGYLAVDHEKKVIILAFRASTTAQDWQSDFETYPKE
                     YYPVSSNEYWDLVRHGVIKECTNCKVHKGFSRFLETLGKHFLAKVQKIITNYPDYHIV
                     SVGHSLGAALAALAGIELKLRGYRVSVITYAQPKIFNRDLKEWVDDLFNTRLLNAIAE
                     YGSCLSSATGYIRVVHENDYVPMIPPFFHHAGLEVVISTRELPHNIQHLTYIGYNNLV
                     TTEKAERLGMNSNLEELLHMYEHRNYFITLTGCTGF"
     gene            complement(<463054..>465102)
                     /locus_tag="CAGL0C04961g"
                     /db_xref="GeneID:2886774"
     mRNA            complement(<463054..>465102)
                     /locus_tag="CAGL0C04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445389.1"
                     /db_xref="GeneID:2886774"
     CDS             complement(463054..465102)
                     /locus_tag="CAGL0C04961g"
                     /inference="similar to AA sequence:UniProtKB:P47144"
                     /note="similar to uniprot|P47144 Saccharomyces cerevisiae
                     YJR106w ECM27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445389.1"
                     /db_xref="GeneID:2886774"
                     /db_xref="GOA:Q6FWK5"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK5"
                     /translation="MGLSSLIHPHELYGDGGLSIGLMFCSVLHILLCFVLLGVCASDF
                     LCPNVAKITDSSGNLRSNSTRTGMLMAIILSWCNSSPDLFSNLMSWTSSSDESFNVAA
                     NLSVGEVLGACGIILCVVVGSIFFLMGDVTIEITTPQRINILYDLFYTWLALTMMLYV
                     TLRDSITIWNCFSMLSIYVGYILHKIKFSRWNSHDSESSDVNQLEEGAVDGIQREYQT
                     FGGLESTLKPNVLAPMDFNSLLSMLENSTSPDAELQSIRNELQSSTSHSDSHERPFSD
                     PNPQVNSQMMGERQTQSSPIEFGRYYDNPEDHRSDAQNIIQRELSTAQSIIDAADERR
                     FLKIAEKYFLKVVPHMKSYSKKTVPDQIISTLIVPFVLLFRLTCPQPDDILEYSEKTG
                     TFKYKKSTLSVLLLQLVFSPVLTYLLISSLLERSMWSPFLILPGLFSFTCAVLVIQFS
                     RSLSQFNRFSLVLTESLGSNNDEELRKRRELISYSDLLKFILLTFGIVNSILWISSTA
                     NSVIEILELYQKQSGISPAILGLTVFAWGNSISDLISNIAMCKLYKKMPHGDSDITLV
                     ATKFFMIACTSCIGGVLLNSMVGIGFSGLISMLFVHKGQGNWWFQRQANLDTTKTNNL
                     KFLVCSLVLEFQCAFLVCIFASKGRLREVLSKNMKYLGITMCSLWALATLMITILEIA
                     "
     gene            complement(<465716..>466732)
                     /locus_tag="CAGL0C04983g"
                     /db_xref="GeneID:2886918"
     mRNA            complement(<465716..>466732)
                     /locus_tag="CAGL0C04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445390.1"
                     /db_xref="GeneID:2886918"
     CDS             complement(465716..466732)
                     /locus_tag="CAGL0C04983g"
                     /note="highly similar to uniprot|P47143 Saccharomyces
                     cerevisiae YJR105w ADO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445390.1"
                     /db_xref="GeneID:2886918"
                     /db_xref="GOA:Q6FWK4"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK4"
                     /translation="MSPSLICLCNPLLDIQATVNDDYLKKYNLNANDAVLLETGSTDP
                     RFAIYEELPTFPDVKYVAGGAGQNTARGSAYVLGKGQVGYFGSVGEDKYSKKLLEENE
                     AAGVISLYQVQKDISTGKCAALITGHNRSLVTDLGAANHFKPEHLDKHWDQVTGAKMF
                     YIGGFHLTVSPDAIVKIGQHAKETGKPVVLNLSAPFIPQFFKDALVKVLPYVTIVVAN
                     ESEAASYAEAFGLTCDKTDLVAIAKEIIGDSSEKKVVFTHGLEPTVLVTKDSDKSFPV
                     KPLDSSKIVDTNGAGDAFAGGFMAGLVQGKSLEQSIDMGQWLAALSIQEVGPSYPKEK
                     IEYA"
     gene            complement(<467626..>470856)
                     /locus_tag="CAGL0C05005g"
                     /db_xref="GeneID:2886923"
     mRNA            complement(<467626..>470856)
                     /locus_tag="CAGL0C05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445391.1"
                     /db_xref="GeneID:2886923"
     CDS             complement(467626..470856)
                     /locus_tag="CAGL0C05005g"
                     /inference="similar to AA sequence:UniProtKB:P27636"
                     /note="similar to uniprot|P27636 Saccharomyces cerevisiae
                     YAR019c CDC15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445391.1"
                     /db_xref="GeneID:2886923"
                     /db_xref="GOA:Q6FWK3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK3"
                     /translation="MADRISVTPAQQFRKEHKSVQYQLRQIIGRGSYGVVYKATNKKT
                     AQEVAIKEVNYQDDDELVDIMSEIDLLKNLNHINIVKYHGFIQKQHNLYIILEYCAKG
                     SLKNLISRNRPMSEHEAKPYVRQTLNGLNYLHEQGVIHRDIKAANILLDSENVVKLAD
                     FGVSTKVNNTAMTLAGSLNWMAPEIIGNRGASTLSDIWSLGATVVELLTGNPPFHNLI
                     DMNIYYAIENDSYFPPSSLSSGAKDFLQQCFAKNMYKRPTAVQLLQHNWLENDNSKDS
                     TMDKQVIPSVEKLNLYQEKFEDSDLCWDDDFEEKDLNLSSPSKKDLVKTKIPSDEFIP
                     DVFNISEVNQGNQGNQGNQGNQGNQGNQGNQGNDPIKNEQARSNNNIVIQSQLERSST
                     PFTMDRNKGNADFLQNSSLDEDNLLQIVKSGKSIENVDYFFQKCSIDMLALTLIELTM
                     NKKDMIREHLAPSNHELNLYKFFEYDEKKNKSKLKRKFIQLGGLPSLFHYEKLLSIFF
                     VDDFVDDLIRAGIIPYVRDYKNGSLVLSIINKHMELMSIQSWCKWCNFNLPIDIILEN
                     LIARKAQSILLKISTYGSKEFKLEILKNIVNYNYNSSNQKILLDSQVMYVIFKSVFYI
                     LRSLHLNSGTSNNSAMLLNFHSHHISTTGSNTGNTPSLSSSPTKSPVSSWKTQSPPLS
                     PTRTLSGKSQGYPSGVSNPPNALSSNNNGFIVPENVFLWMEEFLRSKYFCSLMDIHVW
                     KYFNRAFYYTTYNNKPRLLKLLADDCYTRFCIRVADTVSDKNGRQVMGQASLVLMRMS
                     NELLSSLHNNQILSGNKKISISPSLITIATKFLGKREFIYEGIEIVLNCIQFISHQNE
                     DTGNVNTFNRRGNQRNRNGERLMVLHSDKLLFSEENVLVDMNDIVDCFFIFPENDSNF
                     GNYVVKFMKLCMVQQLEYVCQRIVLKEQFYERIVAFFGFYCNSLLIQIDLLKLVKTLF
                     TRALHSNNERSNILDSLKTLLAFLSENWDPLKGNNKGQVGYNSVLIKQLCSDIAALLS
                     YRPNTKRSNGLDHLGVSQFALDKNITSSGPVVDRGRLPVPRPEFNT"
     gene            <473101..>475341
                     /locus_tag="CAGL0C05027g"
                     /db_xref="GeneID:2886927"
     mRNA            <473101..>475341
                     /locus_tag="CAGL0C05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445392.1"
                     /db_xref="GeneID:2886927"
     CDS             473101..475341
                     /locus_tag="CAGL0C05027g"
                     /inference="similar to AA sequence:UniProtKB:P80235"
                     /note="similar to uniprot|P80235 Saccharomyces cerevisiae
                     YAR035w YAT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445392.1"
                     /db_xref="GeneID:2886927"
                     /db_xref="GOA:Q6FWK2"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK2"
                     /translation="MSELTAVKSRSDPALEATKESKLLKRLPIPPLEDTLKRYLDRVQ
                     PLQDEKQFKRTKRTVMSAENLDVMRTLQEKLLQYDQELANETPESSYIEQFWYDSYLL
                     YDQSVVLNVNPYFQLEDDPTILKDVQRDSQYSGPYGKYTLQIKRCAKLVTSILKFIKQ
                     VRHGTLAEDKIRTTPLSMDQYKKLFGSSRIPPGPGEESCHLQTDPTSHHIMVMYKSQF
                     YWFDVLDINNFPIFQAPEELEWNLYSIIMDTERHIGDHLQSRDEFIRYLVPMGVFTTE
                     SRRVWSNIRDYIYHDSDSTNWKNLKLIDSALFVICLDDLQFDSKDPKTSSQLVQSMLC
                     GTSNINLGEDENSKVPLNIQHGTCMNRWFEKLQLIVTRDGKAGINFEHTGVDGHTVLR
                     FATDIYTDSILSFARGVTKNVPDIFAEKEMEASLMKKQSRANLITIPRKLEWRPDSFL
                     LSSLHFAETRISDLISQYEFVSLDFETYGAAHIKAMFKCSPDAFTQQVFQIAYYALYG
                     KFEAVYEPAMTKTFQNGRTEAIRSVTNQSKKFVKSMFDSKATNAQRIDYLQKAAKEHS
                     RITKECSMGLGQDRHLYALYCVWNEWYRDSLPMPPLFQDHSWSVINNNVLSTSNCGNP
                     CLKNFGFGPVTANGFGIGYVIREDSISIVVSSRHRQTERFVSLLEKSFLEIDRIFRRE
                     HERQEALAKVPSYTPQDDKDKKEERENYLRELRKRAGSMSQNTKSDDLQFLLSGYDYF
                     DISVSG"
     gene            <475910..>479455
                     /locus_tag="CAGL0C05049g"
                     /db_xref="GeneID:2886795"
     mRNA            <475910..>479455
                     /locus_tag="CAGL0C05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445393.1"
                     /db_xref="GeneID:2886795"
     CDS             475910..479455
                     /locus_tag="CAGL0C05049g"
                     /inference="similar to AA sequence:UniProtKB:Q12451"
                     /note="similar to uniprot|Q12451 Saccharomyces cerevisiae
                     YDL019c OSH2 and similar to uniprot|P35845 Saccharomyces
                     cerevisiae YAR042w OSH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445393.1"
                     /db_xref="GeneID:2886795"
                     /db_xref="GOA:Q6FWK1"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK1"
                     /translation="MADDGTHFTSKPLLKLKLLDALRSGSFQELQKVIDTRFLPKDDP
                     NVVEVSQLVLHYAVQVAPLSLIKQIVTKWVNTHVSTHMNSETFLNINHQDQNGNTPLH
                     IAAYQARGDVVMYLMDQPTINDCVSNNSHMQPIEICRDLNVAQGMQIKRSKYVAETAQ
                     ELRTAFNNRDFEHLESILTNSRNSELLDINGLDPETGDTVLHEFIKKRDVEMCKWLLE
                     HGADPFKRDSTGVLPADLVKKVSESEAASNPKLLTDVELKKLLDKATSEQSVIDVTGS
                     LHKPPTYRGYLQKWTNFAQGYKLRWFILSADGKLSYYIDQNDTKNACRGSLNMSTCNL
                     HLDSSEKLKFEVIGGNGAIRWHLKGNHPIETNRWVWAIQGAIRFAKDKEMLLTTGTIP
                     PSLAINYGLNNTDRVLDSPKQPTHMRNKSRQTLVSVQESRRSSSGLGLVINRPEDKIE
                     SAFHMPPTSPSISVGPNGMSSSIFENPSTFESESQRSPVSSSPIQDTNPQAFESTNVK
                     TFDSSMIEKDSEDENEEVEDLFLAMDGGSDEDLQTLCSPHSQEMHILQRSITMELSSL
                     TELLNDRPSNPNDIFNTLGNSLKTITESFDRLNEITSQSDKLMISKLTKQRDVNNVWI
                     KAVKELEFELKDKDERLASLDKERRNLKKLLQRKFQSPNGTTEDDDFDGPVKDTHEAL
                     EEIAKYIDATKEDGEDTDADEFFDAEELMDSSENVDEEESDTEKEATIKAEDINENKE
                     VTHHAGFEKEIVTEKQKEYKQMLLEQKSFAGYEHPKRTNLGLDKDDRPKISLWSVLKS
                     MVGKDLTRIPLPVSFNEPSSLLQRVTEDLEYSDIMDTAATFEDSSLRTLFVAAYSASM
                     YASTVKRVAKPFNPLLGETFEYVSPDGQYRFLTEQVSHHPAISATWGEAPKWNYWGEC
                     KVDSNFTGRTFAVENLGTWWIRLRPDSNNPEEEIYSWKKPDMAVIGILVGNPQVDNNG
                     DSVITNHTTGDYCVLHYKARGWTSAGAYEVKGEVYNKDNEKLWILGGHWNEALYAKKV
                     TKKNDEDMTIDKTKSSVGKSIDEPKFDGSKFLIWRANDRPDIPFNLTSFAVTLNDLQP
                     GLKEWLPPTDSRLRPDQRAMEEGRYDDASDEKHRLEEKQRAVRKQREEANIEYRPRWF
                     SLETHPVNGKQYWKFNGEYWEQRKKHTWTNVPDIF"
     gene            <480117..>481781
                     /locus_tag="CAGL0C05071g"
                     /db_xref="GeneID:2886798"
     mRNA            <480117..>481781
                     /locus_tag="CAGL0C05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445394.1"
                     /db_xref="GeneID:2886798"
     CDS             480117..481781
                     /locus_tag="CAGL0C05071g"
                     /inference="similar to AA sequence:UniProtKB:Q08224"
                     /note="similar to uniprot|Q08224 Saccharomyces cerevisiae
                     YOL055c THI20 or uniprot|Q08975 Saccharomyces cerevisiae
                     YPL258c THI21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445394.1"
                     /db_xref="GeneID:2886798"
                     /db_xref="GOA:Q6FWK0"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FWK0"
                     /translation="MVDSVKEPVLMNTPPPYLRLANDKQLPVVMTIAGSDSSGGAGIE
                     ADIKTITAHKCYAMTCINALTVQTPQKVYDVFPTPQEVVKQILDANLADMRCDVIKTG
                     MLTVETAQMLSAKLKELGSARPKLVVDPVLVATSGSSLASLGIVDVIKKELAPLADLI
                     TPNIQEAFELLGKELPVKSHQDMLQIAMEISQATGCKNVLVKGGHTPWDDETKKYITD
                     VLYMQNDSQYFVYKGNCVSTSNTHGTGCTLASSIASNLAHGYSLKQAIYGGIEYVQNA
                     VGIGCSVAQKHVKQNGPINHVYAIEVPLDRMISDDCFTAYSVLDNIKKPAVDNPIGED
                     FFSYLINHPTVKPHWESYTKHKFVEEVAKGTIDLKKMQFFLEQDYSYLIDYARIQCIG
                     ASKAPSMEDIESALVIVGSVRHEMSEHETRLREVFGVTSDEHFHNIKRGPALRAYSRY
                     FNDVAKHGNWEELILAISPCLMGYGWALKNVQDKITCKEGTVCRNWCDTYLSDKYKGA
                     MDQGVILLNNIGRSYPPDQIDTLVKIYADVCKLETDFWTAALEYSE"
     gene            complement(<482106..>484220)
                     /locus_tag="CAGL0C05093g"
                     /db_xref="GeneID:2886793"
     mRNA            complement(<482106..>484220)
                     /locus_tag="CAGL0C05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445395.1"
                     /db_xref="GeneID:2886793"
     CDS             complement(482106..484220)
                     /locus_tag="CAGL0C05093g"
                     /note="highly similar to uniprot|Q08225 Saccharomyces
                     cerevisiae YOL057w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445395.1"
                     /db_xref="GeneID:2886793"
                     /db_xref="GOA:Q6FWJ9"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ9"
                     /translation="MSYLADHDAPVTMLSVKEKFFPQLSDKEALYAHFMSKASHAGTR
                     VVLRQVSSESEPIFDLVMTIHQKLGGSYDGIELAPNEIQFYLEYVSQFLTNLGNFKSF
                     GDVKFIPRCRIESFKSIVQAASIDLGQHLRTVCGNQYSHVSLPYTSVNDLIEQGIYYV
                     DDKVSLLGYTADGYTSSYYMGQGISLEDMKLLKEELFGKYNILPENTRIYKRANDEFY
                     IFVASGAVENELEQYPKGVITLSNGTKVSFKFGDHTREMQLISKYLAEAKKYAANEYQ
                     IKMLDEYIRHFETGSSHAHKEAQKYWVKDISPVVETNIGFIETYREPSGIIGEYESLV
                     AIQNKERTKKFGAMVSRAEEFISELPWSADFEKPKFNPPDFTSLEVLTFTGSGIPAGI
                     NIPNYDDVRLNIGFKNVSLGNILSASAKASAKHPPTFIKSEDRGIFEKYQSDSFEVQV
                     GIHELLGHGSGKLLCQIEDGFNFDIENPPTGLDGKPVSTYYKLGETWGSKFGQLAGAF
                     EECRAEVIAMYLITNRELLSIFGFTEKTDQDSIIYAGYLQMARAGLMALEFWDPKTRK
                     WGQPHMQARFSIMKTFLKHSSDPNFLRINFDETKPNDLHIDLNPDLIESVGHACVKDY
                     LHHLHIYKCSGDVEQGSAYFIDRSTVTEDLAKMRDTVISKRLPRRQFIQANSEIVDGK
                     VLLHEYEETAIGMIQSFAEREF"
     gene            complement(<484897..>486159)
                     /locus_tag="CAGL0C05115g"
                     /db_xref="GeneID:2886799"
     mRNA            complement(<484897..>486159)
                     /locus_tag="CAGL0C05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445396.1"
                     /db_xref="GeneID:2886799"
     CDS             complement(484897..486159)
                     /locus_tag="CAGL0C05115g"
                     /note="highly similar to uniprot|P22768 Saccharomyces
                     cerevisiae YOL058w ARG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445396.1"
                     /db_xref="GeneID:2886799"
                     /db_xref="GOA:Q6FWJ8"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ8"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLEQGYEVVAFMADVGQEEDFE
                     AARAKALKIGATKVVISDVREQFVKDIIFPAVQVNAVYEDVYLLGTSLARPVIAKAQI
                     DVAEQEGCFAVSHGCTGKGNDQIRFELSFYALKPDVQVIAPWRLPEFFNRFAGRKDLL
                     DYAAEKGIPVAQTKAKPWSTDENMAHISYEAGILEDPNTTPPKDMWKLITDPMDAPNT
                     PQDITLDFEKGIPVKLTYKDNATGKEHVVTDALELALHVSNLGRANGVGRIDIVENRY
                     INLKSRGCYEQALLTILRKAHVDLEGLVLDKEVRQLRDQFVTTTYSKLLYNGSYFTPE
                     CEFIRAMIEPSQKTVNGTVRLSLYKGNVIVLGRYSNTESLYDATESSMDELTGFLPTD
                     TTGFIAIQAIRVKKFGEAKKASGEKITL"
     gene            complement(<487842..>489110)
                     /locus_tag="CAGL0C05137g"
                     /db_xref="GeneID:2886789"
     mRNA            complement(<487842..>489110)
                     /locus_tag="CAGL0C05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445397.1"
                     /db_xref="GeneID:2886789"
     CDS             complement(487842..489110)
                     /locus_tag="CAGL0C05137g"
                     /note="highly similar to uniprot|P41911 Saccharomyces
                     cerevisiae YOL059w GPD3 or uniprot|Q00055 Saccharomyces
                     cerevisiae YDL022w GPD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445397.1"
                     /db_xref="GeneID:2886789"
                     /db_xref="GOA:Q6FWJ7"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /translation="MFVRLARIPRITRHYRLGLFSTQPKPKPNEYLYYRNKHKSKMEA
                     PIKRSSSAVSLVELEREPFKVTVIGSGNWGTTIAKVVAENTKANPQVFQERVDMWVFD
                     ENIDGTMLTEIINTKHQNVKYLPNIDLPENLVANPDLLKSVEGADILVFNIPHQFLPK
                     IVDQLRGHVEPHVRAISCLKGFEVGKKGVQLLSTYITEELGIECGALSGANLAPEVAK
                     EHWSETTVAYHIPKDYQGDGMDVDHKVLKLLFHRPYFHVSVIDDVAGISIAGALKNVV
                     ALGCGFVEGLGWGNNAAAAIQRVGLGEIIKFGQMFFPESRVETYYQESAGVADLITTC
                     SGGRNVRVATHMAKTGKSAEDSEKELLNGQSAQGVITCKEVHEWLSTCEMIEEFPLFE
                     AVYKIVYEDVPMHKLPEMIEELDDIVVAGQ"
     gene            <492512..>494419
                     /locus_tag="CAGL0C05159g"
                     /db_xref="GeneID:2886790"
     mRNA            <492512..>494419
                     /locus_tag="CAGL0C05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445398.1"
                     /db_xref="GeneID:2886790"
     CDS             492512..494419
                     /locus_tag="CAGL0C05159g"
                     /note="highly similar to uniprot|Q12296 Saccharomyces
                     cerevisiae YOL060c AMI3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445398.1"
                     /db_xref="GeneID:2886790"
                     /db_xref="GOA:Q6FWJ6"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ6"
                     /translation="MNSVAYSSIRYLPLLLRYGRALPLLNNPHALEQEHHESESDLVY
                     YGVVSMFLVVLGGVFAGLTLGLMGQDEIYLTVINTSGTQKEKQLSGKVLRLISRGKHW
                     VLVTLLLSNVITNETLPIVLDRCLNGGWQAVISSTILIVVFGEIIPQSICVKYGLEVG
                     AFFAPFVLVLMYLMYPVAYPIALLLDYILGEDHGTVYKKSGLKTLVTLHQTMGVERLT
                     TDEVTIISAVLDLKDKKVKEIMTPIENVFTLSADKILDEKTIEEIFNSGFSRIPIHLP
                     NEPMNFIGMLIVRILISYDPEDALPISSFPLATLPETSPNTSCLNILNYFQEGKSHMC
                     IVSERPGSSNGSIGVVTLEDVIEELIGEEIVDESDVFVDIHQHIMREQPGPLSKRHVT
                     SYLHHLYTTSSKDSCVPLLNSKLNNYSSINEHKPVNHSHPPNLPNGSQLQLAPSNLAS
                     NPLDIKKSFVTIKKLPPGELISPSNKDYSNEHLRLNEQQGENRRLSQGEQQLLQEHAN
                     LSHKAIDYTQSSGKPIRITSSTTTHDPNENGTEDSAKNVLISSSYQSTANGIVESVIT
                     VKGVAKTIIEDDQSVYHDNHEIQHDISKMNSSTDLLLADHDEKSRSSTPVSDNGKKKK
                     KSKKKKRRSKK"
     gene            complement(<494688..>496133)
                     /locus_tag="CAGL0C05181g"
                     /db_xref="GeneID:2886791"
     mRNA            complement(<494688..>496133)
                     /locus_tag="CAGL0C05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445399.1"
                     /db_xref="GeneID:2886791"
     CDS             complement(494688..496133)
                     /locus_tag="CAGL0C05181g"
                     /note="highly similar to uniprot|Q12265 Saccharomyces
                     cerevisiae YOL061w PRS5 ribose-phosphate
                     pyrophosphokinases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445399.1"
                     /db_xref="GeneID:2886791"
                     /db_xref="GOA:Q6FWJ5"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ5"
                     /translation="MSNIVIFGGDSHPDLVKRICENLDIEPAKVTLGKFSNGETSVQL
                     GSSVREKDVYVIQSGCGHVNDTFLQLLILISACKSSSASRVTAVMPYFCYSRQPDIPY
                     TVKGAPIISNPKESNPTDSRPGTPGFKLMTQKPGSESPFKSLDTAIRSTIHMENPQPM
                     RKPAPPTPQMSQSRIPVIPGGKAQPPSGSSNDAGEMFNAQNAGYKLWVVQAGTLIANL
                     LTAAGADHVITMDLHDPQFPGFFDIPVDNLYCKPIVQGYIKHEIPDYKDAVIVSPDAG
                     GAKRATAIADALELSFALIHKERRSQLLKGPPDASLSSGGGVPLSPKPLVANLNNASI
                     AGPSSTEMRRSSSSASIHSNASQSSASKYIQTTMLVGDVRDKVCIIIDDLVDTSYTIN
                     RAAKLLKDQGAKKVYAIITHGIFSGDALTRIRSSKIDKLVISNSVPQDRTVSILGKDR
                     VDVIDVSKVFGEAIRRIHNGESISMLFEHGW"
     gene            <496561..>497988
                     /locus_tag="CAGL0C05203g"
                     /db_xref="GeneID:2886781"
     mRNA            <496561..>497988
                     /locus_tag="CAGL0C05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445400.1"
                     /db_xref="GeneID:2886781"
     CDS             496561..497988
                     /locus_tag="CAGL0C05203g"
                     /note="highly similar to uniprot|Q99186 Saccharomyces
                     cerevisiae YOL062c APM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445400.1"
                     /db_xref="GeneID:2886781"
                     /db_xref="GOA:Q6FWJ4"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ4"
                     /translation="MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLDVRS
                     PILTLGSTTFQHIRSNVHGDDLWLVSVTRSNINCGAVWEFLYKFDHMLELYGLNNEEF
                     LKEEFMVCYELLDVMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLP
                     KIPKFLRRTSSFLNQESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVS
                     KEGSILKSYVDGTIDLVTHLSGTPVCQFGLNDSLSVKNDDYGDSFDYIKNKKAIPKAA
                     AGSVLLEDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTY
                     SSSGTAVEYRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAML
                     WTFNKYNGLTENTLSAVTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTI
                     KESERYKTVKWIRYVSKSGSYEIRY"
     gene            <498337..>500970
                     /locus_tag="CAGL0C05225g"
                     /db_xref="GeneID:2886780"
     mRNA            <498337..>500970
                     /locus_tag="CAGL0C05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445401.1"
                     /db_xref="GeneID:2886780"
     CDS             498337..500970
                     /locus_tag="CAGL0C05225g"
                     /inference="similar to AA sequence:UniProtKB:Q08226"
                     /note="similar to uniprot|Q08226 Saccharomyces cerevisiae
                     YOL063c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445401.1"
                     /db_xref="GeneID:2886780"
                     /db_xref="GOA:Q6FWJ3"
                     /db_xref="InterPro:IPR014839"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ3"
                     /translation="MDEQAYQIWLLSRRIRKKLDTPSECYDYEVFQSIGTPLTEDIVS
                     IDRYYQCYNNQGSDLLPHIEPYLAKKVSEIEADNELTDSQDEFIANVKRDRDTREPVW
                     SNWKSHQPADNLLPSDMKLCVNFTVRKYVSRKSVEGFGFKNNLMQIFGDYIIIGRSST
                     VEIHNRACLTAASKLFYLKLSDWSAHIDETTMTEQLKIPDAFISTNLMDVTINYMKIL
                     EIKGGFYLCLCCDSGIVLFYSLATIVMFIEDNKHGTSRIEIAPYMVLRTPVSCWSADS
                     IDYDGRTYIALGHNGPGISLFVISYDEDNVVVGPVHCKEVITVHNVPCLSFIPGETNT
                     DGSLLLVYASIFGNLTSLAIKFDQTNNDIDVSMKDTQFFGEFCWTVTPLTSADFMEVS
                     AYEFLNLNYQKVSKVSTLSSMCQDSQILGNSPSNCYKTKSFGIGALTTQVKVPVSQLE
                     LSCRYGMVNLPVKLRFTTFDNEGFIQEARLLPNYISGIPPGGTIEFFLHNNTEVQYKV
                     DVQSAQKEKVRFNYAFPALSSETLYEDIERRIEKVLDSTTLDNNLNSRQNDGFSQLFK
                     VRQKSQIWGEKNGLKYQYNRNYLTTIYNSHDLEELSQPFSQVSNDYVVLCASSVFHSG
                     YRGSWKDIAPYNINEITSTENEEIPEDHKFLHPSLSLASAQEGNQRKWGIHNHVKKVH
                     DLLNCIEPNTRNYPMGYKLKEFHSGFLLVTTAQKVYLVKTHPMLILSYTSDEIFPLES
                     ITLCSFKGTIMALNRINFVCHIKEMNCIAVASQVGLISLLRLTKYKGIHSFRQEYILG
                     WNTLGPENDDEFQCIYSKLHGSTNVYCGIDDIDFPFLEINGMDYIYCPRDDVKGVAEY
                     AYLIVSFGSDIAKFKIDRTQV"
     gene            <501476..>502549
                     /locus_tag="CAGL0C05247g"
                     /db_xref="GeneID:2886786"
     mRNA            <501476..>502549
                     /locus_tag="CAGL0C05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445402.1"
                     /db_xref="GeneID:2886786"
     CDS             501476..502549
                     /locus_tag="CAGL0C05247g"
                     /note="highly similar to uniprot|P32179 Saccharomyces
                     cerevisiae YOL064c MET22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445402.1"
                     /db_xref="GeneID:2886786"
                     /db_xref="GOA:Q6FWJ2"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ2"
                     /translation="MAFERELLVATQAVRKASLLTRRIQADVIAHRDSTTITKSDSSP
                     VTVGDFAAQTIIINAIKSNFPDDKIVGEESSDGLSDEFVSEILHQIKENDKIFDKQYN
                     DSSIQFTSNEHPLSSLDDVRKVIDCGNYEGGNKGRFWCLDPIDGTKGFLRGDQFAVCL
                     GLIIDGIVQVGCIGCPNLSLEKYGGSDLPGYKEFGYLFSAIKTQGAFYATCSTKVPDW
                     KPIKVRQLKDTSEMISLEGVEKSHSSHDEQSQIKAKLGINNSLHLDSQVKYCLLALGL
                     ADVYLRLPIKLSYREKIWDHAAGNTIVLEAGGYHTDSMENLPLDFGKGRTLQTKGVIA
                     SSGPKDLHDLIVKTSADVINSRG"
     gene            <502777..>503910
                     /locus_tag="CAGL0C05269g"
                     /db_xref="GeneID:2886838"
     mRNA            <502777..>503910
                     /locus_tag="CAGL0C05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445403.1"
                     /db_xref="GeneID:2886838"
     CDS             502777..503910
                     /locus_tag="CAGL0C05269g"
                     /inference="similar to AA sequence:UniProtKB:Q08227"
                     /note="similar to uniprot|Q08227 Saccharomyces cerevisiae
                     YOL065c INP54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445403.1"
                     /db_xref="GeneID:2886838"
                     /db_xref="GOA:Q6FWJ1"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ1"
                     /translation="MSTTNSDSNGLWDVSVVTLNCARDFPFRDQQEKLAILKELITFN
                     SNNAQDIYAFGFQELVRIWEGAGKIRMEAALIDILKDILDILDELFPQNNYKKLGYSY
                     VGATAVLVVGKETIECHDSASTTSNCGKFGSTLKGGTAYSFRLKKNESTVLQTFTFIS
                     CHLNANEGEDNMTSRINDYDRIMTQCNRDFSDLEFRKGHIFVFGDLNFRVNDPNFKAH
                     IASEWEPTLRKHEELNHLRAKHVIFRGFDEQPVTFPPTYKYKVGDMISYNNKRIPSWC
                     DRILYKKYPSGLPMGKARYESLERVRHMQFTDHQAVGLAIQVPDLTKDNKHELELIRL
                     LEPLNETLGYFADTLLAYEWLRRSTPVYILAALILFYFFYNLL"
     gene            <504216..>505970
                     /locus_tag="CAGL0C05291g"
                     /db_xref="GeneID:2886839"
     mRNA            <504216..>505970
                     /locus_tag="CAGL0C05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445404.1"
                     /db_xref="GeneID:2886839"
     CDS             504216..505970
                     /locus_tag="CAGL0C05291g"
                     /inference="similar to AA sequence:UniProtKB:Q12362"
                     /note="similar to uniprot|Q12362 Saccharomyces cerevisiae
                     YOL066c RIB2 DRAP deaminase or uniprot|Q12069
                     Saccharomyces cerevisiae YDL036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445404.1"
                     /db_xref="GeneID:2886839"
                     /db_xref="GOA:Q6FWJ0"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FWJ0"
                     /translation="MIEGSDPSRSPSAFEQHLEREIKIAKEEQKLKNSRKQKRKFDAT
                     NQMRDDNGFKIRVAEAGAEGKKVTDPEYTVVIDGPLRRVEPYEFEYKTFCKERWRDRK
                     IIDIFTQEFRDQEPDHYRKTIAKGAVSVNGKPANLETILRNGEMITHKMHRHEPPVTS
                     RPIKIVFENDDILVIDKPGGIPVHPTGRYRYNTITKILEKQMKRSVHPCNRLDRLTSG
                     LMFLAKTPEGADQMADQMKTREVTKEYIARVVGEFPTGEITVEKPLKSYDPKVSLNII
                     CDDTNEDDAKPAKTVFQRISFDGQTSIVKCKPLTGRTHQIRVHLQFLGHPIANDPIYS
                     NTEVWGPNFDSKKYEEIVLKLDAFGKTKCAESWYHPDAQGEVMSSYRCEVCDIPLYTD
                     PGPNDLDLWLHAYKYESTEIDPDTGKKKWSYRTELPEWALAPNRKYMVQAIEEADKCG
                     PTKTAFSVGAVLVNGTEVLSVGHSRELPGNTHAEQCALEKYFETHNTDKVPPGTVIFT
                     TMEPCSFRLSGNLPCLQRIMAQDGNISTVFVGVMEPDTFVKNNTSLTDLENNNINYIQ
                     IPGYEEQCKIIAFKGHDE"
     gene            <506270..>508789
                     /locus_tag="CAGL0C05313g"
                     /db_xref="GeneID:2886840"
     mRNA            <506270..>508789
                     /locus_tag="CAGL0C05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445405.1"
                     /db_xref="GeneID:2886840"
     CDS             506270..508789
                     /locus_tag="CAGL0C05313g"
                     /inference="similar to AA sequence:UniProtKB:P12945"
                     /note="similar to uniprot|P12945 Saccharomyces cerevisiae
                     YDL040c NAT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445405.1"
                     /db_xref="GeneID:2886840"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI9"
                     /translation="MSRRRGGVKAKPVSRLGTKDTTQFLEALKLYEGKNYKKSIKILD
                     GVLKKESSNVDCLALKGLDLYSIGEKDEATQYIENAVSKINGTTASAMCCHILGIYMR
                     NIKDYHKSILWFQASLENGSNNYQIYRDLATLYSQVNDHKKALIARKAYWETYMGYRA
                     NWTALAVSQDINGERQQAINTLSQFEKIASGKISEAEKYEHNECLMYKNDIMYRNAGS
                     NADKLQKVLNHLTDVEKDIFDKYAVLERKASIYMKMGNMKDASIMYRTLIKRNPDNFK
                     YYNLLEVSLGIRGDNRLRKALYEKLEKFYPNCDPPRYIPLTFIQDETELSKKLEQYIH
                     PMLKRGVPATFGSLKNLYRSRGDKVIVPIEKIALEYLKNIDERKEQIPYIWTCYFLSQ
                     HYLYLKDFTQAQSYIDKAMDHTPTMVEFYIQKARILKHLGLLDSASDILEEARKLDLQ
                     DRFINCKSVKYLLRANKIDEAVEVASLFTKNEDSVNGLKDLHLVEASWFIVELGEAYQ
                     RLYLDSSNKLKELKKEIEILEESEEKEVKNQELKDAEGNCDKFQGLSLKRFLAISKFY
                     KQFEDDQLDFHSYCMRKGTPRAYLEMLEWGKKLYTMPMYVRAMKRASSTYFELHDIRT
                     KRSSDDSGIENGSKNKKPKKESAAARKRREEEEAKVLAYPKEQEKDVFGLQLLESKNF
                     LEDFAENFYNGYLNQVSQEEKDYCLDFDYNLRNKKLALCLSDLSKLGSIYGEKSALYG
                     AMAITLFLQTKKVTDHDEIAKKVVEKAFENIEHFNQGDRDNEEFDWIEFLKNKYTGNL
                     VAYLFLYKHHIGDKETLKTLIIDQLSNEEPYEQSKVIRYTL"
     gene            <509230..>509829
                     /locus_tag="CAGL0C05335g"
                     /db_xref="GeneID:2886841"
     mRNA            <509230..>509829
                     /locus_tag="CAGL0C05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445406.1"
                     /db_xref="GeneID:2886841"
     CDS             509230..509829
                     /locus_tag="CAGL0C05335g"
                     /inference="similar to AA sequence:UniProtKB:P32607"
                     /note="similar to uniprot|P32607 Saccharomyces cerevisiae
                     YOL067c RTG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445406.1"
                     /db_xref="GeneID:2886841"
                     /db_xref="GOA:Q6FWI8"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI8"
                     /translation="MSTPISQSVPSSSGQMKAARKRNDNMTDKIQELLRLIPAEFFQE
                     SYGSGNESGANGETPGPASGAPKLKGTGTKDGRPNKGQILTQAVEYISHLQNQVDTYN
                     REEIELMVKVTELAKETGTIVNDINLENTSAEIALANIGVGPLAAASAGDETQDQNSE
                     SKPNSSVSSSVADEENSRGTPKKAQMSKFEYGGYAEYAS"
     gene            <510471..>512000
                     /locus_tag="CAGL0C05357g"
                     /db_xref="GeneID:2886842"
     mRNA            <510471..>512000
                     /locus_tag="CAGL0C05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445407.1"
                     /db_xref="GeneID:2886842"
     CDS             510471..512000
                     /locus_tag="CAGL0C05357g"
                     /inference="similar to AA sequence:UniProtKB:P06700"
                     /note="similar to uniprot|P06700 Saccharomyces cerevisiae
                     YDL042c SIR2 or uniprot|P53685 Saccharomyces cerevisiae
                     YOL068c HST1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445407.1"
                     /db_xref="GeneID:2886842"
                     /db_xref="GOA:Q6FWI7"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /translation="MIISRGSHVDEEPVAKKPRISVGEMTDDTTDDGLNTEEIRAPYT
                     TEEMDEPEKAALLPKIPKKSPVSIGMNPENGKYVLPNYSKDESLNARKFLKYYGLRKF
                     LDTYLPEELNSLYIYSLIKLLGFEIRDKELLSSLYRFFHPVKSSDQFKLEYEDFTDPL
                     EKKEAVKLIKDLQKAINRVLATRIRLSNFYTIDHFVSKIKKAERILVLTGAGVSTSLG
                     IPDFRSSEGFYSKIQHLGLDDPQDVFNYDIFMQDPSVFYNIAHMILPPENMYSPLHSF
                     IKMLQDKGKLLRNYTQNIDNLESYAGIDPEKLVQCHGSFATASCVTCHWQIPGEKIFS
                     NIRSMELPLCPYCYQKRREYFPNTGDEEYDTLKGNLESGIQNNNFALKSYGVLKPDIT
                     FFGEALPSKFHKTIREDIMKCDLLICIGTSLKVAPVSEIVNMIPAYVPQVLINKDPVK
                     HAEFDIELLGFCDDVATVVAQKCEWDIPHKDWEGKLKKKRFDVNEIERGVFNIEAGSP
                     E"
     gene            complement(<512277..>514118)
                     /locus_tag="CAGL0C05379g"
                     /db_xref="GeneID:2886843"
     mRNA            complement(<512277..>514118)
                     /locus_tag="CAGL0C05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445408.1"
                     /db_xref="GeneID:2886843"
     CDS             complement(512277..514118)
                     /locus_tag="CAGL0C05379g"
                     /note="highly similar to uniprot|P40150 Saccharomyces
                     cerevisiae YNL209w SSB2 or uniprot|P11484 Saccharomyces
                     cerevisiae YDL229w SSB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445408.1"
                     /db_xref="GeneID:2886843"
                     /db_xref="GOA:Q876N3"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MADGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDGA
                     PVIEVEYLGENKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGG
                     VYTVKSTSGNTHLGGQDFDTNLLEHFKGEFKKKTGLDISNDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFEGEDFEASLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQI
                     DEVVLVGGSTRIPKVQKLLSDYFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDET
                     KDLLLLDVAPLSLGVGMQGDIFGVVVPRNTTVPTIKRRTFTTVGDNQTTVQFPVYQGE
                     RVNCKENTLLGEFDLKNIPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITIS
                     NAVGRLSSEDIEKMVNQAEEFKAADEAFAKRHEAKQRLESYVASIEQTVTDPVLSSKL
                     KRGSKTKIEAALADALSALQIEDGSAEEYRKAEVGLKRVVTKAMSSR"
     gene            <515623..>515886
                     /locus_tag="CAGL0C05401g"
                     /db_xref="GeneID:2886931"
     mRNA            <515623..>515886
                     /locus_tag="CAGL0C05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445409.1"
                     /db_xref="GeneID:2886931"
     CDS             515623..515886
                     /locus_tag="CAGL0C05401g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445409.1"
                     /db_xref="GeneID:2886931"
                     /db_xref="GOA:Q6FWI5"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI5"
                     /translation="MLSKLLLTAVNIQLITDGSQIHYFHLRAIEEYVPKIRWKTIMPF
                     TGGFQYDLAVSLFSKTTIRPLFLRLFMLRKIIYQENIDNLFNA"
     gene            complement(<516403..>517416)
                     /locus_tag="CAGL0C05423g"
                     /db_xref="GeneID:2886944"
     mRNA            complement(<516403..>517416)
                     /locus_tag="CAGL0C05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445410.1"
                     /db_xref="GeneID:2886944"
     CDS             complement(516403..517416)
                     /locus_tag="CAGL0C05423g"
                     /inference="similar to AA sequence:UniProtKB:P25044"
                     /note="similar to uniprot|P25044 Saccharomyces cerevisiae
                     YDL230w PTP1 protein tyrosine phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445410.1"
                     /db_xref="GeneID:2886944"
                     /db_xref="GOA:Q6FWI4"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR016277"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI4"
                     /translation="MRPWYIDQPDVELLRKFKFIQNQEDERLREATIVTADVEVEKRW
                     SLGVSILEKNDARNRYVNIMPYERNRVKLKVVNPRINNDYINASYVKVDVPEQSMNPG
                     YYIATQGPTKNTWQQFWQMCYNECNHGDIVIVMVTPLVEYNREKCYKYWPSSPKEGIF
                     VSPKLQNPSGLDGDVSEFRDELSIEYIDSERIDDTYTYTKLKIVSQGGSEKNVHHFYF
                     DQWRDMSKPEEIVPIMKLCEHSHGLNPRGNPIIVHCSAGVGRSGTFIALDHLVHDTHD
                     FKNVSEFPTIQQLRKPLADYKRDLIEQIVLQLRSQRMKMVQMKDQYIFIYHAAKYLYD
                     MIA"
     gene            <517886..>521224
                     /locus_tag="CAGL0C05445g"
                     /db_xref="GeneID:2886945"
     mRNA            <517886..>521224
                     /locus_tag="CAGL0C05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445411.1"
                     /db_xref="GeneID:2886945"
     CDS             517886..521224
                     /locus_tag="CAGL0C05445g"
                     /inference="similar to AA sequence:UniProtKB:Q07660"
                     /note="similar to uniprot|Q07660 Saccharomyces cerevisiae
                     YDL231c BRE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445411.1"
                     /db_xref="GeneID:2886945"
                     /db_xref="GOA:Q6FWI3"
                     /db_xref="InterPro:IPR018820"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI3"
                     /translation="MSGFQRQKEKSSFLHLNDLSQASPFYQSSTVNLKEQANKYTSPL
                     GPRSLASSPQRSLSSFSQVRLDNLVKEKQWDEIEDFLLEELRDGYFDAMFAKPEPDFR
                     SDPTNEDNRITENNTNVPKRLTSQIHTTVKNDIHVLSTRFLEDASHNVISILKFSITF
                     FVAFIICAIHPSGSWLGHRYRYFLPIAAVIHHPVRNVGIQLEISILSISGAAFGLGWA
                     SLAWYVSTATHPVASHQGAILFQSLFMALLFSTFVRELYRRLNYFFNSFSVAIIFTHT
                     VQLVNNKHDLHWKLYWDFGLSYLFGILLSCFICAVVFPQTGNSSLVREYRKSLFACRD
                     FLVSLIDKENVANVDRKDKHQKNMIQQLNVGLAQEYREISAQISFSKYDRIKLKTLRN
                     SLTALVSPLRVIPVNSELLDEAYLTKLYDALEKSALSKGQSLANSQANTGASTPLGKH
                     FASGSMTKLSNRILKGDFSQKDIYLSILRSSFSKDIFSLLIEMITVLESLANILDMVN
                     RNKNENIEKTLTELNARLKHRIYKLDMCYRNFTSSSYFGPDILKDTACVDCFLFLRYI
                     RNSAKGLVTVIDDCEKLLEDVHWRLLLPNYPLDRALTRLSKQCELDEGAGNVLHYFET
                     KKDVDEIFERLYNAYTSRHKYNKDEKNEKLGATIRAMDHTDFNFHSTKNKWRYNLWRF
                     TTILSGTEMKWSIKVVFIMVFLCIPAWLPESYHWYQEFQCWWCPMIFYLLVHRRYSGS
                     WSSPVRRVGYALLGIFWGWAANQARHFSSPYVICTFAAILVVPISLNFLVYKNTKSSM
                     TSLLCFAVICLEPYSKGDDNHNTSKIWKNTWITGLALLIGISLSIPINWVVWSFKARV
                     ELRISMSSLLAHLSQSYQTVSDRYLYRDANDEPTDLALALAHIREVRLTQSITAIREL
                     LDKASVEPKFISNFSTVKYNSLINSCSFLLEKIIEARISGTYFEIWEQDNDKEVSRAL
                     MSLRRDSVASVVFVFYILSNCFRSKNKIPRYLPNPILSRKKLYDMIAKFEAIGKMKAT
                     GENKFNQAKGINYNDDTLEKMMFKKHLQVDSSANSSNQYIDYEQYHWTEVHGIAFARA
                     YTDVAEAVHDVVKRCKDILGEEFY"
     gene            complement(<521725..>521838)
                     /locus_tag="CAGL0C05461g"
                     /db_xref="GeneID:9487974"
     mRNA            complement(<521725..>521838)
                     /locus_tag="CAGL0C05461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999480.1"
                     /db_xref="GeneID:9487974"
     CDS             complement(521725..521838)
                     /locus_tag="CAGL0C05461g"
                     /note="highly similar to uniprot|Q99380 Saccharomyces
                     cerevisiae YDL232w OST4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999526.1"
                     /db_xref="GeneID:9487974"
                     /db_xref="InterPro:IPR018943"
                     /db_xref="UniProtKB/TrEMBL:B4UMY5"
                     /translation="MINEGQLQTLVIGFGLAMVVLVVVYHAVASTMAVKRD"
     gene            complement(<522565..>524686)
                     /locus_tag="CAGL0C05467g"
                     /db_xref="GeneID:2886852"
     mRNA            complement(join(<522565..523671,524591..>524686))
                     /locus_tag="CAGL0C05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445412.2"
                     /db_xref="GeneID:2886852"
     CDS             complement(join(522565..523671,524591..524686))
                     /locus_tag="CAGL0C05467g"
                     /note="weakly similar to uniprot|Q07684 Saccharomyces
                     cerevisiae YDL233w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445412.2"
                     /db_xref="GeneID:2886852"
                     /db_xref="GOA:Q6FWI2"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI2"
                     /translation="MCICSCDSSNPSFLRTDTQTYRYTQRDTFHPCMYNQSAKETSQD
                     QHNNSDETYTDSFSDTEHKNKSFHLFDRYVSNMAALKLYRITDMFNETAGQMDHPQHW
                     FHFSSITFIPNAKIKYSKVGGPDDGSVYFEPSLLPMIGKTLATNNVIRIQITVKNIES
                     RLLRDFYVYTEMIVSIESTYSDSSSITVIANMRLFMNKYFKIEWADIKPQAFIPNVGW
                     QAIEEVLYKNPSMINTFRSLSRDDNSNANFNSIGANMMNDYSSQNNAEKFEAITKFRS
                     NFEVFRNVSIYGTHDDIIRVMQIGNVVSAMKNIQEYQRLHNIVSPIEAFMKTAKEFKE
                     RQKEEDKCTFKEMSGLKTPDRKRARNTNEDHDTIYVDSSTPSPESAPQTSSEYCKQEP
                     GTKRRKTK"
     gene            <528599..>530836
                     /locus_tag="CAGL0C05489g"
                     /db_xref="GeneID:2886868"
     mRNA            <528599..>530836
                     /locus_tag="CAGL0C05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445413.1"
                     /db_xref="GeneID:2886868"
     CDS             528599..530836
                     /locus_tag="CAGL0C05489g"
                     /inference="similar to AA sequence:UniProtKB:P48365"
                     /note="similar to uniprot|P48365 Saccharomyces cerevisiae
                     YDL234c GYP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445413.1"
                     /db_xref="GeneID:2886868"
                     /db_xref="GOA:Q6FWI1"
                     /db_xref="InterPro:IPR000195"
                     /translation="MSIELLFCKSQVYIHPTKNLQDNVSGYLLITHQSNSETITSSTI
                     SWIPENSLNEEDINFLNNAETRNINEKILRLPVSSRKLNTLLGSGSFLSSNWQFTIPV
                     LSLYSVQFKLPNTWWYGSCILYSKSPRETESIPVLYFHDDLCPSTISKQKELNRSFDP
                     FNNSNEMYWGGQDFKDALGSIVELKRVESEPTFWLVNATLEDLRNFSSANLKSSEEKP
                     SSSKDDGVTKLKEDAWQKWESTKWSLMSQFADITAKTGSFVGSLIKKHPVVQLVERNK
                     NNYYVQKMLKNPKVVEIQDDFDSAKIYLAKWALSVKEEAERYQEGSYDNPYRRILVSE
                     FGLTGNEDVSFTEEELNRAMERNHPMTKQKWNSLFDSEGRLTVTVNEVKDYIFHGGLA
                     DDATRKEVWPFLLGVYPWDSSEDERKQLRKALHDEYMELKQKWVDREVNLDNDEEEYW
                     KDQLFRIEKDVKRNDRNIDIYKYNTSDNLPFPEDTAPTTDDDDSIKNPNLKKLADILT
                     TYNIFNPNLGYVQGMTDLLSPLYYIIRDEETTFWCFTNFMERMERNFLRDQSGIRDQM
                     LALTDLCQLMLPRLSAHLQKCDSSDLFFCFRMLLVWFKREFNYDDIFNIWEVFFTDFY
                     SSQYQLFFMLAILQKNSSPIVNNLQTFDQVIKYFNDLNSKMNWRDLMVRSELLFIQFH
                     KTADLLARRQEQLIPENSGHDTSDIEGGTEPKTQSYISEHLQTLLSKEVIIQKENTRT
                     KDSIK"
     gene            complement(<530985..>531914)
                     /locus_tag="CAGL0C05511g"
                     /db_xref="GeneID:2886870"
     mRNA            complement(<530985..>531914)
                     /locus_tag="CAGL0C05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445414.1"
                     /db_xref="GeneID:2886870"
     CDS             complement(530985..531914)
                     /locus_tag="CAGL0C05511g"
                     /note="highly similar to uniprot|P19881 Saccharomyces
                     cerevisiae YDL236w PHO13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445414.1"
                     /db_xref="GeneID:2886870"
                     /db_xref="GOA:Q6FWI0"
                     /db_xref="InterPro:IPR006349"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:Q6FWI0"
                     /translation="MTATEDPIKITTKEQAQEFLDSFDTFLFDCDGVLWLGTHLLPNT
                     KEILKMLEDAGKNLVFVTNNSTKSRKQYTKKFAGFGIEVSEEEIFTSGYAAAVYVRDF
                     LNLQPGKDKIWVFGESGIGGELTEMGFEYLGGEDARLNEPFDASTSPFLVDGLDKDVK
                     CVIAGLDTKVNYHRLAVSLQYLQQENVEFVGTNCDSTFPQKGHILPGAGSMVESLATS
                     SGRKPAYCGKPNMNMLNSIVSAKKINKDRCCMVGDRLNTDMKFGADGKLGGTLLVLSG
                     IETEERAFEISPDHPRPRYYIEKLGDIYELLKN"
     gene            complement(<532337..>533572)
                     /locus_tag="CAGL0C05533g"
                     /db_xref="GeneID:2886874"
     mRNA            complement(<532337..>533572)
                     /locus_tag="CAGL0C05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445415.1"
                     /db_xref="GeneID:2886874"
     CDS             complement(532337..533572)
                     /locus_tag="CAGL0C05533g"
                     /inference="similar to AA sequence:UniProtKB:Q07716"
                     /note="similar to uniprot|Q07716 Saccharomyces cerevisiae
                     YDL237w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445415.1"
                     /db_xref="GeneID:2886874"
                     /db_xref="GOA:Q6FWH9"
                     /db_xref="InterPro:IPR017946"
                     /translation="MIPFTAQYLLVCGYVILLGVILLERSGYSAFGLLEKRQDYFHNS
                     HAIMLSSRQDLGVSGPALYELFEKHLLDAYRIPGRYPGGISTLYDTFSEYVFKGTSHE
                     NCSVETSAVAKLTRDVTPLPIHSHNDYWRDVPLLKGLAYGSVSTEADVWVHPHKDHPY
                     NSSTDKLEDYVLAVGHDEDYIDPLRKTLEKLYTDPLQSLLEGVNCGKSNNSKTQKNGV
                     FYTANHIPLFFYIDFKSDDNILTYKLLLEKYFTQLIQAGYLTYYDMDTGKIIQGQVTV
                     IMTGNYPNNTDVLDNGKADGYFGDRKRYLLQDANLLELNEESAKMAVTASTSLSEILK
                     MVGSSNLKVIMRGHLDKEEITAIKKYIDNAHSFDLKTRIWGVPSWPRKTMKRLWKQQI
                     EDLNSDFLNVDDLKAAAMF"
     gene            <534398..>535849
                     /locus_tag="CAGL0C05555g"
                     /db_xref="GeneID:2886875"
     mRNA            <534398..>535849
                     /locus_tag="CAGL0C05555g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445416.1"
                     /db_xref="GeneID:2886875"
     CDS             534398..535849
                     /locus_tag="CAGL0C05555g"
                     /inference="similar to AA sequence:UniProtKB:Q07729"
                     /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
                     YDL238c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445416.1"
                     /db_xref="GeneID:2886875"
                     /db_xref="GOA:Q6FWH8"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH8"
                     /translation="MVSLREQLYRLVAFHGTFIDTPVLGQLRVREECTVVVHMTDDGC
                     GTIVLIRDHCEPMDAVREYDPTVHESDVKIVAATDGSGSQFFFPGFIDTHIHASQYPN
                     CGLFGKSTLLDWLETYTFPLEASLADLDIASDVYTSVIKRTLSAGTTTATYYTTIDTE
                     SSKLMGTLCSKLGQRALIGKVCMDQNAPDYYIEDAKDSIESCKEMISFFKNDLNDPRV
                     NAIITPRFAPSCSKDLLAALGALAKENELHIQTHLSENNKEISWVKSLFPECKSYTDV
                     YYQHGLLGERTVLAHCIHCSEDEADLIKKTNSGVSHCPVSNSALASGECRVKWWLQKG
                     VSVGLGTDVSGGYSADILLSARHAHLVSRHLAMKTDEEKEKINVMLSVNECLYLATMG
                     GAGVLHMQDQIGSFDVGKQFDTQLISLDVPNSNVQLFYWQKLNGTKAIKGIRNQPPLL
                     NHEDIIAKWFFNGDDRNVKYTWVSGQLVHSKDI"
     gene            <536419..>538278
                     /locus_tag="CAGL0C05577g"
                     /db_xref="GeneID:2886877"
     mRNA            <536419..>538278
                     /locus_tag="CAGL0C05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445417.1"
                     /db_xref="GeneID:2886877"
     CDS             536419..538278
                     /locus_tag="CAGL0C05577g"
                     /note="weakly similar to uniprot|Q07732 Saccharomyces
                     cerevisiae YDL239c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445417.1"
                     /db_xref="GeneID:2886877"
                     /db_xref="GOA:Q6FWH7"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH7"
                     /translation="MDKRGFFGIVKDIFYSNALDENEGHLRSMSQNLSPVILQLNNKT
                     LLSPTKTPIYNSVGINSSPRSPSPASNLLSHPSNYRHNTNPSQINKNPLLEERKVSSL
                     KDIESSSTADKNGRNLSALEITDKLLFSMDNDNLILNDIEDELDGFTPIDTYVESKDM
                     PTKYNNSMRITKLRSCYNIDIGRAISNCYGDYLKRIGNNFRNLEMEFQQQYQAITING
                     GFEELISLLVNLTSIKEELRSGNLIYRSDCLVSEMSVYLDHYFELLEVNENLLRDIDQ
                     YKLRYSYMVDKVRKSESSIEKCNSLIEKQQAFKKKLVHTLRGLILFDIPLGQVILDYI
                     EQCNGNTTFEQTFREKNSAITNFLTTASTKKINLLQKENDSLTKDIKLVKEAQKSLTD
                     TNKNLKEENDLLKGRMELLKQKQEKEIQELKKENKRLLTMNVGLTKELDEIKRDKGKL
                     EGNLLKEKNKNTLLKNELASIANDNNDLKSSLQNLEGNIEESLTEEALKVRFISLSSE
                     NYNTLDVECIDRQDLVSLRNLLKVLTLTLEIPFSKLQTTIPLLAIRLYHENTSLLSFC
                     NTLHMHLYGKPLAIKNYRRWAYADYLKTCNIHEVQHPIKPILEAMFNKIAPKV"
     gene            complement(<538455..>541559)
                     /locus_tag="CAGL0C05599g"
                     /db_xref="GeneID:2886878"
     mRNA            complement(<538455..>541559)
                     /locus_tag="CAGL0C05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445418.1"
                     /db_xref="GeneID:2886878"
     CDS             complement(538455..541559)
                     /locus_tag="CAGL0C05599g"
                     /inference="similar to AA sequence:UniProtKB:P35688"
                     /note="similar to uniprot|P35688 Saccharomyces cerevisiae
                     YDL240w LRG1 GTPase-activating protein of the rho/rac
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445418.1"
                     /db_xref="GeneID:2886878"
                     /db_xref="GOA:Q6FWH6"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH6"
                     /translation="MVKGNMHSSVNIVSTGTVLQDNHSHINKKICSHCDKPINIDKTN
                     RKPALKALGKYFHEECFVCHDCSRPLRPKYFPFDHQHNGNVETLLLCQYDYFKRNGLL
                     CHVCDEPLRGLYFTAFGNRYDEEHFSCTICKTPCGVKKCFIHDDQLYCRFHFMKYFSK
                     RCIGCKFPISDQYIEFPKGDQVLCWHPECYGIHKYWHVDLSSDTLNLPEIPKLEFNPT
                     ISTESNYSEQASNLDKQMQAFSFILNKTWSILYRFEEEAASCISDMFQSLTISDQKKG
                     VEATALLVLKTGCLFKGLDSLNIFQIDTQQKDLPHTLPSYRESPDFKPNYLKLPKNLS
                     KKLMIYLQFLRKLNQDDKKSSLNISLCMSTITGLAQYLKLLTRYGLHIALERNRYLKT
                     VNPLMKFLKEVEKNEIFDSDPFRYINIPINTNDNCVRCQTYIQDECIQFNEYRWHLKC
                     FSCNICSESIKPSDVTDATFNKEKMFILCSRCSVDDEVSVPGFKYVTNLSQLIFLLKI
                     ALVKTKTVMDLQNKDNKVANIYENGNVPSKFSMEQTYIRTLNDVKRLKSRRESIRVSN
                     EKKEARKSVVLEIPETELGSGKREDKNLIIKTDTPTENSGRDEQLFGNNKTLTLDDIS
                     RIVAAEQARELRPNAFTHFKTLEDGSDEFNSNERKRTGVYYSELDKSALVTLKYISLS
                     LLMSDLKKFNDYSFDFEKLRQQISREVRPSQNGNFWNKMWNIVNKDGKKSAPRKVFGT
                     NLDDLSLYCGVDSELGVGPSKIRVPVLVDELISSLKQLDMSVEGIFRKNGNIRRLREL
                     TNQIDAFPSRSIDFSKENAIQLSALLKKFLRELPDPLLTSDLYLLWISSAKISATVRK
                     QKLFSLIFALLPLYNRNVLEVLLSFLNWTSSFSYIENEMGSKMDIHNLSTVIAPNILS
                     SGLETPHNVEMKSLEVPADTFAQNNGENHFLAIEVIDFLITHSEDICMVPTFLMKLLE
                     ETKNLKLSTFEDINAYVLESLLHNKIDYSEFEIRKSPIVKNAVTKITRSSVLEVKGAI
                     EISQ"
CONTIG      join(CR380949.1:1..558804)
//
DBGET integrated database retrieval system