GenomeNet

Database: RefSeq
Entry: NC_006027
LinkDB: NC_006027
Original site: NC_006027 
LOCUS       NC_006027             651701 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome D complete sequence.
ACCESSION   NC_006027
VERSION     NC_006027.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 651701)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 651701)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380950.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..651701
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="D"
     gene            complement(<17042..>17914)
                     /locus_tag="CAGL0D00154g"
                     /db_xref="GeneID:2887187"
     mRNA            complement(<17042..>17914)
                     /locus_tag="CAGL0D00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445420.1"
                     /db_xref="GeneID:2887187"
     CDS             complement(17042..17914)
                     /locus_tag="CAGL0D00154g"
                     /inference="similar to AA sequence:UniProtKB:P53386"
                     /note="similar to uniprot|P53386 Saccharomyces cerevisiae
                     YPR192w and similar to uniprot|Q12302 Saccharomyces
                     cerevisiae YLL053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445420.1"
                     /db_xref="GeneID:2887187"
                     /db_xref="GOA:Q6FWH4"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH4"
                     /translation="METEHQADKNAELGYDSGSTVAPPNKYSTLRSRFNLGPDTMRNH
                     VIAFFGELVGTFMFLWCAYVIANIANHDVLLDVYPDGSHPGQLIMIALGFGFSVMFSI
                     WCFAGVSGGALNPAVSLSLALSRTITPMRCIVMWVAQMLGGMAAGGAASGMTPGPVLY
                     ANTLGNGCSRTRGLFLEMFGTTILCLTVLMTAVEKGESNFMCALPIGISLFIGHLALT
                     GYTGTGVNPARSFGAALAARSFPVYHWIYWIGPLLGAILAWFVWQVLQWLDYSSYVTR
                     EKEAAAKTKVMVEP"
     gene            <23693..>25075
                     /locus_tag="CAGL0D00176g"
                     /db_xref="GeneID:2887084"
     mRNA            <23693..>25075
                     /locus_tag="CAGL0D00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445421.1"
                     /db_xref="GeneID:2887084"
     CDS             23693..25075
                     /locus_tag="CAGL0D00176g"
                     /note="highly similar to uniprot|P39708 Saccharomyces
                     cerevisiae YAL062w GDH3 NADP-glutamate dehydrogenase or
                     uniprot|P07262 Saccharomyces cerevisiae YOR375c GDH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445421.1"
                     /db_xref="GeneID:2887084"
                     /db_xref="GOA:Q6FWH3"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH3"
                     /translation="MSSQVNEPEFQQAYHEVVSSLKDSSLFEKHPKYAKVLPVVSVPE
                     RIIQFRVTWENDNHEQEVATGYRVQFNSAKGPYKGGLRFHPSVNLSILKFLGFEQIFK
                     NALTGLDMGGAKGGLCVDLKGRSDNEIRRICYAFMRELHRHIGADTDVPAGDIGVGGR
                     EIGYLFGAYRHYTNSWEGVLTGKGLNWGGSLIRPEATGYGLVYYTQSMIDYATKGKES
                     FSGKRVAISGSGNVAQFAALKVIELGGIVVSLSDSKGCIISETGITTEQIASIAEAKI
                     KFKSLEQIVGEYSAFAENKVEYVAGARPWTLVGKVDIALPCATQNEVSGDEAKALVAA
                     GVKFVAEGSNMGCTPEAIDVFESSRATASAPGEAVWYAMGKNSNLGGVLTSGLEMAQN
                     SQRMSWTSEEVDQELKKGMVNCFNDCIEAAEKYSNESNKNALPSLVKGGNIASFIKVA
                     DAMFDQGDVF"
     gene            <27559..>28710
                     /locus_tag="CAGL0D00198g"
                     /db_xref="GeneID:2887040"
     mRNA            <27559..>28710
                     /locus_tag="CAGL0D00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445422.1"
                     /db_xref="GeneID:2887040"
     CDS             27559..28710
                     /locus_tag="CAGL0D00198g"
                     /inference="similar to AA sequence:UniProtKB:P39714"
                     /note="similar to uniprot|P39714 Saccharomyces cerevisiae
                     YAL060w FUN49 or uniprot|P39713 Saccharomyces cerevisiae
                     YAL061w FUN50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445422.1"
                     /db_xref="GeneID:2887040"
                     /db_xref="GOA:Q6FWH2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH2"
                     /translation="MRSLAYFKTGDIHFTDKIDTPKINNDHELMIDVAWCGICGTDLH
                     EFLEGPIFMPKDGDTHYLSGLDLPLPMGHEMSGIVKEVGKGVTRFKPGDRVVIEATTS
                     CGDTHRWPKSKVAKGELCPACEMGLPNCCTHGSFQGLGSVGGGFAEQVVVGEKHVVKI
                     PDKLPLDVAALVEPLSVAWHAARLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIV
                     VSEPAKLRRELAEKLNVVVFNPTHTRAQNAIEKLKELSPKDHGFDYTFDCSGVQDTFN
                     AAVKAACIQGHIVNVAIWGPKPVAFHPMDMTYGEKKLTGTMGYVTRDFEEVVDAIDKG
                     YISIEECKLLITGRVKLEDGMEKGFHELIEHKETNVKILLTPNNHGELQ"
     gene            <29345..>29914
                     /locus_tag="CAGL0D00220g"
                     /db_xref="GeneID:2887258"
     mRNA            <29345..>29914
                     /locus_tag="CAGL0D00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445423.1"
                     /db_xref="GeneID:2887258"
     CDS             29345..29914
                     /locus_tag="CAGL0D00220g"
                     /inference="similar to AA sequence:UniProtKB:P39715"
                     /note="similar to uniprot|P39715 Saccharomyces cerevisiae
                     YAL059w SIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445423.1"
                     /db_xref="GeneID:2887258"
                     /db_xref="GOA:Q6FWH1"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH1"
                     /translation="MAKKISKNSRAARQYDLTDLAPKELQNLPRAENTDLTNIMIRTA
                     AKNESLLEAKIRKKKDSKNKVSKKDFEKKIAKSVKIMEKERLERALNITNRLDGKIAK
                     SISRAKYVQSSRKAGWDSINASIKKELLVQALEAEEEEKKNEEAEKEGDIEVDEMYDS
                     AKIETTTEVKPQSVEPQNLFALLPLDTDE"
     gene            <30268..>31416
                     /locus_tag="CAGL0D00242g"
                     /db_xref="GeneID:2887148"
     mRNA            <30268..>31416
                     /locus_tag="CAGL0D00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445424.1"
                     /db_xref="GeneID:2887148"
     CDS             30268..31416
                     /locus_tag="CAGL0D00242g"
                     /note="weakly similar to uniprot|P27825 Saccharomyces
                     cerevisiae YAL058w CNE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445424.1"
                     /db_xref="GeneID:2887148"
                     /db_xref="GOA:Q6FWH0"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FWH0"
                     /translation="MKSIGLLGLFFTAAHVHGRHLPINSTNISGFWEDFETYKTNEDL
                     KEVWHSSEAVDEHGRKLFPASWKLFHNPDYVESNRKGLLVKSPGKYAMIGRNIEKPVN
                     LSDSELLVIQYEVKSTKDPHCEGAFIKLFHNMYLESLTNYDRKAGVKYDLLFGPDFCL
                     PDTNMVRFEWRNRKDKEEKKLIFSPKSKLNDGQHKNHLYTMILDLGNKILEIRIDGKV
                     VLATSLNDSQHFKDTKYMSTTDTHEDSSEFNFSIDGLTFDIWGTLSGIVFKNVYIGNS
                     IEEAEIIGNNTYLPNALKENDLILKKLKVKNDGKVPNAKSPYDDNIYSQNLFDILFDK
                     LVGLLEGLSIKHMITVLLVLIPYMLYYLARNHEMKKRIRTEDIVEINK"
     gene            complement(<31657..>32868)
                     /locus_tag="CAGL0D00264g"
                     /db_xref="GeneID:2887086"
     mRNA            complement(<31657..>32868)
                     /locus_tag="CAGL0D00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445425.1"
                     /db_xref="GeneID:2887086"
     CDS             complement(31657..32868)
                     /locus_tag="CAGL0D00264g"
                     /note="weakly similar to uniprot|P36047 Saccharomyces
                     cerevisiae YKL193c SDS22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445425.1"
                     /db_xref="GeneID:2887086"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG9"
                     /translation="MHIAPDRALTPLNLNGGFQIPYSSHSFKDDDIDDNSNGSKSSDK
                     FKYATQLDNSLDLSRDELVFKERNVSGRVNLTDTQGKPYSFLCNTDASISQIPFKPKT
                     KIIRELNVQGKGLLHLNLNNYRDLETLNCSYNCIADLEFLNDGYHLTQINMSHNQVRS
                     LTTLENTPLRHLDLSYNLIEGCIDFRELMHGSRDKLGWASLEYLCLTGNKIKELKNIH
                     LLTNLRVLLVDNNNLEKVDNLHLLRYLETVSLMKNFNLPHLELKCLPLMQLKELHIDA
                     CKCLREWKICPPHIEVFEICNGAICDIPKWEYFPPNLKILKISNISGLRELPSNLYQI
                     IPTVQRLDLTDNDLHDLKNILRAIPTTQLKYINLCRNPVTKQLSRRTAQNYEHVFRIA
                     CQIIENVHLVD"
     gene            <37583..>39784
                     /locus_tag="CAGL0D00286g"
                     /db_xref="GeneID:2887196"
     mRNA            <37583..>39784
                     /locus_tag="CAGL0D00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445426.1"
                     /db_xref="GeneID:2887196"
     CDS             37583..39784
                     /locus_tag="CAGL0D00286g"
                     /note="weakly similar to DEHA0D08195g Debaryomyces
                     hansenii and CA4636|IPF1520 Candida albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445426.1"
                     /db_xref="GeneID:2887196"
                     /db_xref="GOA:Q6FWG8"
                     /db_xref="InterPro:IPR021988"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG8"
                     /translation="MSRKNSNISGLSSESSSDQLYADAKTESLPMEDFESSQFDDIES
                     GLIDGKDDANSKRNKTHIKTSLNDIIQQVRQRSRLLANRTGLTSTKNIIIRLLVVNVV
                     LFLIFIHFSSFRSHHLKNEANIGNGGIEEQGNEESIAGLDISIGHGLENSVSVKGRIK
                     DYNRNLNKILQGVPQVNDKSEMSQYDTSKFIKMQRFDLMATANGFPNNTFLPFELTSY
                     QSNMYNLTGSESNKCDAISWKSRIHYSQERLPIEEDLVAARIKFVKEDKHLGKIVEEL
                     HNASKKETIEESVKKQWLRFGSSAQWLEDHQCYLVFSRIIVTEGGFKGAGKMSLVSAQ
                     AFDKDWNEIKGKRIPFIDTEIPDDLEQQLIAIDKKYDLFKNCDEEDKTTYQYQVCVQS
                     KQYMKEKAEEEKDELLGNYYRVYPTILKIPFAMEKKWFYKGPEDPKLILRTNKDGIQE
                     PIVVYNIYDPTHQERMMQVVLPHRKISPVIPLIEQDAIVVGRQKNWTPFIKDEDAGGQ
                     ISRGSLHMFSRAAPLQIVKCSLDTGYCKFVFDAAEYSKKDFEPNEIRGGTPLIKLPPV
                     VPQLKGRNLWFGLMKGHIKECGISDRLYRPSLAILEEENGKYFFNLITDTLHFNTEVL
                     GWSEKNFKADGYNVLSPNSVISWDVLSQNPETKSYDDYMQISVSQSDKGSYVIKMKGV
                     LDFILQSYTKEGLNNNMDWESSGLEDRIELGGVCFRKHLRNYCEEYSKSHS"
     gene            40063..40146
                     /locus_tag="CAGL0D00308r"
                     /db_xref="GeneID:2887006"
     tRNA            40063..40146
                     /locus_tag="CAGL0D00308r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (TAA) cove score=69.31"
                     /db_xref="GeneID:2887006"
     gene            <41436..>42704
                     /locus_tag="CAGL0D00330g"
                     /db_xref="GeneID:2887007"
     mRNA            <41436..>42704
                     /locus_tag="CAGL0D00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445427.1"
                     /db_xref="GeneID:2887007"
     CDS             41436..42704
                     /locus_tag="CAGL0D00330g"
                     /inference="similar to AA sequence:UniProtKB:P32464"
                     /note="similar to uniprot|P32464 Saccharomyces cerevisiae
                     YKL189w HYM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445427.1"
                     /db_xref="GeneID:2887007"
                     /db_xref="GOA:Q6FWG7"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028637"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG7"
                     /translation="MFKKYKNQDLDVSFWWKKNPKTPSDYVKLINEQLNKIEPTPLPN
                     GTNITSSSSDNKRKAQEEVAKYLVGMKHYILGDVDPKPTSEAIDEFYSAMLSSDIFHN
                     LLVHIADLDFESRKEVLLILSICLNYSKDNKFVTVDYLVSQSKTLSLMLRTMGLTLQR
                     RDTYDIFIIVGNMIIECIKYEQLCHIFLTDTQLWSLFEFAGIANFEISTQSMQILNSV
                     LTTHPKLVAREFFSQEKNINLFIRHINKLMAHGSYVTKRQSSKLLASLIIIRAHNVLM
                     MTYINAPENLKLIMTLLTDKSRNLQLEAFNIFKVMVANPKKSKLVFDILVKNRDKLLA
                     YLELFGKEVQDSTFLDEKEFIMREIESLPRIKPNTNEHNINMSNSPPKGLLHSDQKKT
                     ASSQQFNENHNELSGNNSSGNVTKSLASIG"
     gene            complement(<42946..>45531)
                     /locus_tag="CAGL0D00352g"
                     /db_xref="GeneID:2886972"
     mRNA            complement(<42946..>45531)
                     /locus_tag="CAGL0D00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445428.1"
                     /db_xref="GeneID:2886972"
     CDS             complement(42946..45531)
                     /locus_tag="CAGL0D00352g"
                     /inference="similar to AA sequence:UniProtKB:P34230"
                     /note="similar to uniprot|P34230 Saccharomyces cerevisiae
                     YKL188c PXA2 ABC transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445428.1"
                     /db_xref="GeneID:2886972"
                     /db_xref="GOA:Q6FWG6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG6"
                     /translation="MTLLTAYKNHRVNILRTSYILLLFVSLYGSGSSSGSTKQKKTSS
                     NRDRSETLSEKSTLSRLSEKLRDRKDSISSPDELASDVSSDEQSDSKSDEIVLKTRGT
                     RSLSLRRSSNVQENTNVVEQTSPVEKSTDVNLKRTDFLMKLLLGDKKVMILFMTQAFL
                     LVLRTFLSLHVATLDGRLVSSLVKAQYGKFLKILLGQWMVLGIPASFINSLINYVTKL
                     CSVSINRLVTNHLMGKYLSNHRTFYAVAAADSASEVQDNLTKDISKFSNNTSVLLNQL
                     LKPMLDLILCSFKLLMSGSGVMGEGTLVLGLIVYISNSMLKLIQPNFTKITMMRSSLE
                     SWFRSLHSSVHRNNEEIALLRGQSRELTSLDFSFYRLAFFMGREIKARAFYDLASTFV
                     IKYTWGAAGLALCSIPIFFKGKVQNGDQPDATDATADFITNRRLLLTASSSVGRFVEL
                     KKNIQELRGTSLRLNYLNDLLDKYAVGNIDKKDEDVLDLVEYNENLIKFEHVPLITPA
                     NQVLVPELNFELKHGDHLLIIGPNGCGKSSLFRLLGGLWPIRQIETGVQTKLTVPPRK
                     IGQDCAIFYLPQKPYMGNGSTFREQIIYPDTIEDFEERFNGDYNMGDEKLISVLELLD
                     LTDLITENLSLVLAGKGTKKSDNLDEENLTEIRAAFDLKRNWSEELSIGVQQRLAMAR
                     MYYHKPKFAVLDECTSAVSPEMEQKMYENAQNLGISVISVCHRTTLWHFHNYLLKFDG
                     KGSYQFGEFDATTRLETEKRLNELNSLLDQQVPLWEKRLRDLLDAKKSNVIRKSETDL
                     QTLQKMANATTDSDIPELTRADTEKFTSKSATRKINHNGRLPLLSSKGSESSKLLKKK
                     QKKKT"
     gene            <45775..>46086
                     /locus_tag="CAGL0D00374g"
                     /db_xref="GeneID:2887229"
     mRNA            <45775..>46086
                     /locus_tag="CAGL0D00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445429.1"
                     /db_xref="GeneID:2887229"
     CDS             45775..46086
                     /locus_tag="CAGL0D00374g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445429.1"
                     /db_xref="GeneID:2887229"
                     /db_xref="GOA:Q6FWG5"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG5"
                     /translation="MRKDSITRDVVVGKTFILNLKSGPKLIQAPTHTKHQRCPKHSPY
                     SPFSKDDMVESRGKCNRMYRVSHHSRATQKELYSDENEKLDVILTQGRTVSLNRRKNI
                     P"
     gene            complement(<46316..>46558)
                     /locus_tag="CAGL0D00396g"
                     /db_xref="GeneID:2886975"
     mRNA            complement(<46316..>46558)
                     /locus_tag="CAGL0D00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445430.1"
                     /db_xref="GeneID:2886975"
     CDS             complement(46316..46558)
                     /locus_tag="CAGL0D00396g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445430.1"
                     /db_xref="GeneID:2886975"
                     /db_xref="GOA:Q6FWG4"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG4"
                     /translation="MNTAPYATVSTKTQSRFTHKIQYPRIAPKPYRENNWPDLALGRI
                     FYVEAILKNVFTRPHCSFLKPIATRYIERPRDYGAL"
     gene            complement(<47786..>50011)
                     /locus_tag="CAGL0D00418g"
                     /db_xref="GeneID:2887238"
     mRNA            complement(<47786..>50011)
                     /locus_tag="CAGL0D00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445431.1"
                     /db_xref="GeneID:2887238"
     CDS             complement(47786..50011)
                     /locus_tag="CAGL0D00418g"
                     /inference="similar to AA sequence:UniProtKB:P34231"
                     /note="similar to uniprot|P34231 Saccharomyces cerevisiae
                     YKL187c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445431.1"
                     /db_xref="GeneID:2887238"
                     /db_xref="GOA:Q6FWG3"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG3"
                     /translation="MVNLAVHRSAHRAAKKYTHPDTYPNAKQLKRSTEVLLFSVCILF
                     LFTTFITFIVATAGSTANYSPIHNIYIGDADIKHINVTKVLPQIAPILTVLGTALSAP
                     NSSLSEVFNSLKAIADTPALTPLLNLLKNAKNTSDSVVALTELAPLAISSDSSSSTKE
                     LIAISGLLSFSNNTNQTLESLGNLVMPTLAQLKSGQPSDNSTSIVLSILQGSDNKVAS
                     VDSLITLNNMTLAEKTKLLPVFQLFGYTTNINNTVDALGDLMNANVPTQLGVTLLTTI
                     QSSLNGEADQDLSPLFDRIGGSVPEDNKQSVEAVEALLNDSSNKNGTINNLLSLLRQN
                     VTTSPSAKAAFQAMSTLLDHSNNQTMVLQSLPILAAVRNTTLAQAQLEGLQGMLQVST
                     NPVQTLGIIAALQAGMADPNTNTDAVPALFNLLSASDNPANSFTSLVALTSWATSNPD
                     TFRPIVSILEDANSVEPVTQEQLKAMTPALLDFLHVPVDFRLSIFTLCHVNGQGEITD
                     CNSPHAVQNLDFRSIIYDALLDSDFQPYLKALNISKYDLYLEGKLLHRQHEYVPAVKA
                     VLAMNILTIITSFFGIIGFILLIAPKYNRKLGLWIYTVVLTLSTALFSCLGAGIIAIM
                     ISIIKSGTSHDKFNVVFSTGGAYSGCVWAGFAVAFFACLIVLYCAFYARVGKPRGQPF
                     GDEKGYDNDMSSMSNSSENNNYESEKVVQTVDVADVDEDDSSSPEQVNKQQPKDTDII
                     V"
     gene            complement(<52244..>52798)
                     /locus_tag="CAGL0D00440g"
                     /db_xref="GeneID:2887054"
     mRNA            complement(<52244..>52798)
                     /locus_tag="CAGL0D00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445432.1"
                     /db_xref="GeneID:2887054"
     CDS             complement(52244..52798)
                     /locus_tag="CAGL0D00440g"
                     /inference="similar to AA sequence:UniProtKB:P34232"
                     /note="similar to uniprot|P34232 Saccharomyces cerevisiae
                     YKL186c MTR2 mRNA transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445432.1"
                     /db_xref="GeneID:2887054"
                     /db_xref="GOA:Q6FWG2"
                     /db_xref="InterPro:IPR019488"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG2"
                     /translation="MNSNSNNNSQYHLIDIFVKKVLAHLDEQDPNKLMNFLQLFQSSK
                     NMPPSPTVSKVVYNSMPFADPSIFLTMWSQQVVQTQHIISALDFHVIPTGASNTIICN
                     VNCKVRFDESGRDKMGQDSVIPMGPSGAKRMNNNRPLWGSYFGVSLQLCLDDRIFRND
                     INGVITSLNYKIVYKPEDSLIKIN"
     gene            <55305..>57443
                     /locus_tag="CAGL0D00462g"
                     /db_xref="GeneID:2887043"
     mRNA            <55305..>57443
                     /locus_tag="CAGL0D00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445433.1"
                     /db_xref="GeneID:2887043"
     CDS             55305..57443
                     /locus_tag="CAGL0D00462g"
                     /note="weakly similar to uniprot|P34233 Saccharomyces
                     cerevisiae YKL185w ASH1 negative regulator of HO
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445433.1"
                     /db_xref="GeneID:2887043"
                     /db_xref="GOA:Q6FWG1"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG1"
                     /translation="MSLPLNELPVPILGKTSFSSANRSSYISSAGSERHAALMENSEA
                     LRSPSHSSNQGFRLQSNAHTSPISKNYSYFSSPIPSTSRLSLNVGKTGLANITATDLP
                     RESISYQARSSSFGPQIEFPYRKSNTAPASPHHFSTSNYVSIITPSTSPAGLENRMVG
                     STAQFSHLPSLRAASIPNISCSPTFQETTNSLSDHYSGNSTTHISSVKSGTILPSLRH
                     LQLLPDRSLQEHSKLYPDTAKINGAWRQNVISWCKEKSYEDYVKVQEEVAKVRTQFPI
                     SQLRSHPESTKNPNMPKIPSLLNAKDQFESLSNSPWSYEAPVTPPMSPSVSKRRQNSN
                     TSSSKLQSVTYNLTPKTPGDDLKDFTPIISERLVQTVKMKQMETYYQSSPGRHKKTNS
                     FKALQIKKLLDNRDVLSINSKSGFKVSKPGRPMSSVIVSGISTQIASKLESISSNSSS
                     SSASSSPKSSKRSLSRSPTRFTTFVQPSTPREYNQKQKINSSRSRSRSPIRPSTPTQQ
                     TPIYKNTFQNSDNSNYNVNSASVFSTPALKYGQSSTESPNSATFNSIGAHTTSISVTT
                     SPKHYYSSKKISGGSNSPKRRKSNPTFTSVTSTPTASHGAKSKSGSNSPKNGAYHLRK
                     CVSCNSSDSPCWRPSWSGKKTEQLCNSCGLRYKKTRTRCLNDGCRKIPTKGELNIMKS
                     QGLEKEYNTQLQREVEGYKCLFCNHITETR"
     gene            <59152..>60543
                     /locus_tag="CAGL0D00484g"
                     /db_xref="GeneID:2887037"
     mRNA            <59152..>60543
                     /locus_tag="CAGL0D00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445434.1"
                     /db_xref="GeneID:2887037"
     CDS             59152..60543
                     /locus_tag="CAGL0D00484g"
                     /note="highly similar to uniprot|P08432 Saccharomyces
                     cerevisiae YKL184w ORD1 ornithine decarboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445434.1"
                     /db_xref="GeneID:2887037"
                     /db_xref="GOA:Q6FWG0"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR022657"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q6FWG0"
                     /translation="MASQPEIAKNLFASTTTLVDYPAKEEKKSHEDNVDTYLEQLFYK
                     LKNDPEISKLPHNEAHLEIYNALKKRVDDINNETCEPGEENSFFVCDLGEIERLYANW
                     WKELPRVQPFYAVKCNPDLKIIRKLADLGANFDCASKLEIDKVLSMDVNPERIIYANP
                     CKAASFIRYAATNKVMKSTFDNVEELHKIKKFHPESQLFLRIATDDSTAQCRLSTKYG
                     CEMERVDSLLECIKTLGLNLVGVSFHVGSGASDFSSLYKAVRDARIVFDKAVNDYGLP
                     ELKTLDVGGGFQLESFKESSAVLRLALDEYFPESSKVDIIAEPGRYLVASAFTLSANV
                     IAKRKLNEAESMIYVNDGVYGNMNCILFDHQEPTPRTLWHDNNYHYDDFDSTSPNPIT
                     TCPYKVSMWGPTCDGLDCITKEYYMKHDLVVGDWLYFPRLGAYTSSAATPFNGFDQTA
                     DIIYINSENHDNI"
     gene            <61050..>62033
                     /locus_tag="CAGL0D00506g"
                     /db_xref="GeneID:2887080"
     mRNA            <61050..>62033
                     /locus_tag="CAGL0D00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445435.1"
                     /db_xref="GeneID:2887080"
     CDS             61050..62033
                     /locus_tag="CAGL0D00506g"
                     /inference="similar to AA sequence:UniProtKB:P34234"
                     /note="similar to uniprot|P34234 Saccharomyces cerevisiae
                     YKL183w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445435.1"
                     /db_xref="GeneID:2887080"
                     /db_xref="GOA:Q6FWF9"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF9"
                     /translation="MSESKLVFFKPTLEHVIPWKRYQLEQPKVLVNNELYDDKEGKLI
                     LYGGGREFLLRDIDRGEEVEVEVYILEGRLMLWIKHPDINKGVEIPNSSIIYHGSRIN
                     YEGRDGHRLELVVSVCRDKIIDELFGSDKSRDTDIYGGTVLNGGNELNAGHEGSSRGV
                     SEELPMYTLSSVELVLRPKYSSFDRYYSEEIEQLFTFDNFGLNRGDDLIENCHNQLAL
                     SIEHSAQEEEVLSSDNAGMNEQPGEPTSMSTLLNSMNSTNGMYPTNIAQSDQRFENSN
                     SDTPVIGNTGNCDDLDDMNFGMEIGDASSFAIEQNQLNPASAILGRRSRDS"
     gene            <64404..>70649
                     /locus_tag="CAGL0D00528g"
                     /db_xref="GeneID:2887100"
     mRNA            <64404..>70649
                     /locus_tag="CAGL0D00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445436.1"
                     /db_xref="GeneID:2887100"
     CDS             64404..70649
                     /locus_tag="CAGL0D00528g"
                     /note="highly similar to uniprot|P07149 Saccharomyces
                     cerevisiae YKL182w FAS1 fatty-acyl-CoA synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445436.1"
                     /db_xref="GeneID:2887100"
                     /db_xref="GOA:Q6FWF8"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR003965"
                     /db_xref="InterPro:IPR013565"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016452"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF8"
                     /translation="MDTRPFTISYGSIEHTLVIPISQFFLVSQLNDQFLKLELPNHQQ
                     PSEDFQSDEEPTSPVELLGKFIGYVTSLIDTAGSDESQQKKITSILELTFKDFESSYL
                     NGNDIHTLAAKLLQDNDIALEEQVEAVENNTNNKQEVFPTTLPKVKELVKNYLNAKVL
                     LHKLGVITVQNSQNKINSALFGSDITKIYAIFGGQGNTDDYFEELRDLYQTYSYLIED
                     ILDFVSKTLNNLLKNSSQDMEKIFTQGLDVKHWLKYPNATPENDYLLSIPISCPLIGV
                     IQLTHYALTARLLNVTPGELRSKIQGATGHSQGLVAAVSIAEADSWDAFFKSFEKAIT
                     LLFFIGVHCYLAYPKTSLPPSILQDSLENGEGVPSPMLTISNLTKEQVQEYVDKTNSH
                     LPAEKHIVISLVNGARNLVVSGPPQSLYGLNLTLRKAKEPSGLDQSRIPYSERKLRFS
                     NRFLPVASPFHSHLLEPANEAIIDNLKAFNVEFSAKDLKIPVYDTFDGSDLRDNSGSI
                     VQRITDCIIRLPVNWETSTKFEATHILDFGPGGTSGLGVLTHRNKDGTGVRVIVAGTL
                     DINPDDDYGFKQEIFEVASNSVKQNPNWLKEFCPKLVKTKAGKVYVDTKFSKMIGRPP
                     LLIPGMTPTTVSPDFVAATINAGYTIELAGGGYFSPGHMTQAIDEVVSQIKKGYSLGI
                     NLIYVNPRMLQWGIPLIKELRERGYPIQSLTIGAGVPSLEVATEYIETLGLTHLGLKP
                     GSIDAISQCINIAKAHPNFPIVLQWTGGRGGGHHSFEDFHQPMLQMYSKLRRCKNIIL
                     IAGSGFGAAEDTYPYLTGEWSAKMNYPPMPFDGLLFGSRVMVAKEAKTSLAAKKLIVD
                     CVGVPDNQWEQTYKKPTGGIITVRSEMGEPIHKIATRGVLFWKEMDDTIFTLPKNKLQ
                     AALDAKRDYIIEKLNSVSQKPWFATVNGEARDLTSMTYEEVAKRLVELMYIRKTNSWI
                     DITLRNFTGDFLRRVEERFTTQKTSSVIQSYAILEKPDEAIKLVFDAYPCAKDQYLNA
                     QDVDYFLALCQNPMQKPVPFVPVLDQRFEFFFKKDSLWQSEHLEAVVDEDVQRTCILH
                     GPVSAQYTTKVDEPIQDILDGIHNGHIDMLLKDYYGGDSSKIPVVEYFGGEDPVEINN
                     TEIVKDEDTLVLDASTIKDEAYWFKLLSGSKRNWRHAFFSTDRLVQGSSYTENPARKV
                     FKPSKHMFVEITNANNEEKCVITLKEMVQGELKKTAVLKLIQKDLIEMDMIENRTMDG
                     KPVVLPLLYKYNIEDGFAPISEVMEDRNQRIKEMYWKLWIGEPFNLKFDPRKEIKGSD
                     FKITKQDIQEFTHAIGNNCEDFVPRSGRDLLAPMDFAIVVGWRAIIKAIFPETVDGDL
                     LKLVHLSNGYQMLPGAKPLKEGDIISTSASIKSVVNQPTGKIVEVVGTLSRDSKPIME
                     VTSSFFYRGKYSDFENTFQKTVEPIYEMNIKSAKDIAVLRSKEWFQLDDEDIDLLNKV
                     LSFETETEVTFKDATIFSSVKCSGPIFMELPTKEKIEIGIVNYEAGESYGNPVIDFLK
                     RNAATLEQKVNLENPIPIAVLDSYTPSTNEPYARVSGDLNPIHVSRHFAAYADLPGTI
                     THGMYSSAAVRGLIENWAADSVSSRVRGFNCQFTSMVLPNTPLKTSIQHVGMINGRKL
                     FKFETKNENDTVVLVGEAEVEQPVSAFVFTGQGSQEQGMGMDLYEKSAVAKEVWDRAD
                     KHFKETYGFSILNIVKNNPNEFTVHFGGEKGRKIRENYSNMIFETIVDGELKAEKIFK
                     EIDETTTSYTFKSPTGLLSATQFTQPALTLMEKAAFEDLKAKGVIPVEAAFAGHSLGE
                     YAALASLADVMSIESLVEVVFYRGMTMQVAVPRDSAGRSNYGMIAVNPGRVSPTFTQD
                     ALQFVVEKVGSRTEWLLEIVNYNVENQQYVAAGDLRALDTLTNVLNFIKIQKIDIAKL
                     QDEMSLEKVEEHLFEIVDEISKKSTAKPQPIELERGFACIPLRGISVPFHSSYLRNGV
                     KPFKNFLNKNIMKDNVKVDRLIGKYIPNLTAKPFQITKEYFEDVYKLTGSDRIKEILD
                     NWEKYEA"
     gene            <71400..>72689
                     /locus_tag="CAGL0D00550g"
                     /db_xref="GeneID:2887109"
     mRNA            <71400..>72689
                     /locus_tag="CAGL0D00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445437.1"
                     /db_xref="GeneID:2887109"
     CDS             71400..72689
                     /locus_tag="CAGL0D00550g"
                     /note="highly similar to uniprot|P32895 Saccharomyces
                     cerevisiae YKL181w PRPS1 Ribose-phosphate
                     pyrophosphokinase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445437.1"
                     /db_xref="GeneID:2887109"
                     /db_xref="GOA:Q6FWF7"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF7"
                     /translation="MRKCKVFVGNSHPELGNLVCQRLGIEPAPCTLKKFANGETSVQI
                     GVSVRDEDVYVIQSGSPNINDHIMELLILVSACRGGSAKKITAVIPQFPYSKQCKMKK
                     HRGAITARMLANLLVMAGADHVVSMDLHASQMQGFFTKPVDNLYGGPSLANWIRENVE
                     NYEEAVVVSKNPGGTKRVTALADVLKINFAMIHTDRRRAKDLYSQHRDMKQLRQRKQS
                     LLRKNKPIIRQGDDPDEEENIILTNGIQTARIRNGHVIGDDEEDFIPESADEVAMESD
                     AEDASVTDTYGLGGTYDAVDSEDEEEVSEAVKEKLITLVGNVNNRSAIILDDMIDRPG
                     SLISAAEHLVKNCGAKKVYVVATHGLFTGNCLEELEESEVIDKIVVTNTYPISNDRIE
                     KSEKLVVIDVSAIFAECIRRDHYGESISVLFDSLSTL"
     gene            complement(<72970..>76083)
                     /locus_tag="CAGL0D00572g"
                     /db_xref="GeneID:2887254"
     mRNA            complement(<72970..>76083)
                     /locus_tag="CAGL0D00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445438.1"
                     /db_xref="GeneID:2887254"
     CDS             complement(72970..76083)
                     /locus_tag="CAGL0D00572g"
                     /inference="similar to AA sequence:UniProtKB:Q07468"
                     /note="similar to uniprot|Q07468 Saccharomyces cerevisiae
                     YDL077c VAM6 Vacuolar carboxypeptidase Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445438.1"
                     /db_xref="GeneID:2887254"
                     /db_xref="InterPro:IPR019452"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF6"
                     /translation="MLTAELIYTHQSSDIADYLPIYESQKLLVVKKNGDVEVFSRSAD
                     TIKLYQTYPGLLKAKDNTGSCKELIYAHAIGTIFVRSDKSLQLLNSSNLHEYDKISER
                     RGISRCWIVDDRTKSLDTNESELSKSDSTILVYTTHTPRVLRLFEWRKRSFQNVYEVP
                     LNLDKTEIICDVSTIKDDLVVTTNKATYLWNYKTAKPVMNKITKMVKKRTPDNIITAL
                     TELERQSLHFDDASDYSIDMQSSIFSGTSVSEKKSRSNIWSKFKGIQRANLQNDYLDK
                     VLYSAGKSGGITIMDMKNHSIVQLKTSESNEPFLLINKTSENFRWHNGVRDVHYLSSI
                     DSLIQIYDTYLLITDCEYGVPFLQIDVQEGIKDFKQINGQFLLIHTRNDCFKSFKLKL
                     RDLEDDSNSDEMSLTTSVKDHSSFEKLWKEVLIYTKLVESTSLPQFCNNNDEDEQTRL
                     LVSRLRDVTVLFNLQLLDKFFSIFNRINNNNNLTYMDPHLPEIIISEIFGSLSNFWAP
                     PQLVISRSLPKSIAKLVGALTGEYHDFSTLSKGDDTGIQYELIAPNLISYLIDVRRYI
                     RRLVSQPNELLQYTSFTQTLLVDINFFLIDDHEDTSAKSLLSLIDTVLFKVYLNYKPA
                     LLAPFLRIPNDCNYEIVVNDLKIAGLTQELVDFYFQRGKHEFALNLITELIDDSTKSD
                     GYQAKEQAITVLVIQYLQKLSNDDLEVVFSYTDWLLRKFPKSKVQIITPIFMTETMNS
                     RSYEYQRVYNFIKRSDSTLSLQYLEYIIGVYDARQEFIEVELISRYVENLSNQDAKSK
                     LASLIKLIKDDYPAKCLETLQERLPGLPQSDKKFVMFLQTFFLFHLNRHVDSLNILFD
                     QLHDLQKTISYCNSVYEVNDQIGSECFLTLFEKILQSGDYSEMHLQSFLEDNFLKMDP
                     LQLLQKIPTSIPLSKLTFLLSQIMKMSTFHVEDSFIEKDLVKTNIIKTTSILNEEKSK
                     YTTVSEAMLCSLCKRKLVNNSNEKLTWYKDREHDKLMHLSCRRIFLEKQRTDKTKNAM
                     KTLADLT"
     gene            complement(<76764..>77780)
                     /locus_tag="CAGL0D00594g"
                     /db_xref="GeneID:2887118"
     mRNA            complement(<76764..>77780)
                     /locus_tag="CAGL0D00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445439.1"
                     /db_xref="GeneID:2887118"
     CDS             complement(76764..77780)
                     /locus_tag="CAGL0D00594g"
                     /inference="similar to AA sequence:UniProtKB:Q07458"
                     /note="similar to uniprot|Q07458 Saccharomyces cerevisiae
                     YDL076c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445439.1"
                     /db_xref="GeneID:2887118"
                     /db_xref="GOA:Q6FWF5"
                     /db_xref="InterPro:IPR013951"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF5"
                     /translation="MTDDAYRATQSQIYSLQETLLDSNKSAKADVKDKDKDKDKDKDK
                     DKEKKKEKKVKSSKKRKTDEDRPSKRHSKKVEEVLQVVSNTVIPTEAPRYLGTLQYNY
                     AKEGVLNAVNVVDRKDRTTVPFPYDLERRVLPVPFLPEFPEESANSIITISIKYEDLM
                     KSFNDSGECPRTFNNEIWGCDVYTDDTDPILALRHCGFTCLDPPPLTPTHFKGKASHK
                     PSTPAPLRRTPVNQTNKDNVVGEIPKDEHGLKPFDLDVDILLLPRLQQYFSVKRYGIT
                     SRHWGKLTTPLKVDAYTVHLRMSMHVSLEENIYPIETMAHDGLSYGIHKIVIKPRTAN
                     AVEW"
     gene            <78622..>79757
                     /locus_tag="CAGL0D00616g"
                     /db_xref="GeneID:2887139"
     mRNA            join(<78622..78678,79473..>79757)
                     /locus_tag="CAGL0D00616g"
                     /product="60S ribosomal protein L31"
                     /transcript_id="XM_445440.1"
                     /db_xref="GeneID:2887139"
     CDS             join(78622..78678,79473..79757)
                     /locus_tag="CAGL0D00616g"
                     /note="highly similar to uniprot|P0C2H9 Saccharomyces
                     cerevisiae YLR406c RPL34B and highly similar to
                     uniprot|P0C2H8 Saccharomyces cerevisiae YDL075w RPL43A"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="XP_445440.1"
                     /db_xref="GeneID:2887139"
                     /db_xref="GOA:Q6FWF4"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR020052"
                     /db_xref="InterPro:IPR023621"
                     /translation="MAGLKDVVTREYTINMHKRLHGVSFKKRAPKAVKEIKKFAKLHM
                     GTEDVRLAPELNQEIWKRGVKGVAFRLRLRISRKRNEEENAKNPLFSYVEPVFVASAK
                     GLQTTVVEEDA"
     gene            complement(<80947..>83028)
                     /locus_tag="CAGL0D00638g"
                     /db_xref="GeneID:2887150"
     mRNA            complement(<80947..>83028)
                     /locus_tag="CAGL0D00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445441.1"
                     /db_xref="GeneID:2887150"
     CDS             complement(80947..83028)
                     /locus_tag="CAGL0D00638g"
                     /inference="similar to AA sequence:UniProtKB:Q07457"
                     /note="similar to uniprot|Q07457 Saccharomyces cerevisiae
                     YDL074c BRE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445441.1"
                     /db_xref="GeneID:2887150"
                     /db_xref="GOA:Q6FWF3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013956"
                     /translation="MSSEEPPIKKQKLELSDPDEPLTQHDVISFQKEALFRCLNSKRV
                     ELEALTKQYSTVHDKWEQNVHTLATLMSVLSTAASHLRGLCNEESEKTLCDEMINAGE
                     SVDKERTDEFLNLLRKYTNSNGSSDSKIDSLGLELQRANKTKSELRLQNKKLTDEIDS
                     LKAYYHGLVRSYDREDSMTVKRVFNKQKTDDNTDNISNTEQRPTSVSPVLTNGATHVK
                     NEVKTEQEALNNHTDSSQSSGITEEEKKKLFLQYENKITDLESHNSSLNRIIEELENY
                     KQLNEKELAQTRLEISNLLSEKHSNEEEREDLLHQIEKLKASNTDLTLTNESFLSKFQ
                     ELAKEKDTFQEKISSDFEKTLESLKAQNLALEKDLVRVRTTRDELISKVAILEAETSK
                     SVLISDLKQALDILRDQWEKIEFRNNQSPSSDALLKEIQDLESAFKELSSLTHKKYSE
                     YLNHESVISKLTIEKTKADQKYFASMRSKDSILVENKNLSKSLNKANELILQLKDTDK
                     LYKQKIESLHKQLALSQNNEKRLVDSNKAANLKVMNLNSEIQKQKKLLDFTSSQKNEL
                     INELTEANGMLKSKELEIEFKENELQTALKKNEKLEEFLSKENYNMNKPSSLATTNLD
                     EDSMAEELENFRTLVYCSLCSKNWKNMAIRTCGHVFCEDCCKERLAARMRKCPTCNKP
                     FSSNDLLMVHL"
     gene            <85554..>88889
                     /locus_tag="CAGL0D00660g"
                     /db_xref="GeneID:2887162"
     mRNA            <85554..>88889
                     /locus_tag="CAGL0D00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445442.1"
                     /db_xref="GeneID:2887162"
     CDS             85554..88889
                     /locus_tag="CAGL0D00660g"
                     /note="weakly similar to uniprot|Q07454 Saccharomyces
                     cerevisiae YDL073w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445442.1"
                     /db_xref="GeneID:2887162"
                     /db_xref="GOA:Q6FWF2"
                     /db_xref="InterPro:IPR013887"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF2"
                     /translation="MTVKDEEEDTRSFNVFYEQEMMEQEEDEKHLFRDLNAFIGMISA
                     EEVEVERTHSRKNSSSSITDLKRKRSLSLKDLRKKVEPNAFQFLKRKNSSLSSLLRLH
                     LLNYLRSVQTMQHKHNFPLVKEIKKREILLQWWITLLNFLSSKLKFDFLLKTEWPEEV
                     PDTELISIVLEAISRIITLLIVLPNHNKVDHEVYAQHLNLTIKFVSDILIVNSRIQKK
                     YTARHSSSASSFASSNIEAETTFSSTAGSVKTQSNGNICENAAVLQNSVLSMIDNYNS
                     FLTTFIGKVNAYAFVYLPDECHFEYLILSTWYPRLRAIRRQNSLFPWKETRYQVSRSP
                     MDSNTKKYFSCRKNNEHQKICASYMKNKSIFLTFYWHYWYIVLRYSENISTNCFTKGN
                     THQLPGAELLLNFIVEISFKVDLRIFDKFVGGSPMRTSRKGKGNSTSSGLYGDDIDGA
                     AIALAPSSKRYLRNETVNDFIFTNFGTIKLWETIRSVAGCMKSSKNVESMLGLHDLAI
                     LKQVRKIPSHDYTTANLVYNKIFQFIIFQFNSLPSIKFIHWEIWIQGLMKMLENLNTN
                     SQTVALISFFNMWPYLNVAKKQAIIEQIVLSEKYWTLMLEESQSTIIRILFIKFVVFR
                     AIPSMDMDQRNLLALRLHQIELQMNNLFGTLKKEGYTTDIPYSDPFAFALNNRFVIVN
                     SRCYEEDYLTFEFHQRPRKPKLIAVLNNDIYPMEKFPNIGSVSNVRPTYVLKKGRYPY
                     DVFDELLEVVAKNKSSKKWGIRNDIDDGLEDLMLENFDEFVTKCNANDQESSVVKALT
                     NKVNMWFSGMSVNEPIAESSKVDTKDIRPSTAPTKTSEIESQNIDQTSTRSSVKSSGG
                     WSFGFSSRKNSSSSIRKFSDTALNSKAVNLLKIGSTKQGNSHSAKNNKVFESLYGHLL
                     LKQKVIFAPEFTFSQDVLSNPSVVGIIKAIQLHPEKSLNDKLDIVNRKWGSISMKNVP
                     SNAIQVEEIDKNDINVLEIPLTSSSNSMLSEGQELDQSSSDTFGKDVKLPKLDYEKLE
                     LGTNIPDEDVLQGVTQESNLEKDGLPSIMRMRQQTAFENLIKIIRIFNATKDEFLDYR
                     DDHEKILIEFELYRNGYQSLLAI"
     gene            complement(<89194..>90825)
                     /locus_tag="CAGL0D00682g"
                     /db_xref="GeneID:2887180"
     mRNA            complement(<89194..>90825)
                     /locus_tag="CAGL0D00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445443.1"
                     /db_xref="GeneID:2887180"
     CDS             complement(89194..90825)
                     /locus_tag="CAGL0D00682g"
                     /inference="similar to AA sequence:UniProtKB:P32432"
                     /note="similar to uniprot|P32432 Saccharomyces cerevisiae
                     YLR403w SFP1 zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445443.1"
                     /db_xref="GeneID:2887180"
                     /db_xref="GOA:Q6FWF1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF1"
                     /translation="MDTMVADYMEDSNRITIDDHKYYPRIRRDSIAHLQGVGGVSWGS
                     LSIGSWLRDEVMLHTAFNKPSQGSRRESINLMHPISMSSGRRSSVLHPHHMKAGSPPV
                     SYNAILPNLEEQYCKDYSCCGISLPGLHDLLKHYEDAHIEPSHSTHKHKHGTLAPVNG
                     TVGSQLATSSTNNDLNTPQHMNIIRQQLNHDNLHEHQVYTDRQMRSNSNAALGQQYMG
                     HVPHSTVSESPSPTSSQLTSTQTTPLVGKNTALSAVHTTPSFGQSGHRMRNNGNLIDS
                     VPTNDVFMNIMNQNNDSKTVPPDFQNHTISFSNYNINFSENIAKPSNIMPKPLDNSQM
                     NDPLENNTRPDILNTSQTKSGISQVFAASHAAPDQLSRSNTDENGNLNDGRNVNTSKE
                     TQTVPIGMKNNSSGQPSATKKFQSAPKINANIKTDHPGIKNAGLLTSQSIDPARRVFY
                     ENDENKPFKCPVLGCGKTYKNQNGLKYHRLHGHQNQTLIENPDGTYSVVDPESNEIYL
                     ENLQDIKDKPYRCDTCGKRYKNLNGLKYHRGHSTH"
     gene            complement(<92050..>92625)
                     /locus_tag="CAGL0D00704g"
                     /db_xref="GeneID:2887172"
     mRNA            complement(<92050..>92625)
                     /locus_tag="CAGL0D00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445444.1"
                     /db_xref="GeneID:2887172"
     CDS             complement(92050..92625)
                     /locus_tag="CAGL0D00704g"
                     /inference="similar to AA sequence:UniProtKB:Q07451"
                     /note="similar to uniprot|Q07451 Saccharomyces cerevisiae
                     YDL072c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445444.1"
                     /db_xref="GeneID:2887172"
                     /db_xref="GOA:Q6FWF0"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWF0"
                     /translation="MSLYYALVFGILVLEIAVFSVLSLPLPTRIRRPMMLVLLKPFRA
                     PTVQVGIKCILGFILILFIDCITKVYNINRELNAGSKGQSNTAGATGGTVFAQDRIEV
                     VSRKFLAQRNMYLTGITLFLTFVVVRTYALVSELFQLKDNYRAAEGEDTKGMTPEEAE
                     KRRKELLEEIDRKEKEINRLTEKATLLQKEM"
     gene            complement(<93272..>93895)
                     /locus_tag="CAGL0D00726g"
                     /db_xref="GeneID:2887193"
     mRNA            complement(<93272..>93895)
                     /locus_tag="CAGL0D00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445445.1"
                     /db_xref="GeneID:2887193"
     CDS             complement(93272..93895)
                     /locus_tag="CAGL0D00726g"
                     /note="weakly similar to KLLA0B03212g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445445.1"
                     /db_xref="GeneID:2887193"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE9"
                     /translation="MIQGSIKNKLTHVKSLGTVPIKHTIPSRHDSRNKEIVGRVVKQL
                     EFDKYNVQYSRESLKRCLYPSKDILVPIDADRKVEVRNKVLIGQGRHLLNLQWNIAML
                     RLFKRTPDNLNGFDFNYSEKSSILAELRQRDITRLYVQYLRDHDLKGIARIEIPADRV
                     SSRLQKRQDLQAFLGIMGYISLLNSEPTLINFINRSIIIKIINPLIS"
     gene            complement(<94612..>94794)
                     /locus_tag="CAGL0D00748g"
                     /db_xref="GeneID:2887216"
     mRNA            complement(<94612..>94794)
                     /locus_tag="CAGL0D00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445446.1"
                     /db_xref="GeneID:2887216"
     CDS             complement(94612..94794)
                     /locus_tag="CAGL0D00748g"
                     /note="highly similar to uniprot|P07255 Saccharomyces
                     cerevisiae YDL067c COX9 cytochrome-c oxidase chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445446.1"
                     /db_xref="GeneID:2887216"
                     /db_xref="GOA:Q6FWE8"
                     /db_xref="InterPro:IPR014368"
                     /translation="MSALAPITGTLKKRIITDIVIGFSLGGVMASYWWWGFHKNVIDR
                     REAFYADLAEKKKAEN"
     gene            <95715..>96986
                     /locus_tag="CAGL0D00770g"
                     /db_xref="GeneID:2887212"
     mRNA            <95715..>96986
                     /locus_tag="CAGL0D00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445447.1"
                     /db_xref="GeneID:2887212"
     CDS             95715..96986
                     /locus_tag="CAGL0D00770g"
                     /note="highly similar to uniprot|P21954 Saccharomyces
                     cerevisiae YDL066w IDP1 isocitrate dehydrogenase or
                     uniprot|P41939 Saccharomyces cerevisiae YLR174w IDP2 or
                     uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445447.1"
                     /db_xref="GeneID:2887212"
                     /db_xref="GOA:Q6FWE7"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE7"
                     /translation="MLGRRCFASSAKLAKIKVKTPVVELDGDEMTRIIWDKIKKQLIL
                     PFLDVDLKYYDLSIQSRDKTKDQITHDSAEAIKKYGVGVKCATITPDEARVKEFNLTK
                     MWKSPNGTIRNILGGTVFREPIVIPRVPRLVPGWEKPIIIGRHAHGDQYKATDAVIPG
                     QGKLELVYKPNGDASKAEVMEVYDYKGPGVALAMYNTDESIRGFAHSSFKLALQKKLN
                     LFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKFAELNITYEHRLIDDMVAQMIKSKGG
                     FIMALKNYDGDVQSDIVAQGFGSLGLMTSILITPDGKTFESEAAHGTVTRHYRKHQQG
                     EETSTNSIASIFAWTRGLAKRGELDGTPDVVRFANILESATLNTVQQDGIMTKDLALA
                     CGKTDRASYVTTTEFLDAVEKRLQTEIKSID"
     gene            complement(<97236..>98213)
                     /locus_tag="CAGL0D00792g"
                     /db_xref="GeneID:2887222"
     mRNA            complement(<97236..>98213)
                     /locus_tag="CAGL0D00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445448.1"
                     /db_xref="GeneID:2887222"
     CDS             complement(97236..98213)
                     /locus_tag="CAGL0D00792g"
                     /inference="similar to AA sequence:UniProtKB:Q07418"
                     /note="similar to uniprot|Q07418 Saccharomyces cerevisiae
                     YDL065c PEX19 required for biogenesis of peroxisomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445448.1"
                     /db_xref="GeneID:2887222"
                     /db_xref="GOA:Q6FWE6"
                     /db_xref="InterPro:IPR006708"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE6"
                     /translation="MTEDFDYDDLDDLLDEDPSKLEDVQAETTQSRGTTEADGLKKPA
                     DPVMDKDDPAVKEMIEDLQQEFQNLMKQNGDGANVNIEDKEAAENFKKLLDILEEVGQ
                     VPKETTTQQLESLNTQTTSKGEKAGKGGFKDVISSTLDRLKENANKVDTQLEEEKKQS
                     INGSGNPDEVLSKLLNDLVSDSGDVPADGEMDNAILGILNKMSSKEVLYQPMKDMQIE
                     FSKWLEDNKDHPSHKDNMDTYKRQFELVNKLIVIYEKPDYDNDKDRDEVTELLDQLEQ
                     LGDSPVSKNFNGGNPANDFDEMSKMLNIDANDPKLADLDKDLADTCKQQ"
     gene            <98589..>99062
                     /locus_tag="CAGL0D00814g"
                     /db_xref="GeneID:2887178"
     mRNA            <98589..>99062
                     /locus_tag="CAGL0D00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445449.1"
                     /db_xref="GeneID:2887178"
     CDS             98589..99062
                     /locus_tag="CAGL0D00814g"
                     /note="highly similar to uniprot|P50623 Saccharomyces
                     cerevisiae YDL064w UBC9 E2 ubiquitin-conjugating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445449.1"
                     /db_xref="GeneID:2887178"
                     /db_xref="GOA:Q6FWE5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="InterPro:IPR027230"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE5"
                     /translation="MSSLCLQRLQEERKKWRKDHPFGFYAKPTKGPDGTLNLQKWEAG
                     IPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFYHPNIYPSGTVCLSILNEDQD
                     WRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSKNKAEYEKKVLIQAKQYTK"
     gene            complement(<99696..>101555)
                     /locus_tag="CAGL0D00836g"
                     /db_xref="GeneID:2887166"
     mRNA            complement(<99696..>101555)
                     /locus_tag="CAGL0D00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445450.1"
                     /db_xref="GeneID:2887166"
     CDS             complement(99696..101555)
                     /locus_tag="CAGL0D00836g"
                     /inference="similar to AA sequence:UniProtKB:Q07395"
                     /note="similar to uniprot|Q07395 Saccharomyces cerevisiae
                     YDL063c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445450.1"
                     /db_xref="GeneID:2887166"
                     /db_xref="GOA:Q6FWE4"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE4"
                     /translation="MGRSKKRSRTSASRLNPLANPNNGGISKKDANLIERKLQPLIKN
                     LNSVVPNERSMALSSATVLCEDAHMRKLLLKEKLIPTVTTKLLSDENTEIVVEAYGLL
                     RNLCLEEGYDVAVHLWRSDIWTSILSGFEKLSDSLRALAAQDASEDTKKTTPQSKESR
                     RLLFDFAENLLSLVIALCNGADSILEEVLTTQKLAELFTVLVNLLEYGIEKLPISVFN
                     TILDLIYDFSSESFEFIETVSSDPTLSEFVKVLPTLKKEDHKSFNELTYVLIQGIYLQ
                     FLDMDMTYEQANEIIHTTCNAINGIDLVELEKNLSSITQDEDIANTVDSEVAAKIKEY
                     TKKRALAHMQLQSIEITIDLITAIIEIIAAKFEQEHKRKLPESLSETLVSFVPLVFNK
                     LASSFPARVLIGWNNLLWLYMSIDVNFYELPNNQHTLLWNFIKKEEGSDSKDISLKVS
                     LMSVVWAMLKAATLQSEPLAVINQLGLNNSMAFVETIINEYKTCNEIELQQKCIGVLS
                     SLALVQNQVEINRFIGHFFMEILTSKESDPLLLVEVTNFIFEIYSDSAYDYDTEVFVK
                     DSFLQTLKEKVVPNLKERFKFVDRNKSPELKERATETFNILGSFINYKESEAH"
     gene            complement(<102048..>102218)
                     /locus_tag="CAGL0D00858g"
                     /db_xref="GeneID:2887176"
     mRNA            complement(<102048..>102218)
                     /locus_tag="CAGL0D00858g"
                     /product="40S ribosomal protein S29"
                     /transcript_id="XM_445451.1"
                     /db_xref="GeneID:2887176"
     CDS             complement(102048..102218)
                     /locus_tag="CAGL0D00858g"
                     /note="highly similar to uniprot|P41058 Saccharomyces
                     cerevisiae YDL061c YS29B or uniprot|P41057 Saccharomyces
                     cerevisiae YLR388w YS29A"
                     /codon_start=1
                     /product="40S ribosomal protein S29"
                     /protein_id="XP_445451.1"
                     /db_xref="GeneID:2887176"
                     /db_xref="GOA:Q6FWE3"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /translation="MAHENVWFSHPRRFGKGSRQCRVCSSHTGLIRKYDLNICRQCFR
                     ERASDIGFNKYR"
     gene            <103843..>106263
                     /locus_tag="CAGL0D00880g"
                     /db_xref="GeneID:2887192"
     mRNA            <103843..>106263
                     /locus_tag="CAGL0D00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445452.1"
                     /db_xref="GeneID:2887192"
     CDS             103843..106263
                     /locus_tag="CAGL0D00880g"
                     /inference="similar to AA sequence:UniProtKB:Q07381"
                     /note="similar to uniprot|Q07381 Saccharomyces cerevisiae
                     YDL060w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445452.1"
                     /db_xref="GeneID:2887192"
                     /db_xref="GOA:Q6FWE2"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE2"
                     /translation="MAGHSHRSSVKNGHKAFKSRHSSKNALKRANKGKVERESIGTGR
                     PIKNASKLQRRNKAKQLRAQKILDTLQIRKLFEGSNGAEKIITVIPLTEDVDAHDIIT
                     KILSSADLDEQTLSQFVPQGMPNSAFVKDIHIKKFKSNLKFIVPDMSNFLNILDASKV
                     ADFTIFGLSGTSEVDSEFGEQVIRALELQGIASYIGVVSNLSQVHPKEKFQLDVKQSL
                     ESYFKHFFPNEDKIYNLEKPSDSLIALRTLCQKFPRGVTWRDNRGYMVANNIDFIDSE
                     TQPDVGDLVISGTVRGCGFNSDRLIHIPGLGDFQVNKIERIAASTRKTKKDADELDEI
                     SSLLENSFAATSEQDTLDEYAPVDMEFEDMSDEDEFEYSNLKAARYDDHGFLPGREQQ
                     SKKYKIPKGTSEYQAKWYLEDVVEVDDDEELEPDHEETAMDDMDMDEAVDEYAHEGFN
                     DEMEDDFTDAKTTTEDLFVELSPEEEERQLREYRALEKEDREFPDEIELEPTQSAIEA
                     LKYYRGLKNLYNCVWDVEERDPRTPQEWNRLLRIGNYKNTKNRLQKEAVKTAQVVAGD
                     RIKLHINFPKNLLSKVNDPSIISFPVYGLLRHEHKNAMVNFSIQRWEEYEDPVPSKET
                     LLVQYGARRYAIQPLFSGDANSSNNVHKYDRFLHPETASVATCIAPVDFTQSPAIFFK
                     PSSTDRKGIELVGQGTFMNADHTRVLAKRAILTGHPFRFHKKVVTVRYMFFRPEDVEW
                     FKSIPLFTKTGRSGFIKESLGTHGYFKATFDGKLSAQDVVAMSLYKRMWPRPSIPWNG
                     ESIEEIQD"
     gene            complement(<106570..>107208)
                     /locus_tag="CAGL0D00902g"
                     /db_xref="GeneID:2887211"
     mRNA            complement(<106570..>107208)
                     /locus_tag="CAGL0D00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445453.1"
                     /db_xref="GeneID:2887211"
     CDS             complement(106570..107208)
                     /locus_tag="CAGL0D00902g"
                     /inference="similar to AA sequence:UniProtKB:Q12223"
                     /note="similar to uniprot|Q12223 Saccharomyces cerevisiae
                     YDL059c RAD59 recombination and DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445453.1"
                     /db_xref="GeneID:2887211"
                     /db_xref="GOA:Q6FWE1"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="InterPro:IPR016810"
                     /translation="MDGKVTYEGAVYSSGPGVEVGDIVFVEDWDGRPASEWSVQRIGV
                     LQSKIERYTYQIYHSNRYGKHNLSKLIPRHVLVGFANEVFGFDGWKTDIEFVETKDGF
                     PGSTSSISIADKISADSGGGTGALADRYTVIAEASVKVTLKDGTNTRMTGFSRATTPS
                     KIESFNKAKKEAVNDALKKALLSFEKIILEHELKTKNDFYVDGLYGSKAQKI"
     gene            <108341..>114283
                     /locus_tag="CAGL0D00924g"
                     /db_xref="GeneID:2887221"
     mRNA            <108341..>114283
                     /locus_tag="CAGL0D00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445454.1"
                     /db_xref="GeneID:2887221"
     CDS             108341..114283
                     /locus_tag="CAGL0D00924g"
                     /inference="similar to AA sequence:UniProtKB:P25386"
                     /note="similar to uniprot|P25386 Saccharomyces cerevisiae
                     YDL058w USO1 intracellular protein transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445454.1"
                     /db_xref="GeneID:2887221"
                     /db_xref="GOA:Q6FWE0"
                     /db_xref="InterPro:IPR006953"
                     /db_xref="InterPro:IPR006955"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:Q6FWE0"
                     /translation="MDIIQGLIQPPKVQSADETIPTLCDRVENSTLLSDRRSAVLALK
                     SFSRQYRETVIASGLKPLLNTMSRDNIDDDLVKAVLETLLILFIRGDGDDDLTRNWIS
                     LHSRARNGKYPSPLVMKQEEEQVDQFSLWIADALTQSEDLLKLIIELLESENFHIKLY
                     TIQLLEAVLVARPSRARNAMINSPTCISTLVALLDDIHEPIRDESILLLMAVVNDSPH
                     IQKLVAFENIFERLFNIIQEEGGLRGSLVVNDCLSLINNILKYNISNQTLFLETGNLP
                     KLALLLNEPISEKEEFFWNDQRINNVKTVLDIVSLTVEAGTTVVKQHQAALLDSHILL
                     VVLRIAFFHTIPKKVRATALMVAADMIKDNEYAQTEFGNIDVPYFDPSLASDTQFDNS
                     HLVPVVELLINWALYANSIHTFDTRVAASNLLKAYLSNNLGLQKQFLERQISAFKEIE
                     KGSKVDGLKANLLEAILIYDADLKLNPYKLYFSTDILMYLFEHDNEGNAELRELLRSI
                     KLGTAIEDEEPLTSIQTITEIVITFLSCEDKRVPIFYLSFLAYWLFADFSAVNDFLSA
                     KENIHSLLDFSHQIEDEDVTVKCLITILLGIAFEFSSKSSPIPRLEYFDIVSNSIGRD
                     NYTSRVKQFKEKSLFSKSQIEIDMFNPPLDDTGLPKIYFNEYFTILFKENFYRILRCF
                     YHDPTDEPIAIVSFEAFEEVQNQCTSLKSHLSELEIQSSEKRSQLEKQIKSLTSNFEA
                     SEQLKKELEDKLSTISEKQQTLESEYEEKKKELAEITANNTSLEQLNTQKEKLTEELK
                     KQLADTKEKLTQMEKQVKELSEHKEKNEQGINKMNRDLFSLQREKQKLEEDNKQSKKD
                     LEKTKNDFTKQETKLKDQIKAKEILIKETTEKLNEATTQSKEYHDKIQNITSEMNEWQ
                     AKYKSHDTFVAKLTEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKS
                     LEELYKNMESEKDGLLKKITELETGIESDNKKFEDEKSALESETKRLTLEIAEFKSNA
                     EKLDTERERLQTLTESYKEKLNEANSSIDEKNKDLNNIQQQIEGSQSEISTLKAEITQ
                     LKTSLNEEKSTRKALEKLKEENETYIQSAQDELLQLQKEVDLLKSENKDALDNNSSLK
                     QKYDELVKELELKNLESKQLSDNSLNLNSKIEQLEGDIKSKYNTIKELEEKLSTSLQE
                     REENIANIADIELKLNSKEEQYTEQTNKLEELRISFEKKQSECKELESKLKSSNDDLQ
                     EKNRLTKELQKNLDSLMKDKEKTEGSLQSLLEDKKQEEKKYKEEIDQLGKENEDITKQ
                     NKELNLRLEDYSAKIDAKDEELKLANDAVASTKKKMLKLEEKIKDLEDTQHIFKDSEN
                     SLKSELEKTALEMNELRSDNDNIIKLKNELQRTNDKLIEENKRTEEKLRSEVAKLKDE
                     LKTKSDTFEKERKLMNEDSSTIIKEYSEKISSLEEKVETIKSEYDKEINILEDKKEVL
                     ESELSDKKQEIIDYNQKIKEQETKATEKEKEIQVAKNALKNAEKKKKDIENDLRTTIA
                     TVEKENTTLKRENQLKSESIDKHQNNIHLLQEELSKQKELADKKHDEIRKLEKENSKM
                     IDRIDKLEKQKADTNEKIANIEKENSSLISERKTLVEKVENFQDEITNLKSSLEKNDS
                     LSSSHDELKDKFNELETELKRNLTELNKLESENKQLSDKVIEHEEKVSMVEKELSTAQ
                     KTLKEREDVINKLKDSNNELNKTIDKHGATEKHYEESITKKDSDIAQLKKKIKDIEDK
                     LSNILEEKAKAAMLMTQLEKDKTDLKNSESELKQELEHYRSKYSSLESKLKSTEEAKK
                     HVEEESREQHQSMSLDLKATKDKLKSAEISISEMDAIKKQVELLTKENVDLKSKSNKA
                     DNSAKLKSELDELKKENEKLQLKVNDRSELDDLMLLVTELDEKNSKYREKLSELGVEL
                     SSDEEDDDDDDDDDDDDDDDEH"
     gene            complement(<114552..>115802)
                     /locus_tag="CAGL0D00946g"
                     /db_xref="GeneID:2886976"
     mRNA            complement(<114552..>115802)
                     /locus_tag="CAGL0D00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445455.1"
                     /db_xref="GeneID:2886976"
     CDS             complement(114552..115802)
                     /locus_tag="CAGL0D00946g"
                     /inference="similar to AA sequence:UniProtKB:Q6B265"
                     /note="similar to uniprot|Q6B265 Saccharomyces cerevisiae
                     YLR380w CSR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445455.1"
                     /db_xref="GeneID:2886976"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6FWD9"
                     /translation="MTEDNYAFRVKTLNEEQLQFLKIVWLHLLKFWGIKVDERPLLND
                     SGCSGRKRATSLAAHELKTNRPRSRSTIFKIHSSVEENEGEGISDFELHEALKNSNPD
                     DTREEFWNMIRADFPDSLLLRFIRARKWDLNKSMTMISNTLDWRVNDSKVDKIIYEGE
                     RAAYDGTMPGFYKNLELQKAVICGKDKEGRPIVCVRPKLHHSKDQSLEEMQRYSLLII
                     EQARLFLKDPVDTATVIFDLSGFSMSNMDYAPVQFLISCFEAHYPECLGKLYIHKAPW
                     IFSPIWKIIRKWLDPVVASKIVFTKSSNDLKEFIACDQLPEYLEGSNPINLDTYQEIA
                     ADHDNQMEDVDTKNRLLSERELIIKQFVDTTIKWIESSNATESQNLLYSRIALGRQLT
                     ANYCELDPYIRSRSRYDIDGSLVV"
     gene            <117147..>118073
                     /locus_tag="CAGL0D00990g"
                     /db_xref="GeneID:2886988"
     mRNA            <117147..>118073
                     /locus_tag="CAGL0D00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445457.1"
                     /db_xref="GeneID:2886988"
     CDS             117147..118073
                     /locus_tag="CAGL0D00990g"
                     /inference="similar to AA sequence:UniProtKB:Q07379"
                     /note="similar to uniprot|Q07379 Saccharomyces cerevisiae
                     YDL057w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445457.1"
                     /db_xref="GeneID:2886988"
                     /db_xref="GOA:Q6FWD7"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q6FWD7"
                     /translation="MIEVIDFEPDHIECQEHERFIYLYDSTYHHSRGIACIVASPKRH
                     RAKNKLIVLVHGSLSHKNAIYQPLLAHCLAELGYHSLRLDFRGLGDSEDVRDPKLGRT
                     IEEDIHDIKTVYKATQEAQICANLFETESITFHAIVGHSRGVLAMFDFALSIAPSIIP
                     ILVNCSGRFDGQGLLKRCSENNPNWIEKGGFYATTLRQGKLQKIWIPKEESFSVIRTN
                     TLNYRNLSHDTTVISIYGTNDEVVPPMEASLDYSSVFKDHHQLIYIDGAGHNFYGKLG
                     EQNTRGLPLRRGMINYNHELVEYLQDIFTKSV"
     gene            <118878..>121286
                     /locus_tag="CAGL0D01012g"
                     /db_xref="GeneID:2887188"
     mRNA            <118878..>121286
                     /locus_tag="CAGL0D01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445458.1"
                     /db_xref="GeneID:2887188"
     CDS             118878..121286
                     /locus_tag="CAGL0D01012g"
                     /inference="similar to AA sequence:UniProtKB:P39678"
                     /note="similar to uniprot|P39678 Saccharomyces cerevisiae
                     YDL056w MBP1 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445458.1"
                     /db_xref="GeneID:2887188"
                     /db_xref="GOA:Q6FWD6"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FWD6"
                     /translation="MSNQIYSAKYSGVDVYEFIHPTGSIMKRKNDGWVNATHILKAAN
                     FAKAKRTRILEKEVLKEMHEKVQGGFGKYQGTWVPLNIAINLAEKFDVYQDLKPLFDF
                     SEENGDAAPPPAPKHHHASKASSAKAKKAGRSVSSPAMNDSKTRASTRKANTPSSNDI
                     TSDSGAVVNPVVTRRRGRPPNSTLTNKRKLGTGLQRSQSEMAFLKPEIPNDLNSNDIA
                     NIQQVNSGDLLRNEKIQKNIQLKEIDLDDGLSSDVEVQETDTFQPNHQSSLLGAEGHE
                     LRNNDSPLSPSSSSSLPTSPANLNDSNPFDQRLGGGGTSPIISLIPRYSVQSRPQVTD
                     INEKVNDYLTKLVDYFISNEMKSNKTVPQELLHPPTQSAPFIDAPIDPELHTAFHWAC
                     SMGNLPIVEALYETGTNIRAANANGQTPLMRSAMFHNSYTRRSFPRIFELLSETVFDI
                     DSMGQTVLHHIVKRKSSTPSAIYYVNVLLSKIKDISPKYRIELLLNTKDANGDTALHI
                     AARNNDREFFDILIKNGSLSTISNNDGQTPTEIMNQHYQDLHLQAQTNIAGSNTSAYT
                     DSFSSFGGKVKGSKLHSISELDDDKNTQNPENTVTNIVSNLHFSSNAAINLVKNIPAF
                     TDSMKHLAEKFDGSYKNHEESCRSTEKMLGSIKRTVHSTDNRIREILETDADADISSA
                     ILAQEKDITELKIEAENHLRKLKNQFEYLQKQRLLKLTEYHNGEHNDTDNTLDNKIEI
                     CKQISVLQIERKRKISELISHYEDSRKIHKYRRMISEGTEMKTEEVDGCLDIILQTLI
                     NNSS"
     gene            complement(<121908..>122993)
                     /locus_tag="CAGL0D01034g"
                     /db_xref="GeneID:2886966"
     mRNA            complement(<121908..>122993)
                     /locus_tag="CAGL0D01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445459.1"
                     /db_xref="GeneID:2886966"
     CDS             complement(121908..122993)
                     /locus_tag="CAGL0D01034g"
                     /note="highly similar to uniprot|P41940 Saccharomyces
                     cerevisiae YDL055c PSA1 mannose-1-phosphate
                     guanyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445459.1"
                     /db_xref="GeneID:2886966"
                     /db_xref="GOA:Q9Y725"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANA
                     GVTDIVLAVNYRPEVMVETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEKVLKKDNS
                     PFFVLNSDVICEYPFKELADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPILVEQKSLYSFDLEGFWM
                     DVGQPKDFLSGTVLYLNSVSKKNPEKLTKGDNIVGNVMVDPSAKIAASAKVGPDVVIG
                     PNVTIGEGVRITRSVVLSDSSIQDHSLVKSTIVGWKSTVGKWCRLEGVTVLGDDVVVK
                     DEVYVNGGKVLPHKSISANVPSEAIIM"
     gene            complement(<123851..>125320)
                     /locus_tag="CAGL0D01056g"
                     /db_xref="GeneID:2887171"
     mRNA            complement(<123851..>125320)
                     /locus_tag="CAGL0D01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445460.1"
                     /db_xref="GeneID:2887171"
     CDS             complement(123851..125320)
                     /locus_tag="CAGL0D01056g"
                     /inference="similar to AA sequence:UniProtKB:Q07376"
                     /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
                     YDL054c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445460.1"
                     /db_xref="GeneID:2887171"
                     /db_xref="GOA:Q6FWD4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /translation="MALSSIEHYLSYHLRVLLPQVLSSKSSHNIAYIFALFAAITSGF
                     VSLISLYAQPWQEHLSYSSWQINMIVTVINMGMYLTPPILGIIADIHGPITLSLSSVL
                     GFIPSYAYLAYTFHRDHSFTNESDGSFTPTLVCFFIIGVATSGLYFSALITCAKLFPG
                     TKLLSISIPTTCYGLSSLIGSQFLRVKYFHPVDYPYLDLGRVFKAFAWIYTVIGVMIW
                     IATSKVAQIQHEADIMEEQDRMAEPSDNDVENHYDDNEQSRLLHATHAQQMTLMKVFR
                     DPVLYIFGATIFCALGPLEMFIANMGSLTNVLAGGHEPAMSSALLSIYALTSTLTRLG
                     TGLTVDYFNKRQLSVKWILLLFLVVGLVTQGKIYMLSMSSLDHSHMVTINRKLFYIGI
                     MQGIAYGGLFTIYPTITLMVWGEKMFGTAYGTLMIAPALGSALSCLIYADVYDSECAN
                     STTRSCIAPVYETTALEFCAAILLTVVVTVLWRKRRTHI"
     gene            complement(<125834..>128554)
                     /locus_tag="CAGL0D01078g"
                     /db_xref="GeneID:2886987"
     mRNA            complement(<125834..>128554)
                     /locus_tag="CAGL0D01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445461.1"
                     /db_xref="GeneID:2886987"
     CDS             complement(125834..128554)
                     /locus_tag="CAGL0D01078g"
                     /note="highly similar to uniprot|P40482 Saccharomyces
                     cerevisiae YIL109c SEC24 or uniprot|P53953 Saccharomyces
                     cerevisiae YNL049c SFB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445461.1"
                     /db_xref="GeneID:2886987"
                     /db_xref="GOA:Q6FWD3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MSHHKKRVYPQAQFQYGAGVPPAGIPVSDASIIPPQVQSPQVGA
                     TDNMIPPYNQTPTMNQMEQAPQAQMFTPAQQQLNQQINSVTTNMGAMNIGTPMMEQMP
                     QQMTPQPQMYGQSQGLMGHSNKPMNQLYPVDLLTELPPPIHDLMLPPPPLMVSPDKML
                     VPSETANASSDYLRCTLNAMPKNGSLLKKSKLPLALVIRPYQHLHDEVNPPPLNEDGL
                     VVRCRRCRSYMNPFVTFIEQGRRWRCNFCRLANDVPMQLDQSFEGAPANRYERNEIKH
                     SVMEYLAPKEYTVRQPPPSTYIFVLDVSQNAVKNGLLATTARSILDTLEFLPNHDNRT
                     RVSILAVDNSLHYFSIPLDEESDQIRMMDISDIDEPFLPKPHSMIVPLNECRNNLEKL
                     LTQLPEIFQFNIMSKFALGPALKAAQNMISNLGGKIVVVSATLPNIGIGKLQRRNESG
                     VANTPKESTQLLSCQDAFYKNFTITCSKSQVSVDLFLASEDYMDVASLSNLGRFTGGQ
                     THFYPGFTAANIADVTKFTKEFSKFLSMDLSTETVMRARGSTGIRMSAFYGHFFNRSS
                     DLCAFSTMPRDQSYVFEMSIDENIGTEYCYVQIAVLLSLNTSQRRIRIITVAIPTTES
                     LSEVYASADQLAIADFFTKKAVEKAMNSSLQDARDLLNKSLQDILATYKKEIVVSNTA
                     GGAPLRFCANLRMLPLLVHALSKHTAFRAGIVPSDHRAAALNNLESMPLKYLVKSAYA
                     RVYSLHDMVDEAGYPDENGEIVLPEPINASASLFERYGLYLIDNSSELFLWVGGDAVP
                     ELVNDVFGLQDIFQIPNGKHELAIVEGSEFNERVRNIIQKVREHDDVITYQTLYIVRG
                     PSVSEPVGHAAGRELQPLRMWATSNLVEDKVLGTESYREFLQTLKNKLNK"
     gene            complement(<129293..>131713)
                     /locus_tag="CAGL0D01100g"
                     /db_xref="GeneID:2887112"
     mRNA            complement(<129293..>131713)
                     /locus_tag="CAGL0D01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445462.1"
                     /db_xref="GeneID:2887112"
     CDS             complement(129293..131713)
                     /locus_tag="CAGL0D01100g"
                     /inference="similar to AA sequence:UniProtKB:P40433"
                     /note="similar to uniprot|P40433 Saccharomyces cerevisiae
                     YIL107c 6-phosphofructo-2-kinase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445462.1"
                     /db_xref="GeneID:2887112"
                     /db_xref="GOA:Q6FWD2"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FWD2"
                     /translation="MEKMESLSPTNSGSGAGISPGSSREGSQGALSNVVKKSSHSNSA
                     ISFQRKVEVFGSDCDEEEDRMIPDTEDEAIASPRKNYLKSKYVGIGQDDDDDEEDEDD
                     EESRDQLGAHILSSLPSFKRRPLSDTPVASMWNSPSGSAEATPSSSRESSTLSLVQLN
                     QALQNSKINANLNKTVPSEGFTMGPTDIISPKSPSPNEASPGLVKSPSQFYHPKRRPT
                     TIDVPGLTKSKTSPDGLISKEDPGSKLVIVMVGLPATGKSFITNKLSRYLNYSMYYCQ
                     VFNVGNTRRKYAKQMGLSEQDSSFFDPTNTEYTALRDKWALDTLEELMDYLLDGPGSV
                     GIFDATNTSKARRKQVLERIRNRSPHLKVLFLESICTNKAVVESNIRLKLFGPDYKGK
                     DPKKSLLDFKERLSNYIKAYEPIEDEEDIQYIKMIDVGKKVIANKIQGFLASQTVYYL
                     LNFNLKERQIWITRNGESEDNVLGKLGGDSHITSRGDKYAKALSRFIDEQRAQFLVNE
                     IEKNKAGQEQLKKLESGNIHDVDLDKDKLPSVADLNQPDQLYNEFFVWTSMLKRSIET
                     AKYFNEDEYPIKQMRMLDEISAGDYEGMTFPEIQAKFPSEFAERQRDKLRYRYPGIGG
                     ESYLDVINRLRPVITEVERIQDNVLIITHRVVARALLGYFMNLSVDIISNLDVPLHCV
                     YCLETKPYGITWSLWEYDEDKDTFFKVPEYNLNTKRVKEAGLVNNERRYSVIPTAPPS
                     KNKSPSNTNENKSTKQGTAKVSSLGNNGATLLPPKLTRLEGGGTSVSIGQRRQVSNSK
                     GSALLQKE"
     gene            <131947..>133464
                     /locus_tag="CAGL0D01122g"
                     /db_xref="GeneID:2887168"
     mRNA            <131947..>133464
                     /locus_tag="CAGL0D01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445463.1"
                     /db_xref="GeneID:2887168"
     CDS             131947..133464
                     /locus_tag="CAGL0D01122g"
                     /inference="similar to AA sequence:UniProtKB:P53954"
                     /note="similar to uniprot|P53954 Saccharomyces cerevisiae
                     YNL048w ALG11 required for asparagine-linked
                     glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445463.1"
                     /db_xref="GeneID:2887168"
                     /db_xref="GOA:Q6FWD1"
                     /db_xref="InterPro:IPR001296"
                     /translation="MSTMLWVVVAAVLLFVLPVVRVPMLDLTRRNIIRWQRGGIQKYT
                     TRYYGFFHPYCNAGGGGEKVLWKAVQETLLYDPNCSIVIYTGDVDSSPKEIIANVIKR
                     FDYEMDFNRVQFVFLKYRKWVDGSTWKHLTLVGQAMGSMLLTIEALLRFVPDIWLDTM
                     GYPFGYPVVRWLAGLPVMTYTHYPVISSDMIHKIEIENQKQPSKKGTLKLIYWKLFMK
                     WYQYVGKFVDVAITNSTWTGNHIRSIWKRVKIKVMYPPCSTEKLVKNSSPTAYETRQN
                     QAVLIAQFRPEKRHKLVIQAYSDFISRTASKDHFKLVLIGSTRSEEDRAYVETLKSWA
                     FDTLKIPKESLTFKTDCSYDDIKKFLAESTFGINAMWNEHFGIAVVEYAAAGLISLVH
                     ASAGPLLDIIVPWDSAKKQQLPYSDSTKDTRTGLFFKDKSDPDYKPTDAQFNNYGSLA
                     DIFEEANSLSIAERKQISERAKECASNKFSDNTFNHAWDHALDELEHKTSRLGSN"
     gene            <133799..>134281
                     /locus_tag="CAGL0D01144g"
                     /db_xref="GeneID:2887169"
     mRNA            <133799..>134281
                     /locus_tag="CAGL0D01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445464.1"
                     /db_xref="GeneID:2887169"
     CDS             133799..134281
                     /locus_tag="CAGL0D01144g"
                     /inference="similar to AA sequence:UniProtKB:P07253"
                     /note="similar to uniprot|P07253 Saccharomyces cerevisiae
                     YBR120c CBP6 apo-cytochrome B pre-mRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445464.1"
                     /db_xref="GeneID:2887169"
                     /db_xref="UniProtKB/TrEMBL:Q6FWD0"
                     /translation="MSTPPAVREAAKQVVKCLERFPADRFKHLTSFKDIQISRFNRIA
                     GVSLKGEDAANEKKPSLSEVKDMISRTSGPLGLQKDFLKKLQGALQQDMVSEEGLTKQ
                     KRSLEVLMSDKYKNYYEVGDKLYKPNGNPEYYQRLMDELTGKKKENLFTGLRTVFFGK
                     "
     gene            complement(<134536..>135441)
                     /locus_tag="CAGL0D01166g"
                     /db_xref="GeneID:2887024"
     mRNA            complement(<134536..>135441)
                     /locus_tag="CAGL0D01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445465.1"
                     /db_xref="GeneID:2887024"
     CDS             complement(134536..135441)
                     /locus_tag="CAGL0D01166g"
                     /inference="similar to AA sequence:UniProtKB:P32605"
                     /note="similar to uniprot|P32605 Saccharomyces cerevisiae
                     YBR119w MUD1 U1 snRNP-specific A protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445465.1"
                     /db_xref="GeneID:2887024"
                     /db_xref="GOA:Q6FWC9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC9"
                     /translation="MKQENIKTLYLQNLPRRPVNKESFIRNLLKCINRNNIYVLNPSK
                     PIPASIDFNEYNELKESQDKNLYLDESLGLISISLSRSLRLRNQGFLTFESHELAQSF
                     MDRYQNNKLKVSGRIINISFAKKESFLGLYLDNERVLQKALRTKYRKEDLENNQHKLE
                     TLKLRRKQRRLRSKLRSKGVDDEQIKAAVTGLTQKVTATINEKKPVPLALKQETRPPK
                     QDNEKLVEPNSILLLTDLPSGCTSDQIKVNIPTKELKEIRLVSVRNVAFVEYEDIEAA
                     TVALKEMVPKLTKLGNNIKVTYAKK"
     gene            complement(<136033..>137409)
                     /locus_tag="CAGL0D01188g"
                     /db_xref="GeneID:2887031"
     mRNA            complement(<136033..>137409)
                     /locus_tag="CAGL0D01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445466.1"
                     /db_xref="GeneID:2887031"
     CDS             complement(136033..137409)
                     /locus_tag="CAGL0D01188g"
                     /note="highly similar to uniprot|P02994 Saccharomyces
                     cerevisiae YPR080w TEF1 or uniprot|P02994 Saccharomyces
                     cerevisiae YBR118w TEF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445466.1"
                     /db_xref="GeneID:2887031"
                     /db_xref="GOA:Q6FMI3"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI3"
                     /translation="MGKDKQHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW
                     DESRFAEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNASWYKGWEKETKA
                     GVVKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     AASFNATVIVLNHPGQISAGYSPVLDCHTAHIACKFEELLEKNDRRSGKKLEDSPKFL
                     KSGDAALVKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVDKTDKAGKVTK
                     AAQKAAKK"
     gene            <137954..>138646
                     /locus_tag="CAGL0D01210g"
                     /db_xref="GeneID:2887130"
     mRNA            <137954..>138646
                     /locus_tag="CAGL0D01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445467.1"
                     /db_xref="GeneID:2887130"
     CDS             137954..138646
                     /locus_tag="CAGL0D01210g"
                     /inference="similar to AA sequence:UniProtKB:Q9X5E5"
                     /note="similar to uniprot|Q9X5E5 Zymomonas mobilis
                     Aspartate racemase and uniprot|Q8Y2X0 Ralstonia
                     solanacearum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445467.1"
                     /db_xref="GeneID:2887130"
                     /db_xref="GOA:Q6FWC7"
                     /db_xref="InterPro:IPR001920"
                     /db_xref="InterPro:IPR004380"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="InterPro:IPR018187"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC7"
                     /translation="MKVGIIGGIGPEATTHYYISIIKQFQDAVGSDKVLPEMVVESIN
                     MYHMFEMLEQRQYDDVAEYLAHAACNLQKAGADFGVMCGNTPHIVFEKIQGKTDLPLL
                     SMVQCSLDVASAMGLKRLALLGTKFTMQNDFFKRPFEMAGISIYTPSPVEQETIHQKI
                     VGELENGIVTPDTKSTLLTIINGMIKEHGLDGVILGCTELPLILNQRDFSIEVLDIAK
                     EHINAIVKKLSC"
     gene            complement(<138971..>139960)
                     /locus_tag="CAGL0D01232g"
                     /db_xref="GeneID:2887223"
     mRNA            complement(<138971..>139960)
                     /locus_tag="CAGL0D01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445468.1"
                     /db_xref="GeneID:2887223"
     CDS             complement(138971..139960)
                     /locus_tag="CAGL0D01232g"
                     /inference="similar to AA sequence:UniProtKB:Q06815"
                     /note="similar to uniprot|Q06815 Saccharomyces cerevisiae
                     YPR079w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445468.1"
                     /db_xref="GeneID:2887223"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC6"
                     /translation="MLLSCLLLLLSCLPIKAAKAEDNEKPFCAVMNPLTGTYIDLSQL
                     STSPNEEFQMTQRRNNKKTKSNKTRWLVKDWEGKTNFTLSVCSSPVVSKEEKDQLSNT
                     TGAFYVVNDTEHGYTMKYVSIGDFSSEPRLTGIYDTRVLTLKYENGSMCPNGKDRKAT
                     LLNFICDKTVSSKAQISYVGNLHECSYFFEIRSVYACPTSNKTNEVNVYGIFISIIVI
                     FFMVEYACRKWLFKDGSVKSVRLHDNYSSSTTSFARDDMRWEMNRHNRSLWKTIPMKV
                     FGGTFRFVGSVVGGLLTKNNSRAQYSAVSTNQQSPFYRDMEEQNDILDSLDTN"
     gene            <140355..>141038
                     /locus_tag="CAGL0D01254g"
                     /db_xref="GeneID:2887123"
     mRNA            <140355..>141038
                     /locus_tag="CAGL0D01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445469.1"
                     /db_xref="GeneID:2887123"
     CDS             140355..141038
                     /locus_tag="CAGL0D01254g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445469.1"
                     /db_xref="GeneID:2887123"
                     /db_xref="GOA:Q6FWC5"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC5"
                     /translation="MHQDSSTEERMFQFDEEMGDGLDAQLDLLFQQTARVEKIIEFNE
                     RDLAQQELDCTIPALDTKVKWYRKYVRIMLDKWLLIKVRCYSQGQKQEQKQKQEQEQE
                     QEQEQGQHKSTQCTVTKTLSSLVLDVQGPMSNRHEFEAGSYSYEHAHPSSTDADAESI
                     VTDESELQHTRATTSNYRALGQCQGQSQGQSQGPPNILHDRDKEAPRGRTRHRSRYTP
                     VRHASCGNR"
     gene            <142000..>142191
                     /locus_tag="CAGL0D01265g"
                     /db_xref="GeneID:9487975"
     mRNA            <142000..>142191
                     /locus_tag="CAGL0D01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999481.1"
                     /db_xref="GeneID:9487975"
     CDS             142000..142191
                     /locus_tag="CAGL0D01265g"
                     /note="some similarities with uniprot|P41902 Saccharomyces
                     cerevisiae YOR031w CRS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999527.1"
                     /db_xref="GeneID:9487975"
                     /db_xref="GOA:P15113"
                     /translation="MANDCKCPNGCSCPNCANGGCQCGDKCECKKQSCHGCGEQCKCG
                     SHGSSCHGSCGCGDKCECK"
     gene            <142618..>143949
                     /locus_tag="CAGL0D01276g"
                     /db_xref="GeneID:2887242"
     mRNA            <142618..>143949
                     /locus_tag="CAGL0D01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445470.1"
                     /db_xref="GeneID:2887242"
     CDS             142618..143949
                     /locus_tag="CAGL0D01276g"
                     /note="weakly similar to uniprot|Q06810 Saccharomyces
                     cerevisiae YPR075c OPY2 pheromone resistant yeast"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445470.1"
                     /db_xref="GeneID:2887242"
                     /db_xref="GOA:Q6FWC4"
                     /db_xref="InterPro:IPR018571"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC4"
                     /translation="MSSVSQSVSIPQPSQTYSRGADGCVVCPTSVACPTCAEDENCVL
                     TALTCDTCPYTYCAKKSSLAIGSLSGVDANGNALNATNSSGSSTNSHKGRVNIPGIVS
                     GSVVGFLVLVLVLVIVYFWKRRKRFAREGKLRAYKLSRGRRGPNRVGGKNSGDGEDGE
                     DGAGGDGIKWDSDIENELDDDDLDLDIDDDDDDEDDDDDEDDEDDIDDGAGPRHLYAA
                     QPHMRQRLKDIVEEGDDMNVSGPVGLDALRNGQTVEQFRLRPMRPLKAASDAQSIYSN
                     NTVHTKASSNVLPIAYIPGVTINQMQPHVKPGYRPHSRAVRGRLNHDDVRSHITLGSS
                     ILGSEDNFDLEFDHSVTPVPVKPEMEKAEKPATNLTTAIRAKPRLITIDGKDPQDASE
                     GMPEETQDVQVPEQHDDVHSSGSSTESFTIDLDISLPEDESPFGDQHQIVN"
     gene            <145031..>147070
                     /locus_tag="CAGL0D01298g"
                     /db_xref="GeneID:2887198"
     mRNA            <145031..>147070
                     /locus_tag="CAGL0D01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445471.1"
                     /db_xref="GeneID:2887198"
     CDS             145031..147070
                     /locus_tag="CAGL0D01298g"
                     /note="highly similar to uniprot|P23254 Saccharomyces
                     cerevisiae YPR074c TKL1 transketolase or uniprot|P33315
                     Saccharomyces cerevisiae YBR117c TKL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445471.1"
                     /db_xref="GeneID:2887198"
                     /db_xref="GOA:Q6FWC3"
                     /db_xref="InterPro:IPR005474"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR005478"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR020826"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC3"
                     /translation="MSFGEIDKLAVSTIRLLSVDQVSKANSGHPGAPLGMAPAAHVVW
                     SQMRTNPKNPDWIARDRFVLSNGHACALLYSMLHLTGFDFSIDDLKNFRQLNSRCPGH
                     PEFELPGVEVTTGPLGQGISNAVGMAIAQANFAATYNKPDFTLSDSYVYTFLGDGCLQ
                     EGVSSEACSLAGHLKLGNIIAIYDDNKITIDGNTTVSFDEDVCKRYEAYGWEVLHVEN
                     GNEDLNAIAQAVNKAKQSKDKPTLIKMTTTIGYGSLNAGSHSVHGSPLKEDDLKQLRK
                     KFGFDPEKSFVVPQEVYDYYQAKIATPGAKANQEWDAKFAKYQQKYPEQGKELARRLA
                     GELPAGWCSKLPTYTPADSAVATRKLSEIVFQSIYDELPEMIGGSADLTPSNLTRWKE
                     AVDFQPPSSGLGDYSGRYIRYGIREHGMAAIMNGISAFGANYKAYGGTFLNFVSYAAG
                     AVRLSALSGHPVIYVATHDSIGVGEDGPTHQPIETLAHFRALPNLHVWRPADGNETSA
                     AYKVALESKHTPSVIALSRQNLPQLEGSSVEKALKGGYVLKEANNADITLVSTGSEVY
                     LTVDAVKVLAAKGITARVVSLPDFLAFDQQPEDYKLSVLPDGAPVMSVEVLSTKSWGK
                     YAHESFGIDRFGASGKAPEVYDYFGFTPEGIAERAEKVVKFYHGQKLSSPLKKAL"
     gene            <148620..>149102
                     /locus_tag="CAGL0D01320g"
                     /db_xref="GeneID:2887199"
     mRNA            <148620..>149102
                     /locus_tag="CAGL0D01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445472.1"
                     /db_xref="GeneID:2887199"
     CDS             148620..149102
                     /locus_tag="CAGL0D01320g"
                     /note="highly similar to uniprot|P40347 Saccharomyces
                     cerevisiae YPR073c LTP1 protein-tyrosine-phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445472.1"
                     /db_xref="GeneID:2887199"
                     /db_xref="GOA:Q6FWC2"
                     /db_xref="InterPro:IPR000106"
                     /db_xref="InterPro:IPR017867"
                     /db_xref="InterPro:IPR023485"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC2"
                     /translation="MTTDKKLSVAFVCLGNICRSPMAEAVFKHTVKENNLESRFEKID
                     SFGTAGYHVGESPDSRSSSTCRSHGVPVNHRAQQIRAHHFNEFDYIICMDESNYKSLE
                     RIKPKGSRAQIFLFGNWNTDSKFKKIVDDPYYGGKEGFEYNFQQVTYFSNEFLKQELV
                     "
     gene            complement(<149562..>151208)
                     /locus_tag="CAGL0D01342g"
                     /db_xref="GeneID:2887149"
     mRNA            complement(<149562..>151208)
                     /locus_tag="CAGL0D01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445473.1"
                     /db_xref="GeneID:2887149"
     CDS             complement(149562..151208)
                     /locus_tag="CAGL0D01342g"
                     /inference="similar to AA sequence:UniProtKB:Q12514"
                     /note="similar to uniprot|Q12514 Saccharomyces cerevisiae
                     YPR072w NOT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445473.1"
                     /db_xref="GeneID:2887149"
                     /db_xref="GOA:Q6FWC1"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC1"
                     /translation="MSQRKLQQEIDKLLKKVKEGLEEFDSIYEKFQGTESSNISYREK
                     LEGDLKREIKKLQKQRDQVKTWLSKEDVKDKDTVLMETRKLIENDMEKFKQIEKLMKT
                     KQFSKEALTNPDIIKDPRELRKRDESLFIHECIDELTKQLESLEAQEDNEHQIERHEF
                     HIANLENILKLLQNNELDPDKLNEFHDDIKYYVENNDDPDFIEYETIYEDIGCELNKA
                     AIAAQQEESIKSTPKKSPTKKSSKISGSAAKRSPTPLAGTANANKNESSDKTKTIDTQ
                     ETKADKSKPEEIIKSEDKPTKQAEDEQSNNEGDDNEDEDDDKEDDYVEPVDRTAEINE
                     ILQQDIQLNSTAMNNPLFKDEIQYWLESKRNLLQPIEDMTPAMIQQLESSLLNCPDSL
                     DADSPSLYRKPLSQHHPTSIFFPNEPIRFVYPFYEQTQPNHQNGSEGRNNKHEDIYSR
                     TSLAKIFNMFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKEIEKL
                     PPGMTKSEEESWRYFDFKKSWLSRRCGSDFVYNEADFEKL"
     gene            <152033..>155479
                     /locus_tag="CAGL0D01364g"
                     /db_xref="GeneID:2887231"
     mRNA            <152033..>155479
                     /locus_tag="CAGL0D01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445474.1"
                     /db_xref="GeneID:2887231"
     CDS             152033..155479
                     /locus_tag="CAGL0D01364g"
                     /inference="similar to AA sequence:UniProtKB:P14922"
                     /note="similar to uniprot|P14922 Saccharomyces cerevisiae
                     YBR112c CYC8 general repressor of transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445474.1"
                     /db_xref="GeneID:2887231"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FWC0"
                     /translation="MATTPSAVAAAAAAATTGNASANATTTTTTTANATNEQQLDPLT
                     QSTAETWLSIASLAETLGDADRAAMAYDATLQHNASSTKGLTSLAHLYRSRDMFQKAA
                     ELYECALQVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGI
                     LYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWSQALECFRYILAQ
                     PPTPLQEWDIWFQLGSVLESMGEWQGAREAYEHVLLQNDHHAKVFQQLGCLYGMNNVQ
                     FYDPQKALSYLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIF
                     WCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQ
                     AARLDPENIHIRKRLETLTAQLENPQEAAALQQQQQQQQLSTPSNGNVILSNNSQQQE
                     FNQGSVQMMINNNANASPPVMLQPTLQVTDQVNPLNVRPAYPADQQPQQPQQLYSGAP
                     LQQPPQTQQPPHTETQPLQQPVAPPSLPPTQIPNTLPQQPLPSQQQANLLPKANPMDI
                     SNANNQIPPRNPDIPSAEQAEPAYTAGAHQQSVGAAQPEAPESVGAAPKPDILNQPEA
                     PKTEDNQLPQANIPEIKPMEVQNPTTQETETHQLPRIQPNAAPQTLPENGSINALVNA
                     AVSSAPAPTNKNEREPDANEVEPAQKRQKLDDSPEAPQATESAPESVPESAPESAPES
                     NIEPTNQEKEDLAKETTPTENTESAKSVKQEQQTQQEVSEPPVENGQEETTTSLPVPA
                     TEETNHNNETVGTAEDLKDEAMHDATQDGEKHQAVEESVTTDLPSTEQEKHLDEPAQK
                     SEVEENTRAETAGYEEPSDLPDAQKSSETTGTTETAEAEHTEVTNVPSEVETSETAKP
                     AETTADQLTGEINQEKQIEQPSEASESVPEEKTEVEQPKPAEEDSKGNDTPQEEVSIS
                     NTETTMADESSTQPVKDSTETNQNDPADNMTEESHGQDSTIDEADKGSIEENKDTPNE
                     DFQKLQEGTSTDEKINNDEEMKEENDEPKITTTNENTEQNDSVNGEVQTNGTTEVEEA
                     ADETVIKPTAEALEKLEEEAKLREEEEKERLNNENNEDNKTEVTKDAVVREVEEDENY
                     DD"
     gene            complement(<155762..>157459)
                     /locus_tag="CAGL0D01386g"
                     /db_xref="GeneID:2887120"
     mRNA            complement(<155762..>157459)
                     /locus_tag="CAGL0D01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445475.1"
                     /db_xref="GeneID:2887120"
     CDS             complement(155762..157459)
                     /locus_tag="CAGL0D01386g"
                     /inference="similar to AA sequence:UniProtKB:Q12321"
                     /note="similar to uniprot|Q12321 Saccharomyces cerevisiae
                     YPR070w MED1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445475.1"
                     /db_xref="GeneID:2887120"
                     /db_xref="GOA:Q6FWB9"
                     /db_xref="InterPro:IPR019680"
                     /translation="MADQYVEVLGDLIGLLKDYKPGTITIENITKLCQSMGLESFIDE
                     LDNDISRLSTASKIIVIDIDYNKTQSTVQDVKLVLASNFDNFDYSNEQLEEAGDKQSN
                     ILLNSLTNYDSLKQFHHNLEFLYLLDTYSSVESDNQISSGNNLGSGNGTNGSSLTNKT
                     DKKSVSSGNGLDSKLNEGKLNLFKYFRELKKYINTFFKESCDNRFKVVANVDNRFGLY
                     IYETHGYSMRSRPLAKVYFERAKVPQQRFYEYIYSSETGSWINENSENYSVGVNLILE
                     VNFDDTDEDVFWFPKEFVPTDLFIDEKDQLTSRKVSDVLCHAFYELGSSKKQTIELMN
                     DFTTDLIQIRRFNINNDNLDLIADILNWTIWYRTVLRPIYLKLVSSISDDDDQHIRAD
                     IANTKDEFTVENTNPEIMKGPTNKNASFMQRNSMSLQRRRRSSNKAKRPSMSEAVVFK
                     DEGLQQFSLHEIMADTTTEPDQKPDNLNISNNSESFIGQQELMEGSNIINDDKMDIDE
                     EAINDDDSDSQSGEEGNIPVLLVNEDHVSFKGLGSCSFYDDKDKWAKFVEDLFNVFS"
     gene            <157783..>158664
                     /locus_tag="CAGL0D01408g"
                     /db_xref="GeneID:2887011"
     mRNA            <157783..>158664
                     /locus_tag="CAGL0D01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445476.1"
                     /db_xref="GeneID:2887011"
     CDS             157783..158664
                     /locus_tag="CAGL0D01408g"
                     /note="highly similar to uniprot|Q12074 Saccharomyces
                     cerevisiae YPR069c SPE3 putrescine aminopropyltransferase
                     or uniprot|Q12455 Saccharomyces cerevisiae YLR146c SPE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445476.1"
                     /db_xref="GeneID:2887011"
                     /db_xref="GOA:Q6FWB8"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB8"
                     /translation="MSEITHPTIVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQD
                     VLIFKSTNYGNVLVLDNVIQATERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVL
                     REVVKHECVEEAWLCDIDEAVIRLSKEYLPDMAGVYSHPKVKTHIGDGFQFLRDYQNT
                     FDVIITDSSDPEGPAETLFQQSYFELLRSALTDKGVITTQAESMWLHLPIIKDLKKAC
                     SQVFPVAEYAYTTIPTYPSGTIGFMVCSKDASANVKKPLREMTEEQEKKLLRYYNKRI
                     HESSFVLPTWVAKELEL"
     gene            <158990..>160327
                     /locus_tag="CAGL0D01430g"
                     /db_xref="GeneID:2887160"
     mRNA            <158990..>160327
                     /locus_tag="CAGL0D01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445477.1"
                     /db_xref="GeneID:2887160"
     CDS             158990..160327
                     /locus_tag="CAGL0D01430g"
                     /inference="similar to AA sequence:UniProtKB:Q12214"
                     /note="similar to uniprot|Q12214 Saccharomyces cerevisiae
                     YPR068c HOS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445477.1"
                     /db_xref="GeneID:2887160"
                     /db_xref="GOA:Q6FWB7"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB7"
                     /translation="MVQLVISASQFQSQVVDLLPCNKRQKSQLIYSMLESYGLLECFD
                     HIIDVPSCQRKDLEKFHSKDYLNVILDEQLNWNPQIDGNEDQLMELRKAWNDITTSNE
                     ASKPDFKTYSELLHYYRDHIEVSEHNKKRTALEAELSDVESGDEVTRRSTLAKFNLLD
                     DCPIFPYLPLYCYVSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYIND
                     IALLIMTLRRGGVDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETGFFPCSGSL
                     EDNSSGKSIVNIPLLHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYS
                     EWQLSIKGLTSTITSLIEQFNCHIVLLGGGGYNNLLMSRFYTYLTWSICHQYASEYST
                     PIDDLIQDHCYSDLYSPEQFKFWYYDQETSGGSLKNYNTTAYIEDLIKNIPLT"
     gene            <160810..>161253
                     /locus_tag="CAGL0D01452g"
                     /db_xref="GeneID:2887035"
     mRNA            <160810..>161253
                     /locus_tag="CAGL0D01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445478.1"
                     /db_xref="GeneID:2887035"
     CDS             160810..161253
                     /locus_tag="CAGL0D01452g"
                     /note="highly similar to uniprot|P06787 Saccharomyces
                     cerevisiae YBR109c CMD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445478.1"
                     /db_xref="GeneID:2887035"
                     /db_xref="GOA:Q6FWB6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB6"
                     /translation="MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSP
                     SEAEVTDLMNEIDVDGNHQIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVDEMLREVSDGSGEINIQQFAALLSK"
     gene            complement(<161495..>163480)
                     /locus_tag="CAGL0D01474g"
                     /db_xref="GeneID:2887115"
     mRNA            complement(<161495..>163480)
                     /locus_tag="CAGL0D01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445479.1"
                     /db_xref="GeneID:2887115"
     CDS             complement(161495..163480)
                     /locus_tag="CAGL0D01474g"
                     /note="some similarities with uniprot|P38266 Saccharomyces
                     cerevisiae YBR108w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445479.1"
                     /db_xref="GeneID:2887115"
                     /db_xref="GOA:Q6FWB5"
                     /translation="MDSLKSGLATAGKFTYKGTKTVAKAGYNTSKKHMHKKDKDTHHT
                     DHHEEDEYSEDYHTPRSVNTLRDPSSFPPPPTRSGQAGHVAGNTAGSIAGNYSGYSQP
                     TAAANNTISYNAQAQNTPYSSPAQQQPVSPQPPVQNSQYNPTQNYAIQQPQQPAGTNA
                     NYSYGNQQHPAGQAPIVNSITPNHQYNANNTFQSNLPNQQLNVAAPTQSTNNNFNQMA
                     ANNTYTNSAQVAYNSQQQQLQQNSQQNTYSNAPYQVQAQAAYNPLPQQQQQQQQQPEY
                     NTQLQQNQQLHNQQAYGQQQQIYSNNTQPQYVSQTQQTSYTQNAPPQQTRSPEQPVYG
                     QGITPPVQANAYRPMPSIPPDVNQTAITSTNSANEALQNRIPMNNVDLSSLPPPPTHR
                     DRGRASVENETIDENMQTNNSTIDSSSVASADINNNSIRNIPAPAVGPPGAATRAVPP
                     PPPRRTTSQSMSTNSVVETSPGINSIEQINNYYDGTYAGHSANERPPITNTLKRGTPP
                     LPRRSTSTKMNTQPNPQTPISPSRDTNMDLQRRSTVSSIQSSNRPMPDPPIRKDNIQE
                     NNIESKQVNQEVNSQMSVSNIGIGDITSELQHIKLKSVGNSYEREIHGEAATEVVHNK
                     PLKKKPPTVPKKKDSLKGKAPPPVPKKKPTLTSFVHS"
     gene            complement(<163802..>164482)
                     /locus_tag="CAGL0D01496g"
                     /db_xref="GeneID:2887116"
     mRNA            complement(<163802..>164482)
                     /locus_tag="CAGL0D01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445480.1"
                     /db_xref="GeneID:2887116"
     CDS             complement(163802..164482)
                     /locus_tag="CAGL0D01496g"
                     /note="weakly similar to uniprot|Q12425 Saccharomyces
                     cerevisiae YPR067w ISA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445480.1"
                     /db_xref="GeneID:2887116"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB4"
                     /translation="MRDSVTLDKTAVKMIGIRSVTVSRISVRGYARVVSMPKVIPMAK
                     AMAKPMAKPMMNTMQNTRWYGIKVEASEGEVPLVEPYKVLNKQEDKGLKIAERAAKRL
                     NEIYKESQEVLRVLVESGGCHGFQYNMKLVPESTLSLEETGNSESKTQEEVVDEFAEG
                     ADSSSKDVIYIVSEEGGKVAIDETSLGILNNTTLNYTTELIGSTFKITDGNLKSSCGC
                     GSSFDIEK"
     gene            complement(<164750..>165643)
                     /locus_tag="CAGL0D01518g"
                     /db_xref="GeneID:2887237"
     mRNA            complement(<164750..>165643)
                     /locus_tag="CAGL0D01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445481.1"
                     /db_xref="GeneID:2887237"
     CDS             complement(164750..165643)
                     /locus_tag="CAGL0D01518g"
                     /inference="similar to AA sequence:UniProtKB:Q99344"
                     /note="similar to uniprot|Q99344 Saccharomyces cerevisiae
                     YPR066w UBA3 ubiquitin-like protein activating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445481.1"
                     /db_xref="GeneID:2887237"
                     /db_xref="GOA:Q6FWB3"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023318"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB3"
                     /translation="MAMKVLVLGAGGLGCELLKNLARYDYVSEIHVVDLDTIELSNLN
                     RQFLFREQDIGKYKAEVAAHAIGKRVTDKVIVPHVTDLTTLDATFYSQFQFVISGLDA
                     IAPRRYVNQVLVDITRASAFEICIPFIDGGVEGLKGHIKTIIPGINACWECSIDTLPH
                     ESAMNNPMCTVANNPRSLEHIVEYVVLISNPDADLDDLAVCTQLLDQCRQRASQYGID
                     CSELTLSKMAGIAKRVIPTVSTTNSIVAAMCCEQLNCIYRDLWDPESSPNFTTINGAE
                     GMYIFSFQYQRNPECTVCSML"
     gene            <166233..>166616
                     /locus_tag="CAGL0D01540g"
                     /db_xref="GeneID:2887170"
     mRNA            <166233..>166616
                     /locus_tag="CAGL0D01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445482.1"
                     /db_xref="GeneID:2887170"
     CDS             166233..166616
                     /locus_tag="CAGL0D01540g"
                     /inference="similar to AA sequence:UniProtKB:Q12160"
                     /note="similar to uniprot|Q12160 Saccharomyces cerevisiae
                     YPR063c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445482.1"
                     /db_xref="GeneID:2887170"
                     /db_xref="GOA:Q6FWB2"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB2"
                     /translation="MALNNVRRQDLCVQYKKSEPPRGIYSESQSLSGIVNQTMPMAAI
                     FLKNKFIAWFSLIQSVHSYLNTDEETLEKNKSKTGNSALDQPPLVKVAMSLVGILVCY
                     MNLVFPTPDAPPPSSEKKILDEEKK"
     gene            complement(<166898..>167365)
                     /locus_tag="CAGL0D01562g"
                     /db_xref="GeneID:2887136"
     mRNA            complement(<166898..>167365)
                     /locus_tag="CAGL0D01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445483.1"
                     /db_xref="GeneID:2887136"
     CDS             complement(166898..167365)
                     /locus_tag="CAGL0D01562g"
                     /note="highly similar to uniprot|Q12178 Saccharomyces
                     cerevisiae YPR062w FCY1 cytosine deaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445483.1"
                     /db_xref="GeneID:2887136"
                     /db_xref="GOA:Q6FWB1"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB1"
                     /translation="MSNAAQWDALGMKIAYEEAAKGFEEGGVPIGGCLINNKDGTVLG
                     RGHNMRFQKGSPTLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAILLYGIPR
                     CVIGESDNFKSPGEEYLKSRGVEVVQMNDEPCKAIMKKFIDTRPQDWFEDIGE"
     gene            <167879..>168781
                     /locus_tag="CAGL0D01584g"
                     /db_xref="GeneID:2887113"
     mRNA            <167879..>168781
                     /locus_tag="CAGL0D01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445484.1"
                     /db_xref="GeneID:2887113"
     CDS             167879..168781
                     /locus_tag="CAGL0D01584g"
                     /inference="similar to AA sequence:UniProtKB:Q12350"
                     /note="similar to uniprot|Q12350 Saccharomyces cerevisiae
                     YPR061c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445484.1"
                     /db_xref="GeneID:2887113"
                     /db_xref="GOA:Q6FWB0"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FWB0"
                     /translation="MLVKGSTKFLMAHRHDSMLLNKIRCYATTDDNNLVSAGKGSQVL
                     HDSLWPDKHNPTPYEIFGFGVGTHVDLKKLKMEYHKYVKMYHPDLSSHIQIRKSSLVK
                     SHHAMEIANTAQYLTQAEKIQRFKLVTQAYEILKDPRKKNLYDCTRSGWDMAGSAGPT
                     GAQSAYYASSAAYNNFSDQSYAYWNAGNWEDVHNYQNNSGQKLDPWTLLMWFGGLLLC
                     LEGSSLLARIEDTLTDKSITEDNIEVELGQCYINYGLDTDKWSRLRRFLWFRTFNMYR
                     SKVDLDREAEKNEDLIKTLQEKVK"
     gene            complement(<169066..>169983)
                     /locus_tag="CAGL0D01606g"
                     /db_xref="GeneID:2887159"
     mRNA            complement(<169066..>169983)
                     /locus_tag="CAGL0D01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445485.1"
                     /db_xref="GeneID:2887159"
     CDS             complement(169066..169983)
                     /locus_tag="CAGL0D01606g"
                     /note="highly similar to uniprot|P32331 Saccharomyces
                     cerevisiae YPR058w YMC1 or uniprot|P38087 Saccharomyces
                     cerevisiae YBR104w YMC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445485.1"
                     /db_xref="GeneID:2887159"
                     /db_xref="GOA:Q6FWA9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA9"
                     /translation="MSEEFPTPQLIDDLEDHPGQDNGRVVKDLLAGTAGGIAQVLIGQ
                     PFDTTKVRLQTSKVPTSAAEVVKNLLKNEGPKGFYKGTLTPLVGVGACVSIQFGVNEA
                     MKRFFHARNVDHNATLSLSQYYLCGLTGGMTNSFLASPIEHVRIRLQTQTGSGAQAEF
                     KGPIDCIKKLRSQKGLMRGLIPTMLREGHGCGTYFLVYEALVSKQINQGLKRTEIPPW
                     KLCLYGALSGTALWLMVYPIDVVKSVMQTDNLNKPQNGKNMIQVARNLYAREGLKAFF
                     KGFGPTMLRAAPANGGTFATFELAMRLLG"
     gene            complement(<170546..>171628)
                     /locus_tag="CAGL0D01628g"
                     /db_xref="GeneID:2887070"
     mRNA            complement(<170546..>171628)
                     /locus_tag="CAGL0D01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445486.1"
                     /db_xref="GeneID:2887070"
     CDS             complement(170546..171628)
                     /locus_tag="CAGL0D01628g"
                     /note="weakly similar to uniprot|Q99177 Saccharomyces
                     cerevisiae YPR057w BRR1 involved in snRNP biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445486.1"
                     /db_xref="GeneID:2887070"
                     /db_xref="InterPro:IPR023251"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA8"
                     /translation="MAGRNRNSKDQNKEALSSAIDPVFGQAKAFNINDPEVNPLVKSY
                     LSEVRNEALHTNAISHQIGQVSKNTFDANIYDDEDDSTSIPSDTKVKSDQITEYLYSI
                     ENWYKWFENISDIIWHGCYVFEGYDDESISHLTQLLRFYLQKKIDENRASSFDRHLVN
                     IFRDQLKCSDPDPVNGTLEIDEDWAENLLKTMRNSKIKDLNTVKYCIRTDYKRAPHGL
                     KPWAKYVTSNQPTHTAFINMIDSSNLWTLVMYMTQIWLKEIYTFGKNLERKKMLSQWL
                     LYILLHIPTRLTAEQMSNIRSLAKQAREILNRRVNSNIFGTTNIVIPDELHEHNCPPC
                     PPNLDIASLILAVVTRKYGQHDILEF"
     gene            complement(<172035..>173042)
                     /locus_tag="CAGL0D01650g"
                     /db_xref="GeneID:2887225"
     mRNA            complement(<172035..>173042)
                     /locus_tag="CAGL0D01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445487.1"
                     /db_xref="GeneID:2887225"
     CDS             complement(172035..173042)
                     /locus_tag="CAGL0D01650g"
                     /note="highly similar to uniprot|Q12004 Saccharomyces
                     cerevisiae YPR056w TFB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445487.1"
                     /db_xref="GeneID:2887225"
                     /db_xref="GOA:Q6FWA7"
                     /db_xref="InterPro:IPR004600"
                     /translation="MDAIADPNFQQTKLRSTATEDIPSLLTVVLDISPRLWAEFDHRS
                     GEKQSVTTVLKSLIVFLNSHLAFNSANQVAVIAAFSQGIQYLYPRSSDTSEQNAGNSK
                     DLSIISSHMYRRFRNVDETLIEEFYKLYQREESLIDKPVQKSTLSGAMAAALTYTNRL
                     TKEFESISLRSRLLVITCGSSREKDEIFQYIPIMNCIFSATKLKCPIDVIKIGGNKQS
                     TFLQQTTDATNGVYIHLESTNGIIQYLSTAMSIDPSLRQIIVRPTQGSVDFRTSCYLT
                     GKVVAIGYICSVCLCVLSIIPPGNKCPACDSQFDERVIAKLKKKPVVPKSTLKKVKKK
                     V"
     gene            complement(<173338..>176382)
                     /locus_tag="CAGL0D01672g"
                     /db_xref="GeneID:2887226"
     mRNA            complement(<173338..>176382)
                     /locus_tag="CAGL0D01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445488.1"
                     /db_xref="GeneID:2887226"
     CDS             complement(173338..176382)
                     /locus_tag="CAGL0D01672g"
                     /inference="similar to AA sequence:UniProtKB:P32855"
                     /note="similar to uniprot|P32855 Saccharomyces cerevisiae
                     YPR055w SEC8 transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445488.1"
                     /db_xref="GeneID:2887226"
                     /db_xref="GOA:Q6FWA6"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA6"
                     /translation="MSHLAVNQGRGRRRALSVNSYSEDQQHAMENALDNLRDDLSLVK
                     SQWNRVLTEDSNPLELALAFLDDTSVGLGHRYIEFNQLKEQIGSHLQEVVNQHSQAFN
                     SNVASYTQAVNAITKSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDL
                     NSIEKLIQYPDIIEEHIRGKNYRDARILLEKGFLLAGSQTLKDVSAIKPLVQQLELQE
                     HVLFNTIIEEIHNILYSKNDDSFVTNEIGRMVGTAQTNFSTLENYVYNVVNIDIKEQS
                     RIINDKFSIFMKDIEDSKSYSKKVMVRSKQTVFDKLFIYLSLLKDMKKLSPALNIIYD
                     RTKEEFHNIVLKSTEKVRLKHPSLLKMSQGFEKELNFGLSIKDILSLIMRECFWEIFI
                     KFLVATQGHRVVAESVNSLRSPTSKSTIYPLDKVWRKVIDEIEFLLTRYLRNDQLLNS
                     NKLLKTKRSRASSIANNRIEHFSLEDNIEGEASAKKHAAELKTLLKDIFPGFTVSSNM
                     ELGSIYIQDESFERDDSLIPGSIFNIKVLLEPYLVYVSACENILPEQIKTNTISPLKF
                     FKDYMENQFFPNIEVTFNSLFENHVENNNPYALEINDENKTIFKAAVDFQNLLARIML
                     LMNTTNTFRKNVSTSILEVIIRLQAYYEDLFNTIVNSHNDISNNILITWLNDEKLSHL
                     ESKIYNGDESVITQETNELFRYVPNFCVKSRGLTTYDSLSPTSFDNIIYFLSTIMWIL
                     DWLPTMKKRVEEENNVETKSEIDILRKQWSFFETTDSDVKQIKTLKFSLDKESEEKFD
                     QTINAFMQLKTKLVSLLRFDMRSLCISNIGELFQNTTMWNPEDSSNEIDQSIASLISR
                     LRLSENKLKQQLSDVELKIIFIGVDKLCNIAFIKGSQTIKVLNSNGVKKLSRNIQMLQ
                     HTFRNFSPDPSNIDMSEPLLFYSLCDADESTLFEELNKGSLANLPVELHKTILKLQFS
                     EELYRQQMRSARMSTSTHSKPTNKRYLDAMEKLNNLGVSTAA"
     gene            complement(<176981..>178279)
                     /locus_tag="CAGL0D01694g"
                     /db_xref="GeneID:2887034"
     mRNA            complement(<176981..>178279)
                     /locus_tag="CAGL0D01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445489.1"
                     /db_xref="GeneID:2887034"
     CDS             complement(176981..178279)
                     /locus_tag="CAGL0D01694g"
                     /inference="similar to AA sequence:UniProtKB:P41808"
                     /note="similar to uniprot|P41808 Saccharomyces cerevisiae
                     YPR054w SMK1 sporulation-specific MAP kinase or
                     uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
                     ser/thr"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445489.1"
                     /db_xref="GeneID:2887034"
                     /db_xref="GOA:Q6FWA5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA5"
                     /translation="MGLSKILGSNDNIVNKNGSSNTGGSKKSSFFSLNSKRNTDAAGI
                     VPDFTSIKAPRTIYKNANFSISGKYEIIQVLGKGSYGVVCSAKHKLDNEDQEQFTVAI
                     KKITNIFYRKILLKRAIREIKFMNYFKGHKHIVNLIDIEIVQDKPYDGLYCYQELIDY
                     DLARVIHSSVQLSEFHIQHFIYQILCGVKYIHSADVIHRDLKPGNILCTVNGCLKICD
                     FGLARGVAKQFVNKNSKPNEITNYVATRWYRAPELILSNNEYTKSVDMWSVGCILAEF
                     YGRRPIFMGKDSIHQVYEIKKILGTPSRSLLVKYGTLKAWNLFGHNSNHNLDNLKSGM
                     PWSTVYPMASATALDLIDKLLQWEPESRLNVLQSLEHQFVQSVRKPNDEPICSKGPFN
                     FSYEYNLNSMDDLRQCLNEEVAQFYIERQLGEEYSKYIEE"
     gene            <179249..>180025
                     /locus_tag="CAGL0D01716g"
                     /db_xref="GeneID:2887230"
     mRNA            <179249..>180025
                     /locus_tag="CAGL0D01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445490.1"
                     /db_xref="GeneID:2887230"
     CDS             179249..180025
                     /locus_tag="CAGL0D01716g"
                     /note="highly similar to uniprot|P15873 Saccharomyces
                     cerevisiae YBR088c POL30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445490.1"
                     /db_xref="GeneID:2887230"
                     /db_xref="GOA:Q6FWA4"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA4"
                     /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSR
                     VLLVSLEIGIEAFQEYRCDHPVTLGIDLTSLSKILRCGNNSDTLTLIADDTPDSVLLL
                     FEDTKRERIAEYSLKLMDIDADFLKIEELQYDTTLMMPSYEFSKVVRDLSQLSDSLNI
                     MVTKETIKFVADGDIGSGSVILKPFVDMEKPEDSVKLEMEQPVDLTFGSKYLLDIVKG
                     SALSEKIGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE"
     gene            complement(<180212..>181279)
                     /locus_tag="CAGL0D01738g"
                     /db_xref="GeneID:2887257"
     mRNA            complement(<180212..>181279)
                     /locus_tag="CAGL0D01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445491.1"
                     /db_xref="GeneID:2887257"
     CDS             complement(180212..181279)
                     /locus_tag="CAGL0D01738g"
                     /note="highly similar to uniprot|P38251 Saccharomyces
                     cerevisiae YBR087w RFC5 DNA replication factor C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445491.1"
                     /db_xref="GeneID:2887257"
                     /db_xref="GOA:Q6FWA3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA3"
                     /translation="MSLWVDKHRPKTLKTLSYNDDLTRFLSSLAMNPRDLPHLLIYGP
                     NGSGKKTRCMALLESIFGSQVYRLKIDVRRFVTPSNRKLELNVVSSPYHLEITPSDMG
                     NNDRVVIQELLKEVAQMEQVDFQDGSSGIANRFKCVIINEANSLTRDAQAALRRTMEK
                     YSKNIRLIMLCDSMSSIISPIRSRCLMIRSPAPQMKDITKTLKDVASEENVNIVDQVI
                     LDKVANESNGNMRLALLMLESMSLSNEMQLKENTPVIKPDWMVVILKLANKIKKERSV
                     SSLVECRAVLYDLLAHCIPAKVILQELAFALISDKTTPDSSRVEIIDHASVFDERLCL
                     GNKAIFHLEGFIAKVMCTLDK"
     gene            <181792..>182544
                     /locus_tag="CAGL0D01760g"
                     /db_xref="GeneID:2886981"
     mRNA            <181792..>182544
                     /locus_tag="CAGL0D01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445492.1"
                     /db_xref="GeneID:2886981"
     CDS             181792..182544
                     /locus_tag="CAGL0D01760g"
                     /inference="similar to AA sequence:UniProtKB:P53093"
                     /note="similar to uniprot|P53093 Saccharomyces cerevisiae
                     YGL198w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445492.1"
                     /db_xref="GeneID:2886981"
                     /db_xref="GOA:Q6FWA2"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA2"
                     /translation="MATDDQFIEPDFIEPDVPVRDGSNGNSSAAGSRGIAGLSGNMET
                     SSGDWNRGTLDESVLATFKRDIYDINSKLKQVVYPHLPSHRYMATTSGDQDSAQGANE
                     DIFNSSDFWAPLTFIILYSVCVSHAKGLFSSVFVSCWFVLVVMALHLKLTKPYQNATL
                     LSYVSLSGYCMFPLVICGLLVQIVIPAVSHTLGTSPWKVRVSTLLRLTVFGFCFIWSF
                     TCSAIVTRSKGFVQLYPLALCLFGLAWLSMIL"
     gene            <183156..>188054
                     /locus_tag="CAGL0D01782g"
                     /db_xref="GeneID:2887041"
     mRNA            <183156..>188054
                     /locus_tag="CAGL0D01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445493.1"
                     /db_xref="GeneID:2887041"
     CDS             183156..188054
                     /locus_tag="CAGL0D01782g"
                     /inference="similar to AA sequence:UniProtKB:P53094"
                     /note="similar to uniprot|P53094 Saccharomyces cerevisiae
                     YGL197w MDS3 or uniprot|P32634 Saccharomyces cerevisiae
                     YER132c PMD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445493.1"
                     /db_xref="GeneID:2887041"
                     /db_xref="GOA:Q6FWA1"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA1"
                     /translation="MSLLQPFTCTCYPLRLPAAQAGSGDEYVRRKQSLDCRTGAAVTL
                     TRSNIFVHGGLTIPLNLEKVTCAEIQNQVVLYFAKEKDCSAGFKDLKQWLSPEIFFLD
                     LISRTWNRVDTTVESETMLGAGAGAGAGTATGTGMETDPAREAADVDVFANEQSLSSS
                     VTLSVIEQESFRERLFHSMCYVDGNIFVFGGLVMSPQNGYEFTASNELWRLDLRTKQW
                     SLVSRNPLIQRRFNHSMHVKNEHSDTRDTKIVIVGGLNNLDEPVHKVDIYNLTRGYWQ
                     SVPDSEFPIELETNIEGKPVDLATDSCFSILVENNEAKIPALAFYKPLSCRDHSVITS
                     RSKKAKQVSGRSSVDTEMAVCDSDTGTKEQDEQDPNSQSPIVALPIVSGSKGIRMASH
                     PLQPNDLLEAPLNLLNPTGDYFGYNIVIGGFCPTLLPSDFHCYIYDIPSGKWTRIGIT
                     CPDCEINTHRFWKLFVWDSHHQALVLGTKNDDGYLPSVQKFDHLLSFGLPIINIFNKG
                     IHSVPSNKDAVMSVPDSKFGSSGVSDLESDLNRMSFASSQTSQFESYIRYIAPPYEMT
                     SIRSVFPAYAMVLGKDALEIYGKPLSDFELVSSEGEAIGVPLYLLRKRWGRYFDLLLS
                     QGYSKACTEYEASGNLSTLIKLTPFSSRTGSRDIHSSRLSSSSSLDNYFVKGIGAQHH
                     HYSVSGPAGRKPPGSENIVDRTSRSSVDGHLMGSSPNPMSESVYLTHIDDVDDDDDDC
                     VGPTSQAKNTNKMKSVSRTITSSTTSSTGGMVFRVPFQEKKPSSSVQDIAPDSQFFQT
                     GSSSRRSSLLSSQTMGIQRSPKIEGKRRASHPIISSIMDKGQPVSTRSVGSTRSSLSY
                     VSSSSERQSKSHLPGSRNSSVTGSPILGVLNVPLPPPCQTPTEPVPPPPVTKYPNITS
                     KPRTNSMSEVFNTIKGSPLSSRRSSYSRKTSTSEVNSAIDRQLMEDRFKEADMAFAKQ
                     TPTKPVAGSKMPENIRSSTRNSVNNDWSRHSFASVSDSSESATVNGNIEMEPMLIPRT
                     LYLPWSTATVHAFAEFFYTGQVNGKWMLSPVVLDLLVISKLYELPLLFNLISEVLYSI
                     VGKKEEGMYITCKSLIDSFSRKVSTYFGNDKEKEVAYLESCEAYKILKKIKLCLERID
                     NGFFDLDLMRRHSMSRSSYNSSNGSTVEKKNSLDLSPRGSSNLPTMMGNGPRDSHVSI
                     ESLNYPMHMNIPSSRRSTGTFAHRTTKKSSLSKEIDPSFFNDTSSTLSLHDTAIVKDF
                     NEKIAKADTITEKDYSSTSSSSSCDLDDESDQEKLRHLSETDFATILDTRDSKSHQLN
                     TKEDINNFDFSLGLLSSFNDEKNKLRKVDVDEPIDPLAKISHNLDSPNRLYSKYSQGF
                     GKMPKSGSQASNMGLLTLENLASPNALPPDDAVIKAIHQTTVLANEVRLMIRCGDCLQ
                     ISKDLRRCKKIMNSELTKLEKTHNVSESRTSISASSSQTRLSDYQSSTNSGKITPTAG
                     GSVTTMDPLVKSKLKQNLTGQELHPGIHFVETLHSPKSVADFESKETSSQPGVLNGLH
                     TGLHSGFHAGLHTSPHAGLHSKPQHSHSATKIPKVSHKLGKATTSTSLKSESKSPSST
                     NLGKKEHNSSLGPLSFFGIRNK"
     gene            <188295..>189578
                     /locus_tag="CAGL0D01804g"
                     /db_xref="GeneID:2887038"
     mRNA            <188295..>189578
                     /locus_tag="CAGL0D01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445494.1"
                     /db_xref="GeneID:2887038"
     CDS             188295..189578
                     /locus_tag="CAGL0D01804g"
                     /inference="similar to AA sequence:UniProtKB:P53095"
                     /note="similar to uniprot|P53095 Saccharomyces cerevisiae
                     YGL196w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445494.1"
                     /db_xref="GeneID:2887038"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR026956"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q6FWA0"
                     /translation="MKEYPEEYLGQHISTLPTPCMVIDEKKFNSNCENMLKHVGELGS
                     LTEHPILFRAHVKTHKTTEGTLRQLGFEGTSAPFRSKAILVSTIKEAEGLLEYQDSIN
                     GVFVDDIAFSLPACVPEVLERLSSISTRVSNLRVFVDNIDHLENLKQFGRPKSGKKWS
                     IFLKIDMGTSRAGLEVRSEEFKELVEKLCDESVKEVTQIFGLYAHAGHSYSSHDINEA
                     NGYLIDEITAVNEAAKLVGSVTEIEPRLLTLSVGATPTANSLSTKENKKLIDIIRNDL
                     VAPLEIHCGNYPCYDLQQYSTKCIKLNKISAFVLASIVSKYEKRNEALINAGVLALAR
                     ENSSIPGMGLCINTDKYLHAPRDFEVSSFVNRVSQEHGILQPYNRDKCEDWKLGEKLL
                     VIPQHACITMAQFPYYFVFNDSGKVIDVWKPHQKW"
     gene            <189933..>197933
                     /locus_tag="CAGL0D01826g"
                     /db_xref="GeneID:2887194"
     mRNA            <189933..>197933
                     /locus_tag="CAGL0D01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445495.1"
                     /db_xref="GeneID:2887194"
     CDS             189933..197933
                     /locus_tag="CAGL0D01826g"
                     /inference="similar to AA sequence:UniProtKB:P33892"
                     /note="similar to uniprot|P33892 Saccharomyces cerevisiae
                     YGL195w GCN1 translational activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445495.1"
                     /db_xref="GeneID:2887194"
                     /db_xref="GOA:Q6FW99"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022716"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:Q6FW99"
                     /translation="MSNPRSWEVLEPELGKLCYDSKISNRIPILTELKEIVKTNNLSR
                     EQLLNLASVLLNTYTIYKDHESKKAVCDIYDEMITIDGSFIAIFLDHIVETLGDKIGT
                     KALSDYLNLLDNINHFLQVILVDSNLTSQYLPKVLQCHTITTASIETSLDISEKSMEL
                     VSEKQNQHRRRMRKTIIQNSTKYLNKGLKNTENIQDVLETIRHQLLEEYVKLKLPVAG
                     ILVFSAALTKAALQLHVQTPIVLEFLRTTYSKDFVVFFGKEVLLGKTPPSSLCVATSI
                     DTISQELFTEDMIKNDIIPVLEKSNLRSPESSFQYARALFGSINAKTINMAELYASTK
                     LMSQAFSSFKSSREGTKTAAISFTVSVLRSLCVETTEESALLKIVENIFTNLKTNMNA
                     DYKAIVSTLLQAIPTFHENVSLDIAEKLSPLLVKESNEQALVNLLNPFYQHYFATGTS
                     IDKFNTTIISGLQEKKAPLKRCWFSSLFMNIDTVTESIAKTIGKLCTTYIKENLVHAQ
                     RTEHSVAFSILSGFVFFSENVYAEIEHDIIDIQKDAMLGEAFLRVCTSIELDAVTRQR
                     SVTLLEKAVSLQGETISENVINSIANLMKQDSFELDEKCSIVYFIPIFNALVTSNEDK
                     TTQGNILRFLLVISQYDKFRIKNGWAGLALKCGIDPSQIIAENTSTIINTIISESSKP
                     ELLNTIYGSCVIKAASYIAFINPVAVAGPIAKLFSEDLSVADLDKLTEEDVSIWKGNE
                     GEMVINVLEKRNDRKLADKNSKDYETLKWEESIRKEQAKKANLKLSKEDQMLVKEQLE
                     KESKIRTHVNGIYLRLYRSLSLIKQLSKEAKLVDNGILVWYPTAVNSLMSLIRTENSY
                     NLLESLLVESFLSLSENTAEKLEHYRLFCGLAILRVYKAKFIPSNYLEENLEELLSRV
                     LFRLKIVTSNTELDSITLTYLLPLITYVLEEGKKAALKNADKPVNRTEFVEEDSEEEN
                     LLLAMDIISAQAPLFENSSIPRASILQVLLSLLSLPSKAKIAKDCLNTLSQSISVHPT
                     ENDLKIIISSLLSGHSFVRTTILEVLDNEYELQEFMKFSPEIFMCRFDSDDNNRELAN
                     FIWEFNKFEIVPELLDGLLSLFYQQDSGLRLFLARGFAYATYNVKGEEYLEQSLKMLM
                     NFYNEKAQPLTAILDEFGLVVVPASQRKDLWEERSTAAIALKELSPGLPSDGDTVVSV
                     IEFLIAGPLGDREPIVRQEMKEAGIEIINQHGAQKSSQLVPLFESSLETIKDVNTKEN
                     VIILYGTLAQHLDKSDKRIGSIIDQLLQTLDTPSLDVQQAVSSCIAALVFQFKENCGS
                     YITQLLAKLLDSTIAKPVRKGAAWGIAGIVKGYGISALSEFDIIRSLMEASEDKKDAI
                     KRESVAYAFEYLSQSLGKLFEPYVIEVLPNILKNLGDSVPEVRDATAAATKSIMANTT
                     GYGVKKMIPVTVANLDEIAWRTKRGSVQLLGNMAYLDPTQLSNSLSTIVPQIVGVLND
                     SHKEVRKAADESLKRFGEVIRNPEIQRLVPILLKAIGDPTKYTEEALDALIQTQFVHY
                     IDGPSLALIIHIIHRGMHDRSANTKRKACKIVGNMAILVETKDLIPYLQQLIDEVEIA
                     MVDPVPNTRATAARALGALVERLGEDQFPDLIPRLLDTLNDETKSGDRLGSAQALAEV
                     ISGLGLSKLDELLPTVLAGATNYRSFVREGFMPLLLFLPICFGAQFAPYINQIIQPIL
                     AGLADIDENIRDTSLKAGKLIVKNYATKAIDLLLPELERGVFDENERIRLSSVQLSGE
                     LLFQVTGISSRNEFSEEGEIGSEFSGKMVDVLGQERRDRVLSSLFVCRNDTSGIVRAS
                     TVDIWKALVPNTPRTVKEILPVLTDMIVTNLASSSNTLRNIAAQTLGDVVRRVGGNAM
                     AQLLEALEVTLEKTSNPDSREGVCIALNELVMSASMDTLTQYQDTVANILRRTLIDSN
                     ESVRQAAALSFDSYQEAVGKVAVDEVIPYLLNALKSNENSEYALLGLQDIMATKSDVI
                     FPILMPTLLASPIDSFRASALGSLAEVAGPALYKRLSVIINSLVDTLISDDIDDTTKE
                     GVKQALDRVFLSVKDDEGLHPLLQQILALVKNDDMKKRIVTLQCLPNFFEQTSLDLDV
                     YVPDFVSNSIMSLDDENAVFVKATFEALSALVKKQPKDMLEKLVQPAKQALQRTGKQG
                     EDLSAFALPRGPNCVLPIFLHGLMYGSAEEREVSALAIADVVSKTPADNLKPFVSAIT
                     GPLIRVVGERFKSDVKAAILLALNILFKKIPQFLRPFIPQLQRTFVKSLSDPTNETLR
                     LRAAKAIGTLIEFQPRVDPLVIELVTSAKQTEEEGVKTAMLNALLEVVGKAGSKLNEA
                     SKKNIVKLVEEEMLSSNDKLAVAYAKLIGSLSEILSEDEAKNILQEKVLDADMEGSAG
                     KFAVLILNSFLKDAPSHIFSSGEIHKFVKFITDAMTSTNVHFVENATLAAGKLLLLHN
                     ETKSPYTNMKNDVTFIVPEEDIKSLVEELAKSALVPSSNTTDQRRLSLVVLRTIARLK
                     NEETVKPYLDVLAPAVFSCVRDVVIPIKLAAEKAFLALFGLIEEEDMATFNNWFESVS
                     SNGATIDNIVGTTIQLRSIGDYTKRVAKRLAAVERERTAAGGDDEMMFSDRYEDEREI
                     WAVGGVELPTDI"
     gene            complement(198566..198685)
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0D01848r"
                     /db_xref="GeneID:2887195"
     tRNA            complement(join(198566..198610,198647..198685))
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0D01848r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2887195"
     gene            <199161..>200417
                     /locus_tag="CAGL0D01892g"
                     /db_xref="GeneID:2887029"
     mRNA            <199161..>200417
                     /locus_tag="CAGL0D01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445496.1"
                     /db_xref="GeneID:2887029"
     CDS             199161..200417
                     /locus_tag="CAGL0D01892g"
                     /note="highly similar to uniprot|P23542 Saccharomyces
                     cerevisiae YLR027c AAT2 aspartate aminotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445496.1"
                     /db_xref="GeneID:2887029"
                     /db_xref="GOA:Q6FW98"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FW98"
                     /translation="MSATIFNNIEELPADALFGIKQRYNQDTRATRVDLGIGAYRDDQ
                     GKPWVLPSVRMAERAIQEDPSYNHEYLGINGLPSLSSAAANVIFGEDSPALKEGRTIS
                     VQSLSGTGALHIAAKFISKFAADKKIYLSQPTWANHNAIFKAQGLETASYPYWKSSTK
                     SLDLEGFISAIESAPKGSIFLLHACAHNPTGLDPSEKQWPVILDALVKGDHLALFDSA
                     YQGFASGDLDKDAFAVRLGVEKLASTSPIFVCQSFAKNVGMYGERVGCFHLILPKQNA
                     NLAPIKSAITSQISSIIRSEVSNSPAYGAKIVSKILNTPELTKQWHEDMVTMSSRIKE
                     MRIALRDHLVKLGTPGTWDHIVEQCGMFSFTGLTPEMVKRLEVQHAVYLVSSGRASIA
                     GLNSGNVEYTAKAIDEVVRHYSTSKL"
     gene            <201005..>202012
                     /locus_tag="CAGL0D01914g"
                     /db_xref="GeneID:2887099"
     mRNA            <201005..>202012
                     /locus_tag="CAGL0D01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445497.1"
                     /db_xref="GeneID:2887099"
     CDS             201005..202012
                     /locus_tag="CAGL0D01914g"
                     /note="highly similar to uniprot|Q01590 Saccharomyces
                     cerevisiae YLR026c SED5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445497.1"
                     /db_xref="GeneID:2887099"
                     /db_xref="GOA:Q6FW97"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR021538"
                     /db_xref="UniProtKB/TrEMBL:Q6FW97"
                     /translation="MNIKNRTFEFQQSVATYKKRVKKNDATSNGKPQAGVSEFQKKAS
                     AIAREISSSAQLLSKLALLAKRKPMLNDNPVEIAELSFLIKRKIYAIEQSLIDLSKLQ
                     KVQRNGGNSSAGSTTDVTTQHSKNVVNLLNTKMRNISGGFKDVLEERQRMEMANRDRW
                     EKINSTSNSTSRAMSNTQDSENKNLNDNAMVNEVATYNHSNPFMSSSLIDEESHANAN
                     KGSELALPQSDSQMLLMMEEGQMANNVYLQERNRAVETIESTIQEVGNLFQQLASMVQ
                     EQGEVIQRIDANVDEVDLNITGAQRELLKYFDRVKSNRWLVAKIFFIVFVFFLVWVLV
                     N"
     gene            complement(<202712..>203398)
                     /locus_tag="CAGL0D01936g"
                     /db_xref="GeneID:2887075"
     mRNA            complement(<202712..>203398)
                     /locus_tag="CAGL0D01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445498.1"
                     /db_xref="GeneID:2887075"
     CDS             complement(202712..203398)
                     /locus_tag="CAGL0D01936g"
                     /note="highly similar to uniprot|P39929 Saccharomyces
                     cerevisiae YLR025w SNF7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445498.1"
                     /db_xref="GeneID:2887075"
                     /db_xref="GOA:Q6FW96"
                     /db_xref="InterPro:IPR005024"
                     /translation="MWASIFGGKGNTNKELPKKAIIELREHINLLSKKQAHLQGQITA
                     QENEARKFLTRGNKTMAKNALKKKKVYEGQLVKLESQMDSLEQQLFSIESANLNLETM
                     RAMKQGAKAMKSIHSGLDIDRVDETMDEIREQVELGEEISDAISRPLYTGANEIDEDE
                     LDEELDMLAQETEPQVATKEQALPESKQALSMPNIPNTKIDESKTKIEEEEEDEDERA
                     LRELQAEMGL"
     gene            <204175..>204720
                     /locus_tag="CAGL0D01958g"
                     /db_xref="GeneID:2887163"
     mRNA            <204175..>204720
                     /locus_tag="CAGL0D01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445499.1"
                     /db_xref="GeneID:2887163"
     CDS             204175..204720
                     /locus_tag="CAGL0D01958g"
                     /inference="similar to AA sequence:UniProtKB:P33421"
                     /note="similar to uniprot|P33421 Saccharomyces cerevisiae
                     YKL141w SDH3 cytochrome b560 subunit of respiratory
                     complex II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445499.1"
                     /db_xref="GeneID:2887163"
                     /db_xref="GOA:Q6FW95"
                     /db_xref="InterPro:IPR000701"
                     /db_xref="InterPro:IPR014314"
                     /db_xref="InterPro:IPR014361"
                     /db_xref="InterPro:IPR018495"
                     /db_xref="UniProtKB/TrEMBL:Q6FW95"
                     /translation="MLSLGLMNRSAGCTRRAVLLIRGAAQRRLLSSSVRRLNTMKSSM
                     NAEEEALLNKQRALRPISPHLTIYQPQLTWYMSSVHRISHLILGGTFYVLTILFGLGY
                     FVSGINTESVSQWYHKHVSPMTEQIVKAGFAFTFAFHYFSTIRHYIWDFAKELTLKGV
                     YRTGYSVLALTAIAGTYIWNM"
     gene            <205102..>206787
                     /locus_tag="CAGL0D01980g"
                     /db_xref="GeneID:2887164"
     mRNA            <205102..>206787
                     /locus_tag="CAGL0D01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445500.1"
                     /db_xref="GeneID:2887164"
     CDS             205102..206787
                     /locus_tag="CAGL0D01980g"
                     /inference="similar to AA sequence:UniProtKB:P34163"
                     /note="similar to uniprot|P34163 Saccharomyces cerevisiae
                     YKL140w TGL1 triacylglycerol lipase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445500.1"
                     /db_xref="GeneID:2887164"
                     /db_xref="GOA:Q6FW94"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FW94"
                     /translation="MIFNSFTITDYVIVLLVYLESMVAFFLKLVPQPIISLLEWFIDY
                     SFSEDNTSFEERLRTAVTIHDMCRLFGIEVEDHLVRTEDDYILTLHRIPPREGTANGK
                     TVYLHHGLLMCSDVWVCHVERHKNLPFVLHDLGFDVWMGNNRGNKYSTAHLYKQPKSK
                     EFWDFSIDEFAFFDIPNSIQFVLDRCKIDQLICIGFSQGSAQMFAALSISEDLNKKVS
                     HFIAIAPAMTPKGLHNRIVDTLAKSSPTLMYLFFGRNIILPSAVVWQKTIHPKLFNFF
                     IDFGNRILFNWKALNITQKQKMAAYSKLYSTTSVKSIVHWFQILRAQKFQMFEEQDDM
                     FNSLTRPYKIPRFPTKTNIKTPILLIYGGVDSLVDINVMRNNLPLTNVFDIKVDLHEH
                     LDLIWGKDTDTLVIAKVLRFIEFFSGEKLLQSTTLSLGEPERLMPVKTPISQHTSRRN
                     SNSSVGTENATPSTFNVRKTTTPSNYRYEQTESPTAQYGLEKLNSLYSNVGRGLEDID
                     EKEAFLDYNTGDKMDEIQKTNSINQRRLSEYLDSSTDLKQMDSNATTTVNTPN"
     gene            <207419..>209080
                     /locus_tag="CAGL0D02002g"
                     /db_xref="GeneID:2887063"
     mRNA            <207419..>209080
                     /locus_tag="CAGL0D02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445501.1"
                     /db_xref="GeneID:2887063"
     CDS             207419..209080
                     /locus_tag="CAGL0D02002g"
                     /inference="similar to AA sequence:UniProtKB:Q03957"
                     /note="similar to uniprot|Q03957 Saccharomyces cerevisiae
                     YKL139w CTK1 carboxy-terminal domain kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445501.1"
                     /db_xref="GeneID:2887063"
                     /db_xref="GOA:Q6FW93"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FW93"
                     /translation="MSFAGYSGNSNSNSHFKRRNTTQTDRDGANTHNKRSRPNNYSKN
                     ADFAKSNDMNDRNNSKPEFTGSRYQGGKASRFPKKDYEESSNKNRNRNQNTKRFQSTK
                     PNRKLNVNESRFREDYNNKHGRISTRYNNFTTGNTSDIRTNGNNTPLRQDDRNTITRP
                     SNNANNNQDSGRKIFELPKGPKSTISRYNTGEPYKGTKPQSIPTPTLPTTFLSRPMND
                     SVYERLLQVGEGTYGKVYKARNTVTKELVALKKLRLQGEREGFPITSIREIKLLQSFN
                     HENVSTIKEIMVESQKIIYMIFEYADNDLGGLLLNKQININAAQSKHIFKQILHGIEY
                     LHDNNILHRDIKGSNILIDNQGSLKLTDFGLARKIDCNRDAIRDYTNRVITIWYRPPE
                     LLLGTTNYGPEVDMWGCGCILVELFNKMAIFQGTNELEQLEAIFKVMGSPSIEQWPNI
                     FDMPWFFMIMPQQATKYPNVFEEKFRAVLETDNCFKLAQGLLRYDQEKRLTASEALQS
                     EYFKEDPQPQPLILNDAISCHEFEVKLARKQQKKKEQSKSTTSSA"
     gene            complement(<209430..>209642)
                     /locus_tag="CAGL0D02018g"
                     /db_xref="GeneID:9487976"
     mRNA            complement(<209430..>209642)
                     /locus_tag="CAGL0D02018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999482.1"
                     /db_xref="GeneID:9487976"
     CDS             complement(209430..209642)
                     /locus_tag="CAGL0D02018g"
                     /inference="similar to AA sequence:UniProtKB:P69852"
                     /note="similar to uniprot|P69852 Saccharomyces cerevisiae
                     YKL138C-A HSK3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999528.1"
                     /db_xref="GeneID:9487976"
                     /db_xref="InterPro:IPR013183"
                     /db_xref="UniProtKB/TrEMBL:B4UMY7"
                     /translation="MNNTKQRQYAHLAQQLEELNQNLKETTRHLDTMSKQCNENLVGQ
                     LGKVNSSWLIGSSRCFEDQMLGGGEK"
     gene            complement(<209961..>210353)
                     /locus_tag="CAGL0D02024g"
                     /db_xref="GeneID:2887026"
     mRNA            complement(<209961..>210353)
                     /locus_tag="CAGL0D02024g"
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /transcript_id="XM_445502.1"
                     /db_xref="GeneID:2887026"
     CDS             complement(209961..210353)
                     /locus_tag="CAGL0D02024g"
                     /inference="similar to AA sequence:UniProtKB:P14063"
                     /note="similar to uniprot|P14063 Saccharomyces cerevisiae
                     YKL138c MRPL31"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL31"
                     /protein_id="XP_445502.1"
                     /db_xref="GeneID:2887026"
                     /db_xref="GOA:Q6FW92"
                     /db_xref="InterPro:IPR016340"
                     /db_xref="UniProtKB/TrEMBL:Q6FW92"
                     /translation="MFGPFRGTQFLQGGLLWKVPWRMSGPQKFRQRQRLKAVDDVVKN
                     LTLGLHVQRCQEKGLQFEQALEERKYKPRSAIMRLLNKASFFPKEYQMSAKDKYTVFD
                     KKSRGYRKGIHKVPKWTKISARRNPQFF"
     gene            <210605..>210919
                     /locus_tag="CAGL0D02046g"
                     /db_xref="GeneID:2887052"
     mRNA            <210605..>210919
                     /locus_tag="CAGL0D02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445503.1"
                     /db_xref="GeneID:2887052"
     CDS             210605..210919
                     /locus_tag="CAGL0D02046g"
                     /inference="similar to AA sequence:UniProtKB:P36064"
                     /note="similar to uniprot|P36064 Saccharomyces cerevisiae
                     YKL137w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445503.1"
                     /db_xref="GeneID:2887052"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:Q6FW91"
                     /translation="MSEQAASESGRRVPLWVLNAREEKEARTNLKNMAYKNCDEYVKA
                     MADCAKQNGLKCFPACDQQRADMRQCLLFYQTDHYLDVERDKIVQKRIARLEEMVNKQ
                     KS"
     gene            complement(<211249..>213378)
                     /locus_tag="CAGL0D02068g"
                     /db_xref="GeneID:2887179"
     mRNA            complement(<211249..>213378)
                     /locus_tag="CAGL0D02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445504.1"
                     /db_xref="GeneID:2887179"
     CDS             complement(211249..213378)
                     /locus_tag="CAGL0D02068g"
                     /note="highly similar to uniprot|P36000 Saccharomyces
                     cerevisiae YKL135c APL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445504.1"
                     /db_xref="GeneID:2887179"
                     /db_xref="GOA:Q6FW90"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:Q6FW90"
                     /translation="MPPLDKRIKKFLKDSVRVAPKISSKGELAELRAGLVSPYSQTRK
                     DAIKKTIQQMTLGKDVSSLFPDVLKNIATNDVEQKKLVYLYVMNYAETHPELCILAVN
                     TFIQDAQDPNPLIRCMAIRTMSLIRVEKILEYIETPLRKTLQDDNPYVRKTAVICVAK
                     LFQLNKQLCVELGVLEDLQSALDDSNPMVVANATAALVEINNMDPTAVKLPQLIQSHV
                     SQFLLALNECTEWARITILTALAEYSARDGVEAQDIIDRVTAHLQHVNPAVVLATIKV
                     IIQNLPLIIADNSSKRASIMKKLSSALVSLMSTPPEMQYVALKNIRIVLEKYPELLTK
                     ELRIFYIKFNDPLYVKVEKIDILVRLVDPSNLKQCNLLLAELKEYAMDFEPEFVSRVI
                     LALSQLAIKYSDLPFIQKVMDILVELLEVREKSKDDCCSAAIDLLRHTNNNAELAKQL
                     CSVLNSWESPEIELTTDAAKCKYIWIMGQYPRLFSSLESKMKGFVDNFVNENTSTQMS
                     ILITTVRLHNMLPSDLLQSVLDTSTKETKELDVRDMAMVYWRTLSLPNVDELINSLCS
                     SQVPQINSTIDQFSPELLEKLLRQLGNISSINFKLDSGNKRVKYVQNIVNNKQLEELQ
                     DIAKNELENKANDDVLLDFGDEDDDMMSTSNNNNSTPQPSALSELDDLFGFSSTNATV
                     GSVSQKVENLNINEKKSTTTQDLLDLF"
     gene            <214357..>215860
                     /locus_tag="CAGL0D02090g"
                     /db_xref="GeneID:2887233"
     mRNA            join(<214357..214893,215564..>215860)
                     /locus_tag="CAGL0D02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445505.1"
                     /db_xref="GeneID:2887233"
     CDS             join(214357..214893,215564..215860)
                     /locus_tag="CAGL0D02090g"
                     /note="highly similar to uniprot|P38011 Saccharomyces
                     cerevisiae YMR116c ASC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445505.1"
                     /db_xref="GeneID:2887233"
                     /db_xref="GOA:Q6FW89"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FW89"
                     /translation="MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLIS
                     WKLTGDDQKFGVPVKSFKGHSHIVQDCTLTENGAYALSGSWDKTLRLWDVATGETFQT
                     FVGHKGDVMSVAIDKKASMIISGSRDKSIKVWSIKGDCLATLIGHNDWVSQVRIANSS
                     DDDDKVTVISAGNDKMVKVLWNSAAKVPMYTLSAGDEVYALSFSPNRYWLCAATASGI
                     KIFSLDPQCLLDDLKPEFAGYTQSAEPHAVSLAWSSDGQTLFAGYTDNVIRVWQVMTS
                     N"
     gene            complement(<216204..>218489)
                     /locus_tag="CAGL0D02112g"
                     /db_xref="GeneID:2887167"
     mRNA            complement(<216204..>218489)
                     /locus_tag="CAGL0D02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445506.1"
                     /db_xref="GeneID:2887167"
     CDS             complement(216204..218489)
                     /locus_tag="CAGL0D02112g"
                     /inference="similar to AA sequence:UniProtKB:P35999"
                     /note="similar to uniprot|P35999 Saccharomyces cerevisiae
                     YKL134c MIP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445506.1"
                     /db_xref="GeneID:2887167"
                     /db_xref="GOA:Q6FW88"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /translation="MLIQKILLNKEISRLPRILSILNYTGLRWLSGSSGRNTTELQRI
                     FDDSKYWQSLSENTTQYTKETGLFKNPYLTSTDGLRQFSHDSLHKAHKLAEILRNSVS
                     KEEKVHYIMNLDQLSDTLCRVIDLCEFLRSAHPDQSYVEAAQMCHEEMFEFMNVLNTD
                     VVLCNKLKEVLEDPEILKVLSEEERKVGEILLDDFEKSGIYMKAGIREQFIELSQQIS
                     VIGQEFINNTDYVAKEFIKVKRDEMDKSGISPLLTARLNRDLTGKYYKIPTYGQIPLQ
                     ILKSCPDEDIRKEVWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMA
                     GSPENVKGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYF
                     SSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGITLQPSRTENGETWSPDV
                     RRLDVISEEEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSD
                     GTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNIS
                     GTRCATDFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCE
                     TYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDESNWCGRFGHLFG
                     YGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGLKNPWSCIADVLE
                     KPDLAKGGAEAMTYIGDSEDL"
     gene            complement(<219065..>220477)
                     /locus_tag="CAGL0D02134g"
                     /db_xref="GeneID:2887057"
     mRNA            complement(<219065..>220477)
                     /locus_tag="CAGL0D02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445507.1"
                     /db_xref="GeneID:2887057"
     CDS             complement(219065..220477)
                     /locus_tag="CAGL0D02134g"
                     /inference="similar to AA sequence:UniProtKB:P36066"
                     /note="similar to uniprot|P36066 Saccharomyces cerevisiae
                     YKL133c or uniprot|Q04472 Saccharomyces cerevisiae
                     YMR115w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445507.1"
                     /db_xref="GeneID:2887057"
                     /db_xref="UniProtKB/TrEMBL:Q6FW87"
                     /translation="MLRRVILVSRFGVRSFGQSSRWRQISASANRAYSVENGIDEAPQ
                     SDKSGRYSRLAMRVVGAAVIGVGLWWFYWPHHTFPSSVATILRKGLWQETEKFGKNYH
                     RGLQYYRDALKECDKLGVDPLSDEYTGIEIKIAEMHERLDDLENACEIYDHIMQKYLD
                     YLLTTSVSDLDKVGRYIKRDLSVLIKYLQHRDDKYLGKTMLLHHLRVLQNVIYTRYPE
                     ISEFLQEQQAVLDTVVKPTSEHRPFEFIDLADGSQTAIGKKLSGEMLDDVVGLFKDEL
                     FTALDLFTQYCLQSNDVPAALRNQLMTVQLMSLANVKKSQILFSQANLGSILYLQAEK
                     IEGVLYKLEKEKSSLENEVATDTSKDNEENYYLNLLHSNHDRYVKLSLQCFQGVLNSA
                     EITDNFEEMLDPLSMKAAALAVYGIGVWNIHEGNLKKARKLLKESAKFAKETSFDSLL
                     KEAEKELRKVRKMIKQEKVG"
     gene            <221349..>221579
                     /locus_tag="CAGL0D02150g"
                     /db_xref="GeneID:9487977"
     mRNA            <221349..>221579
                     /locus_tag="CAGL0D02150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999483.1"
                     /db_xref="GeneID:9487977"
     CDS             221349..221579
                     /locus_tag="CAGL0D02150g"
                     /note="highly similar to uniprot|P40204 Saccharomyces
                     cerevisiae YFL017wa SNP2 Small nuclear ribonucleoprotein
                     G"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999529.1"
                     /db_xref="GeneID:9487977"
                     /db_xref="GOA:B4UMY8"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B4UMY8"
                     /translation="MVSTPELKKYVDKKILLQLNGSRQVAGVLRGYDLFLNVVLDDAI
                     ELLKDGEKQKLGSQTVVRGSSILSLEALDTIV"
     gene            complement(<221692..>222174)
                     /locus_tag="CAGL0D02156g"
                     /db_xref="GeneID:2887098"
     mRNA            complement(<221692..>222174)
                     /locus_tag="CAGL0D02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445508.1"
                     /db_xref="GeneID:2887098"
     CDS             complement(221692..222174)
                     /locus_tag="CAGL0D02156g"
                     /inference="similar to AA sequence:UniProtKB:P43577"
                     /note="similar to uniprot|P43577 Saccharomyces cerevisiae
                     YFL017c GNA1 essential acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445508.1"
                     /db_xref="GeneID:2887098"
                     /db_xref="GOA:Q6FW86"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FW86"
                     /translation="MALDPRYVIRRMTSEDYEGVVGALQVLTAVGEVSKEQFDKLLQY
                     WDSSLLFPEDEGKKQYRMYNPTVIYDTETKSVAACGNIIIERKIIHGTGMCGHIEDIA
                     VSKHHQGKRLGKHLIKRLTEIGFDAGCYKVILDCDEKNVAFYEKCGYKRAGVEMQCRL
                     "
     gene            <222597..>224330
                     /locus_tag="CAGL0D02178g"
                     /db_xref="GeneID:2887249"
     mRNA            <222597..>224330
                     /locus_tag="CAGL0D02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445509.1"
                     /db_xref="GeneID:2887249"
     CDS             222597..224330
                     /locus_tag="CAGL0D02178g"
                     /note="highly similar to uniprot|P38967 Saccharomyces
                     cerevisiae YOL020w SCM2 high affinity tryptophan transport
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445509.1"
                     /db_xref="GeneID:2887249"
                     /db_xref="GOA:Q6FW85"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="UniProtKB/TrEMBL:Q6FW85"
                     /translation="MSTKEFKEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQ
                     RCVDSFKPPVDGSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVI
                     IGWTIAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVL
                     PLEIIASAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITIC
                     GFIILCIVLICGGGPDHEFIGAKYWHDPGALAHGFPGVLSVLVVASYSLGGTEMTCLA
                     SGETDPKELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNSPFVIAIK
                     LHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLA
                     GIVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNK
                     TLDELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCA
                     LIMLLIFCIHKVYYRVSFGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKKK
                     PWIVRWYHFWC"
     gene            <224941..>228159
                     /locus_tag="CAGL0D02200g"
                     /db_xref="GeneID:2887250"
     mRNA            <224941..>228159
                     /locus_tag="CAGL0D02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445510.1"
                     /db_xref="GeneID:2887250"
     CDS             224941..228159
                     /locus_tag="CAGL0D02200g"
                     /note="weakly similar to uniprot|P40987 Saccharomyces
                     cerevisiae YOR349w CIN1 chromosome segregation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445510.1"
                     /db_xref="GeneID:2887250"
                     /db_xref="GOA:Q6FW84"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FW84"
                     /translation="MEGISIETSLLDIKDGIDKIIASGEPCDVNEVIDKIDLFQQDPE
                     VLDRELNGLIKKLTTGFFQLESDDKKIHIASVFYTLSKVCNVKKTYIHLDANVYLLEH
                     IENAVRTYDSMELSTPVSSKILKWHYLYLAFCWLCVIVKAPLKLSNDSHLLQFIDDSI
                     TKHEKVTVLQPLFAEIKAELLVKNRILLHKFCELLHETTNDENVIDYFEMLLIYRILK
                     AIVKSPKQFSIYRDDVGLIELLSWICLYQSDRLLSLERGAILMTKIFPKLLPFFIYHH
                     NIEMIEDIISWYLNNMNSKFSEFRFAIANSYKKVVEQLTNTYEDKDILPPLILERLTD
                     TSNILNNSSWDTVDSDRLHTLLLISAFSIDMIYKRLPNQIEEIIVKLIPLASRFQQRS
                     ISVIRGNQVRDAANFICWSLARCSLENKSTIENIIFFLLTRSIMDSDYLIRKSANAAL
                     QEVLGRHGYKIFDNNTILEFIQLPSFNLEKHLFSNLESIFEITNLNYPSFLSRLLFWL
                     VDFGILDNVDCETTLLCIYGLSHLAYKSAEKILKDFGITTKLKQLLSIASTLSTEKQT
                     RLINLCLHLPSAINLIEVLPILGSISEKVLSSQHKSLSQEDIFLHLTILKFWSVAINE
                     SKPVLLTHQDIQLFFSIVRGAQATISNFSKFQEYSNIIVSQISNLGSSIFCTDDISRL
                     FWTEYKKFIRFDNILACGSLPYVHGEMFINILSEVLPLLFSQAKACIIKSIDDNTQLL
                     KPFIQTKDFMYIMSDFLDDYTVTDQGDIGRHVRMQAVQFYMNNITMFHHIDNVILQKV
                     ETSLVRLMAEPSFSIREMSYQLLCKIYSYNEVLESNKSYEYSILIFQKNIFKNDNIDF
                     WKGYCLNGGAIYSTDLQIATAIDEFIKFYTNEGIDEKIKLCNYLAKIIPAAQKILDER
                     IKNKKKSITGGKEYDIVKFTISATIFWRRLIESQLEVPSHFNFNGLFARVYNIHLLNI
                     NKVMKTNCIKLFPLIAIAASRSQADNEKHLANSILKKMIILMKRLPTTNNQQPLYKKA
                     YLEGIIQILLYYKADSQVELLQATGDTDYELTKLKDEDILLS"
     gene            complement(<228285..>229223)
                     /locus_tag="CAGL0D02222g"
                     /db_xref="GeneID:2887117"
     mRNA            complement(<228285..>229223)
                     /locus_tag="CAGL0D02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445511.1"
                     /db_xref="GeneID:2887117"
     CDS             complement(228285..229223)
                     /locus_tag="CAGL0D02222g"
                     /note="weakly similar to uniprot|P24720 Saccharomyces
                     cerevisiae YOR350c MNE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445511.1"
                     /db_xref="GeneID:2887117"
                     /db_xref="GOA:Q6FW83"
                     /db_xref="UniProtKB/TrEMBL:Q6FW83"
                     /translation="MMLKRYTPGLNIRNYQLLCYTSKRYQSDNSISKLVTDVFPQPKR
                     SKFLKVQYDTRAWITKYIDFSKLKEKDDRKDHSALDLSMIIKKLQQLRNENRRKIYFR
                     VLTLLNTSNIDWIANSGKTLKGRIPKELYHECIKMLKNINNRIDDEASKVTFAKLGIG
                     MIKSYKRMESGDIGNFKQNERGLVFYRDCLQLISKADSKQLYNEVIKELNSEEYKLLK
                     IWFQIAWYLHTKQNIELKLTIQTLVSSIGNDDVILNNAEKAIFIPILIKSLAEFITCN
                     NPDGIRQLAHIFTKWEDILTADDKERYKLLSNKIMV"
     gene            complement(<229504..>230967)
                     /locus_tag="CAGL0D02244g"
                     /db_xref="GeneID:2887012"
     mRNA            complement(<229504..>230967)
                     /locus_tag="CAGL0D02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445512.1"
                     /db_xref="GeneID:2887012"
     CDS             complement(229504..230967)
                     /locus_tag="CAGL0D02244g"
                     /inference="similar to AA sequence:UniProtKB:P24719"
                     /note="similar to uniprot|P24719 Saccharomyces cerevisiae
                     YOR351c MEK1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445512.1"
                     /db_xref="GeneID:2887012"
                     /db_xref="GOA:Q6FW82"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FW82"
                     /translation="MDSYLEVIGDFKPGEVLLSGQWGHRVVGHNLAGTPRPRVYIELH
                     NPIKIGRSPKENCMCISNPAISAIHCMVWMILFDETSIPMYYLRDCSLNGTYINGTKL
                     LKENVAILNDGDLIELCENGGKFLKFSCQPSTPSLPKKITINYTENVDNWNISNIVVG
                     NGTFGYVLIAYMGIGAHSGKSSQKITPKCYAVKIVKMKLSKLDKEAKILMQLNHPNII
                     KVFKTHTDKSNNLYIFQELIPGGDLFSYLAKGDCLMPISQTEALVFVYQILHALKYLH
                     TKGIVHRDLKLDNILLCTPEPFTKIVLADFGIARTVTTMKSRMFTVVGTPEYCAPEVG
                     FKANRKAYHSFFRAATLEQQGYDSKCDLWSLGVITHIMLTGISPFYGDGTEQSIVENA
                     KAGILNFNVSQWSTIDIMAQNFVSKLLEVNVDKRLDCEQCFNHLWISKHQKSLKEIYE
                     KKVLLRFSEKNQMGQPKTELETKYLIEEKINHKGIVA"
     gene            <232229..>233164
                     /locus_tag="CAGL0D02266g"
                     /db_xref="GeneID:2887247"
     mRNA            <232229..>233164
                     /locus_tag="CAGL0D02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445513.1"
                     /db_xref="GeneID:2887247"
     CDS             232229..233164
                     /locus_tag="CAGL0D02266g"
                     /inference="similar to AA sequence:UniProtKB:Q08816"
                     /note="similar to uniprot|Q08816 Saccharomyces cerevisiae
                     YOR352w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445513.1"
                     /db_xref="GeneID:2887247"
                     /db_xref="GOA:Q6FW81"
                     /db_xref="UniProtKB/TrEMBL:Q6FW81"
                     /translation="MSEPPTPVHAGPNEQLDIDDIKELSDEDIEELDLKPDMDTDSLS
                     EKHQGEYVQENGAVKREHSILSNEELYGEDERSDFQPRVNINSPFSSYANLRALDDRA
                     RPKPQRRLSMSQQSKFIAYCDQKLMDIQRKFVQSRGLNTQNGYQGLEPLLQDVKCLVD
                     FIWYSLDGSPNTDVLLTEELQSDDSMGMKMNNNNMAKDTYFGQSSYLIKIADDLLDYI
                     EKFDLKFLSGEELHQTLSKLFKLLFILDRIFSKLIDGDIPGGKRLNGTESVRVNGIAE
                     RTRMKLPVIFESQDLHGYHFEVSKVYENTLERCSR"
     gene            complement(<233487..>236093)
                     /locus_tag="CAGL0D02288g"
                     /db_xref="GeneID:2887015"
     mRNA            complement(<233487..>236093)
                     /locus_tag="CAGL0D02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445514.1"
                     /db_xref="GeneID:2887015"
     CDS             complement(233487..236093)
                     /locus_tag="CAGL0D02288g"
                     /inference="similar to AA sequence:UniProtKB:Q08817"
                     /note="similar to uniprot|Q08817 Saccharomyces cerevisiae
                     YOR353c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445514.1"
                     /db_xref="GeneID:2887015"
                     /db_xref="GOA:Q6FW80"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR019487"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q6FW80"
                     /translation="MPLANEKYNDDSSKGSQAMNELSIDEMREVIDHELTQQESKNSS
                     TVKLIGLNLKTIPPEDIKLLANAERLSLRKNNITYLPENFSELKNLRYLDLHSNGLRE
                     IPVELLNCQKLEILDISSNKISQLPEEFPSVFSTRLKVISLKNNRLTSIWKLSPILQL
                     NHIKVLEIEGNPIPKEELDQVLSYVPNQQNLPKDEYWAIAIPRFLNNHPKMKVQSLES
                     KLSRAAKRMGFVNTIPVTDEQLNDSSISSATISEHINNVTIAKENFTDTNMNTPNVLS
                     SNDLYNHTKYNDYFKRLSILPEEVNQEQHKVSHTDLVVACRKLLFSFTECQQAIRKIT
                     SLCKEKSIAVNVVSLLYSVRSHIDNLVEILEQSDNQEISNDQPLITLCMTIISIFKQI
                     IALLQKNFKAFFEEDDLCFIRMFFMSLVCSYTEMYNAWSFITPQETLLLHKKSASNNS
                     NKIQPESDGHPAIIRSKSEANSRTDHVGLSRKPTLTNVSKPDIAGVRLSNEEKTRYHD
                     AVSDQESSVEHNESGIPKVARSRSNTIQGRGTGSLLNVNGSKSNIITSPNGVSQLRTQ
                     GQLPTHAVATTNSTQEQGSSDKHKMNISNLAKTADNRGGNFKNPPDEKQINNELQNGN
                     VSLTAPKLKQVQQPPLTEKGGISTPTGTDVDIDQQLHETLGTVVKMVTMVYNQLTSEI
                     SKVALASSTGHQVLTDTLATKIKDLTDTCRQLLQLSQVLGERLRLLTGDGITAEKYST
                     TSEKLKTWESINAFLKAIISILANAKTLMADLPSLNEVRPQLASLAKITKDVTVILDL
                     SSYKAVSVAAANQEALQHNNNNSETKSGDSKSPVNESAISGDHSHTDIANVPLFTPQA
                     ASAYMRDPFDQQ"
     gene            complement(<237084..>239213)
                     /locus_tag="CAGL0D02310g"
                     /db_xref="GeneID:2887056"
     mRNA            complement(<237084..>239213)
                     /locus_tag="CAGL0D02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445515.1"
                     /db_xref="GeneID:2887056"
     CDS             complement(237084..239213)
                     /locus_tag="CAGL0D02310g"
                     /note="weakly similar to uniprot|Q08818 Saccharomyces
                     cerevisiae YOR354c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445515.1"
                     /db_xref="GeneID:2887056"
                     /db_xref="GOA:Q6FW79"
                     /translation="MLRINQRLLVRSLRDAQYQYLKSTALRFLSSSTQSNVETTPRRS
                     GRLFELNKEYTGKLAQPDGKANIESLYNEFKNDLDKISEFSNGRQGMAPKYGRSRSLS
                     FINRLFQSITNAKNTSSLDPYVVLEQLSKYNLIGPAQYEMILRYYLLVKDAPKDVISL
                     WVKYLEQFTTSNENLMAYTTIAYLKLPDMNEPDCSMLQQILQTERFHTDIPFGRIISI
                     VEQNEVLKRDQELSNRFAYLLNLYATQNKTWFINQLDICYTESRLRSFYNIYSAQRDI
                     NNCDIEIITKFMEQFNKLNANSSFPMQVFNEYKDKLSDADGFKLKLGLLDIVSKYPAP
                     SKIQKLQRLLAVWNSYLKPEFGKVGIDASLAYASLIKALNTSGNIEELQNIWEKEIPT
                     EYKNNQVVFEAFLLAIIRRTKITYSQIQNRIDATKFGKLKSVDLAEAIALKIFNENPN
                     DSKVFDDFYQQNSLDSFGSNTSILALKTYGDYIYKTKTDDETYVIANDVRSKVLKLKP
                     QISTQSWKQEVNLILEKFIDIAPSIIPVRVLFEQRGIYQLNFTLQKKILFSEFRKPDG
                     DVQNAEKIFEELMKTDNNKVSQPMRINSPQLMGTMIKGLCQVIGRTHDVSLYPELSKY
                     LEMLPGLEVHMSINWMEQVLRTIRMVFRSGSTKTIPKELLEFSEFIIEKLPAIDPDFN
                     YQFRNDDIAMFKKIGAKSFSKLKSTST"
     gene            <239710..>242241
                     /locus_tag="CAGL0D02332g"
                     /db_xref="GeneID:2887185"
     mRNA            <239710..>242241
                     /locus_tag="CAGL0D02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445516.1"
                     /db_xref="GeneID:2887185"
     CDS             239710..242241
                     /locus_tag="CAGL0D02332g"
                     /inference="similar to AA sequence:UniProtKB:Q12102"
                     /note="similar to uniprot|Q12102 Saccharomyces cerevisiae
                     YLR115w CFT2 cleavage and polyadenylation specificity
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445516.1"
                     /db_xref="GeneID:2887185"
                     /db_xref="GOA:Q6FW78"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:Q6FW78"
                     /translation="MTYSFKCCDDGSGIASGSILRFDNVTILLDPGWSSYKVSYEDSV
                     AFWSNIIAEVDIILISQPTTECLGAYTFLYYNFISHFISHIQVYATLPVANLGRVSTI
                     EFYVTKGIIGPYQTNQLDIDDVEKAFDFIDVLKYSQLVDLRSKYDGLSLFAYNSGYAP
                     GGAIWCITTYSEKLIYAPRWNHTRDTILNAANLLDNTGKPLSSLMRPSAIVTNFDHFG
                     SSQPFRKRAKSFKDILKTKLSNNGNILIPVDIGGKFLDLFVLVHDFLYENGRNNKLAN
                     IPIVLLSYTKARSLTYAKSMTEWFSSISAKTWENRNQKTAFDLDTPFSVVDSNELANL
                     KGPKICFVSNVETLVNDALSILGSDNNTLLVLTTDNRQEVPALHTIYDYWKENNTESS
                     IESANVLKLNQKITINTTTFKELQNEELDAYLSKLEQRKRKQLITEITTRKGLKKGAA
                     VALPTNLASDEGQKTEVDLVDDITNTEDLEKLLEEEEEDEDEDNEDNLINILEDEDRA
                     DGIEESIPVDIIITPGVNNKHKIFPFQPLRQKKDDYGIVVKFDQFVPAEDKDDITPSK
                     RHINGDNEEDMDDDYVIKEASNKKIKSDSVNQPTKETKFSDDINHLRNSNRPGIREFK
                     ATEVNLNMSLTFINMESLVDRRSCGVIWPLFKSRKLILMGPSNVQDKHVTGIITSKTM
                     EVTSLAYNQSIDFDTTIKALDITISPELDALLKWQRISNDYTLAHVTGRLVKESAHQS
                     SAVPVTDNTTSSGREKYVLKPLNGNVGVQTNGSLAIGDVRLIKLKQNLNATNHTAEFK
                     GEGILVVDDKVIIRKISDSETIIDGPPSALFYSVKKLVMDMLAKI"
     gene            <242706..>244103
                     /locus_tag="CAGL0D02354g"
                     /db_xref="GeneID:2887047"
     mRNA            <242706..>244103
                     /locus_tag="CAGL0D02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445517.1"
                     /db_xref="GeneID:2887047"
     CDS             242706..244103
                     /locus_tag="CAGL0D02354g"
                     /inference="similar to AA sequence:UniProtKB:Q12186"
                     /note="similar to uniprot|Q12186 Saccharomyces cerevisiae
                     YLR116w MSL5 branch point bridging protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445517.1"
                     /db_xref="GeneID:2887047"
                     /db_xref="GOA:Q6FW77"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /translation="MSERREEERGRTGFSMKKNHNSNFNRRNQEQIHQKLPTKISGPL
                     TLEQLCAYQHMFRIQEISSIIKSHSFEVPNARNRSPSPPPVYDAEGKRINTREQLYKK
                     KLMNERFKLVEVVSKLIPGYSAPKDYKRPTTFQEKYYIPVSQYPQINFVGLLLGPRGK
                     TLRKMQEDSGCKIAIRGRGSVKEGKTSSDLPPGAMDFSDPLHCLIIADNEEKIENGIK
                     ACRNIVIKAVTSPEGQNELKRGQLRELAELNGTLREDNRPCATCGQQGHKKYECPHRE
                     TFAMKIICRRCNQPGHTIRDCTSDSNYGKQIHSSRYNNEMPYHRTSTAVDQPSAYSRY
                     GYTPRNHNGSSRFNDNSKYLNNGNKRATPQPELELETSHKRQQINPTSSSQDTLSHQT
                     NHMTMTTIEDSGIDKLQLPAGMSNENPIPQPVNFNEIQINDVSGPNGTLEAPPGLDLG
                     NNDSNITLQGPPGLN"
     gene            complement(<244241..>246328)
                     /locus_tag="CAGL0D02376g"
                     /db_xref="GeneID:2887048"
     mRNA            complement(<244241..>246328)
                     /locus_tag="CAGL0D02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445518.1"
                     /db_xref="GeneID:2887048"
     CDS             complement(244241..246328)
                     /locus_tag="CAGL0D02376g"
                     /inference="similar to AA sequence:UniProtKB:Q12309"
                     /note="similar to uniprot|Q12309 Saccharomyces cerevisiae
                     YLR117c CLF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445518.1"
                     /db_xref="GeneID:2887048"
                     /db_xref="GOA:Q6FW76"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /translation="MTEIPAKQITDNDILKDVYKSQNKQFSIDAIDILDLEELKDVQR
                     RKRTEFEGYLKRNRLDVKQWMRYAVFEIEQHDMRRARSIFERALRVHISYVPLWIRYI
                     ESELKLGYINHARNILERAITKLPRVDKLWYKYLIVEESLAHFDIVRNLFQKWCSLEP
                     AAHVWDSFTDFEVRQERYEDVRNIYSKYVLIHPQFSTWRKWINFEVRYGSTKTVRSVY
                     SLALDALIAYSESRNELVDDCINLIVEFSKWEALQKEYIRSKSLLEIAIQKWPKSNTL
                     NNALLQFEREHGTAETLENTIILNRKKHYEDILNEKVYDYDTWLLYLQLLENNYPKLV
                     MEAFSNVLNAAIPTSRTKDKYWKQYILIWIKYLTFLELTINDIPLCGQKFEELIHNII
                     PNDDFTFSKIWILYAEFEIRQDNLEKARSILGRSLGLCPKRKTFKYYIDLETKLREFD
                     RVRILYENFLKFDPLNLDTWRAYVEFEDSLGDEVRVRSVCMIPIQNNIGLFSKSFQLH
                     LLEILIDYEMEYQNFDNIEPLLKKQVELSNFTVEAWTDYAMKKLTVPTEEQVQNFQIM
                     KEERLKDSSALDEQEIEFEFEITDNNKDNARDVFERALNYFKEIKRDEDRARILQSYV
                     DFEGQYGDISSRQRIEKRLPSIVNGIKDIDGLKTQNITYTFPDDENKSNIDTSNILAL
                     AHKWKESQEAKSR"
     gene            complement(<246787..>247479)
                     /locus_tag="CAGL0D02398g"
                     /db_xref="GeneID:2887106"
     mRNA            complement(<246787..>247479)
                     /locus_tag="CAGL0D02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445519.1"
                     /db_xref="GeneID:2887106"
     CDS             complement(246787..247479)
                     /locus_tag="CAGL0D02398g"
                     /inference="similar to AA sequence:UniProtKB:Q12354"
                     /note="similar to uniprot|Q12354 Saccharomyces cerevisiae
                     YLR118c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445519.1"
                     /db_xref="GeneID:2887106"
                     /db_xref="GOA:Q6FW75"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /translation="MSTAVRIASTKKPAKYALIFLHGLGDTGQGWSFLAQYLQQYHPC
                     FESTNFIFPNAPIKPVTANGGMPMPSWFDIKVWDWTTSNVDTVGFQQSLKEVQKYVDS
                     SISDGIEPQNIIVGGFSQGAALALASAVTLNNKIGAFIGLSGFAYLRNELQETRKNLN
                     PNTPVFHGHGESDDVVPFPIGVQTAEFFKSAGELENYTFKSYRGLGHSADPAELNDLA
                     EFLKSNVYSKDA"
     gene            <247761..>248318
                     /locus_tag="CAGL0D02420g"
                     /db_xref="GeneID:2887264"
     mRNA            <247761..>248318
                     /locus_tag="CAGL0D02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445520.1"
                     /db_xref="GeneID:2887264"
     CDS             247761..248318
                     /locus_tag="CAGL0D02420g"
                     /note="weakly similar to uniprot|Q99176 Saccharomyces
                     cerevisiae YLR119w SRN2 suppressor of RNA1-1 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445520.1"
                     /db_xref="GeneID:2887264"
                     /db_xref="GOA:Q6FW74"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="InterPro:IPR017435"
                     /db_xref="UniProtKB/TrEMBL:Q6FW74"
                     /translation="MDKPPILPPREDAVALEPANDQPKLDVKLPVNINLLSYNELLEL
                     INQHRDKLHWFCASMDSFEPITEEVKRLKNQFKELEEKFSKLEDGKVVIQDQIAELVI
                     LESEYTKKYQNLQQLIRSNYSKDVAKRTMLNKIKENEQKCDELEINAKGSLDLDVFLK
                     SYMDFKLDYHMQKQKLNVLSAQNNF"
     gene            complement(<248731..>249984)
                     /locus_tag="CAGL0D02442g"
                     /db_xref="GeneID:2887181"
     mRNA            complement(<248731..>249984)
                     /locus_tag="CAGL0D02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445521.1"
                     /db_xref="GeneID:2887181"
     CDS             complement(248731..249984)
                     /locus_tag="CAGL0D02442g"
                     /note="highly similar to uniprot|P42838 Saccharomyces
                     cerevisiae YNL323w LEM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445521.1"
                     /db_xref="GeneID:2887181"
                     /db_xref="GOA:Q6FW73"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:Q6FW73"
                     /translation="MVKLDLTQVNNVFRKKEHEYQEDVPEEEDVDASEFEDDDYVPVK
                     TKNRRPKEDNFTQQRLASINPVFTPKSVLPIYLLVAAVFVIVGGCLLAQSSRVDEITM
                     FYQDCVTAAPKDNFQDMPDDHFNYIFHNHKDFNTKPQWRFVDDPSDDSNERGTCQIRF
                     TTPADLKKTVYVNYVLEKFAANHRRYVLSFSEDQIRGKRPSLHDVRSNTGINCKVLGH
                     DSEGKLIYPCGLIANSMFNDSYPFELQNVQDSTKNYPLTNKRINWHSDKKRYKKTKYN
                     HTEVVPPPYWAKAFPNGYNETNMPNINEWEEFQNWMRPAAFDKQTKLIRKNTNDTLPA
                     GEWQIDIGLHWPVTEYNGKKGVFITHGSSIGGRNPFLGEVYLIGGCICAAMAIVLALA
                     WVMGGRKIADPTALSWNKDDSFRLK"
     gene            <250405..>253020
                     /locus_tag="CAGL0D02464g"
                     /db_xref="GeneID:2887140"
     mRNA            <250405..>253020
                     /locus_tag="CAGL0D02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445522.1"
                     /db_xref="GeneID:2887140"
     CDS             250405..253020
                     /locus_tag="CAGL0D02464g"
                     /inference="similar to AA sequence:UniProtKB:P42837"
                     /note="similar to uniprot|P42837 Saccharomyces cerevisiae
                     YNL325c FIG4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445522.1"
                     /db_xref="GeneID:2887140"
                     /db_xref="GOA:Q6FW72"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:Q6FW72"
                     /translation="MAGGYESYSDAGENLADVREDSPMKDVDDVTVAQKPRSSKFVLS
                     KFTIYEAKDRMYVVGSNKRESMFRIMEIDLTVPCEELSLLEDNVFFTRNEVMDVLSRL
                     EDASSDGLTKILTCDALLGFIRFTSCYYLVVVTKISQVAVIGGHSIYHIDGTELIPIM
                     SKKTFKTPERSSPEARLMNIFKDLDLTKTFYFSFTYDITNTLQTNLLREKLKAIGRTD
                     ISIPYDIFGYNDMFMWNNNLLEPVLSCLESVYDWFQPIIHGFIDQVNVSVLGKSVYIT
                     LIARRSRFFAGARFLKRGVNNNGYVANEVETEQIVADMVLTAFHKSGMGYFDSNRYTS
                     FVQHRGSIPLFWTQEASNLTAKPPIEITVRDPFFSAAAIHFDNLFQRYGGGRIDVLNL
                     IKTKEKVPRETKLLKEYEECIKYLNSLIYDNNMISYTSWDMSRESKQDGQGVIEFLES
                     YAIDTITSTGIFHNSKDFKGTKIQQGVCRTNCIDCLDRTNAAQFVIGKRALGVQLKSL
                     GIIDDSFLEYDSDIVNILTELFHDLGDTIALQYGGSHLVNTMETYRKINQWKSHSRDM
                     IESIKRFYSNSFMDAQRQDAVNLFLGNYVWKEDQPSLWEMNTDHYLHNDFGLEETKRS
                     YTHWWNNHHVIKLGDLIRNEVTEKNNDISRANLIANIRGYPAAFDNYWNEYYTTKVVT
                     WLHELFAYNMNSTRRYHQLKKYSGKDSSPFKSRKQSWINKKVKGSVIDSPIDLNSPED
                     RKLDVIKDEKCLRITSTDELLFGNYQLTSLVNKRNHIANLLHADEISLERATSTGYED
                     EHCCSTIEDRFEIERYGNNDNLYSVIDITTSIGYYKEIRVDFDYYTRLGQVDRYKELE
                     NYETYFDNHSWEPIM"
     gene            <253763..>256399
                     /locus_tag="CAGL0D02486g"
                     /db_xref="GeneID:2887060"
     mRNA            <253763..>256399
                     /locus_tag="CAGL0D02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445523.1"
                     /db_xref="GeneID:2887060"
     CDS             253763..256399
                     /locus_tag="CAGL0D02486g"
                     /note="weakly similar to uniprot|P25611 Saccharomyces
                     cerevisiae YCR106w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445523.1"
                     /db_xref="GeneID:2887060"
                     /db_xref="GOA:Q6FW71"
                     /db_xref="UniProtKB/TrEMBL:Q6FW71"
                     /translation="MYDKNRHFSINSMLDHRSNHSQYLGNNIRTTDSGTSENPSTENK
                     ERTKELEFSSTMNTTEKNYSENIANMLTNSSAYQPINEITPESLSASGRKSLECNGET
                     AYDSILAENDLDDMILELFNPNNMIVVYGNMTYIDSPFALHTLAQLDAFARALCGALH
                     GNTMIELHSKLLLCPQANNYAEMLSQLQPPSPVAELNSELSTLPYIKQSIIKWVESSE
                     KNQYCAIAIGLSHKTVSLDETMSPQLYAGLQLLVYDIENKFTTVVETEYILKNFFENI
                     YPFYPFMELCSFKSNLNKICETSENGRYKFNIISKNNTQSDFETFCLFNVVLAISFRQ
                     LMVESDVTFLKSKDVESVIKNLYSNSQKLLIMLDTYKNTNESSFCCELYAFLLSYLEP
                     NAELTCLTHEKIGRLKSLNEIALTLGLHHNPSKYTRYFNELEPDPKILKFRRKLWLGL
                     NTLKMEILIPNGVANRLDIDYMNAFISPERSLAKILQNDFHSIGEIDASILQRYDNKY
                     QLQLILNELVISCTPVSNNVHFGEVVQNLKRAKNFLIANFSITDCEMLEDQTLLYKVD
                     PNIEINLKSTKNVELIINYINGYTCIMCVYFVLATKFEELSRQDWRKYEKYYHKFLIE
                     AIESNVKLDTLVMGYLEGKYAKFIDTKHRYVLDRIVSNLVIKLWTLKSCFLTRFSYKR
                     YVTERLERKYRAEKMAYPEANLLPVLIRIINLLNVQMYRSVELLRSNISAEYYTRSYC
                     SPMFQYIVNIIEKGKLVEVVNKFWDRTFEAANVPSLLLKSVNMKWGLDMKNPQIIKYH
                     LISPEGLQCMNKKLLEGIENVLNVHLVDCRDCEAIWDSNEVADTASTESGNFDQFFET
                     NFDLFLGAFNNSLGDFPKITFD"
     gene            <256760..>257758
                     /locus_tag="CAGL0D02508g"
                     /db_xref="GeneID:2886970"
     mRNA            <256760..>257758
                     /locus_tag="CAGL0D02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445524.1"
                     /db_xref="GeneID:2886970"
     CDS             256760..257758
                     /locus_tag="CAGL0D02508g"
                     /inference="similar to AA sequence:UniProtKB:P42836"
                     /note="similar to uniprot|P42836 Saccharomyces cerevisiae
                     YNL326c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445524.1"
                     /db_xref="GeneID:2886970"
                     /db_xref="GOA:Q6FW70"
                     /db_xref="InterPro:IPR001594"
                     /translation="MNLVNNFSKLFPRCLTTGLYLWSLYAIVVCIHVIRARVVLPLVF
                     TIAMVALYTYAKLIYVGPGTTKEYSILRVYDLNAAESGFELPPEMLVKRSYTQKRNGR
                     FRVCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTVYS
                     ILVLILSSMEIYTWFKGEFFEVELINFTLLSLWLLALVVSISITIFTVFSISQVCQNQ
                     TTIELYSLRRYNEEVAFLNEFSNEPIKGTINIFDLGKKLINWEEVMGYSLIEWALPIS
                     RRPSSLDLEGSHSHGLFFNVNKNVSKTMNESVDLQDRLLRRLTPRSSLDVDRSNFV"
     gene            complement(<258073..>260103)
                     /locus_tag="CAGL0D02530g"
                     /db_xref="GeneID:2887134"
     mRNA            complement(<258073..>260103)
                     /locus_tag="CAGL0D02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445525.1"
                     /db_xref="GeneID:2887134"
     CDS             complement(258073..260103)
                     /locus_tag="CAGL0D02530g"
                     /note="weakly similar to uniprot|P42835 Saccharomyces
                     cerevisiae YNL327w EGT2 cell-cycle regulation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445525.1"
                     /db_xref="GeneID:2887134"
                     /db_xref="GOA:Q6FW69"
                     /db_xref="UniProtKB/TrEMBL:Q6FW69"
                     /translation="MKFTTTFLLTFMSISTSIFANAQKGFLTDIQVFDTHSGSNNSTD
                     PSHWFLIQGQVFVPQDAKNSIPFTVPDEFDSFPSGDFPLSYNSKIIGSINKADDSNNF
                     DIQLVDSNILQNVSTTFNFLCKLSSKGLSEIRSPGSVSYTFTNGDNVEFVRNINYLAT
                     DPTKINTNGGIYQTNNTAWFTLDIPISQFKRPIRIQSTPSVPNAYQFDASKTTFKVVT
                     KLNKFNQPLATVPLTAVHDYSTNSKIDVLFNSSFSGGEYVRITYYSSQLYSKTISNNL
                     NISYPANDLSKRDVVDPSEININTNLYAAPLDNLSHINVSTPNPDVSKNSTMTPLPAY
                     TNGTASNVTKSLEVIPTYSLDHSTVSAIVSEYGVWIPVSTLNGTTSSKMMIQSKIVRN
                     DTTTSTPTATPTSRPDEFTNSTSSSSSIMYHNSTITTISSSQTDYSSAATSSSISSST
                     SKFTNTTTTQSLKQTVTKTVCPTCEKADNETQLSTIASVYQSTISEQLSEYEFLEAAS
                     TIQSTKQTSSTKASTSSKVKSTELSVSEQVYYSTKPASKSVYGDLEAVSTLSSKSSNS
                     VAHSVEVSASKSLSTKSAVVTDIGVLEPVSTLKSSSSPKPTNNIVSGKVETTSTAPAI
                     ISLYTSVQASTLSTVHPGNTTTSHVVSIYQGGSSSLTIQFSTIIIGFIALLL"
     gene            <261991..>262422
                     /locus_tag="CAGL0D02552g"
                     /db_xref="GeneID:2887135"
     mRNA            <261991..>262422
                     /locus_tag="CAGL0D02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445526.1"
                     /db_xref="GeneID:2887135"
     CDS             261991..262422
                     /locus_tag="CAGL0D02552g"
                     /inference="similar to AA sequence:UniProtKB:P42834"
                     /note="similar to uniprot|P42834 Saccharomyces cerevisiae
                     YNL328c MDJ2 heat shock protein - chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445526.1"
                     /db_xref="GeneID:2887135"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q6FW68"
                     /translation="MVLPIIIGVGVTLVAWTTQSALRAWQIYRTLTPGMIAAMNGIKL
                     TNFRSKYASKFHSDRLNPGLKMQLNKWEGGFYHPMSESEALMILNITQKEIMSLNAPL
                     LKKKHRLAMLKNHPDKGGSPYLSAKINEAKELLEKSVLTRK"
     gene            <263063..>266116
                     /locus_tag="CAGL0D02574g"
                     /db_xref="GeneID:2887074"
     mRNA            <263063..>266116
                     /locus_tag="CAGL0D02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445527.1"
                     /db_xref="GeneID:2887074"
     CDS             263063..266116
                     /locus_tag="CAGL0D02574g"
                     /inference="similar to AA sequence:UniProtKB:P33760"
                     /note="similar to uniprot|P33760 Saccharomyces cerevisiae
                     YNL329c PAS8 peroxisomal assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445527.1"
                     /db_xref="GeneID:2887074"
                     /db_xref="GOA:Q6FW67"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /translation="MMITADLIWDENLDNDCEVSKDIWEDDTFIDKSYLKVVLPSYDG
                     VDTPIVYHFKLNDDLKINSIKIPTNSIGNLGKFGRLNTCSLEAVSGEPPVLKEIIIKI
                     DERLYDKLALLPKANEKKQYFQIKYNLVNKQSVIHEGNIWGHVCEVVETKPFSQGVID
                     FSVTDIVLIRSKILSVENKHDRSLVNLQAFHDLSRIPLKCLHYPVERSLLLPEPPFDD
                     DDSIYVFFPFDLLSKLKISSGSFVRLSNSKNSVLVRAFLLQSPNHYAVDGIYTTPFVL
                     AQFDELPLVEVEPVYNNELAFPTASEVVISKVGNVLHTQKRYQELILQKLRYYFLTAR
                     RILSNGSLIPITIDSSFDEIILEDIDLDVNTIKSDDDCIVWFVVSNRKFENISNYDPK
                     AEFFVDPKHTKLITSAMENRSLSSNTFNSALKYYGLPGVFHYRPDIFPVVNDIKNVIN
                     THAEANKKVPNLPMILNLSSNVPKVGKASILRSIAIDLSYQFVDIDTLSVVFSSGSSD
                     IATTFLGYLKGKLENLLPFTGNTIILIKHIDHILKKVDQNQDIQQSRQVKALEGDLIS
                     FIKSYSRIYPGVVFAFTSASIDNLPEGFRSEIKFDYVVHPPNEKQRRSIIDELLSTSD
                     LFQKYGNRKLRIQCSNEIEISTLSLHSAGLSPYDIQYIISLAVADSLRKCNNYLLWRQ
                     NKIKVDMISIQNALEKVRSDYSASIGAPSIPNVTWDDVGGLSSVKDAIMETIDLPLKH
                     PELFGSGLKKRSGILFYGPPGTGKTLLAKAIATNFSLNFFSVKGPELLNMYIGESEAN
                     VRRVFQKARDAKPCVIFFDEVDSVAPKRGNQGDSGGVMDRIVSQLLAELDGMSSDGDG
                     VFIIGATNRPDLLDEALLRPGRFDKLIYLGIADTREKQANIMRALTRKFKVSSDINFD
                     ELVSDFPFSYTGADFYALCSDAMLKAMTRISKEIDEKVDKYNQDNGTSISIRYWFDHV
                     CSDEDTDVIVKKEDFLNANKELIPSVSQQELEHYKQIRANFEDSK"
     gene            complement(<266641..>267390)
                     /locus_tag="CAGL0D02596g"
                     /db_xref="GeneID:2887042"
     mRNA            complement(<266641..>267390)
                     /locus_tag="CAGL0D02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445528.1"
                     /db_xref="GeneID:2887042"
     CDS             complement(266641..267390)
                     /locus_tag="CAGL0D02596g"
                     /inference="similar to AA sequence:UniProtKB:Q12146"
                     /note="similar to uniprot|Q12146 Saccharomyces cerevisiae
                     YOL146w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445528.1"
                     /db_xref="GeneID:2887042"
                     /db_xref="GOA:Q6FW66"
                     /db_xref="InterPro:IPR010492"
                     /db_xref="InterPro:IPR021151"
                     /translation="MGYYDIDDILVDSTEVPCKFNYEIPGLGYLENNPGKPIRKNTKL
                     SLPLWLARVLAIVGADSQEQEDMDPNAEEEDGGDAFVELLTPDMFSNKVINAIKTDPK
                     SLDLHAINPYFLDMALKWIALYSDKDLGEIVYELLLERAQQINNYASSVSIDTEYGNK
                     YRSALLDALRLQQNSANEDRSGPLASINGTSSLTTRSANNSGIGSSVGTSQATNLAAS
                     TRFLLKLDEFERQLYKDTHDSYRDTKKWVSK"
     gene            <268327..>269073
                     /locus_tag="CAGL0D02618g"
                     /db_xref="GeneID:2887121"
     mRNA            <268327..>269073
                     /locus_tag="CAGL0D02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445529.1"
                     /db_xref="GeneID:2887121"
     CDS             268327..269073
                     /locus_tag="CAGL0D02618g"
                     /inference="similar to AA sequence:UniProtKB:Q12462"
                     /note="similar to uniprot|Q12462 Saccharomyces cerevisiae
                     YOL147c PMP27 peroxisomal membrane protein - peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445529.1"
                     /db_xref="GeneID:2887121"
                     /db_xref="GOA:Q6FW65"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q6FW65"
                     /translation="MVCDTLVYHPTITRLIKFLDTTAGREKALRLLQYLCRFLAVQQS
                     SALAKGLQVQFTMVRKILRFLKPLNHLQAASKFYDNKLNGDDILRVGNVIKNLAYAGY
                     LTFDQINLLRILKLVPVTQFTGKKVPKLANWFWFVGLISGLVMDVRNIHTSQTKILTI
                     ASKASSVSPDGSDVEKPSDAQFAEETKAAYVTACKQRYAAIRRLVWDSFDTFIVLNNL
                     GYLSSSEDSIGLAGVVTSLLGLEDLWKGTK"
     gene            <274285..>275979
                     /locus_tag="CAGL0D02640g"
                     /db_xref="GeneID:2886983"
     mRNA            <274285..>275979
                     /locus_tag="CAGL0D02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445530.1"
                     /db_xref="GeneID:2886983"
     CDS             274285..275979
                     /locus_tag="CAGL0D02640g"
                     /note="highly similar to uniprot|P23585 Saccharomyces
                     cerevisiae YMR011w HXT2 high-affinity hexose transporter
                     or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
                     or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445530.1"
                     /db_xref="GeneID:2886983"
                     /db_xref="GOA:Q6FW63"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FW63"
                     /translation="MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSA
                     MSPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAAD
                     GSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISS
                     TTTWYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYC
                     TNYGTKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARS
                     NKVSMDDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQL
                     TGCNYFFYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSS
                     TMAVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVA
                     ETYPLRVKNRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFF
                     FVCETKGLTLEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKRFA"
     gene            complement(<278099..>279793)
                     /locus_tag="CAGL0D02662g"
                     /db_xref="GeneID:2887062"
     mRNA            complement(<278099..>279793)
                     /locus_tag="CAGL0D02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445531.1"
                     /db_xref="GeneID:2887062"
     CDS             complement(278099..279793)
                     /locus_tag="CAGL0D02662g"
                     /note="highly similar to uniprot|P23585 Saccharomyces
                     cerevisiae YMR011w HXT2 high-affinity hexose transporter
                     or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
                     or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445531.1"
                     /db_xref="GeneID:2887062"
                     /db_xref="GOA:Q6FW63"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FW63"
                     /translation="MSQAQSLSPSESAENSPVREVNVANSFKDDDFILEQKQTADVSA
                     MSPEAEAPPKPISAYFTVICLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQQAAD
                     GSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVYVVGIVIQISS
                     TTTWYQYFVGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYC
                     TNYGTKTHTNSIQWRVPLGLCFAWALFMLVGMSMVPESPRFLVEKGRFEEARRSLARS
                     NKVSMDDPIVTAEIENISAGVEAEKSAGNASWGELFSTKGKILQRVVMGIMIQSLQQL
                     TGCNYFFYYGTTIFKAVGLEDSFQTSIILGIVNFASTFVALYVVDRFGRRKCLLWGSS
                     TMAVCMVIFASVGVKSLYPNGKDQPSSTTAGNVMIVFTCLYIFCFATTWAPTAYVIVA
                     ETYPLRVKNRAMAIAVGFNWIWGFLIGFFTPFITTAINFYYGYVFMGCLVFSFFYVFF
                     FVCETKGLTLEEVNEMYEEGVLPWKSAQWLPTTKRTSGYDVDAALHDDKPWYKRFA"
     gene            complement(<282249..>284369)
                     /locus_tag="CAGL0D02684g"
                     /db_xref="GeneID:2887182"
     mRNA            complement(<282249..>284369)
                     /locus_tag="CAGL0D02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445532.1"
                     /db_xref="GeneID:2887182"
     CDS             complement(282249..284369)
                     /locus_tag="CAGL0D02684g"
                     /inference="similar to AA sequence:UniProtKB:P40460"
                     /note="similar to uniprot|P40460 Saccharomyces cerevisiae
                     YIL144w TID3 DMC1P interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445532.1"
                     /db_xref="GeneID:2887182"
                     /db_xref="GOA:Q6FW62"
                     /db_xref="InterPro:IPR005550"
                     /translation="MPNEQSEASVLSRLNPHRFTTQIPQHPLSQNMQRRRNSVSSAAS
                     DSINSLKQSSARAVSNSNGIQKNNKKYMRSTVAGASGILPTYNKSMSFSQNKNLDDNN
                     MRASLPVLERDLNANNFKSANNNPIGFSSFSQPYSGSRDPRPLRDKNFQSAIQQEIFD
                     YLIQNTFEIDTNYPISLKTLKQPTQKSFVTIFKWLYLRLDPGYTFTKSIEYEVYQLLK
                     ILQYPYLESINKSQISAVGGSGWPKFLGMLHWLVTINLRLDKCLNTLDQNLLNQQTQD
                     LTTLSKPVENIEDQEVRQEKYELMAERLFIDYITDSYKTFLNLKDDYSDHMNELKAGF
                     ERYLHIIKLDVNNIQSKNENMFEKFEISRNRVEKLKVARGKSTALNGDLVKFQKYVDS
                     MKAKSEEWPIKLSKIEDELNEKKENIKLITEEISQIQDSLQRKGLSVEQIENKNEQKL
                     QLEKEIDQIAEKADEFVSLIKSTKVDNEKVFVTFQDSIRQYNDLLLEFLTSRRKLGHD
                     IEIEPLKITLPNEVVVPNSENALTMDKLFPTDHPMPEYYQNMLLSINSDIMKRIETLK
                     TDNQELEREIGMLTEEINSRGSTNESLELKLSDLNLNLKNVRQENRAEILAQSLEIEK
                     LERQITEGNKNIEQKIANAERIVTELLNEKEVLYNEHSKFKSDLNLKIQKLIKEAHSL
                     RFAVKDSTNRLNELIFTESSETDD"
     gene            <284942..>287245
                     /locus_tag="CAGL0D02706g"
                     /db_xref="GeneID:2887183"
     mRNA            <284942..>287245
                     /locus_tag="CAGL0D02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445533.1"
                     /db_xref="GeneID:2887183"
     CDS             284942..287245
                     /locus_tag="CAGL0D02706g"
                     /inference="similar to AA sequence:UniProtKB:P38883"
                     /note="similar to uniprot|P38883 Saccharomyces cerevisiae
                     YHR197w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445533.1"
                     /db_xref="GeneID:2887183"
                     /db_xref="GOA:Q6FW61"
                     /translation="MNKAIPVSVLADQLAESNGFQFHNILYHLKSSDYVDEKLLKSEL
                     SVLVVKIQKLLNSNSNYSIWKGCHAAVVICTYNPLVLMAYGGKLLDIVYQKLEIKVLQ
                     RSTNSLDAQGKQVLNSLVNAISVLMNLMRNKTGLSREFLVPKIKAIIPTLITLSQYEP
                     ELVLPILRSLIFKHTTTFKPFNAKFKVILTQFLTEGFDTLNEHTQKLVCDCYAYLHMV
                     KTQTYQQQDEHSSHHKTFQDENWMNGMNAVLAEFKPLIELCGEILDFSQDEELTKLIG
                     KMVPLAAESTSIFRSLTMDMNKSTTLYDIPKRIDVLSKMLMSFISVPTTYTIRIPLDK
                     LNVTCSALLSITSKHIPIKRELRRDIELNATINDVFTKIQFAGIRLYSTMVSKFGNVC
                     FSYLSDIFYALSLFIPFKEKSLNIDFEKCFALKREFLVVFDLVSKIIANVGHQLTDID
                     FLLQLIEIGLDLTEERSLIQNVFQQTNAKKEQELSKTKNKNKKDNKRGSLADLYVSGS
                     QFTLACDLKTFDTLNKFFISIIANQKLATAQMTKLSRYAIFTAQTYKQNLGEVPTTFV
                     ELLRTLVIQPGNERVTILPMAVNIIKESSDDVFDILSHPRLPMSILHSIEKSTFDNGE
                     DDEDDNPDLHANEKQQEYNDQPVERSEQKVVDFVLEEPVAVDVKTKETVQFKDGITTS
                     EDQVDTKRPRDEEFIIEKSSSAKKFRTENQPETIPIGVSDETVYQETEKVTVNVDTSS
                     NDNEDDEDDSDFEIPAIELSDDDDEDE"
     gene            complement(<287379..>288308)
                     /locus_tag="CAGL0D02728g"
                     /db_xref="GeneID:2887105"
     mRNA            complement(<287379..>288308)
                     /locus_tag="CAGL0D02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445534.1"
                     /db_xref="GeneID:2887105"
     CDS             complement(287379..288308)
                     /locus_tag="CAGL0D02728g"
                     /inference="similar to AA sequence:UniProtKB:P38885"
                     /note="similar to uniprot|P38885 Saccharomyces cerevisiae
                     YHR199c or uniprot|P38884 Saccharomyces cerevisiae
                     YHR198c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445534.1"
                     /db_xref="GeneID:2887105"
                     /db_xref="GOA:Q6FW60"
                     /db_xref="InterPro:IPR016087"
                     /translation="MLRTLVRRSLIKNTGLATRATRLSAVTKRLQSSAPKPATEKSDK
                     KAWWIVGLVSAAFAGGTYVCTWEREELQKERDGKSVLVDDAVTPFPVVISRPTYPLST
                     KYDILGSGIRSVSVLTFKAYALGIYIARQDKPKVAQVFDSTFMSKNFIDMDENKSHAE
                     NVKIALDDPEKSRILIDNLLDSNIRMVAKLTPIKNASAKLLKEGIIKNVQMHPDASKN
                     KETLAMGIKEVEEAIKIKGPVPKDDDFLMELLADGSLKFSYYNRRKDIVNELGTVHQP
                     LVGKYLFAQYLSGSNPVSPGTKDQCAETLASLV"
     gene            <288647..>289021
                     /locus_tag="CAGL0D02750g"
                     /db_xref="GeneID:2887214"
     mRNA            <288647..>289021
                     /locus_tag="CAGL0D02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445535.1"
                     /db_xref="GeneID:2887214"
     CDS             288647..289021
                     /locus_tag="CAGL0D02750g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445535.1"
                     /db_xref="GeneID:2887214"
                     /db_xref="GOA:Q6FW59"
                     /db_xref="UniProtKB/TrEMBL:Q6FW59"
                     /translation="MGHGGLATKYLSKFTVTHSLLWKNVYKIVTWITMVLSRYSYELS
                     DSITDHSMIKDKNRNLMITNQFQNNYAVGTLSSFVIFDVNGFEYYVINVYRQFTIHYC
                     RRNNTRKLSWTLGVRYTLSLQF"
     gene            complement(<289675..>291276)
                     /locus_tag="CAGL0D02772g"
                     /db_xref="GeneID:2887224"
     mRNA            complement(<289675..>291276)
                     /locus_tag="CAGL0D02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445536.1"
                     /db_xref="GeneID:2887224"
     CDS             complement(289675..291276)
                     /locus_tag="CAGL0D02772g"
                     /inference="similar to AA sequence:UniProtKB:P32523"
                     /note="similar to uniprot|P32523 Saccharomyces cerevisiae
                     YLL036c PRP19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445536.1"
                     /db_xref="GeneID:2887224"
                     /db_xref="GOA:Q6FW58"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="UniProtKB/TrEMBL:Q6FW58"
                     /translation="MYCAISGKVPKEPVLSLESRCVYERRLVEEYVRQHGTDPVNGRP
                     LAVEQLVEINVDPESMTLVNAANSATLNSNYSIPSLLSTLQNEWDAVMLENFELRKAV
                     ESLKKKLSTTLYERDAAKKVALKAISQKRKLQSEVDRLATEVTLVETTGNDDAPSKKR
                     KMDTEPSHAELAVPDSNFSDELLASSVAYLKETKPLLKQSNISKDSEIVFDKLDKIAI
                     NNKSMTFTSLLAENKSKSLALIHDKSISHIKDPKNTTMIDMSEQLATGDDLELVVPTT
                     GEDILVKTTNNRIMVLNTKTKQAQQIELGGSELGNLLYLYSHENVKPEYCVWADDKGN
                     IGYVSKDGKTDVRVRQTENSDDMHYDKVDLHKDGILIALARSSCVEILNLCQPDDPPI
                     KFEIGSELPNDAKAITNVKFCPNGFYFIVELDGDVLYTFDLRKSPPTLSSNPLPINGG
                     CWDFDITGRFLLLNKSLDSNRIEFQFHQYDKTANSWKAVQTREVVLGDNSSFNSAKSM
                     WLLSHEDTSFILLYSDDNLLTFDLK"
     gene            <292034..>293425
                     /locus_tag="CAGL0D02794g"
                     /db_xref="GeneID:2887008"
     mRNA            <292034..>293425
                     /locus_tag="CAGL0D02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445537.1"
                     /db_xref="GeneID:2887008"
     CDS             292034..293425
                     /locus_tag="CAGL0D02794g"
                     /inference="similar to AA sequence:UniProtKB:P38739"
                     /note="similar to uniprot|P38739 Saccharomyces cerevisiae
                     YHL028w WSC4 or uniprot|P53832 Saccharomyces cerevisiae
                     YNL283c WSC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445537.1"
                     /db_xref="GeneID:2887008"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:Q6FW57"
                     /translation="MFWHFLLLLCAVRAEQLFCSNENSASGPGTSYTWQSTGWCASHC
                     SGYDYAIVQGLMCWCSNSGPADSIDISSCDHYCPGYSLENCGSQQNNAYGYMYLGSQP
                     QSAIIPPRKSSNTAQSSTPSSTSAASTSSTSTSTSSTSTSSTSSTSSTSSTSSTSSTS
                     TSSTSSSSSSTSSTRSSSRTTLAPSTTSSSSRTRSSSEASDDYVLSTSMIYSVMTVTS
                     TQTHDSAVQSNVTSVFSSNVITTKVVTSIISTVATVATTTTSQAANTSVASTAAGMRG
                     SSNQGDVSEKKAKGYWQSPGKVAGTFVVVGVVILAILGLLFWYFVLRPRWEQKKFEKN
                     YNDAVGLAPATPPNMPRNESGHSRIFSTPIFHTHHSSSEDDSSTGSNGAGFNEEKNLD
                     EANVKTNKRATRHDVFADDAYSDYSNTIPVMVDQRLDPNQMMSQIEQSPSNVSLSDDV
                     DYSRRVLRVINEL"
     gene            <294431..>296323
                     /locus_tag="CAGL0D02816g"
                     /db_xref="GeneID:2887173"
     mRNA            <294431..>296323
                     /locus_tag="CAGL0D02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445538.1"
                     /db_xref="GeneID:2887173"
     CDS             294431..296323
                     /locus_tag="CAGL0D02816g"
                     /inference="similar to AA sequence:UniProtKB:Q07845"
                     /note="similar to uniprot|Q07845 Saccharomyces cerevisiae
                     YLL035w GRC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445538.1"
                     /db_xref="GeneID:2887173"
                     /db_xref="GOA:Q6FW56"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029007"
                     /translation="MAETDLNALAYKDSDSTDTSSSSSSDEEYQAEVKVSNQNEKQVD
                     YDSDTDLNTDNKVSSVDAYKPCVGENLIIRDSNIIILLRAKEKLCLSGLFDLKIEKGG
                     LLYNDIHFNASSKTYHYWHPLSNSIPEIKSSFYAGFEDVDISAFYAAYDISPNNDYET
                     VLKISNHKSKSLIDGEILMPSLKSLWITKEDFLQKNGYTNFSFDIIMPATLQEITTLN
                     ISKSWTNCLQKLKFINQNSIHDTRIMVIGGKNSGKSTFLRSLVEKVLYSHDISDKSVS
                     EMLYLDLDPGQPEFSHPDCISMTRLTSNDMNFGQSFGQASPEVLKQYYIGSPSPQEYP
                     TRYLNMVNKLITEFEDTMFAGISCINLPGWVKGFGLNILQKVLEIYKPTDIVYLESPS
                     TVRHFSELRIPKSFSSTMMTEYSPRSYRIPAEFSNAAINNSPEIKFAPSDIRTYKLLC
                     LFHRSDTSNVPTFDFRPLIAKSPKKISYGRAGIHTIIINIEFALVPSHELIQALEGTI
                     VAIYHEENTDDEHDSSSDIRVLSNDDLETAKFITLGLVHSVDEERKYFNIYVPENMVA
                     TLKNLGNRFMIERLSTETPFCELSPPNKVLKTDQTSPFISFKTRKKYEHVWKIRKNIK
                     RKGHHL"
     gene            complement(<296403..>298907)
                     /locus_tag="CAGL0D02838g"
                     /db_xref="GeneID:2887206"
     mRNA            complement(<296403..>298907)
                     /locus_tag="CAGL0D02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445539.1"
                     /db_xref="GeneID:2887206"
     CDS             complement(296403..298907)
                     /locus_tag="CAGL0D02838g"
                     /note="highly similar to uniprot|Q07844 Saccharomyces
                     cerevisiae YLL034c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445539.1"
                     /db_xref="GeneID:2887206"
                     /db_xref="GOA:Q6FW55"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FW55"
                     /translation="MAKAKGKKNGSLTNSLENKLTDLIYRMLEEKTLEKQRQLRSQAD
                     SSQEDEEMDIMDATCFAKDLVPGEIFTYVLSKDLSLQRVKKVPLQKTIEKVLKAIVED
                     EMEELQEMPGYVEDTPVMDEGDVLAEKNLMIAPETNDMNKSIVSQWETKSETPAADVG
                     NGETDQETKTRKRSKESSQKSKRQKIKEDRSPPTSSLSALGGMDDVIAQLMELIGLPI
                     LHPEIYLSTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFISISAPSVVSGMSGES
                     EKKIRELFDEAKSLAPCLMFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELTLSN
                     TNGKPVIVIGATNRPDSLDAALRRAGRFDREICLNVPNEISRLHILKKMAGKLKIDGE
                     IDFHKLAKLTPGFVGADLKALTTAAGTCAIKRIFETYASIVPNIEAVEDMDVDKNKLD
                     SVEGNSQKDSDSEINLKNTANMIDPLPLSVIQRFIHNYPDPLNDDQLNQLTIKYEDFL
                     KALPTIQPTAKREGFATVPDVTWSNVGALQKVRIELNMAIVQPIKRPELYEKVGISAP
                     GGVLLWGPPGCGKTLLAKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARAS
                     VPCVIFFDELDALVPRRDTSMSESSSRVVNTLLTELDGLNDRHGIFVVGATNRPDMID
                     PAMLRPGRLDKTLFIELPNEQEKFDIIRTLTISNGTPLSKDVDLKEIVADERCRNFSG
                     ADLAALVRESSVLALKRNFFKSEEIQSVGDNDLDKEFEDLSVGISSDEVIVTPADFKV
                     ALNKIKPSVSDKDRLKYDRLNKKMGWNDEVPTPNDA"
     gene            <299215..>299850
                     /locus_tag="CAGL0D02860g"
                     /db_xref="GeneID:2887207"
     mRNA            <299215..>299850
                     /locus_tag="CAGL0D02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445540.1"
                     /db_xref="GeneID:2887207"
     CDS             299215..299850
                     /locus_tag="CAGL0D02860g"
                     /inference="similar to AA sequence:UniProtKB:Q07843"
                     /note="similar to uniprot|Q07843 Saccharomyces cerevisiae
                     YLL033w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445540.1"
                     /db_xref="GeneID:2887207"
                     /db_xref="GOA:Q6FW54"
                     /db_xref="InterPro:IPR016613"
                     /translation="MVRRGVGTIETVNALVNDNYALIRNVAKYMLNDKGLTNAEFLRA
                     SYRRFIRLRPFVSNRSMVKDTYTDYIRYKYRYEDYPKRMAMIGVQCDNQLNRSQVKNS
                     LSFVAKACSFIDESKGTKFEVARDNTMCRQILKNLLTIHYEKTSHTNEKRTPLRHIFQ
                     YSFEHMKDINKSTNSQSYSKPASPKSSLILDLYGEFDRDILLLNNLLNMRL"
     gene            complement(<300025..>302028)
                     /locus_tag="CAGL0D02882g"
                     /db_xref="GeneID:2887049"
     mRNA            complement(<300025..>302028)
                     /locus_tag="CAGL0D02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445541.1"
                     /db_xref="GeneID:2887049"
     CDS             complement(300025..302028)
                     /locus_tag="CAGL0D02882g"
                     /inference="similar to AA sequence:UniProtKB:Q07084"
                     /note="similar to uniprot|Q07084 Saccharomyces cerevisiae
                     YLR006c SSK1 two-component signal transducer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445541.1"
                     /db_xref="GeneID:2887049"
                     /db_xref="GOA:Q6FW53"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:Q6FW53"
                     /translation="MNEYPIPRPYPLAKSNTGLSLQTNWKAGSNWKLWLKLDYNSDEI
                     NQAISIEFDENDTIEDVKDKLFNRLNGTRWNRYNDMMSVGIGIYTNVPDLQENMTNLN
                     TSDKILSHSPSSLKEQILQTNNNRSPQNSPLDRQNYRTRWLANHRRSNSASPTFQSIP
                     NNRITPILNSNWHSEYHNEQLSSLYSHPKYASPNPHVSRQSPRKNLKYSVEDIDDYHY
                     KIIFDPDEQIYQIYVSLFGAIGSQTSSSALLVFSNVDMGHAPPLPMESPAAGIFDDDH
                     DKFAGHIQVLSQEHSVGNMDTYDNDNSLHGFGSNNADEVNFYANGTDIDERSNSELQA
                     VQPAMLLLPKDYRLEEQEQLYHESEHNSNEQNKGLAFISDRNSSASVPQLENDKSKQL
                     HVDTNVLDKQNAIDSNNYKQANSLLLSPLDVLKTTETTPIPVSKEKQQNITALDTLPF
                     KLTTTSEKVFPKINVLIVEDNVINQAILGSFLRKNKISYKIAKNGKEAVDKWKEGNLH
                     LIFMDLQLPVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIV
                     ALTASNSQEDKREALISGCNDYLTKPVNLLWLSKKITEWGCMQALIDFDGWKKEASRM
                     TDSVLVRSPHRNRIPSANKSSTSISRSSSSGGKKQERAVSINN"
     gene            complement(<302952..>305615)
                     /locus_tag="CAGL0D02904g"
                     /db_xref="GeneID:2887200"
     mRNA            complement(<302952..>305615)
                     /locus_tag="CAGL0D02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445542.1"
                     /db_xref="GeneID:2887200"
     CDS             complement(302952..305615)
                     /locus_tag="CAGL0D02904g"
                     /inference="similar to AA sequence:UniProtKB:P07272"
                     /note="similar to uniprot|P07272 Saccharomyces cerevisiae
                     YLR014c PPR1 transcription factor regulating pyrimidine
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445542.1"
                     /db_xref="GeneID:2887200"
                     /db_xref="GOA:Q6FW52"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FW52"
                     /translation="MTKGKKRVSKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKG
                     CLRNNVPCVSVDPVTGQDIPRSYVFFLEDSLSNMMSKLSECGINPMTIKSNVPCSEND
                     TNCNLEEYKKKFKKNGSLIPVDDMLGSYLVQKGMLMQDNSETSNGSRSDFANSPSINS
                     PMDQAYFRSPKPMMPQTASPMESSSVGADLEETNNHFSDIGSMKETTKNSYLGDSSGV
                     SFAKLVYTAANFQPDYIDSEFDEDIKLRELKYRDYALAENDPNFDPLALPPIEEAEQL
                     INRFFIDTNSQLPVFHREQFLKKYYEPIYGEWNNKITLVSNKTKINRNFMGPEPLRPN
                     SPYGVQPWYNTWKSLEDKGVRDIELHDYYRIPYFVLNMVFTIGCATKVLASDIKQVVT
                     FKRRATYFKKDIFSSTDRLEALMGTLLLAIYSIMRPNVPGVWYTMGSVLRLTVDLGLH
                     SEKINMTYDPFTREIRRRLFWCVYSLDRQVCSYFGRPFGIPEDTITTGYPSLLPDSEI
                     TPAYGTIEDYSDVKPKSISYKKLAIAMFAIRQLQAKIVRVLYAPHAEIPRKYNDLEEW
                     RAAVHSELNAWYDKAVPRSQKMIDCHYNSSLFELNYHYTKSILYGLSPKCPILTELSC
                     RLVFLSTKGTIDVFYDLCINQKIGYTWVAVHNVFMAGMTYLYVIFYSGNNIKENRQEV
                     EDYTGKILFILKNLIGTCEAAKNCFQSYDVLSKVVIKLKFGEKIIEDNSSKENTFKSG
                     GNLQIDDSKNTDLLKRKPSISGGSLDLPLEKFFLQLDKLEENNDEEPSNTGKFRGRSM
                     SFLNNNNNNNNNMNNGNKDTGINLHNEQDFQNDFKLQDDLPLFDDPANEEQNMVDILF
                     QVTSQSLWDEFFVKQNNEEKKEENIDPFFTL"
     gene            <306241..>307686
                     /locus_tag="CAGL0D02926g"
                     /db_xref="GeneID:2887068"
     mRNA            <306241..>307686
                     /locus_tag="CAGL0D02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445543.1"
                     /db_xref="GeneID:2887068"
     CDS             306241..307686
                     /locus_tag="CAGL0D02926g"
                     /inference="similar to AA sequence:UniProtKB:P43132"
                     /note="similar to uniprot|P43132 Saccharomyces cerevisiae
                     YLR015w BRE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445543.1"
                     /db_xref="GeneID:2887068"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FW51"
                     /translation="MKPEIIPYQPEVDLVLDDSVCERRPHLPVYQETHEVNGVQFWKT
                     EDIPLSRRNFIYRPCLPNPLFTELGYCTTEYPFDTSGVNIQDRSYGMSVLRGENSVVS
                     VRAKDGWRTARSDVCIKEGDVYWEVEVLNVGNGSGSGTGSGSSSNVDVDVDKGSVQQR
                     RQFLNSSAHVRVGISRREASLEGPVGFDSYGYGLRDFSLESIHDGQLEQVLARAPLKN
                     GDRLGFLVSLPSVERQVAQAREYTARRIEALASHGQELGAQEEWESHGRKRQKRAGVT
                     NMDFQRALLEDIDHANVVRDHIPIRYKNQLFYEATDYVKTTKPEYYSSDKREREEYYH
                     LEGSYVAVFLNGEYLGKAFEEVKPFLPPFSELQYNEKFYYGYWKHGRAEGEDREEARI
                     GGKHRKGLILRNKYVNNSKLGYYPTISCFKGGAARLVTTRSELRHLRAATDVADQPVA
                     VLDDLYRRQIADEVVWDIVDEIEEEAKVKWK"
     gene            <308191..>310194
                     /locus_tag="CAGL0D02948g"
                     /db_xref="GeneID:2887030"
     mRNA            <308191..>310194
                     /locus_tag="CAGL0D02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445544.1"
                     /db_xref="GeneID:2887030"
     CDS             308191..310194
                     /locus_tag="CAGL0D02948g"
                     /note="highly similar to uniprot|P16474 Saccharomyces
                     cerevisiae YJL034w KAR2 nuclear fusion protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445544.1"
                     /db_xref="GeneID:2887030"
                     /db_xref="GOA:Q6FW50"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MNAIKRLLPVSLFLYALFVVLLPFQARAKDDVENYGTVIGIDLG
                     TTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQIAANPTNTIFDI
                     KRLIGLKFNDRSVQRDIKHLPFKVVDKDGKPVVQVKVKGEDRVFTPEEISGMILGKMK
                     QIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAIAYGLD
                     KSDKEHQIIVYDLGGGTFDVSLLSIENGVFEVQATSGDTHLGGEDFDYKIVRQLIKTF
                     KKKHGIDVSDNEKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLTRAKFE
                     ELNLDLFKKTLKPVEKVLEDAGLEKKDIDDFVLVGGSTRIPKVQQLLESFFNGKKASK
                     GINPDEAVAYGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETTGGVMTPLIKRNTAIP
                     TKKSQIFSTAVDNQPTVQIKVYEGERAMSKDNNLLGKFELTGIPPAPRGIPQIEVTFA
                     LDANGILKVSATDKGTGKSESITITNDKGRLTQDEIDRMVEEAEKFASEDAVLRTKIE
                     ARNKLENYAHSIKNQVEGDLAEKLEEEDKETLLDAANDTLEWLEDNFDSATTEEFEEK
                     FEALSKTAYPITSKLYGGADGSAPVYDDDEDEDDDTDYFDDEL"
     gene            complement(<310516..>311148)
                     /locus_tag="CAGL0D02970g"
                     /db_xref="GeneID:2887210"
     mRNA            complement(<310516..>311148)
                     /locus_tag="CAGL0D02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445545.1"
                     /db_xref="GeneID:2887210"
     CDS             complement(310516..311148)
                     /locus_tag="CAGL0D02970g"
                     /inference="similar to AA sequence:UniProtKB:Q07930"
                     /note="similar to uniprot|Q07930 Saccharomyces cerevisiae
                     YLR016c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445545.1"
                     /db_xref="GeneID:2887210"
                     /db_xref="GOA:Q6FW49"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6FW49"
                     /translation="MRQSRYDATGSRAGRGISKPGYRYNNRKREWKDRREVKRTKPSK
                     GPLLPNFESSGLLELDSNNKNGIALKYVEPKDAISPLDYFKGSTDKTKYKCLLYKEST
                     GKVIDEFELEAKNSYLIGRKDEEEEENNIADILIPEETCSQQHCVIQFRRTENDSIKA
                     YIIDLESSNGTVLNGNTIPQARYIELKNGDTIQFTADSRDRKYYLVYAYT"
     gene            <311423..>312364
                     /locus_tag="CAGL0D02992g"
                     /db_xref="GeneID:2887245"
     mRNA            <311423..>312364
                     /locus_tag="CAGL0D02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445546.1"
                     /db_xref="GeneID:2887245"
     CDS             311423..312364
                     /locus_tag="CAGL0D02992g"
                     /inference="similar to AA sequence:UniProtKB:P46962"
                     /note="similar to uniprot|P46962 Saccharomyces cerevisiae
                     YJL006c CTK2 carboxy-terminal domain kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445546.1"
                     /db_xref="GeneID:2887245"
                     /db_xref="GOA:Q6FW48"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:Q6FW48"
                     /translation="MSSTKFDTQLYLSRPYLTRKQVQRAQQNTIGDHRAYNAKRVAIV
                     KFLSDICVQLRFPRRTLEAAVYFYLRYHLFNNFETEPCYIIATSCLVLSCKEVETIKK
                     VNDICTVSLSLRNTGKVSGEVLENFKKRVFVMELKVLESCSFDYRINDAVHVDEYIIK
                     FGKTLGLSYELCHIAWCIAFDVLKTELLLLVPQHVISLACIKLASGILDVPVAIEKSI
                     QQFEMDNPMFSEAYFELLNFYINSFDSCDLKNVYQGASLEQFMDLKRKAGQEHGLKEP
                     LEKQIEMDTYLTTSRTQPIRERRYVLSQSLVNNEVGK"
     gene            <312825..>314522
                     /locus_tag="CAGL0D03014g"
                     /db_xref="GeneID:2887246"
     mRNA            <312825..>314522
                     /locus_tag="CAGL0D03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445547.1"
                     /db_xref="GeneID:2887246"
     CDS             312825..314522
                     /locus_tag="CAGL0D03014g"
                     /note="highly similar to uniprot|P47079 Saccharomyces
                     cerevisiae YJL008c CCT8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445547.1"
                     /db_xref="GeneID:2887246"
                     /db_xref="GOA:Q6FW47"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FW47"
                     /translation="MSLKLPQNPNAGLFKQGYNSYSNADGQITKSIGAIREIHQMCLT
                     SMGPCGRNKIITNHLGKIIITNDAATMLRELDIIHPAVKVLVMATEQQKIDMGDGTNL
                     VMVLAGEMLNVSEKLIALGLSPIEIIQGYQLAKNFTLKELDKMVVGEITDKGSKEELI
                     KIIKPVVSSKQYGSEDLLSELIAESISHVIPKGSNQPLFNVDSIRVVKIMGGSLINST
                     VIKGMVFNREPEGHVKSLPQGDKHKVAVFTCPIDIAATESKGTVLLHNAQEMLDFSKG
                     EEQQIDAMMKEIADMGVKCIIAGAGVGELALHYLNRYGILVLKVPSKFELRRICRVCG
                     ATPLPRLGAPTLEELGLVETVKTMEIGGDTVTVFKQEENESTRTATIILRGATQNNLD
                     DIERAIDDGVAAIKGLMKPNGGKLLPGAGATEIDLVSRITKFGEKTPGLLQLAIKEYA
                     LAFEVIPRTLAETAGLDINEVLPNLYAAHTVTNEDGEDKKHLVKGIDIDGLTSEGVKD
                     ITEDGVYDMLETKKFAINVATEAACTVLSVDQIIMAKRAGGPQAPQGPRPGNWDQDD"
     gene            complement(<314724..>316592)
                     /locus_tag="CAGL0D03036g"
                     /db_xref="GeneID:2887032"
     mRNA            complement(<314724..>316592)
                     /locus_tag="CAGL0D03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445548.1"
                     /db_xref="GeneID:2887032"
     CDS             complement(314724..316592)
                     /locus_tag="CAGL0D03036g"
                     /inference="similar to AA sequence:UniProtKB:P47082"
                     /note="similar to uniprot|P47082 Saccharomyces cerevisiae
                     YJR001w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445548.1"
                     /db_xref="GeneID:2887032"
                     /db_xref="GOA:Q6FW46"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6FW46"
                     /translation="MSTPVDEERQPLNPRGSRSQVRYISIPLARNPDLEAVDGDTSGY
                     AVQDSSFTNHEPQPMGRRQSILDQPIGSFRGVNSLSRFATSLRRANSFRNIEVKPEVE
                     RTYFNDDYDELFDPSTLAPAPHGRSLSIALQSANATLQVSGKPSIPNIDAQSTHSISQ
                     QELEDFRSIRTTSFSMDNNGILRPTLSMNEMLTGSTPFDTNDVDSMVIKQVEGKDGTV
                     VTLLAGQSTAPQTIFNSINVLIGIGLLALPLGMKYAGWIPGLIMLSIFAFGTFCTAEL
                     LSRCLDTDPTLISYADLGYAAFGSRGRAFISALFTVDLLSCGVSLVILFGDSLNALFP
                     QYSVTFFKIVCFFVVTPPVFIPLSILSNISLLGILSTTGTVLVIFICGLFKRDAPGSL
                     IEPMPTHLWPTDFKSLCLSIGLLSASWGGHAVFPNLKSDMRHPQKFKKCLKTTYQITS
                     VTDIGTAVIGFLMFGDLVKDEITKNVLLSDGYSNTVHVLISALMTVIPIAKTPLNARP
                     IVSVLDIMFGIHEAEKEYTGKKLKFAQFGQFFNRIFVNFMFVLIAIIFPQFDRIIAFM
                     GAGLCFAICFILPCLFYLRICGEANIVKPWERLACKATIVVSVVLSVLGVSAAMFS"
     gene            complement(<317022..>317669)
                     /locus_tag="CAGL0D03058g"
                     /db_xref="GeneID:2887235"
     mRNA            complement(<317022..>317669)
                     /locus_tag="CAGL0D03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445549.1"
                     /db_xref="GeneID:2887235"
     CDS             complement(317022..317669)
                     /locus_tag="CAGL0D03058g"
                     /note="highly similar to uniprot|P38624 Saccharomyces
                     cerevisiae YJL001w PRE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445549.1"
                     /db_xref="GeneID:2887235"
                     /db_xref="GOA:Q6FW45"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FW45"
                     /translation="MDGVQVDITALKKGEVSLGTSIMAVTFKDGVILGADSRTTTGAY
                     IANRVTDKLTRVHDNIWCCRSGSAADTQAVADIVQYYLDMYEGQFGEPDTYTAANMFK
                     TLCYQNKDALTAGIIVAGYDEKNKGEVYSIPLGGSIHKQPYAIAGSGSTFIYGYCDKN
                     FRENMSKDETIDFIKHSLSQAIKWDGSSGGVIRMVVLTKDGPERLIFYPEEYENL"
     gene            complement(<318089..>319975)
                     /locus_tag="CAGL0D03080g"
                     /db_xref="GeneID:2887027"
     mRNA            complement(<318089..>319975)
                     /locus_tag="CAGL0D03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445550.1"
                     /db_xref="GeneID:2887027"
     CDS             complement(318089..319975)
                     /locus_tag="CAGL0D03080g"
                     /inference="similar to AA sequence:UniProtKB:P54790"
                     /note="similar to uniprot|P54790 Saccharomyces cerevisiae
                     YLL004w ORC3 origin recognition complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445550.1"
                     /db_xref="GeneID:2887027"
                     /db_xref="GOA:Q6FW44"
                     /db_xref="InterPro:IPR020795"
                     /db_xref="UniProtKB/TrEMBL:Q6FW44"
                     /translation="MDVSEFADSQRTHYIARPTYNVSEFVEKSNSETEESLGTVPFVK
                     LLDGEETNVAVLKRWELYHLLYSNFHNQVDDIVNNIETDLKDEVMSVLLNLPNRQDNY
                     GKPCFNTLFLLGSDSSLAVDLPNNDPETIDVLIDLTPKESPNVRMMLRRSMFKLIQTA
                     DSILSGTTKIKTELEDDDDNEVPDFSVSSDKITYDLTLLENFKEVFGKNLNIVFNFKD
                     VDSMGAIVLDNFVELLSRALKNDHVKISLIFNINTNLSNFEKNFRQSTIRLLKRHFHK
                     IDVSSNKGYKYGNRIFQSFLDTVDGKLNLSDRFVEFVIEKMSNNSNHNLQLLIKILDY
                     SLMAYFFENPFSVFIDPVNIDYLNDEYLNRLVRCPTFMFFIEGLIKDNANTSEVLALL
                     DNTDGNLVNFFVEFLVRENPINGHAKYVANFLETELGIKNYNLIELYHNLLQGKLKDY
                     LWRWKSCQEHIEKLDFEPVDTMFQELFTLDHNNGLLSQSLFPFYRTNVENNLLNWEQV
                     LPIKEAPAPESKVLQELNRKLNPILSHLFKLYREANNQINTYDFYMVFKETMPRDIIL
                     DYVKEQAQENHSLETLLDKPDAFDKISLILFMQAIVDFEMIGILKPAGKGHDVMEKCI
                     WRGL"
     gene            complement(<320341..>320697)
                     /locus_tag="CAGL0D03102g"
                     /db_xref="GeneID:2886982"
     mRNA            complement(<320341..>320697)
                     /locus_tag="CAGL0D03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445551.1"
                     /db_xref="GeneID:2886982"
     CDS             complement(320341..320697)
                     /locus_tag="CAGL0D03102g"
                     /note="highly similar to uniprot|P47081 Saccharomyces
                     cerevisiae YJL003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445551.1"
                     /db_xref="GeneID:2886982"
                     /db_xref="GOA:Q6FW43"
                     /db_xref="InterPro:IPR020164"
                     /translation="MALGGRSFRSKKQQLAYDRSFAGRYQKLLSKNPFIFFGLPFCGM
                     MVLGSYWLAGISQVKFDRDDQKVQEMNEEEILKMKHGKREFDIKEEYYRLQGLAEEDW
                     EPKRVERFKGESDNVF"
     gene            complement(<321029..>323206)
                     /locus_tag="CAGL0D03124g"
                     /db_xref="GeneID:2887241"
     mRNA            complement(<321029..>323206)
                     /locus_tag="CAGL0D03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445552.1"
                     /db_xref="GeneID:2887241"
     CDS             complement(321029..323206)
                     /locus_tag="CAGL0D03124g"
                     /note="highly similar to uniprot|P32892 Saccharomyces
                     cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445552.1"
                     /db_xref="GeneID:2887241"
                     /db_xref="GOA:Q6FW42"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSLKMKGKKYTDLDFVPTISDSEEDVPDLDSDEEKPKPETKGKK
                     KNKSVDEESADMNSGFRFNTDDGEINTNFDGWEFLGDEKDEEKKDVDLDKIIRKKGGL
                     IGMAHVDEAEKSESEESESDDEDLAMDGFGMGAQEQPEGEEEDEDASNSEQESNDEEE
                     DDDEETYDVGDAGDAEEKVEEDTAEEMQAFYAPESESENAKKEVHKTFNDLALSRPVM
                     KGLSNLGYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVA
                     STRVIVLTPTRELAIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIA
                     TPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSA
                     TMNSRIKQLISLSLKRPVRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNLIRKLD
                     PNGQKRIVVFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVL
                     ICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFVGEASAERS
                     IVKDAIRGVNDSEIPGSKAVGRNVDWNQVEETNKIVENMDQTVQDILVEEKEEKEILR
                     AEMELKKGENLLKHKDEIQSRPKRTWFQSEKEKKNSKIMGALSKTKKEVNSKKRKRNE
                     AMEDGHKRSYKKTQSDRTADQERTMKKQAKANGKKKGKSKGKR"
     gene            <323492..>324064
                     /locus_tag="CAGL0D03146g"
                     /db_xref="GeneID:2887066"
     mRNA            <323492..>324064
                     /locus_tag="CAGL0D03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445553.1"
                     /db_xref="GeneID:2887066"
     CDS             323492..324064
                     /locus_tag="CAGL0D03146g"
                     /note="highly similar to uniprot|P41544 Saccharomyces
                     cerevisiae YJL004c SYS1 multi copy suppressor of YPT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445553.1"
                     /db_xref="GeneID:2887066"
                     /db_xref="GOA:Q6FW41"
                     /db_xref="InterPro:IPR019185"
                     /db_xref="UniProtKB/TrEMBL:Q6FW41"
                     /translation="MVNFRRYLRVPRELRPSEIFKQDSMSPGKIALQIILLQVFYYTT
                     ACILFYGWAKVAGYKLEMVQWLFSWQAIEFTNALGLTLCLLWLTDSLICVIFLTVIVE
                     RSKLAWDFAITIHAINLIVVSVHTGTLPSLSWFVLQVLSSLILIFLGTYTTRWRELRD
                     TFFEGLVDADMVSPSASSQPIEMRDLESQK"
     gene            complement(<324192..>330440)
                     /locus_tag="CAGL0D03168g"
                     /db_xref="GeneID:2887067"
     mRNA            complement(<324192..>330440)
                     /locus_tag="CAGL0D03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445554.1"
                     /db_xref="GeneID:2887067"
     CDS             complement(324192..330440)
                     /locus_tag="CAGL0D03168g"
                     /inference="similar to AA sequence:UniProtKB:P08678"
                     /note="similar to uniprot|P08678 Saccharomyces cerevisiae
                     YJL005w CYR1 adenylate cyclase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445554.1"
                     /db_xref="GeneID:2887067"
                     /db_xref="GOA:Q6FW40"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:Q6FW40"
                     /translation="MSRRSESNRTHLEQGTYSKKVHDEQPRFKSTYDQQDFSGTSSRR
                     NSTIQNVYSSIGGLTRTRSRDSVSSIKSNPGEFPSNKNYQHKSKKSPFSLKRTLSNLS
                     VTNMLQTQTPSSLQNMAFEDEIDQKIDSSNTTDVDSIGSMSDRSFTSRVASNSENDHT
                     HHRKHGSTSRKYSFAENLFKKLAPSNSSTKTSHKGQTTRRTAGLTHSKPTAETISELP
                     GEHDLTNVKFPPPLAEIGADGLRNKVKQIVRGHSTSGIAIANDGSTRSSIPLMKELEK
                     KKLKHKDQEKHQSESSSIHSSQGNKKLFLSTGSSASSRRGSTVNSILTNDNRSSVSNP
                     KEPKSVLGEPSHNNQTKDINTPNQKGFTTAQRANSISVPSKSHKFNAIDPENTIEARF
                     NESTLDKEKDESIKEKDNSDNKGNDENNAEDIKTENPNTGLFPLDTNLENMAEITKNV
                     EPPSEADKEPITRSNTFISGPKKSHSIADIPTWVSSESSLKDYTQTDRDQWVAPESWD
                     VEMRMGGSNANHLENEEEPFDSILSPEEVTMATQQKQRRNKSNNKSSKSRNGSEVNGK
                     KPLSTKSMVRIKNSLFMSPTSNDTENSSDLSRNGGINFNSKLGSSRVRKSSSDSLASI
                     ISPTESLHSDDDKQSTTSRSSYNSSTSNQYPDNIDDENEEYELQLNARAARKRKTISS
                     SELFQKMNDGTDNSDSNENISADIDDERHDNVEYELERYYKDVSDLDPKRHYAIRIFN
                     TDDTFTTLSCTPGTTVEEMIPALKRKFNITTQGNFQISLKVGKLSKILRPVSKPILIE
                     RKLLLLNGYRKSDPLHIMGIEDLSFVFKFLFHPVTPSHFTPEQEQRLMRSEFVHVDLR
                     NMDLTTPPIIFYQHTSEIESLDVSNNANIFLPLEFIESAIKLLSLRMVNIRASRFPAN
                     ITEAYKLVSLELQRNFIRKVPSSISKLVNLTILNLQCNGLDRLPSGFSQLKNLQLLDL
                     SSNRFAHYPEVINFCTNLLQIDLSYNKIHHLPKSCRQLVKLAKMNLSHNKLTHVGDLS
                     ELKNLRTLNLRFNRINTINTNAPNLQNLFLTDNRISNFDENLPKLRALEIQENPITSI
                     SFREYPMNMTSLSLNKAKLASIPGEIFKKLLRLEKLELNENNLTRLPSEISLLTKLVY
                     LSAARNKLESIPQEFSKLKSLRSLDLHSNNIRDFFAGMEDIELTFLNISSNVFANASL
                     DPSFFLNVSNDSKLSKSLMFFVAADNQFDDDAWPLFNCFTNLKLLNLSYNNLQDITKM
                     KLENLTELFLSGNKINTLPGDTVSKWKYLKTLMLNGNQLLSLPAELSQLPQLNVFDIG
                     SNQLKYNISNFHYDWNWRNNKELKYLNFSGNRRFEIRSVTNQELQTDLSDLTVLPHLK
                     VLGLMDVTLNTTKVPDENINFRLRTTASIINGMNYGVADTLGQRDYVSSRDVTFERFR
                     GHDDECLICLHDSKNQNSDYGYNISRIVRDIYDKILIRQLEKFGDSNEDEIKKALRFS
                     FLQLNKEINGMLNSVDNGANIDNLTSADLLSGACSTVIYMKGTKLYAANLGDCMAVLS
                     KNNGDHQKITKQHVPTKREEYERIRLSGGYVNNGKLDGVVDVSRAVGFFDLLPHIHAS
                     PDISVINVTKADEMLIIGTHKLWEYMDIETACDIAREHVLEPMLAAEELKDHAIAYGC
                     SENITILCLALSKSNSQESKFTLNRSSLLSKRSTVEDTTLRRLQPEIAPPTGNLAVVF
                     TDIKNSTFLWELFPNAMRTAIKTHNDIMRRLLRIYGGYEVKTEGDAFMVTFPTPISAL
                     VWCLSVQLKLLEAQWPEEITSIQDGCLVTDRNGTKIYQGLSVRMGMHWGCPVPELDLV
                     TQRMDYLGPVVNKAARVSSVADGGQITLSSDFVSEFNKIMKYHDNVVKDKKPLKEVYG
                     EEIIGEMLEREITMLESIGWSFFDYGEQKLKGLETKEFITIVYPKSLASRHEFITEEE
                     QSKIINLDFLLSLRQLANKLEAILSAVGGGFLELDSKQREYHSVIDRSLKGVVAASMS
                     DKELILFFDHLVTRIETIIAVLQLRIKVTKGLDICQHHDFCLPQKGIFEVLDDVFKLM
                     DAAKQIQN"
     gene            <331747..>332760
                     /locus_tag="CAGL0D03190g"
                     /db_xref="GeneID:2887261"
     mRNA            <331747..>332760
                     /locus_tag="CAGL0D03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445555.1"
                     /db_xref="GeneID:2887261"
     CDS             331747..332760
                     /locus_tag="CAGL0D03190g"
                     /note="highly similar to uniprot|Q07938 Saccharomyces
                     cerevisiae YLR017w MEU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445555.1"
                     /db_xref="GeneID:2887261"
                     /db_xref="GOA:Q6FW39"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="UniProtKB/TrEMBL:Q6FW39"
                     /translation="MLFTRFTGRRVLKMTSDIATTFEGEIDLGIIGGTGLYNLECLKA
                     IAILPPMETPWGKTSSPITISKVTTTKDIEGHPSINKNFHVAFISRHGLHHEYPPTKV
                     PFRANMAALKHLKCKAVLSFSAVGSLQHHIRPRDFVLPQQIIDRTKGIRDSSYYNDEG
                     LVGHVGFGNPFSEAFAKYIYQFKDNLVNKGDHCTLHFNKDITVICMEGPQFSTRAESK
                     MYRLLGGDVINMSVIPEAKLARECELPYQMVCMSTDYDAWKDEEEPVTVETVIGHLTN
                     NGMNANVLASCIIESMAHELPEFMVTGDGLKNSVKMSISTKPEGMSKETLNKLRYLFP
                     DYW"
     gene            complement(<332928..>334025)
                     /locus_tag="CAGL0D03212g"
                     /db_xref="GeneID:2887010"
     mRNA            complement(<332928..>334025)
                     /locus_tag="CAGL0D03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445556.1"
                     /db_xref="GeneID:2887010"
     CDS             complement(332928..334025)
                     /locus_tag="CAGL0D03212g"
                     /note="some similarities with uniprot|Q12445 Saccharomyces
                     cerevisiae YLR018c POM34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445556.1"
                     /db_xref="GeneID:2887010"
                     /db_xref="GOA:Q6FW38"
                     /db_xref="InterPro:IPR012578"
                     /db_xref="UniProtKB/TrEMBL:Q6FW38"
                     /translation="MSGINRNNLSTPSRPLSREQFFSVRERIVKDTPKLYQGRSIATD
                     EKKERTDERVFTPTSSINIFSHKSQEPIQQTVERQTVQSHDLGFFENPVLEKLAERSV
                     NKSLEVQKIINNVLLYLLWNLITKFILLYLDHTSSGQKVRKNWLQTDQILALLHMPNN
                     KAAENAIDLLFSVSSFNKAFRGLVLYNVLMSIFALVGKVKISDLKLNQRQKNLLGFIG
                     QGETSNLRRIEPSNLMLKQNSKKTTENTKDQSVSSGINKKNTESQVSAPPYAFRSIQT
                     PMKKKMEEERNSNMNSVSNNVNPLVRSNIFNNNASTGNNRSVNFAELHHSDIVRRNST
                     ITTLNDTSAGYIPSSKYTYMMDTPSPRKSFK"
     gene            <334913..>336145
                     /locus_tag="CAGL0D03234g"
                     /db_xref="GeneID:2886990"
     mRNA            <334913..>336145
                     /locus_tag="CAGL0D03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445557.1"
                     /db_xref="GeneID:2886990"
     CDS             334913..336145
                     /locus_tag="CAGL0D03234g"
                     /inference="similar to AA sequence:UniProtKB:Q07949"
                     /note="similar to uniprot|Q07949 Saccharomyces cerevisiae
                     YLR019w PSR2 oruniprot|Q07800 Saccharomyces cerevisiae
                     YLL010c PSR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445557.1"
                     /db_xref="GeneID:2886990"
                     /db_xref="GOA:Q6FW37"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FW37"
                     /translation="MGFISALFCCSSNSTTDSITTKQITSQNNNRDTSNTDPEKYHQN
                     VKMMTYNNTTTLTPERDSSLNKHNNSSSPQIADINASKRPRTTPDISANPQNNNIPQV
                     NVPDDALSRSSSDSGQQRILKGSWTIGGEDEKMDDHTHLKIHGDEDMGEMSNEKTTIN
                     ESNSELDRSTQSSSEMTYQPTDNQGGIITSVYDNDVDMDRDVTPPYDEPYVDLAALQE
                     DQYHAPGYNTLLPPQTEQFKGKKCLVLDLDETLVHSSFKYLRTADFVLPVNIDDQVHN
                     VYVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSIHHRLFREACYNY
                     EGNYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPVSSWFSDSHDNELIDIVPLLE
                     DLSSNSVLDVGKVLDVTI"
     gene            complement(<336625..>338250)
                     /locus_tag="CAGL0D03256g"
                     /db_xref="GeneID:2887239"
     mRNA            complement(<336625..>338250)
                     /locus_tag="CAGL0D03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445558.1"
                     /db_xref="GeneID:2887239"
     CDS             complement(336625..338250)
                     /locus_tag="CAGL0D03256g"
                     /inference="similar to AA sequence:UniProtKB:Q07950"
                     /note="similar to uniprot|Q07950 Saccharomyces cerevisiae
                     YLR020c or uniprot|Q07804 Saccharomyces cerevisiae
                     YLL012w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445558.1"
                     /db_xref="GeneID:2887239"
                     /db_xref="GOA:Q6FW36"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FW36"
                     /translation="MTNYLVHILHEIVSDLMIGGFMAALFILALFHNLFSSHIFGNKD
                     PRDVRKSSTKIYPERHKHNKSHGREKSHNRGMSTSSTTPLDIEVDEDNNIEYDNTITG
                     SPEPSTLNEDSYEENRQFYLNNITENPFDSISEVEDSQLVPNLEYYYSQYNIEIETFR
                     IETKDGYIIDLLHMKHNEPGMENIQRYPLLLLHGLLQSCGAYASTGRASLAYFFHQAG
                     FDVWLGNNRCGLNPDWNKNKIDKPHWFNKWDWDIKDFVKYDIRALVEQVKSRTGFSKI
                     TLIGHSQGTTQSLLGLINGPELYDEPDKFTLIDSLDNFIALAPAIYPGPLLDEKMFVR
                     FMAASIDSPWVFGQKSFIPFMMRMRKLMAGTKMFSFFSYIMFNYMFDWNDKLWDKKLR
                     DRCFLFSPVYVSVKLMRWWLTPDRSITGFKNGAHKLFPDTKTWFPVLSDTSSSSSSLN
                     LKNVPNHLNAPRETANDFPHIMLFAPKQDRLVDGERLINHFINYESRDIYKIWYIDEY
                     SHLDVLWAKDVIERIGKPIVENMRIPSNETVHN"
     gene            <338736..>339248
                     /locus_tag="CAGL0D03278g"
                     /db_xref="GeneID:2887020"
     mRNA            <338736..>339248
                     /locus_tag="CAGL0D03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445559.1"
                     /db_xref="GeneID:2887020"
     CDS             338736..339248
                     /locus_tag="CAGL0D03278g"
                     /inference="similar to AA sequence:UniProtKB:Q07951"
                     /note="similar to uniprot|Q07951 Saccharomyces cerevisiae
                     YLR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445559.1"
                     /db_xref="GeneID:2887020"
                     /db_xref="GOA:Q6FW35"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:Q6FW35"
                     /translation="MQVRSIRRKLDAQIDAAEGEVAVKALHYSNSVVLQIRYNGEFDS
                     TYEVNSVGLRPGSMTNGRPLALNTYASEDNSQNGGSGEIDEETEEPTDYLADYKVVVR
                     LGNGDDPKMNIVCSQIAELYNQMQGGDELRGVNLVISLSRKLWKGEDSHSRDFAVLVF
                     LLQCIKDMYV"
     gene            complement(<339318..>340058)
                     /locus_tag="CAGL0D03300g"
                     /db_xref="GeneID:2887072"
     mRNA            complement(<339318..>340058)
                     /locus_tag="CAGL0D03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445560.1"
                     /db_xref="GeneID:2887072"
     CDS             complement(339318..340058)
                     /locus_tag="CAGL0D03300g"
                     /note="highly similar to uniprot|Q07953 Saccharomyces
                     cerevisiae YLR022c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445560.1"
                     /db_xref="GeneID:2887072"
                     /db_xref="GOA:Q6FW34"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:Q6FW34"
                     /translation="MGVINQPSGQIKLTNVSIVKLKRNKKRFEVACYQNKVQDYRKGV
                     EKELDEVLQIHQVFTNVSKGLVAPKEDLQKAFGTTDVDLVIKEVLSKGEIQLSEKERQ
                     LMINKINNEMLTIISAKCINPQSKKRYPPTMIHKALQELKFTPVINKPAKTQALDAIR
                     LLVSSQIIPITRAKMKVKLTINDKSTHEDIIQKMEKLFTDSEFTQTDSAWIASGLIDP
                     VSYRYIVESAKDIGTVQVLDMAVIDSSK"
     gene            complement(<340949..>342586)
                     /locus_tag="CAGL0D03322g"
                     /db_xref="GeneID:2887073"
     mRNA            complement(<340949..>342586)
                     /locus_tag="CAGL0D03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445561.1"
                     /db_xref="GeneID:2887073"
     CDS             complement(340949..342586)
                     /locus_tag="CAGL0D03322g"
                     /inference="similar to AA sequence:UniProtKB:Q07959"
                     /note="similar to uniprot|Q07959 Saccharomyces cerevisiae
                     YLR023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445561.1"
                     /db_xref="GeneID:2887073"
                     /db_xref="GOA:Q6FW33"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q6FW33"
                     /translation="MDSISSASKHVSQYFDFEPSLHKWKQRGLDNIHRVRQTGRNVRY
                     PRFIHNTWNSLTSYTDELRAPDNDAKARSQGQNKVTRPARSRAPKKNRYSESTISLTS
                     DANTLVNSNASTTSFSRFRAPKPATTSNSFGSVGSGGSSPNDYSSTTSLSSAATPVPE
                     ELLEYVEKPVYTLTFKDDDVVVKEEEIIEELDIKTYINTYNYENAFEFGKVRHLHYYE
                     LPFPWRENRCIINGYRFYNSHKKSLLSIVNWYGWHNETSNIWTHLLGGLYILYLMFYQ
                     FPSSEVFMSEQVPKAAKLITYVFLIAAAKCLFSSVFWHTFNGTSLLRLRCKFACVDYS
                     GISILITASILTTEFVTMYQCPWAMVSYMALSTALGIFGVFMNWSPKFDRPEARPLRI
                     KFFILLASMGILSFLHLTFITSLSHSTWLLSPITKKSVVWYLVGVVFYGSFIPERWRT
                     DIQYDHTIPTSHELSTNVDIINKEKHIHFRETPTPHEMCKHHEHHHRSFKSLWWVDYV
                     GCSHTLWHFFVVLGVIGHYRAILDILTKKWILSGSPL"
     gene            complement(<343595..>348958)
                     /locus_tag="CAGL0D03344g"
                     /db_xref="GeneID:2887025"
     mRNA            complement(<343595..>348958)
                     /locus_tag="CAGL0D03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445562.1"
                     /db_xref="GeneID:2887025"
     CDS             complement(343595..348958)
                     /locus_tag="CAGL0D03344g"
                     /inference="similar to AA sequence:UniProtKB:Q07963"
                     /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
                     YLR024c UBR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445562.1"
                     /db_xref="GeneID:2887025"
                     /db_xref="GOA:Q6FW32"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:Q6FW32"
                     /translation="MDSVSCLRTFLDRLPTLCGARHDQSVKFLLWKAIHLSAEHGSQN
                     VNWPELIEVFTSEEFRNCTLGNILSNETWEESFIQIQDTNTHHGVCNRICFPPETVYY
                     CFTCTLNPIYEICEECFDESKHVGHTYTARTVTRAEGKICHCGDPAVFKKPELAYCCK
                     SYRDSGYTPDLTNKDGFLLKTINILVDFLIEYSLKQPNLSLEAPENNEFTNNKNKKPL
                     KDVHLRDSMTDGAEIMDTSTDDMTNFELEQEPTWAITIRSDDCDLHYIDLASRVSDIL
                     NIPNEYAIGIVDSLQDDCSIVTLVESNDLSKIKALADEFYSKNVNVRISKLESIFNQL
                     LIEDIICYITKRCLLDKGNIRFKHLLRLSLIDIWNSELPTKQLNKNNNLNPYSSKINL
                     LGGFLVSSEQNPDNPWFKKWSFPEIKDNYVQMVISNYNQRIDEANSPDTLAHFYTLYG
                     SRMQYLLSESLMLFCSVTKRQLLKIVNSVFSISDNCRKFVAAQYLDIYLTLLYKTVAS
                     DTTGFRVCTMSLISQQIFLEPTYAAMAIESGFIERTLKFAFTLMYFESDDLLPYLSIP
                     LHSGFQLPQETIKSRRTIICFKDLCCVMSTNRNPLLLLQREETFNAVLKTFEAFSAIL
                     PLKRETSEHVEFENFDFSAFYFFFSSCLIMMDGYIRNLSMVEDKNIRAKIAVRMLELV
                     MENEFTALAKSRSEITSRNMNVEKLPGNIKLPTYNKLPFLRERICNHVSEVVNFQVGI
                     DTQNLFNPMAYMFKFVLQWARCGRYEPLNYNGNTVLDLKTIFEDKQKALYISESSLAT
                     LVLIGQVRVGFWVRNGTPMTHQIRMYTKYSMREFTYFSDFFNVQFSMAIADPNEFMVT
                     YLYKWGLKHWSNGIPNCDYPDMEITLSIVEEALILLIQLLTDMKSIVVISSIDSFEKT
                     LKTEIIHAIGFQSFTYSQIMAMIPEHITKHNAFDIALKKYTTYSPPSGLSDSGLFSLR
                     DDLKCEIDPYYIGLPNGKRYEIEQQLRKHISAIKDIPYELSFVPAKRVIDDIKESAFP
                     NLFAITSKDTFGLFIKNSLDHIKKFENEGLLHRILHLIHICVVNNVNDFAKIFWREYA
                     IVDTEYCNDHSIGSILYSCLFKDCFSDLHGKIKEIFSIFNSEAAHINVEEYLKEQTVN
                     FNPKILVSSDSSSCRDEEFERKKKLAMIRKEKMLRKLAKQQKKFMKLNREASCEDSLP
                     TTATNSSEDLLMCDDKMGTPEILEETCVFCKMYKDDDQFIYFAYLERNICDKGVCTGH
                     QYGQEETMVTDSVVRACGHGAHTKCLAHHMKSARLLHNQTTKNVPIAYGMGLIYCPLC
                     AALCNCIIPHITNNNASTSNLISANKTNSFSFNELFEDSISEIVIKSGFIFSDLCNEK
                     YSKEDNLNHLFITVSRLLYNTVANFELRIRRNLQKGFYKKSGKKYIPNMGSLSSRLLN
                     DMRVYMIKYMSKHDVTIKLEDSFLAAACLVADSVTGKELGSNVPTMTISKIQMDIDAI
                     VSHIATCEFSDESESDIDMFDISSKEEVMAQTCGYLLGHGCEKAVQTNLERIDIWRRL
                     RDSALVFLRRLFILSNLASEKITLANCDQGPDHELSFYSEYFCIGLELPQLVEQAVNQ
                     WTATGKQCSEFNIVCTNTPLQLYSIPRNLSNYEKDLRSSQHLMLGRSPTDTTDLALCL
                     MCGEHVRTQRLVSRLGYEIGECTNHCRNECSMATPFGTFLLVRSNAIYIAYGNRGVFY
                     PGPYLNEFGERDVEFKYGTPVYLNQQRYEHFCDEILLGNMIPHVVFRLTDGNADLGGW
                     ETM"
     gene            349921..349991
                     /locus_tag="CAGL0D03366r"
                     /db_xref="GeneID:2887009"
     tRNA            349921..349991
                     /locus_tag="CAGL0D03366r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (GCC) cove score=62.73"
                     /db_xref="GeneID:2887009"
     gene            <350302..>350898
                     /locus_tag="CAGL0D03388g"
                     /db_xref="GeneID:2887155"
     mRNA            <350302..>350898
                     /locus_tag="CAGL0D03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445563.1"
                     /db_xref="GeneID:2887155"
     CDS             350302..350898
                     /locus_tag="CAGL0D03388g"
                     /note="highly similar to uniprot|P47064 Saccharomyces
                     cerevisiae YJL024c APS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445563.1"
                     /db_xref="GeneID:2887155"
                     /db_xref="GOA:Q6FW31"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027155"
                     /db_xref="UniProtKB/TrEMBL:Q6FW31"
                     /translation="MIHAVLIFNKKCQPRLIKFYTPVEISKQRILLKQVHELISQRNN
                     EYQSSFLVSPPAVLTNGTHTEDNSFNEDGEDIQIIYKNYATLYFTFIVDDQESELAIL
                     DLIQTFVEALDRCFSEVNELDLIFNWQTLESVLEEIIQGGMVIETSVSKIVQSVDDLN
                     KACESTDGKVGGLLGNSSFGSAFQAFASGGFANWAGSQ"
     gene            complement(<351075..>352706)
                     /locus_tag="CAGL0D03410g"
                     /db_xref="GeneID:2887050"
     mRNA            complement(<351075..>352706)
                     /locus_tag="CAGL0D03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445564.1"
                     /db_xref="GeneID:2887050"
     CDS             complement(351075..352706)
                     /locus_tag="CAGL0D03410g"
                     /note="highly similar to uniprot|P40992 Saccharomyces
                     cerevisiae YJL025w RRN7 polymerase I specific
                     transcription initiation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445564.1"
                     /db_xref="GeneID:2887050"
                     /db_xref="InterPro:IPR021752"
                     /db_xref="UniProtKB/TrEMBL:Q6FW30"
                     /translation="MSTFIRGPVCGTDNCPSRLWRIIDGRRTCRYGHVMDGDIEFNND
                     EDDVGGNAMAGVASSGVVTRRLNLTTNAVGGFQASLDPSQIGQMDKLRQQKDKKRKLS
                     GVEADRMFLRCIQYILRKQCRMLITKKSFPESFESTVKLIWIRLLQDIDQKNSYDLRA
                     HAPEDGSDSDNEPIEDQGRSKNRLHADREPRHQPLGIHMLTTISILYLASYLMGLPVY
                     TNDFIRWICNQDIPYFHTSRHLPHNFKSRLPGYYFMLLDGSKPPRKGAYFAQISAVAA
                     KVRFSTLCKDSLFLEGLLLKTTLQLTIPPIIYLKVNYLINAIDPERESFHLPESERFL
                     KKRRQINTMPEYRLLAYLIITLRYELLLNSDNYSESYVRSLIEQPYPDIDPSGKTVQN
                     QISNVSYGRINIENITRWSKDETMDYLDFIENKLVHGNDELSQQSPFSDLTIDQKIAK
                     RQLFKLFPIKDSIDSKMERRKLQSFSNELQEKYLKQFSMHSVYYEQNTSEYVKLVSVL
                     EDRLITILAEDFAVTKRQFELCVKRIEHQIKRASI"
     gene            complement(<353289..>354491)
                     /locus_tag="CAGL0D03432g"
                     /db_xref="GeneID:2887051"
     mRNA            complement(<353289..>354491)
                     /locus_tag="CAGL0D03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445565.1"
                     /db_xref="GeneID:2887051"
     CDS             complement(353289..354491)
                     /locus_tag="CAGL0D03432g"
                     /note="highly similar to uniprot|P09938 Saccharomyces
                     cerevisiae YJL026w RNR2 ribonucleoside-diphosphate
                     reductase or uniprot|P49723 Saccharomyces cerevisiae
                     YGR180c RNR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445565.1"
                     /db_xref="GeneID:2887051"
                     /db_xref="GOA:Q6FW29"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:Q6FW29"
                     /translation="MTKETPSKVAASALSDLELKDSQSNLKKQLEVLREENREQIEAL
                     KAKLSTAAVEHKEYLKSHKVHRHELKELEKDEPLLNDDPDRLTLFPIKYHEIWQAYKR
                     AEASFWTAEEIDLSKDLHDWNNRLNENERFFISRVLAFFAASDGIVNENLVENFSTEA
                     VIPEAKAFYGFQIMIENIHSETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWAL
                     RWIANSEALFAERLVAFAAIEGVFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLH
                     TDFACLLFAHLNHKPDPEVVERIVTEAVEIEQRYFLDALPVALLGMNAQLMNQYVEFV
                     ADRLLVAFGNKKVYNVENPFDFMENISLAGKTNFFEKRVSDYQKAGVMSKAQNTEGGG
                     AFSLDEDF"
     gene            complement(<355262..>356368)
                     /locus_tag="CAGL0D03454g"
                     /db_xref="GeneID:2887240"
     mRNA            complement(<355262..>356368)
                     /locus_tag="CAGL0D03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445566.1"
                     /db_xref="GeneID:2887240"
     CDS             complement(355262..356368)
                     /locus_tag="CAGL0D03454g"
                     /note="highly similar to uniprot|P53295 Saccharomyces
                     cerevisiae YGR173w or uniprot|P39729 Saccharomyces
                     cerevisiae YAL036c FUN11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445566.1"
                     /db_xref="GeneID:2887240"
                     /db_xref="GOA:Q6FW28"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FW28"
                     /translation="MGIIDKIKAIEEEMARTQKNKATEHHLGLLKGKLARYRQQLLAD
                     ESQSSGGGGSGFEVAKSGDARVVLIGYPSVGKSSLLGKITSTKSEIAHYAFTTLTSVP
                     GVLKYEGAEIQIVDLPGIIYGASQGKGRGRQVVATARTADLVLMVLDATKSKHQRESL
                     EKELEAVGIRLNKEKPNIYFKKKETGGVKITFTSPSRTNLTEQAIKLILRDYRIHNAE
                     VLVRDEKCTIDDFIDVINEQHRNYIKCLYVYNKIDSVSLEEVDRLAREPNTVVMSCEM
                     DLGIQDVVEEIWYQLNLSRVYTKKRGSKPSFDDPLVVRNNSTVGDLCHQIHRDFKDKF
                     KYALVWGSSAKHSPQKCGLTHRIDDEDVISLFTK"
     gene            356685..356758
                     /locus_tag="CAGL0D03476r"
                     /db_xref="GeneID:2887197"
     tRNA            356685..356758
                     /locus_tag="CAGL0D03476r"
                     /product="tRNA-Asn"
                     /note="tRNA Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:2887197"
     gene            complement(<357058..>357675)
                     /locus_tag="CAGL0D03498g"
                     /db_xref="GeneID:2887263"
     mRNA            complement(<357058..>357675)
                     /locus_tag="CAGL0D03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445567.1"
                     /db_xref="GeneID:2887263"
     CDS             complement(357058..357675)
                     /locus_tag="CAGL0D03498g"
                     /note="highly similar to uniprot|P36015 Saccharomyces
                     cerevisiae YKL196c YKT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445567.1"
                     /db_xref="GeneID:2887263"
                     /db_xref="GOA:Q6FW27"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /translation="MKIYYIGVFRSPAEQSSDEKALELTEVKDLSQFGFFERNSVGQF
                     MTFFAETVATRTTAGQRQSVEEGNYIGHVYARSEGICGVLITDKDYPVRPAYTLLNKV
                     LDEYLVAHPADQWKSITATNDSLKMAELSTYISKYQDPAQADAIMKVQQELDETKIVL
                     HKTIENVLQRGEKLDNLVDKSESLTASSKMFYKQAKKTNSCCIIM"
     gene            <358053..>359267
                     /locus_tag="CAGL0D03520g"
                     /db_xref="GeneID:2887208"
     mRNA            <358053..>359267
                     /locus_tag="CAGL0D03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445568.1"
                     /db_xref="GeneID:2887208"
     CDS             358053..359267
                     /locus_tag="CAGL0D03520g"
                     /inference="similar to AA sequence:UniProtKB:P36046"
                     /note="similar to uniprot|P36046 Saccharomyces cerevisiae
                     YKL195w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445568.1"
                     /db_xref="GeneID:2887208"
                     /db_xref="GOA:Q6FW26"
                     /db_xref="InterPro:IPR010625"
                     /translation="MVSAVSRQLVNRQLNRVLLRNARIAPFARATRFYSSKYAQESEN
                     AKRHKMGLLIAGVAVAGAIVFVTPPQWKKYFRAAKKVEEVAESKEDPVSEAAEEVSES
                     VQESTEEPQQSQEKETADVGNEQAQDESASSGDSEAKKAHDEFADQNEASEKESAPMG
                     ESADADQTAKDETVAEKTGNSKSESSESDQSEQDILSSDLEETMETVSEADKELHQIS
                     DNTVLSSEEDKTPKAEELKSTSPSGNDEEPKKEDDSSKTIHSLNSEKDMEAVEEEVKQ
                     ESAYNPDTGEINWDCPCLGGMAHGPCGEEFKAAFSCFVYSEAEPKGIDCVEKFQHMQD
                     CFRRYPEHYAEQLADPADDENVDHEKNLSEGKDTGVDSTPPKDEAYLKTEKEKKIEEN
                     ASPDEDTASKKD"
     gene            complement(<359549..>360937)
                     /locus_tag="CAGL0D03542g"
                     /db_xref="GeneID:2887209"
     mRNA            complement(<359549..>360937)
                     /locus_tag="CAGL0D03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445569.1"
                     /db_xref="GeneID:2887209"
     CDS             complement(359549..360937)
                     /locus_tag="CAGL0D03542g"
                     /inference="similar to AA sequence:UniProtKB:P07236"
                     /note="similar to uniprot|P07236 Saccharomyces cerevisiae
                     YKL194c MST1 threonine--tRNA ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445569.1"
                     /db_xref="GeneID:2887209"
                     /db_xref="GOA:Q6FW25"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6FW25"
                     /translation="MLCNSVGRIPVKPVTNSVVLIRANSKLAKKDSDSRLTLLQEVSN
                     RQRLFITDQITPGSAFFLPNGTKIYNKLVSFMKTQQKHLFGFKEVITPLIYRKSLWEQ
                     SGHWENYKEDMFRVEGNDLTKEEYGLKPMNCPGHCVIFNRFDHSYNDLPIRYSDFSPL
                     HRNEASGALSGLTRVRMFHQDDGHIFCTPDQVEVEILNCLKLVDMCYTKVFPISGEQS
                     KSKDSYEIHLSTRPEHYIGELESWDHAEEVLRSVLEKSSKPWKLNAGDGAFYGPKLDI
                     MVKDHHGKQHQVATIQLDFQLPQRFNLRYKDRDNSYKRPIMIHRAVLGSVERFMAMLV
                     ESNGGKWPFWLNPNQAIVIPLNTNNEEQVKMAKQLHDKLRGKLEIEDNLKPVPISHVS
                     YNADIDIRAEPVGYRIKDAITKNYSYLIIVGDNEVKAQKFSVRTRENRTPVLMDTNEI
                     LEKFKDLESNYK"
     gene            complement(<361241..>362260)
                     /locus_tag="CAGL0D03564g"
                     /db_xref="GeneID:2887023"
     mRNA            complement(<361241..>362260)
                     /locus_tag="CAGL0D03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445570.1"
                     /db_xref="GeneID:2887023"
     CDS             complement(361241..362260)
                     /locus_tag="CAGL0D03564g"
                     /inference="similar to AA sequence:UniProtKB:P36047"
                     /note="similar to uniprot|P36047 Saccharomyces cerevisiae
                     YKL193c SDS22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445570.1"
                     /db_xref="GeneID:2887023"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:Q6FW24"
                     /translation="MEVDGGKHEDKQEDKHAKIEIVDDDREVDVIKPDSELTDDLPDD
                     TENIELVHLRIGSLEELNLTRFHQLKYLCVRQNFIESISEVDVLPDDTVEDLDFYDNK
                     IKHISKYINKFKNLKNLDLSFNKIKNIKNIDKLENLENLYFVQNKIEVIENLSTLKKL
                     KNLELGGNRIHEIGEDSLKGLDKLEEIWLGKNHIPRLINLHWLKNLKILSIQSNRIKK
                     IENLEQLENLEELYLSHNFIEKIEGLDKNLKLTTLDITSNKITKIENVKHLTKLTDLW
                     LSFNKIDQSFESIGDELRDLPEFDTIYLEGNPVQLNNKTSYRRKLMLNLGPSLQKIDA
                     TYTRQ"
     gene            complement(<362690..>363040)
                     /locus_tag="CAGL0D03586g"
                     /db_xref="GeneID:2887165"
     mRNA            complement(<362690..>363040)
                     /locus_tag="CAGL0D03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445571.1"
                     /db_xref="GeneID:2887165"
     CDS             complement(362690..363040)
                     /locus_tag="CAGL0D03586g"
                     /inference="similar to AA sequence:UniProtKB:P32463"
                     /note="similar to uniprot|P32463 Saccharomyces cerevisiae
                     YKL192c ACP1 mitochonrial acyl-carrier protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445571.1"
                     /db_xref="GeneID:2887165"
                     /db_xref="GOA:Q6FW23"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:Q6FW23"
                     /translation="MLRTVVNVARQRPMMMAKANMQMLRPVRFYSQGLSKDVVQKRVV
                     DVIKAFDKTSASANITEDTLFHKDLKLDSLDTVELLVAIEEEFDVEFPDKVADELKSV
                     KETVDYILSNPDAN"
     gene            complement(<363465..>364790)
                     /locus_tag="CAGL0D03608g"
                     /db_xref="GeneID:2887061"
     mRNA            complement(<363465..>364790)
                     /locus_tag="CAGL0D03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445572.1"
                     /db_xref="GeneID:2887061"
     CDS             complement(363465..364790)
                     /locus_tag="CAGL0D03608g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445572.1"
                     /db_xref="GeneID:2887061"
                     /db_xref="GOA:Q6FW22"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FW22"
                     /translation="MPLPPIYTNRFGYENSNISLPSFSELTSMLNLPRYTLPKPRIQI
                     CSHLRPRTQATTGGIDGTANNKPISAYIFMERQPQTTPKIPIVSGSSVSPGAATPYYG
                     ALPYDVSRRKLSIASLDNGIRPVNSLSPTISITPVSSYGSVPPKLASVALDNPGVPEP
                     SFAPPSMPRINGVCSHRYKIKVTPERETSSMRARCNNSGADKLHSLSAVASALVEEEC
                     MVKTENSYPLSPDSINNSVLKSRNNSIDSLISGAIPKFDKEARNNCDGAAQELPAKAS
                     YIVSATDDVKEVPSVTLTSSATSNDVTVESQLITAERDAIILAGSQRRESQRSSGSSG
                     SHGSALSQDSSEPKFNTIGSSIRRRKSKPGKVSKSGKNRNVFGYCLQCGKVDTPEWRN
                     GPQGKATLCNACGLFYKKLKKYFADENMAIQFMQHRSIVDPEDRTMPKF"
     gene            <366246..>367025
                     /locus_tag="CAGL0D03630g"
                     /db_xref="GeneID:2886977"
     mRNA            <366246..>367025
                     /locus_tag="CAGL0D03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445573.1"
                     /db_xref="GeneID:2886977"
     CDS             366246..367025
                     /locus_tag="CAGL0D03630g"
                     /note="weakly similar to uniprot|O13297 Saccharomyces
                     cerevisiae YPL228w CET1 or uniprot|Q03220 Saccharomyces
                     cerevisiae YMR180c CTL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445573.1"
                     /db_xref="GeneID:2886977"
                     /db_xref="GOA:Q6FW21"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:Q6FW21"
                     /translation="MKSLTYDEFVGFLGKWVTQEYKKIPLECYQQVEIEAKFGRINSK
                     SNSTEFKESKKIIVLNNDYHMIPRISKFDFDRLRNKYINTKFNKLKKSSTKNSNNLSL
                     SDYSVSTSLPAPLDKGRLRLNNETAKLDSLIHKEKISNILLSIPNSTYGCKISFNLEI
                     ELPKAVYINTDLDKCYRRHKLGNRISMPRSKNTLELFKVCTENRAGKTFENYEVEIEL
                     CSKNIATLIKQENNKDLEKEIRKFSNDFLEIKNTCKLKSKK"
     gene            complement(<367129..>369198)
                     /locus_tag="CAGL0D03652g"
                     /db_xref="GeneID:2887124"
     mRNA            complement(<367129..>369198)
                     /locus_tag="CAGL0D03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445574.1"
                     /db_xref="GeneID:2887124"
     CDS             complement(367129..369198)
                     /locus_tag="CAGL0D03652g"
                     /inference="similar to AA sequence:UniProtKB:P35209"
                     /note="similar to uniprot|P35209 Saccharomyces cerevisiae
                     YMR179w SPT21 required for normal transcription at a
                     number of loci"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445574.1"
                     /db_xref="GeneID:2887124"
                     /db_xref="GOA:Q6FW20"
                     /db_xref="UniProtKB/TrEMBL:Q6FW20"
                     /translation="MSADTRMTLKILYSLDNGAAGSYLARSKTPHLVKVLNIPDPNAV
                     PVGRMVTEGDGMAMLRVGAVHISSVLQEIYNNSPEVLSALDSGCGQDYNLYYRDICET
                     DEPLVSLGLLSHIRKTVDSDRKELAGNDADEDLDEDFVVTGRVCSNLSALLRRSYSGM
                     SKKVSSTPQETLEVKLRFTKIYNTASLKPDNEVKVRRVTKEPSLPQPKVVETTPIVNQ
                     PKQVINRNKGRVVTKHVQQMNAPPLGAANVNTNRRQTNPMPAPKAKRTQSLPIWNLKP
                     GGSNNSYLKNSIAHKIYMADRQLDNSSNTTTVSNSVAEHESKPTDDDKVSKRFDFMLS
                     KKKGNSGSKNVTKKSSSNSKKTTEKDNQSQNKSVKKAKAKTTEFRKPSLSINQDFNLP
                     YPNLLGETTPQADLFINNKINDDINDKENIPPHSDSDNYDISSELDMIAFDNMTMKGD
                     MNWLNTYDAFEYQNAHLNLQNSKGFNSTPQDANTCNTVNIENDDDDEISAGTRMDDVN
                     INSDGYRSKSSAYAQTDIDKTSPIDNMSGSAITNLNRNSTDVDKKDKNKMVLNIEVDD
                     DDDDDDNMNANTTSAAAMNSTPIEQSTIRKVSTTRRSISTIQEEDQDEADEDKRMSKK
                     RKTIPSSPSMMFSYHDGSPSSEITNELFTSFINNGIEGEEDNQDTPATICPSSDPAIG
                     QKETPLV"
     gene            <370066..>373626
                     /locus_tag="CAGL0D03674g"
                     /db_xref="GeneID:2887203"
     mRNA            <370066..>373626
                     /locus_tag="CAGL0D03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445575.1"
                     /db_xref="GeneID:2887203"
     CDS             370066..373626
                     /locus_tag="CAGL0D03674g"
                     /note="highly similar to uniprot|Q08972 Saccharomyces
                     cerevisiae YPL226w NEW1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445575.1"
                     /db_xref="GeneID:2887203"
                     /db_xref="GOA:Q6FW19"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FW19"
                     /translation="MPPKKFAKSLDDFLGEQPQDPNLVPSPFGGYFQQKQSNYQKQRT
                     YNKNPNVQKWNQNSNYNYNAQPYNNNQNNYNNYNNYNNYNQSQGFDANGIPINAYKYQ
                     QSAVTPNQSNGPTPSASAVSLTSLTNKLNELDVSPISGHINKLMEAQNITECKAQVAA
                     IADEFKNTSAKSIKDWKFTDVLSKLTKSKSNPLIRESTMLLITALANVFANNSPQEAY
                     LLPFFEFSLDMMADKETTVKRAAQHSLDALMNAFPVDALTSNVLPVILEYLASGAKWQ
                     SKLGALGVIDRIREDSPNDLLELTFKSTVPILTDVATDFKPELAKQGHKTLLDYVSIL
                     DNLDLAPRYELIVNTLQDPNKVPQSVKALSSVTFVAEVTEPALALLVPILNRSLNLSS
                     SSQEQLRQTVIVIENLTRLVNNYIEIESYIPQLLPGVQKVVDTASLPEVRELAEKALK
                     VLKGDDSTSSHNKDSFQGRITEEEGKQYVSDAIKKANITDETKSSFIQDEDVVEYLGK
                     ILTVDTNVNDWKRLEELFTGVFGADNEAVVNTEIIDRMRALFHQEKVKHDEDEGIEIV
                     NTDFSLAYGSRMLLNKTNLRLIKGHRYGLCGRNGAGKSTLMRSIANGQLDGFPDKDTL
                     KTCFVEHKLQGEEGDLDLVSFIALDEQLQTTSRDDIANALASVGFDETRRAQTVGSLS
                     GGWKMKLELARAMLQKADILLLDEPTNHLDVANVKWLEEYLLEHTNITSLIVSHDSGF
                     LDAVCTDIIHYENKKLIYYKGNLAKFVEQKPEAKAYYTLSDTNAQMRFPPPGILTGVK
                     SNTRAVAKVTDVTFTYPGASTPSLSHVSCALSLSSRVAVLGPNGAGKSTLIKLLTGEL
                     VPQEGKVEKHPNLRIGYIAQHALQHVNEHKEKTANQYLQWRYQFGDDREVLLKESRKI
                     SDEEKEMMTKEIDVDDGRGKRAIEAIVGRQKLKKSFQYEIKWKWWKPKYNSWVPRDVL
                     IEHGFEKLVQKFDDHEASREGLGYRELVPSVITKHFEDVGLDAEIANHTPLGSLSGGQ
                     LVKVVIAGAMWNNPHLLVLDEPTNYLDRDSLGALAIAIRDWSGGVVMISHNNEFVGAL
                     CPEQWIVENGTMVQKGVKDVDQSRFEDGGNANAVGLKPSSSVTDDDSPANIKVKQRKK
                     RLTRNEKKAQAERRRLRYIEWLSSPKGTPKPVDTDDEEED"
     gene            complement(<373830..>374657)
                     /locus_tag="CAGL0D03696g"
                     /db_xref="GeneID:2887204"
     mRNA            complement(<373830..>374657)
                     /locus_tag="CAGL0D03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445576.1"
                     /db_xref="GeneID:2887204"
     CDS             complement(373830..374657)
                     /locus_tag="CAGL0D03696g"
                     /inference="similar to AA sequence:UniProtKB:Q03219"
                     /note="similar to uniprot|Q03219 Saccharomyces cerevisiae
                     YMR178w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445576.1"
                     /db_xref="GeneID:2887204"
                     /db_xref="GOA:Q6FW18"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="UniProtKB/TrEMBL:Q6FW18"
                     /translation="MGKISAACVIIGDEILNGKVIDKNSSFFAKFCYDQGIQLNSIVT
                     IGDDEDQIVRTIKELSKRYQFIVTTGGIGPTHDDITYESIAKCFNLQCRIDEETKKRM
                     AMKSNPESRLDPESLKDYYRMATLPSGPDVKKYYVADDLWVPICSINQQVYIFPGIPQ
                     LFSRMLMEFLPTLECIYKLDDDKREYKRYFVKTKLSESELSRHLRNFQEEATVHSNEI
                     KLGSYPHFGMGFNTVSILGEKKDDEYLRGLKDKIIGILNGEEISEEQESKFSNGNRI"
     gene            complement(<375335..>376552)
                     /locus_tag="CAGL0D03718g"
                     /db_xref="GeneID:2887184"
     mRNA            complement(<375335..>376552)
                     /locus_tag="CAGL0D03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445577.1"
                     /db_xref="GeneID:2887184"
     CDS             complement(375335..376552)
                     /locus_tag="CAGL0D03718g"
                     /note="highly similar to uniprot|P38431 Saccharomyces
                     cerevisiae YPR041w TIF5 translation initiation factor
                     eIF5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445577.1"
                     /db_xref="GeneID:2887184"
                     /db_xref="GOA:Q6FW17"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:Q6FW17"
                     /translation="MSINICRDNHDPFYRYKMPPIQAKVEGRGNGIKTAVLNLSDVAR
                     ALNRPPQYLLKYFGFELGAQTSGNVETERYLVNGVHEPAKLQDVLDGFINKFVLCGSC
                     KNPETEIIITKNDDLVRDCKACGKRTPMELRHKLSSFILKNPPNTLAGSKKNKKSATA
                     SANVRGGGVSISDIAQGKSQGGDEDGEGNAGDDDDDALAREINAAASELEQIEVKDDE
                     WAVDMSEEAIRARAKELQVANGAVDTELTKLEEYGEWIINEAGEDKSNLPSDVELYKK
                     AVELDVLSDPKIACVLAQCIFTEDIVNEISEHSAFFTKVFVNADYEKNFLGGIERFLG
                     LEHKELIPTLPKILVQIYNEDVVSEEEIMRFGTKSSKKFVPKDVSKKVRRAAKPFITW
                     LENAESDEESDEE"
     gene            <376920..>377804
                     /locus_tag="CAGL0D03740g"
                     /db_xref="GeneID:2887101"
     mRNA            <376920..>377804
                     /locus_tag="CAGL0D03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445578.1"
                     /db_xref="GeneID:2887101"
     CDS             376920..377804
                     /locus_tag="CAGL0D03740g"
                     /inference="similar to AA sequence:UniProtKB:P38786"
                     /note="similar to uniprot|P38786 Saccharomyces cerevisiae
                     YHR062c RPP1 required for processing of tRNA and 35S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445578.1"
                     /db_xref="GeneID:2887101"
                     /db_xref="GOA:Q6FW16"
                     /db_xref="InterPro:IPR002738"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:Q6FW16"
                     /translation="MLVDLNVCWPQKDFKTPISAQDEANVRATLMTLKTLGYTHVALN
                     FTVSQTEKFPNDARELNPMDINVRFKKLMEATGLKIYSRITLVIDDPSKGQSLAKVSQ
                     AYDIVAALPISEKGLTLATTNLDIDLLTFEYSQRLPMMLKHKTICSCVNRGVKVEIAY
                     GAALRESFVRKQFVSNARSVIRSSRGRGIIISSGAASPSECRNVLGASSIISFLGLKS
                     DSCSRAMGEVPSLVLLNGRLRNKSYKQTVAVGTASNGSNVVESKLEDDSRNIKIVARD
                     ISATAEPDQGPERKKRKI"
     gene            <380418..>381356
                     /locus_tag="CAGL0D03762g"
                     /db_xref="GeneID:2887076"
     mRNA            <380418..>381356
                     /locus_tag="CAGL0D03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445579.1"
                     /db_xref="GeneID:2887076"
     CDS             380418..381356
                     /locus_tag="CAGL0D03762g"
                     /note="weakly similar to uniprot|Q06648 Saccharomyces
                     cerevisiae YDR309c GIC2 CDC42 GTPase-binding protein or
                     uniprot|P38785 Saccharomyces cerevisiae YHR061c GIC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445579.1"
                     /db_xref="GeneID:2887076"
                     /db_xref="GOA:Q6FW15"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:Q6FW15"
                     /translation="MDNTKPATGRKSLPKMNSIWIDEDQEEKLYNIQAQVMLNDDNSN
                     DDLQNIMFLNSKTPLLNNKKNIELPPLDENQGKTGKTPKNAKVNQKTKGNSQEARIST
                     MKLLKLFGSRKETKPLTISTPFDFQHISHANGFSSAAEAREVERHELKRETLQTPRAS
                     IDLTQVALQSPVRLSTKPNYHHSSSSRSSSKFSESPSGSSGIMSNFTVDTSVDEVSVE
                     LLTTENKDDDSVYLNDLKNYNFPSIISQSLDNMQSNSSKENSTSKLTSEDPSPTDIAP
                     SIGKKQRISVDDILRFYSGNSNSRSSTQASIPIKGV"
     gene            complement(<381868..>382356)
                     /locus_tag="CAGL0D03784g"
                     /db_xref="GeneID:2887014"
     mRNA            complement(<381868..>382356)
                     /locus_tag="CAGL0D03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445580.1"
                     /db_xref="GeneID:2887014"
     CDS             complement(381868..382356)
                     /locus_tag="CAGL0D03784g"
                     /inference="similar to AA sequence:UniProtKB:P38784"
                     /note="similar to uniprot|P38784 Saccharomyces cerevisiae
                     YHR060w VMA22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445580.1"
                     /db_xref="GeneID:2887014"
                     /db_xref="UniProtKB/TrEMBL:Q6FW14"
                     /translation="MIQLLQLLADYDALLEQLSKSMHDGFNNISRANYHNKDALRGKY
                     GKDYWDDGYVGQVMAEVMVSGKVDIVAKPKPVNVPAEKVKDKEAEQLRNRKQTKKIAD
                     AEITEETNRTRDYDPILMFGGGLSTPQTLRNAQSNFKGTLPIIVKLLNCKNSINAIIN
                     EN"
     gene            complement(<382689..>383066)
                     /locus_tag="CAGL0D03806g"
                     /db_xref="GeneID:2887227"
     mRNA            complement(<382689..>383066)
                     /locus_tag="CAGL0D03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445581.1"
                     /db_xref="GeneID:2887227"
     CDS             complement(382689..383066)
                     /locus_tag="CAGL0D03806g"
                     /inference="similar to AA sequence:UniProtKB:P38783"
                     /note="similar to uniprot|P38783 Saccharomyces cerevisiae
                     YHR059w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445581.1"
                     /db_xref="GeneID:2887227"
                     /db_xref="GOA:Q6FW13"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR019083"
                     /translation="MLSIFGCVRAVPRVVQMSARRTLKVPAPSQSIPDVEAFLKTIGR
                     DCSELTETFENKWENLFEWDSKTLKSKGVSVQQRRYILHQAQKFRNGEPVKEMKKGKK
                     SFFGGERNRKATVAKWRAEQRNK"
     gene            <383316..>384224
                     /locus_tag="CAGL0D03828g"
                     /db_xref="GeneID:2887259"
     mRNA            <383316..>384224
                     /locus_tag="CAGL0D03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445582.1"
                     /db_xref="GeneID:2887259"
     CDS             383316..384224
                     /locus_tag="CAGL0D03828g"
                     /inference="similar to AA sequence:UniProtKB:P38782"
                     /note="similar to uniprot|P38782 Saccharomyces cerevisiae
                     YHR058c MED6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445582.1"
                     /db_xref="GeneID:2887259"
                     /db_xref="GOA:Q6FW12"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="InterPro:IPR016612"
                     /translation="MDTPLDELQWKSPEWIQAFGLRTDNVLDYFAESPFFDKTANNHV
                     IKMQRQFSQLPNNGAAAGSMNPETMRDAHSEDMGQEQEFSYVDPIRRAILEKYVVHAF
                     LERELMKVRGIEYVLANVREPDFWVIKKQRRTSPTAIEPLQTYYIVGANVYQSPTVFK
                     IVQSRLLACSSHLSATLAELNNLVEFKPSQGVQYKNILDMPVTTRKTGNTANVGSVPG
                     TISASLNMPMVNTGRLNSAGAATIGTSGVPNSAGMTGANTMATGQTGATSRFENGSSR
                     SSTDAISTDTLDKLLITSMKSTPEYI"
     gene            <384689..>387193
                     /locus_tag="CAGL0D03850g"
                     /db_xref="GeneID:2887260"
     mRNA            <384689..>387193
                     /locus_tag="CAGL0D03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445583.1"
                     /db_xref="GeneID:2887260"
     CDS             384689..387193
                     /locus_tag="CAGL0D03850g"
                     /note="weakly similar to uniprot|Q06639 Saccharomyces
                     cerevisiae YDR303c RSC3 or uniprot|P38781 Saccharomyces
                     cerevisiae YHR056c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445583.1"
                     /db_xref="GeneID:2887260"
                     /db_xref="GOA:Q6FW11"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FW11"
                     /translation="MYQAVLTKKVKKPPACQQCRRRKIGCDRGKPICGNCLKQGKTDC
                     FYPKVPGGASADYTSLNGQVGQLPTDFTKAKFTVDKSSKSKQSGYKNSILPGENGSHR
                     RLELELSTVEKLREYQTALQLFNAHNPDSLATSSSYDNYKLGAFRSSNYLNWHEDSAE
                     YDIMTTTMTQEEVIDKEMEYLKDRLAELKSYALDRRLISTKDSELNSSNSKKRSFEEV
                     TQDDNIYDDEDGEFLLRPIFDYQLPQASDTLIVKEVFNALYSPSFLMTLDNVLLQFFG
                     NTLGSFNEEQMAEFKKLKVEKKAGLDVEAVSQSSLIIPSSNTLRNIGDFYFDVAIPSK
                     YFDLLNKNEYDTLIPSSHKSDSAISINGLSIDDIAAVGILSIIALIVFEALLSMNDLS
                     RSQKSLFELLKQNYESLIANLFLVKNELNFKNHSLQSMRVLKFYIFMKFFDSISVSRS
                     IVNANDNDEDIYLARALRINNCSNSSENEEKIHIWNILLRLYQDRKLNKGTIPIYSQD
                     INDNSTNVTDSLLLKNLPFYDAASSLVDYLMIRDARLSSLELAERVNNVEKTIASNKL
                     ECINTPYFLLNDYNCWLLGKTSVLSVQYFQLLGIEAERLLSPAQHFSQMQSIIEHVKD
                     ALLHSLFYNTSGISENFMYLTLSKALTSVESACLITFGILQRCRLQLDSFNDNEEYGE
                     PDNQEELNETKELEETNNHKKEIIRRIVEKLEDVLKKVYCYLVDWATKSEGLNLKAAN
                     LAKKLRIFIKYFLHTPKESFTPDIDWKEYLSERVGEIDIEAYRKLYYLSENLSEKLMN
                     SVVYEGKSKQLIHESGKFNAPLVDESILHDFFEAFF"
     gene            <387624..>388433
                     /locus_tag="CAGL0D03872g"
                     /db_xref="GeneID:2887104"
     mRNA            <387624..>388433
                     /locus_tag="CAGL0D03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445584.1"
                     /db_xref="GeneID:2887104"
     CDS             387624..388433
                     /locus_tag="CAGL0D03872g"
                     /note="some similarities with KLLA0C10230g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445584.1"
                     /db_xref="GeneID:2887104"
                     /db_xref="GOA:Q6FW10"
                     /db_xref="UniProtKB/TrEMBL:Q6FW10"
                     /translation="MSCVKRSFCNGLQRAVQIRRLTGLANSDLTPFLAEQKQGSGSGP
                     FVEIPSIEKVPRSNVLFKLPRNTNLHGELNSVAVLDIAESPDLAQGQDKAKLKVIDQN
                     CKSISKIFSNTNAMNLLVNTTVPTTNIRFFKIEDYKNGIQVNVKSNPSILCYTGEIRR
                     SPVREQGKLRLSNIVGHGLLGIRSSAGPITQIALAAGEDVTIGTNSLITLESTCQVVP
                     ETQLEPAVTSMRNIYQSISVAIKRSYRKYSNRWTEDKITIRGPGNLLIQLK"
     gene            <389509..>390966
                     /locus_tag="CAGL0D03894g"
                     /db_xref="GeneID:2887220"
     mRNA            <389509..>390966
                     /locus_tag="CAGL0D03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445585.1"
                     /db_xref="GeneID:2887220"
     CDS             389509..390966
                     /locus_tag="CAGL0D03894g"
                     /inference="similar to AA sequence:UniProtKB:P32264"
                     /note="similar to uniprot|P32264 Saccharomyces cerevisiae
                     YDR300c PRO1 or uniprot|P38690 Saccharomyces cerevisiae
                     YHR033w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445585.1"
                     /db_xref="GeneID:2887220"
                     /db_xref="GOA:Q6FW09"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:Q6FW09"
                     /translation="MSQTIVIKLGTSSLVDEKTREPKLSIMTQVVETVIQLKRQGHKV
                     VIVSSGGIAVGLNAMEMDKKPTDLAEIQAIAAIGQGRLIGRWSMLFQQYGEKIAQILI
                     TRNDILGWTQYKNAQNTILQLLEMGVVPIVNENDTLSISEIKFGDNDTLSAITAALVS
                     ADHLFLLTDVDCLYTENPRTNPDAKPIVIVPNMDQGVPGVDTSNADAGSSVGTGGMRT
                     KLIAADLATNAGVNTIIMKSDAPSNVKHIVDYLVKYPKKVLYDDNKSSREQSSEPLSL
                     DQLKNHPYGKGGVISPPKSEEDLLSLQDAELKEIKERNVPLHTVFLAKDIDHHLKNRE
                     FWILHGLVTKGVLIIDEDAYNTLTNESGDEEHVSEAYVSEVEDDEMSEVDQDHGLLPK
                     DVIEVKGSFHELECVDIKVGKRLPNGKLDPDAPLEYVGRARCNFTSVELNRIKGLPVD
                     RVQDVLGYDVSEYVAHKDNLAFPPSASSVSLQLKT"
     gene            complement(<391089..>392123)
                     /locus_tag="CAGL0D03916g"
                     /db_xref="GeneID:2887147"
     mRNA            complement(<391089..>392123)
                     /locus_tag="CAGL0D03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445586.1"
                     /db_xref="GeneID:2887147"
     CDS             complement(391089..392123)
                     /locus_tag="CAGL0D03916g"
                     /inference="similar to AA sequence:UniProtKB:P38768"
                     /note="similar to uniprot|P38768 Saccharomyces cerevisiae
                     YHR034c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445586.1"
                     /db_xref="GeneID:2887147"
                     /db_xref="GOA:Q6FW08"
                     /db_xref="InterPro:IPR012981"
                     /db_xref="UniProtKB/TrEMBL:Q6FW08"
                     /translation="MDFLLRPIASGDDNQVTVLHPEPLFVIKSKIVNIDNRPKKLLKL
                     EAGSKIFVNLCHDPQAPKPEIPFDPNIVYPLIINNKWEIPIVASSIRTDTDKKGQVCY
                     VIDCCVASDCVKWFVEDYQLKEIVVEWCLEAAELREVIEISRDKISFPKMRKKGDSIP
                     DLEIFSNELDGSDIKEATQNDKGNDPSSLLQIRRDLLSQEEDLSLSNDSDITAHGLPP
                     LFPKANETKGRSLIQEIDDLTLKEKPKNAAKKVQKNIEYNVVMKKIENHKYKLRLDIQ
                     IDSITGKSDLNIFYDPTNNDIVLRNLNTDLYDQKDFKIPLPNIFEGKDIMNSSEIFYV
                     NKTGTLTIFL"
     gene            <392433..>394304
                     /locus_tag="CAGL0D03938g"
                     /db_xref="GeneID:2887122"
     mRNA            <392433..>394304
                     /locus_tag="CAGL0D03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445587.1"
                     /db_xref="GeneID:2887122"
     CDS             392433..394304
                     /locus_tag="CAGL0D03938g"
                     /note="weakly similar to uniprot|P38769 Saccharomyces
                     cerevisiae YHR035w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445587.1"
                     /db_xref="GeneID:2887122"
                     /db_xref="GOA:Q6FW07"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="UniProtKB/TrEMBL:Q6FW07"
                     /translation="MQLQCAQAAVTESSHLRDIDNNENVLYSIFEPFLPEQDDNMVDG
                     DSSVCSVCGCHIYEKEVCHICDSVRLGDMNGYTLRTGDARVPLEGRVIVIDTICEEIE
                     FLALKTKLVDFLSQIDPVPSLLISLHADGTIKIHGSEKIASIYVEHLRVKYAFKRHDK
                     KYFMKLIDGIEIMNSYNEHVIAHIKALRNSVYTHNRKKRAKRATGCALFLANLLCKSD
                     KLHYEVLSFLSGPCTLGNGKVISREVKNTIRQFTDLDQQKAKYFDDARSFYKYLAADS
                     KSVAYGFYINCLDQIGIYEMSPLIKQSGIIYQFDSFQDTDLHDAFDKYKFFKKSNAIY
                     DVKINVVTSPGIQWQKNHDVPLNWSMIFNKTSISIPIRLKIQDFTKKFYNIQATLEYT
                     LGPNRYKYVKNAVIHGKDNIAKNIMFHNVLLASITKEIAWETLNEKYYSSQTCTKYRE
                     VILKRIAPRFKHNMDVLHYIYNLLRSNLLTTRNMSPDERVIAAHEIAYSTMEKIVLMI
                     KPKILLAREADIEPQEVEITAELYADRHSMLGVDAGNLFLLRKSDDIDNNELRETIER
                     WFRKRDTYSVTIIPLIEVVPGSGQDRFFKYKLIPMVSQQASAVHSEDTSFEEFVRQL"
     gene            <394925..>396421
                     /locus_tag="CAGL0D03960g"
                     /db_xref="GeneID:2887108"
     mRNA            <394925..>396421
                     /locus_tag="CAGL0D03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445588.1"
                     /db_xref="GeneID:2887108"
     CDS             394925..396421
                     /locus_tag="CAGL0D03960g"
                     /inference="similar to AA sequence:UniProtKB:P38770"
                     /note="similar to uniprot|P38770 Saccharomyces cerevisiae
                     YHR036w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445588.1"
                     /db_xref="GeneID:2887108"
                     /db_xref="GOA:Q6FW06"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:Q6FW06"
                     /translation="MDDFVSLSIQDEYDKSTKNEDLIGISNLCISEGSKLPQQLICKF
                     MPHVPVSPSPLRNAFHVEMLQEDMEIDEEGINVPPEDQVAPLSDNTRGSSPNSVFEEQ
                     RGASNGTAVESETEKEIEQGINAIGKISLGSTKDDDDLLDDSEVTEKGDESGDWSDIN
                     EEQSIDKKSVIKALLSPTTLGIAAATKHDPTLRPSLINAEMEKRTKVTEEPEIETIDK
                     ENMLEVNGVVDRSATEYIKQELRSRAKRNEPIHVSINTHNHYYPTPQQYMDNGISNSK
                     QYEFVGKDINIHQAALLHDELQQKKLYSLPDPWSPQSQPASRHWYAITSYLQYFLNVV
                     TLGILCAIFITLVHAFKADVQAIWHQHKVTFEQESLDCKRNFYENKCDRDTPLPALID
                     QCHTWSKCMSRDNDKLFTARISLVARILGSILNSFIEPLGWKALLVLFIGCTIWCFST
                     NFLLGFARARSYYGHNLEDRIKKLELTRYYNQDHSEPLQHSKLITYNK"
     gene            <397039..>398763
                     /locus_tag="CAGL0D03982g"
                     /db_xref="GeneID:2887218"
     mRNA            <397039..>398763
                     /locus_tag="CAGL0D03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445589.1"
                     /db_xref="GeneID:2887218"
     CDS             397039..398763
                     /locus_tag="CAGL0D03982g"
                     /note="highly similar to uniprot|P07275 Saccharomyces
                     cerevisiae YHR037w PUT2 1-pyrroline-5-carboxylate
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445589.1"
                     /db_xref="GeneID:2887218"
                     /db_xref="GOA:Q6FW05"
                     /db_xref="InterPro:IPR005931"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:Q6FW05"
                     /translation="MLSARLYRGSVRGVAQFARASIPKHVTNEAVKPFSKDADSKDWD
                     LLRASLMKFKSSSLEVPLVINGERVYADRGRAVFAQTNPANHEQVLANVAQATRDDIK
                     SAIGAAKQAKEKWYNMPFYDRAAIFMKAADLISTKYRYDMLAATMLGQGKNVYQAEID
                     CITELSDFFRFNVKYADELYATQPIESVPGIWNRAEYRPLEGFVYAVSPFNFTAIAAN
                     LIGAPALMGNTVVWKPSQTAALSNYLLLTVLEEAGLPKGVINFVPGDPVEITDEVLAS
                     RDFSALHFTGSTAVFKQLYGKIQSGVAENKYRDYPRIVGETGGKNYHLVHPSANVPHA
                     VFNTIRGAFEFQGQKCSATSRLYLPKSMSEEFFRDMFGTLSNNKVVPVNTSASAISGG
                     NLHGFMGPVIHEQSFNKLSAAIEEAKKDPELEILYGGQYDKSQGWYIGPTIIRTTNPN
                     HKFLTTEFFGPILTVYEYQDSQFKDICELINETGEYGLTGSIFSRDRDAIIYASEKLR
                     FSAGNFYINDKCTGAVVAQQWFGGARMSGTNDKAGGPSILSRFVSIRSIKENMQEITD
                     FRYPSNYE"
     gene            <399319..>400203
                     /locus_tag="CAGL0D04004g"
                     /db_xref="GeneID:2887219"
     mRNA            <399319..>400203
                     /locus_tag="CAGL0D04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445590.1"
                     /db_xref="GeneID:2887219"
     CDS             399319..400203
                     /locus_tag="CAGL0D04004g"
                     /inference="similar to AA sequence:UniProtKB:P53210"
                     /note="similar to uniprot|P53210 Saccharomyces cerevisiae
                     YGR017w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445590.1"
                     /db_xref="GeneID:2887219"
                     /db_xref="GOA:Q6FW04"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR024624"
                     /db_xref="UniProtKB/TrEMBL:Q6FW04"
                     /translation="MAPNSHMAPWVPMFTQSCKNAKQAFIPFQFATVAESVDGIPLPK
                     CRTVVFRDFLFDERKTNVLTFNTDLRSNKVEESFPNGNGTCLFEACFYFHETWEQYRF
                     TGECFLVSRKQQAIVSNETLLRYGIVDPTTFKRSESNSSVSSCSSSDEGSLPAMVDSL
                     KLDDSKYDNHHDDGEEDIHNTDDGKVPLPTDEEWQQEIMRQWDTLSRATKSVYKKPAP
                     GEPITEEMKKKIDKIERGVDGSKADYGLDNFAIVCLCIDKVDYLNLKGGKGGARWIFE
                     RVIDETGFETWEEQEVCP"
     gene            <401513..>402928
                     /locus_tag="CAGL0D04026g"
                     /db_xref="GeneID:2887071"
     mRNA            <401513..>402928
                     /locus_tag="CAGL0D04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445591.1"
                     /db_xref="GeneID:2887071"
     CDS             401513..402928
                     /locus_tag="CAGL0D04026g"
                     /note="highly similar to uniprot|P17649 Saccharomyces
                     cerevisiae YGR019w UGA1 4-aminobutyrate aminotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445591.1"
                     /db_xref="GeneID:2887071"
                     /db_xref="GOA:Q6FW03"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FW03"
                     /translation="MPSPAEQYYPSEPKAPIIKTPEVPGPESKKRLAELNDLYDCRPA
                     AFMADYEKSIGNYITDVDGNVMLDVYAQIASIALGYNNPALIEATKTPEMIRALVDRP
                     SLCSFPPTDLEKSLNQLLKFAPKGQNRIWCGLSGTDANELAFKAAFIYYKSMQRGYDA
                     EFTAEEEESVMNNEEPGAPHLSILSFKKAFHGRLFAAASVTNSKAVHKLDFPQFHWPH
                     AEFPDYKYPLHEHEEENRKEDERCLANAEKIINTWETPIAAVIIEPVQAEGGDNHASK
                     YLLQGLRDLTLKYGIVYIIDEVQTGVGATGKLWCHEHADIQPPPDIVTFAKKFQTCGY
                     FFHEPKIVPNKPSRQFNTWCGDPARMLIGGAIGQEITDKKLVEQCSRVGDYLFGKLEE
                     LQKQYPKKLLRLRGKNRGTFIAWDLETGEERDAFLKKMRANGVNIGGCANSTVRLRPT
                     LTFEEKHADILIDVLKKVLQE"
     gene            complement(<403135..>403491)
                     /locus_tag="CAGL0D04048g"
                     /db_xref="GeneID:2887236"
     mRNA            complement(<403135..>403491)
                     /locus_tag="CAGL0D04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445592.1"
                     /db_xref="GeneID:2887236"
     CDS             complement(403135..403491)
                     /locus_tag="CAGL0D04048g"
                     /note="highly similar to uniprot|P39111 Saccharomyces
                     cerevisiae YGR020c VMA7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445592.1"
                     /db_xref="GeneID:2887236"
                     /db_xref="GOA:Q6FW02"
                     /db_xref="InterPro:IPR005772"
                     /db_xref="InterPro:IPR008218"
                     /db_xref="UniProtKB/TrEMBL:Q6FW02"
                     /translation="MADKRTLLAVIADEDTTTGLLLAGVGQITPDTQEKNFFVFQEGK
                     TTREEVGEMFDKFTEERNDIAILLINQHIAELIRSRVDSYTKPFPAILEIPSKDHPYD
                     PEKDSVLKRVRKLFGE"
     gene            <403855..>404727
                     /locus_tag="CAGL0D04070g"
                     /db_xref="GeneID:2887201"
     mRNA            <403855..>404727
                     /locus_tag="CAGL0D04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445593.1"
                     /db_xref="GeneID:2887201"
     CDS             403855..404727
                     /locus_tag="CAGL0D04070g"
                     /inference="similar to AA sequence:UniProtKB:P53212"
                     /note="similar to uniprot|P53212 Saccharomyces cerevisiae
                     YGR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445593.1"
                     /db_xref="GeneID:2887201"
                     /db_xref="GOA:Q6FW01"
                     /db_xref="InterPro:IPR002876"
                     /db_xref="InterPro:IPR017856"
                     /db_xref="InterPro:IPR026563"
                     /db_xref="InterPro:IPR026564"
                     /db_xref="InterPro:IPR029072"
                     /db_xref="UniProtKB/TrEMBL:Q6FW01"
                     /translation="MLRCSTSRVLSVLESPCASRLPTRTFSHARVMLSGHNKWSTIKH
                     DKAKNDAEKNKLINKFASQVTIAVKSGGSGDPAMNIRLQSAIDLAFKNNVPKKVIEGA
                     INRGLGIGGEKNSSEVCVYEGIGPGGVAYVVECLTDNKNRSIALVRSAFNKIGGSMTP
                     TLYFFERKGYLVVESPKELTSEDDVLDAVLEIDGVEDIKLVEEEESNVSDTDEEPGAK
                     YDVITEVQMNNKAANAFKEKGFKIHEMGLEYIPNPDTTVQVTDEEVLAKIEKLTNTLE
                     ELDDVTSVYTNISE"
     gene            <405613..>406368
                     /locus_tag="CAGL0D04092g"
                     /db_xref="GeneID:2887021"
     mRNA            <405613..>406368
                     /locus_tag="CAGL0D04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445594.1"
                     /db_xref="GeneID:2887021"
     CDS             405613..406368
                     /locus_tag="CAGL0D04092g"
                     /inference="similar to AA sequence:UniProtKB:P38773"
                     /note="similar to uniprot|P38773 Saccharomyces cerevisiae
                     YHR043c DOG2 2-deoxyglucose-6-phosphate phosphatase or
                     uniprot|P38774 Saccharomyces cerevisiae YHR044c DOG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445594.1"
                     /db_xref="GeneID:2887021"
                     /db_xref="GOA:Q6FW00"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FW00"
                     /translation="MTVKKDNQFSVDVCLFDLDGTIVSTTVAAESAWRMLCAKEGVDP
                     EELFKFSHGVRTSEVLAKFFPNIDNTDNKMTRELELSMANNFLDTVSLIPGAKDLLLT
                     LDKDTARQGAKFNERKWAIVTSGSPDLAFSWFKTILKEVGKPDVFITAFDVTKGKPDP
                     EGYAKAKKLLCERLQYESASATSVVFEDAPAGIKAGKAMGAITVGITSTYDLQTLIDA
                     GADYVVKDLTQVEVLKNTEGDQITLEIENPLNQ"
     gene            complement(<406872..>408935)
                     /locus_tag="CAGL0D04114g"
                     /db_xref="GeneID:2887077"
     mRNA            complement(<406872..>408935)
                     /locus_tag="CAGL0D04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445595.1"
                     /db_xref="GeneID:2887077"
     CDS             complement(406872..408935)
                     /locus_tag="CAGL0D04114g"
                     /note="highly similar to uniprot|P16603 Saccharomyces
                     cerevisiae YHR042w NCP1 NADPH-cytochrome P450 reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445595.1"
                     /db_xref="GeneID:2887077"
                     /db_xref="GOA:Q6FVZ9"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR023208"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ9"
                     /translation="MDKTDLLVLIGLTLVVVLYLKRETIKSFISELLFAEEDSATTVS
                     TSSRDIAEVVNEHGKNYVVFYASQTGTAEDYAKKFAKELTAKFGLNVMCADVEYFDFE
                     TLNDLPDGCVVSFFVSTYGEGDFPDGAVHLEDFLSNCGTTDLENVNFTIFGLGNCTYE
                     FFNGASRKCNKYLLEAGAKQIGAAGEGDDGSGSTDEDYLAWKDAILEELKSKLKLDER
                     QEKFVPSFKLETLETVTEKTSLGEPSLQYLPANKLSFNDEGVQLGPFDLSQPYVAPVA
                     KSYELFKSGDRNCIHSEIDVSGSNIKYTTGDHLAIWPSNANEKVEQFLQLFNLKGDTI
                     FNLKPLDSTIKVPFPCPTTIEATVRHYLEITGPVSRQSFGSLIQFAPNEEIKQKLTAL
                     AKDKDLFAKEITAKCYNLADALLYVSNGQPWSTVPWEFLIEAMAHIQPRYYSISSSSL
                     SEKQTIHITSVVENSPNPVDPSLPPVVGVATNLLRNVQLAKNNEDTSSMPVHYDLNGP
                     RNLFQGYKLPVHVRRSTFRLPTNPSTPVIMIGPGTGVAPFRGFVRERVKFVEQQENVQ
                     LGKHLLFYGSRNTDDYLYREEWPEYAKKLGASFEMIVGHSRIPGQPKVYVQDKIREHA
                     QEVLKLIHEGAFLYICGDAKNMAQGVNAALVDILSEDKKITKEEASEMIKMLKTTGRF
                     QEDVW"
     gene            <409387..>410097
                     /locus_tag="CAGL0D04136g"
                     /db_xref="GeneID:2887190"
     mRNA            join(<409387..409397,409461..>410097)
                     /locus_tag="CAGL0D04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445596.2"
                     /db_xref="GeneID:2887190"
     CDS             join(409387..409397,409461..410097)
                     /locus_tag="CAGL0D04136g"
                     /inference="similar to AA sequence:UniProtKB:P34162"
                     /note="similar to uniprot|P34162 Saccharomyces cerevisiae
                     YHR041c SRB2 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445596.2"
                     /db_xref="GeneID:2887190"
                     /db_xref="GOA:Q6FVZ8"
                     /db_xref="InterPro:IPR013921"
                     /translation="MSSAVIFVESATPGTLTEFKDLLAKQLLEVRETWSLEFRTYRTL
                     VKDFPSREKLLYSLTFPHHDKKTVLIRNSLAWVLGTAEIPDNLQTCSTGLSESIDQLL
                     ASKLSNMWAQRQVIRGDAGQTLLITGDVTVRIINLFAATGFKGLLIELDNLQSATSLA
                     NITDLLNEMKVKVFKVASAPGLKSEDVEVVDSSSTMESGNEALFTLAKQYIEVLE"
     gene            complement(<410309..>411127)
                     /locus_tag="CAGL0D04158g"
                     /db_xref="GeneID:2887191"
     mRNA            complement(<410309..>411127)
                     /locus_tag="CAGL0D04158g"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_445597.1"
                     /db_xref="GeneID:2887191"
     CDS             complement(410309..411127)
                     /locus_tag="CAGL0D04158g"
                     /inference="similar to AA sequence:UniProtKB:P40496"
                     /note="similar to uniprot|P40496 Saccharomyces cerevisiae
                     YIL093c RSM25"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_445597.1"
                     /db_xref="GeneID:2887191"
                     /db_xref="GOA:Q6FVZ7"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="InterPro:IPR019520"
                     /translation="MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTR
                     EPHKINPSTDKKVSELKDPDLESVNRNGLYKTRFNALERKVANKQIYKPPKLVYLEDK
                     IRTLFYKQHPWELARPKIVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQ
                     SNITDAYDQARLEFYRLRMQQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKW
                     KRDAELQSELLSAKKENASKAAGDASAVSSEKQVEDDVVNFDESTDADQEVLHF"
     gene            complement(<411498..>413600)
                     /locus_tag="CAGL0D04180g"
                     /db_xref="GeneID:2887158"
     mRNA            complement(<411498..>413600)
                     /locus_tag="CAGL0D04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445598.1"
                     /db_xref="GeneID:2887158"
     CDS             complement(411498..413600)
                     /locus_tag="CAGL0D04180g"
                     /inference="similar to AA sequence:UniProtKB:P40498"
                     /note="similar to uniprot|P40498 Saccharomyces cerevisiae
                     YIL091c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445598.1"
                     /db_xref="GeneID:2887158"
                     /db_xref="GOA:Q6FVZ6"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /translation="MDKRGRKELRSIRRAKRTKIEPEADAGVESSGSVLEAGPAVEEK
                     VQDDGEKEDDKEQVYNALLTILKSEHKEDKVKTHRDHDEEESEAEEEEQAEDQYNDAF
                     ADGESDDEDDDEDEQAQEQEEIESDDEEKDPFDTHFNGEEAAKHGEALGNALKDNKLR
                     YKSIKLKVGSADEDQVQEDAIFSVPYIEGETPKIEDPKLKCSLSSYFLKKRLRIQNNL
                     LDTESNALTDLQRKIVDPMMQYKDILYEYDTYGKDEDEYRDLYTLHVLNHVYKTRDKI
                     IKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDSAYQIVTKLIEKSGLDQVDKKGKFR
                     DQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFTRKAIKLYSNFYQSDIIVCSPLG
                     LQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYTHLFTIFDHLNKIPQEQHDAD
                     FSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRNLEGRWKNHKIVSSEDSSV
                     GTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITKSTGYDDGTLIYIPEYS
                     DYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVLLYTERLHHFRRYEL
                     KGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYSKLDGLALEKIVG
                     TKRTGVLTHGQNETYEFK"
     gene            <414049..>415548
                     /locus_tag="CAGL0D04202g"
                     /db_xref="GeneID:2887154"
     mRNA            <414049..>415548
                     /locus_tag="CAGL0D04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445599.1"
                     /db_xref="GeneID:2887154"
     CDS             414049..415548
                     /locus_tag="CAGL0D04202g"
                     /inference="similar to AA sequence:UniProtKB:P40499"
                     /note="similar to uniprot|P40499 Saccharomyces cerevisiae
                     YIL090w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445599.1"
                     /db_xref="GeneID:2887154"
                     /db_xref="GOA:Q6FVZ5"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ5"
                     /translation="MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFT
                     VTLFNLYLISTTLSVLARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNR
                     FLSPVGSYQELDPDGSFLDLLKHRILMATTAENSKNWTLYYYYFKFIVQPWQWLLSYS
                     TPFFTLLEGFFTILAIQAIGETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIY
                     VTPIWKLTIQSASLLGFVLSIVFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKL
                     ATRATEEILDLVKDVWQTHQRNLLNRDNLLAYYHNVVLKNAEMVWESFILPRSRSLNA
                     MEKIRFWLDVTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVNLCFRILIF
                     YSATRIIPALQRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELKRELCLW
                     GCTSNWFGSKDQPRIVTDSWSFWNWCNIFWTVLVYANELIGTQAPNELT"
     gene            complement(416568..416641)
                     /locus_tag="CAGL0D04224r"
                     /db_xref="GeneID:2887153"
     tRNA            complement(416568..416641)
                     /locus_tag="CAGL0D04224r"
                     /product="tRNA-Val"
                     /note="tRNA Val (AAC) cove score=68.42"
                     /db_xref="GeneID:2887153"
     gene            complement(<417103..>417753)
                     /locus_tag="CAGL0D04246g"
                     /db_xref="GeneID:2887081"
     mRNA            complement(<417103..>417753)
                     /locus_tag="CAGL0D04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445600.1"
                     /db_xref="GeneID:2887081"
     CDS             complement(417103..417753)
                     /locus_tag="CAGL0D04246g"
                     /inference="similar to AA sequence:UniProtKB:Q04272"
                     /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
                     YMR077c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445600.1"
                     /db_xref="GeneID:2887081"
                     /db_xref="GOA:Q6FVZ4"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ4"
                     /translation="MGQKPSKVHITETDKAILQLKRSKDEIHKYTKKSDRLIAIEKDR
                     LKQLIHDNPKTYKKDTKVRFLLKKIHYQEHLLQQASDQLINLENMVSTLEFKMVEKEF
                     VSGLQTGNEILKKLNAEFKDVDKLMDDVQDQIEYQAEVDNALANSVVGTNTFEDELDR
                     ELDQLDKEVNGLPELPTTEGLPAFDNRQKEKNEVERINNPQQNTEIQSKKEEALPA"
     gene            complement(<418104..>420269)
                     /locus_tag="CAGL0D04268g"
                     /db_xref="GeneID:2887082"
     mRNA            complement(<418104..>420269)
                     /locus_tag="CAGL0D04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445601.1"
                     /db_xref="GeneID:2887082"
     CDS             complement(418104..420269)
                     /locus_tag="CAGL0D04268g"
                     /inference="similar to AA sequence:UniProtKB:P49956"
                     /note="similar to uniprot|P49956 Saccharomyces cerevisiae
                     YMR078c CHL12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445601.1"
                     /db_xref="GeneID:2887082"
                     /db_xref="GOA:Q6FVZ3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ3"
                     /translation="MDGAPNFSGFGGSVLFGDEGEKLVFNGCKGGSVVLEKRASANAT
                     ATTSASATTTYNGAVWQAEDGYGINIAHLIDRIEARSDDSNGETAPAETVSGQRSPDC
                     TLWVEKWRPKKFMDLVGNEKNNRRILKWLRQWNFAVFKEQLPQPDQSKEQENFDPFER
                     PMKRILMLNGPPGIGKTSVAHVVAKQAGFSVAEINASDERAGTLVRDKVHNTLFNHSF
                     TGEPVCLIADEIDGSVESGFVKVLIDIVNADKRATDNYVLKKNARGKNNGKSNRYRPK
                     LLLRPIIVICNNLYAPALEKLRPLCEIITLRKPSDNSVRERLTHICMKERINLGMKTI
                     NELIDISEGDIRNCVNNLQFQSKGNHKTSNNDNVSEDTLGLKDISLSWFKIVNQIFRK
                     DPHLDNKRQFIRLARKIEKVDNYDRVVTGCHTLFPHVKYSDSGLRKPAAMADWLYFHE
                     QMFKSMFEHNGELLRYCAIVPMVFHQKFGDISNKDDQRIKNADYEQREARKAVESITE
                     SIMKKLSTFSPLLASNMNKKDLGFEILPYLDSMIASDISKIKDAKKKQAVLNNIINLI
                     DLFQLELLETRGEHYTSRGVLMIEPPIDKVVLIDEMKKNEVTTKRAANLNLILAKQEE
                     IKVRKRHLNQVEANKGKSTVEETTSKRQKISIENFSKANNDKTVDMLKSQYTAIQQNT
                     TDQNKSTNNESEEVKIWIKYKEGFSDAVRKKVTWETLWS"
     gene            <420985..>421893
                     /locus_tag="CAGL0D04290g"
                     /db_xref="GeneID:2887243"
     mRNA            <420985..>421893
                     /locus_tag="CAGL0D04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445602.2"
                     /db_xref="GeneID:2887243"
     CDS             420985..421893
                     /locus_tag="CAGL0D04290g"
                     /inference="similar to AA sequence:UniProtKB:P24280"
                     /note="similar to uniprot|P24280 Saccharomyces cerevisiae
                     YMR079w SEC14 phosphatidylinositol phosphatidylcholine
                     transfer protein or uniprot|P33324 Saccharomyces
                     cerevisiae YKL091c SFH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445602.2"
                     /db_xref="GeneID:2887243"
                     /db_xref="GOA:P53989"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /translation="MVSEAEFLASYPQKCPAGSLPGTPGNTDEAQEGALKQLRSELEA
                     AGFKERLDDSTLLRFLRARKFDVALAKEMFENCEKWRKEYGTNTIMQDFHYDEKPLVA
                     KYYPQYYHKTDKDGRPVYFEELGAVNLTEMEKITTQERMLKNLVWEYESVVNYRLPAC
                     SRAAGYLVETSCTVMDLKGISISSAYSVLSYVREASYISQNYYPERMGKFYLINAPFG
                     FSTAFRLFKPFLDPVTVSKIFILGSSYQSELLKQIPAENLPSKFGGKSEVDEAAGGLY
                     LSDIGPWRDAKYIGPEGEAPEMFSMK"
     gene            complement(<422482..>425376)
                     /locus_tag="CAGL0D04312g"
                     /db_xref="GeneID:2887092"
     mRNA            complement(<422482..>425376)
                     /locus_tag="CAGL0D04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445603.1"
                     /db_xref="GeneID:2887092"
     CDS             complement(422482..425376)
                     /locus_tag="CAGL0D04312g"
                     /inference="similar to AA sequence:UniProtKB:P30771"
                     /note="similar to uniprot|P30771 Saccharomyces cerevisiae
                     YMR080c NAM7 nonsense-mediated mRNA decay protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445603.1"
                     /db_xref="GeneID:2887092"
                     /db_xref="GOA:Q6FVZ1"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ1"
                     /translation="MNFPAESNDPELAILADLEDAEELEFMQEVQGNLQVEPVERQAE
                     GHACAYCGIDAPTSVIKCNSCSKWFCNSKNGTVNSHIINHLILSHHHSVSLHPESDLG
                     DTVLECYNCGCKNVFVLGFVSAKSEAVVVLLCRIPCAQSKNPNWDTDQWQPLIEEKQF
                     LSWVAEPASDEEIKLKAKLITPSQISKLENKWRSDKYATMDDVQDESKKVQDDILAGI
                     GEEEDIPPLLLRYQDAYEYQRSYGPLIKLEADYDKQLKESQALEHISVEWSLALNNRH
                     LASFALSTFESSELKVAVGDEMILSYSGIQGEDWKGTGFIVRLPNSFKDMFTLELRPS
                     KTPPPTHLTTGFTAEFIWKATSYDRMQTALKNFAVDKKSISGYLYYKILGHQVVDLHF
                     DVPMPKELSLPGYTKLNASQSKAVEHVLQRPLSLIQGPPGTGKTVTSASIVYHLSKIR
                     KDRILVCAPSNIAVDHLAAKLRDLGLKVVRVTAKSREDVESSVSSLALHNLVAKGAKG
                     VLKKLLKLKEEAGELSARDTKRFISLVKKTEKSILEQADVVCCTCVGAGDRRLDMKFR
                     TVLIDESTQASEPECLIPIVKGAKQVILVGDHQQLGPVILERKASDAGLKQSLFERLI
                     SLGHIPIRLEVQYRMNPFLSEFPSNMFYEGSLQNGVTEEQRTLANSTFPWPINGIPMM
                     FWANYGSEEMSANGTSYLNRTEAMNCERIITRLFRDGVKPEQIGVITPYEGQRAYVLQ
                     YMQMNGALDKELYSNVEVASVDAFQGREKDFIILSCVRANEQQMIGFLRDPRRLNVGL
                     TRAKYGLIILGNPRSLSRNTLWNHLLLHFRQKGCLVEGVLENLQVCTVPLTRPNVKKN
                     RSTDYNYNFGVEMGDLPNTNDMDTQSLLSFGGQAGNFSNLFSNDSEFNNYLNNEYWNY
                     TRNGKNAKPSAQNFESNTYSNEGPTLNSNYAQELAREQESVRNTLQSLEF"
     gene            425740..425811
                     /locus_tag="CAGL0D04334r"
                     /db_xref="GeneID:2887016"
     tRNA            425740..425811
                     /locus_tag="CAGL0D04334r"
                     /product="tRNA-Glu"
                     /note="tRNA Glu (CTC) cove score=61.61"
                     /db_xref="GeneID:2887016"
     gene            <426132..>427307
                     /locus_tag="CAGL0D04356g"
                     /db_xref="GeneID:2886978"
     mRNA            <426132..>427307
                     /locus_tag="CAGL0D04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445604.1"
                     /db_xref="GeneID:2886978"
     CDS             426132..427307
                     /locus_tag="CAGL0D04356g"
                     /note="highly similar to uniprot|P48015 Saccharomyces
                     cerevisiae YDR019c GCV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445604.1"
                     /db_xref="GeneID:2886978"
                     /db_xref="GOA:Q6FVZ0"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:Q6FVZ0"
                     /translation="MSLVLKRFNSTALKKTALHDLHVSLGGTMVEFAGYSMPVLYKGQ
                     THIESHLWTRQNAGLFDVSHMLQSRLTGAEATKLLHSVTPTDFANLPQGTGSLSVLLN
                     EHGGVVDDTIITKEQDNQYYIVTNAGCVDRDTEFLKGEVSKLDCSWDIIQGRSLLALQ
                     GPKAQQVLERLVTRDSKLNELYFGERKEFTLDDATATRIGVARGGYTGEDGFEISVEN
                     GKANEFAQKLLDNELTKPIGLAARDSLRLEAGMCLYGHELTESITPVEAGLAWVISKS
                     RRDAGSEDQFNGYSKIIDQLKNKTHEIIRIAYKYKGKGPAARPGAKIFLEDGETQIGE
                     VTSGSAAPSLNNINIGQGYVKRAHNKKGKTVLIQVRNKFYPAELAKMPLVQTHYHKA"
     gene            <427971..>431132
                     /locus_tag="CAGL0D04378g"
                     /db_xref="GeneID:2886979"
     mRNA            <427971..>431132
                     /locus_tag="CAGL0D04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445605.1"
                     /db_xref="GeneID:2886979"
     CDS             427971..431132
                     /locus_tag="CAGL0D04378g"
                     /inference="similar to AA sequence:UniProtKB:Q12494"
                     /note="similar to uniprot|Q12494 Saccharomyces cerevisiae
                     YDR017c KCS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445605.1"
                     /db_xref="GeneID:2886979"
                     /db_xref="GOA:Q6FVY9"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY9"
                     /translation="MPSHDGTRAKTKLRSKSRSQTHEYETEPFVHGSLEDEETVKNLK
                     DLNISNKQKLSPVMHGRKASTYLRIFQDDDEPVINNEKAGRHRGSRHHHKRLSGTLDE
                     SDGNIPNIYRNIEGKQRRNSKNYGGHSPMGRRNSAYNQQRKPTKESLQNLALSNRTSP
                     QSPPSNRNKIALDNGKGTRYSYRRSSSSSKERPHEIPKHASRDWSNFNVNIATTRVGN
                     IHNYAQMDSSPGSKMLSSGNDQDLPLTDDLMLKPVSSATYYPHKSKEKKKLSDEFTSN
                     KHNRTDRQSDEFGNKGNEKNQSTNTEEKLEYDISPNSDIIDIVAPISSDSFDNQLLEN
                     IPKVKHSPVDIEQNNVVTDESDIEDEDNDREYPLAVELKPFTNNVGGHTAIFRFSKRA
                     VCKALVNRENKFYENIEINHQELLPFMPRYIGVLNVRQHFYSHDDEMINNISKENEKI
                     NDDDEQIKTTPIKQKIPSNDSEQIGSALTHIHSFPIERQQRSISCKDYMSSQQQLPEV
                     VLNDNRHIIPDSLWGRYSHSPNSLPDNSPSSYLSSHSFDEKKFERALENRDREGERDA
                     GYTVINTELKNSVLEEVFAPICYRRHQKQRSQIQFKIPPGHSPSNSLQESRFPHDNSR
                     RDSDTVVGSVRNSQIDQPLLQKSVKDSISNCLESSHSVMDLKQFKRKEEIKEGLQGNT
                     NEQPNPNLTSQTMALSNSVSSCGTSKSKIDCEDDMDVFLMDEDNETLDHHNRKPQQNQ
                     LAEYRSASRESVPTEDQEHTIVSQFILLEDLTRNLSKPCALDLKMGTRQYGVDAKRTK
                     QQSQRAKCHKTTSRKLGVRICGIKVWDQDYYIKRDKYFGRRVRAGWQFARLLARFLYD
                     GKHKGSVIRQIPRLLKQLETLNNEVNELKGYRLYGASLLLMYDGRAKETSIDNTSDLT
                     KMLTSVGKAKVNLIDFARCVTKEDMVAGLSTFKIPPKNPKLEDKGFLRGVKSLKFYLQ
                     LIWNYLTNDAKIPEEEEDMIEWMNSNLDSVLSPWDWLDSFADEEENEFNDPTSELRKK
                     WRKYELIFDAEPRYNNLDPEISD"
     gene            <431539..>431778
                     /locus_tag="CAGL0D04394g"
                     /db_xref="GeneID:9487978"
     mRNA            <431539..>431778
                     /locus_tag="CAGL0D04394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999484.1"
                     /db_xref="GeneID:9487978"
     CDS             431539..431778
                     /locus_tag="CAGL0D04394g"
                     /inference="similar to AA sequence:UniProtKB:Q12248"
                     /note="similar to uniprot|Q12248 Saccharomyces cerevisiae
                     YDR016c DAD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999530.1"
                     /db_xref="GeneID:9487978"
                     /db_xref="GOA:B4UMY9"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="UniProtKB/TrEMBL:B4UMY9"
                     /translation="MNKQEISTADKDFIEQRDVLLQEVNELVASILNGLNDLNISLES
                     SISVGKEFEKVSTLWKSFYDGLESVDNEHSDSGED"
     gene            complement(<432126..>432398)
                     /locus_tag="CAGL0D04400g"
                     /db_xref="GeneID:2887251"
     mRNA            complement(<432126..>432398)
                     /locus_tag="CAGL0D04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445606.1"
                     /db_xref="GeneID:2887251"
     CDS             complement(432126..432398)
                     /locus_tag="CAGL0D04400g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445606.1"
                     /db_xref="GeneID:2887251"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY8"
                     /translation="MFGRSYTVITNTNPVTGQLTQNRISKRSVTESDVVVQFSLTKDR
                     SSIKRVKSLKRVSSLKNLIAKANRTLYNVDSSKVVYKAGLSKKLRR"
     gene            <434014..>435159
                     /locus_tag="CAGL0D04422g"
                     /db_xref="GeneID:2887205"
     mRNA            <434014..>435159
                     /locus_tag="CAGL0D04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445607.1"
                     /db_xref="GeneID:2887205"
     CDS             434014..435159
                     /locus_tag="CAGL0D04422g"
                     /inference="similar to AA sequence:UniProtKB:Q08913"
                     /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
                     YOR390w or uniprot|Q08991 Saccharomyces cerevisiae
                     YPL279c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445607.1"
                     /db_xref="GeneID:2887205"
                     /db_xref="GOA:Q6FVY7"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY7"
                     /translation="MGLPSISENKHLKTNGTVHRILCYTLATILGNYARQGLEYLTNY
                     EPSYVRPTTVLWANCGGCIMMGLCQDLRELFFYANEYHVLFLSITTGFCGSFSSFSTM
                     IIEMFTYSASLTNENIATGSRLPNRAYGIMEFLSVMIVHLGVSLSGLLLGRKLGKEVL
                     IPYFISRPTKTEVSLTDNEPTEPSDNSGEVIEKTDSYVEPEYYTPRWCVYILFGLDLF
                     LTYMSIPILVMIIILTAFYGNYSRGVWTLPVLFGIPGSFLRYYLSKWFNNRKSLSMFP
                     VGTFIANISATLILSILIMVQRGQKNSQTHERIINNKNTCHIVQALGSGFCGSLSTVS
                     TFINEAHQKDISYILRYYFITIFCAYCLCVITLGSYSWTRGLTLPVC"
     gene            complement(<435564..>437288)
                     /locus_tag="CAGL0D04444g"
                     /db_xref="GeneID:2887253"
     mRNA            complement(<435564..>437288)
                     /locus_tag="CAGL0D04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445608.1"
                     /db_xref="GeneID:2887253"
     CDS             complement(435564..437288)
                     /locus_tag="CAGL0D04444g"
                     /note="weakly similar to uniprot|Q99359 Saccharomyces
                     cerevisiae YDR014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445608.1"
                     /db_xref="GeneID:2887253"
                     /db_xref="GOA:Q6FVY6"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY6"
                     /translation="MKVYGRRAHSYDYDTSHDIEFSDDEMTPVRSDLSMEPKSESSIS
                     SASNKQAKVFSNVAGQRSDNKLDLQGDSFDDLFNNIELPKRKKRKTTYRKKIEINQSN
                     NVLDGENFDGGPASDNNLEFETSIQDISDYLDQIKSDDDRKRTNALEDIDSLYEGQQV
                     SISSLQNTKLSATKSELPMNRNLGNATVVHRQVSLYDSLDSDSKQVDGNKFKAMRKQG
                     HALQYQDDVDELLLPLKAVTVETSAESFVLAIIKLLINMFTDSDLKDFIIQNYSDNLI
                     NTLDKFSFKTDTVFKPLSQMLLSDLVTCLVDGDSKIGDNMVFTIANVIKFNIIDLNHI
                     DFKEEIAEIGRKYPQLSSSVNAYSAIIDHHDKNISAFVKLIVQFPSSLNFFDECSLKS
                     IFTNIIKYYESEANPIKNDIEDVLLKGLILLVNSGINFAGNSKKDKSFFIDMLEHIID
                     DIENENDLDDIHLLKAVLSCNLLINDPITESCDLKEKIERFLCKILCEESERKIVEDN
                     LMVFQYLSLVYLLSGSKISSDKLALTLEQTKRLKLRFTKLLSSLHVENVKIQNKINDC
                     MLSMDLIK"
     gene            complement(<437489..>438157)
                     /locus_tag="CAGL0D04466g"
                     /db_xref="GeneID:2887234"
     mRNA            complement(<437489..>438157)
                     /locus_tag="CAGL0D04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445609.1"
                     /db_xref="GeneID:2887234"
     CDS             complement(437489..438157)
                     /locus_tag="CAGL0D04466g"
                     /inference="similar to AA sequence:UniProtKB:Q12488"
                     /note="similar to uniprot|Q12488 Saccharomyces cerevisiae
                     YDR013w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445609.1"
                     /db_xref="GeneID:2887234"
                     /db_xref="GOA:Q6FVY5"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /translation="MYGDLANKLILEAKRTQQLNQRRVNEDLQSGGGVNLLSRLPIYH
                     DELVRNILNEVDQLRRNAEFLRNNGNAEEFAHLDEKIVKCQYFVTLLCMERNKRCLLA
                     YQKLRTDILDNIAWCNNGTGIELYSGSNEDETNSLSHYEQEYLKEYGELITELKSESM
                     ADIDLSGSLEPPSDVFIDVRVLKDAGEIQTEYGVFNLIKDSQFFVRQSDVERLIQQGY
                     LQKI"
     gene            <438456..>439238
                     /locus_tag="CAGL0D04488g"
                     /db_xref="GeneID:2887053"
     mRNA            <438456..>439238
                     /locus_tag="CAGL0D04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445610.1"
                     /db_xref="GeneID:2887053"
     CDS             438456..439238
                     /locus_tag="CAGL0D04488g"
                     /note="weakly similar to uniprot|Q06109 Saccharomyces
                     cerevisiae YPR116w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445610.1"
                     /db_xref="GeneID:2887053"
                     /db_xref="GOA:Q6FVY4"
                     /translation="MPRLERNVYKGLITSLSRKKPSNSLAVKESPLLTKFERWSGKRM
                     KLFFESEDSFEHYGLRDLKLPHNMLANKLASPIRAERNTRYRIPKEFLIKLNLYKDAT
                     NNVLQLKANFNGVTGLGTTYIHNNKKCLEMKFCDISRWSSRQPLKVPPLPIVADKSAL
                     LKDYENQLIRELNECFSKLKTTSKHDHNTVKLYVSTENNLLMDVDTQGSLCINLQSIT
                     DKLPHTMLETVTNAPIHISAYSNMDFLTTLHRLLGYYRHRNR"
     gene            <440080..>447522
                     /locus_tag="CAGL0D04510g"
                     /db_xref="GeneID:2887127"
     mRNA            <440080..>447522
                     /locus_tag="CAGL0D04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445611.1"
                     /db_xref="GeneID:2887127"
     CDS             440080..447522
                     /locus_tag="CAGL0D04510g"
                     /inference="similar to AA sequence:UniProtKB:Q06116"
                     /note="similar to uniprot|Q06116 Saccharomyces cerevisiae
                     YPR117w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445611.1"
                     /db_xref="GeneID:2887127"
                     /db_xref="GOA:Q6FVY3"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY3"
                     /translation="MIELISVHNVLQLLHIAFKVLVAEVLLQAFIWLVLSFFNLPIKA
                     FSFGVLLGPAIRNVLVQFKGVKLTVRSITLRASLQPSIIFNSINVTLSDVIDKGDNDT
                     DQNAPAVPRVRIKMNSWQLWLVNILTKFQFYFANVYITLADNHMIKVDLVSASISKVG
                     KDTTNIEFFAHEIEKGDEFTMNHVIYMLSFKTNRAKDDEEKGIVIELYEWNSYLKTTN
                     TVIDYHSYQKKYYRVPKSVAPEVAEDSKLSSTPQSFDDSIIHKIIDMNRHLIKRLRII
                     DVKIENIDVVFCPSFKISVSSFQFCLKSMNKTEKRSVWELVEFNSSIWEEYEITLSMN
                     SIICESGPDTCLRLPLVNILITTDCMAHYTNGVPFENLKIVTTINVINPSFFTTSEQV
                     LKLLKTFLIKGNTESKNEDTLNSFPIDNFRMDKFPSFTLEYSFSNFTSTIGLSNEEDL
                     NLSLFNVQAIICHSSVVDELSIPEMTLEKVQWSFIKSSSPKKEFSNYIKIVGLSISYL
                     RSSHLADVPPLSIPLCGLERLDTFIEDVFSKNSRVNSTLRHFSLTLDSLKVVDKLSGF
                     MSKINSVMHDNVSNKNENMPDLESHKGTSIKRKRGLAKLINDLNWTLRFRFKDVTISL
                     IVSGFLPKYLDPIDNADLNLTDIDRGIKITFKESLLLIDNDGKRFSLFNATLSRIIDN
                     INKESEVGGIFVLNDFVVYQPKNSNDISIKLPLVHMKFDVSTLWLIFFLKSIWERYSV
                     TMLNASKEKVKKIKKPTMRKTLRIQANEINIHVMLMSGNPIVFAIEDLNFDSLSMMVS
                     LQNFRLLCKSVYITKIPVLVNLMQIRDLSVDLKKLGEHSAVPITTSLIHFQTEYHLRL
                     YIIIDDIITMFKSYKQIHLAFSNILYYRRLYPSRMFAAKIPKINFSVEKFLIDIEEDP
                     FEQELGLIYKVGVSEQRERIRKEVEFDNEVRRLKEMTPEEQEEFLSRVNNYPYRGRMS
                     ENYYIQQARMRLLEHFSTSWIVRYRKAKLLHHQAPYHVEEKRYIDTKYYVYSKERVIT
                     TANLIIDNLMLNIGPPSFPVENHMDFIHKYGKGVPKSMEYTLLIMMGMNIYSDLFELN
                     LRDYPIPVMSFSQVKTDGDIVFAEKMPIEDSHRSIFVPFVKSASAVPYNIHNSFYGSH
                     IIRTLNSIKIYYNLNSRTEAATPSFLTWGKSLQPAFESLMLWFDYLTKPPLDPSEKLG
                     FWDKFRFIVHGRWVFKFEKDSSFHLHIKGSYDPYKIADDGAGVSFCWSDNTAVKIHDS
                     SDPKNFLVIDSSRFLLAIRDFTEVDKFEKIFMKLHGNVTWKMGLLFEQGNYEKIGEED
                     REAPSRPHYDVDLVNPISVRNKSTHDSYSGFRSRFIHMSFGVYSYGANAYNNMFIAPN
                     SFALFLRWWNLFHQYTSGPIRQGPLFTELVQNKNKFGKALFTIKYQLHLEPLIISHTL
                     RHMSSEYSSFEGKNVIFTGLKGRVSSLKMDFHQKRIKLAHIYEKLELTNSVWKFRMFE
                     GEMDCCDADVRIIAAEFAQSKIDDILSGMKKSEIIDRESPQKPLSTGNDEWFDLHDYH
                     DVDHVPLDSEPVDFKAEPLLYSPRMSYFRKINEDGFPVSYPFGDEDSHVCLIGRNHPE
                     STQKMLARERKLEIETRLSEIESEFKDFECSKMTESHKYKLKELQSERHELKHSLHII
                     HNILRDLRLSEEISRIYTNDDLESSIGSGVSSVSSGRNTNNEAALLRTNTIESFVSMR
                     KNSSVNAVSSYDNRFMLHNIHLKINKSITHHLLDYIHNWYERKSMRFFMTYKSICIVE
                     ELLKLSLKGTKSRFQEYGSLSEFFKTSNAEFIEQFDRLNREVSNDSYEAIDSFLFRLV
                     SPQVQIRSDCEPNDALILSARDIEVGIIDINQIYGENGKRLPTDVDTIVETRYCVVSK
                     DLQLFALFKNDLIKHGARGFKSHGYGLEENSTFWPPWIPLEMCYDGSLLEKNVVLRRR
                     SMYLTFTAPNSLYFSQRNDQNIVTTCSNIRIAFPGLLVTSTSQQYCSVYAIVQDLLAF
                     ASSADEKIEKLSRNLIEDEIRNSLESLDISHITNLQDRVRNMYHVRAYMKLNEPSTYN
                     EFLPLINFEAQVSIIKLTLLMTAIKETYNKLGSNDTSNPQKLVWQISTEDLIWELFDE
                     KKSPFVTIGLGPSKFIRVETSDGNNTNVVSINSLKCFNQQENPIFSELFAPDFQHSHY
                     HKDMPMVEISWVMGNPIGGISDLNDLTVILQPSIFKMDHKTGDHLMSYLFPDVNSANV
                     ESDDSLSISLPRKSNSSIVSPAPAISYYGMSSILSAPRDSGSWDVSSIKALSASGSGR
                     SPSPEDDKIDRQFLNINEMVQRSGEYFTVRNIKIKHTYMSVSYKGSRAIFTDVNKLKI
                     KVPTLRYHNKIWSRDELFDAIKKDVVRIVIQHLGSIIGNKFLPHKKEDKKSIKKKYTE
                     MLKSDEALNPELAGTISNRRTLTSSSSKTTTDDNIDSILFEGDSSPIAFYPGPSSNKQ
                     "
     gene            447843..447929
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0D04532r"
                     /db_xref="GeneID:2887128"
     tRNA            join(447843..447880,447893..447929)
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0D04532r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2887128"
     gene            complement(<448106..>449353)
                     /locus_tag="CAGL0D04576g"
                     /db_xref="GeneID:2887005"
     mRNA            complement(<448106..>449353)
                     /locus_tag="CAGL0D04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445612.1"
                     /db_xref="GeneID:2887005"
     CDS             complement(448106..449353)
                     /locus_tag="CAGL0D04576g"
                     /inference="similar to AA sequence:UniProtKB:Q06489"
                     /note="similar to uniprot|Q06489 Saccharomyces cerevisiae
                     YPR118w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445612.1"
                     /db_xref="GeneID:2887005"
                     /db_xref="GOA:Q6FVY2"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="InterPro:IPR005251"
                     /db_xref="InterPro:IPR011559"
                     /db_xref="InterPro:IPR027363"
                     /translation="MNALRAIDFKRDDPNNVSVSVLDQLLLPYTTKYIPIYTIDDGFT
                     VIKKMQVRGAPAIAIVGALSVLMESQLLLSEGFCKTQYYYNLNDWENIRSKIDERLAF
                     LLSSRPTAINLSNALDEIKIVLDSASDLQTFKNNLFDYVCKLIDDDFANNKRMGDNGA
                     EFLLNLLKKENFNEDFAVFTICNTGSLATSGYGTALGVIRSLWNDSKSKTQEGNPNKK
                     VKLTESSPKMVQVFPLETRPYNQGSRLTAYELVHDDIPATLIPDSSIAYKIMTSKIPI
                     KAAFVGADRIVRNGDTANKIGTLQLAIICKQFGIKFFVVAPRTTIDKVTEEGKDIIVE
                     ERNANEFKIVTGSAVDMQTNKPILDEKNEPITAKVGIAPENINVWNPAFDITSFEYID
                     GIVTEVGVFTKNENGNFDLSALH"
     gene            complement(450020..450101)
                     /locus_tag="CAGL0D04598r"
                     /db_xref="GeneID:2886984"
     tRNA            complement(450020..450101)
                     /locus_tag="CAGL0D04598r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (GAG) cove score=66.64"
                     /db_xref="GeneID:2886984"
     gene            <453500..>454930
                     /locus_tag="CAGL0D04620g"
                     /db_xref="GeneID:2886985"
     mRNA            <453500..>454930
                     /locus_tag="CAGL0D04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445613.1"
                     /db_xref="GeneID:2886985"
     CDS             453500..454930
                     /locus_tag="CAGL0D04620g"
                     /note="highly similar to uniprot|P24869 Saccharomyces
                     cerevisiae YPR119w CLB2 or uniprot|P24868 Saccharomyces
                     cerevisiae YGR108w CLB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445613.1"
                     /db_xref="GeneID:2886985"
                     /db_xref="GOA:Q6FVY1"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY1"
                     /translation="MSLSGNNFENPQNNGTSRLLKNVQRLALNNVTNTTAGPHVGFLG
                     SQSQDNSALRSFKSSIANLKGDSVPTYKVNPLSRPALVNNERDLTKTKLGIQEEKETR
                     NYEENKENHGPQKGHFTQYDERVEDKNQSESTVSSQTTTESTQITTSNGDDDQTEEEN
                     SEDADSKKKRPISTIVEQDIPKKFKSCNRFGTEEYEWEDLDAEDANDPFMVSEDVNDI
                     FEYLHQLEIVTLPRKEDLYKHRNICQNRDILVNWLVKIHNKFGLLPETLYLAVNLMDR
                     FLCKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFIL
                     KTLEFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGVLPSLCAAAA
                     MFLSRKMLGKGQWDGNLIHYSGGYTKNQLAPVCEMIMDYLVSPVVHDEFHRKYQSRRF
                     MKASIISVQWALKVRKNGYDIMSLHE"
     gene            complement(<455638..>456837)
                     /locus_tag="CAGL0D04642g"
                     /db_xref="GeneID:2887087"
     mRNA            complement(<455638..>456837)
                     /locus_tag="CAGL0D04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445614.1"
                     /db_xref="GeneID:2887087"
     CDS             complement(455638..456837)
                     /locus_tag="CAGL0D04642g"
                     /inference="similar to AA sequence:UniProtKB:P30283"
                     /note="similar to uniprot|P30283 Saccharomyces cerevisiae
                     YPR120c CLB5 cyclin or uniprot|P32943 Saccharomyces
                     cerevisiae YGR109c CLB6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445614.1"
                     /db_xref="GeneID:2887087"
                     /db_xref="GOA:Q6FVY0"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FVY0"
                     /translation="MSSMSSSSMDSAQRKPSEDEKMDRPALTNVEVNRALPGGRKAQP
                     LTEQEKKRHPMYRKPSRIRREDSDASYMANSKKRQVFQDNADDDEPTGKDQESRIKRA
                     KVQDRQIKWVDLDSKEKNNIAMVVEYTNDIFDFLYEREKNTIPMHNYLLDRKSKYHLR
                     PATRAVLVDWLVEVHDKFQCYPETLYLGINIMDRFLSQHKVDINKLQLLAVTSLFIAA
                     KFEEINLPKLSEYAYITDGAASKDDIKVSEMFILTELKFSLDWPNPLNFLRRLSKADG
                     YDGECRMIAKFILEYSLCSSKFVGEKPSELAAMAIFLARRILKRESPIWDDTFIHYSG
                     GIDALNDNHFQNLCTIMINEIAQPATKLTALCDKYKSIKGGTIYDKTIKWCKDQMERN
                     YENVFSC"
     gene            complement(457334..457405)
                     /locus_tag="CAGL0D04664r"
                     /db_xref="GeneID:2887069"
     tRNA            complement(457334..457405)
                     /locus_tag="CAGL0D04664r"
                     /product="tRNA-Cys"
                     /note="tRNA Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:2887069"
     gene            <457938..>461483
                     /locus_tag="CAGL0D04686g"
                     /db_xref="GeneID:2887217"
     mRNA            <457938..>461483
                     /locus_tag="CAGL0D04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445615.1"
                     /db_xref="GeneID:2887217"
     CDS             457938..461483
                     /locus_tag="CAGL0D04686g"
                     /inference="similar to AA sequence:UniProtKB:P40851"
                     /note="similar to uniprot|P40851 Saccharomyces cerevisiae
                     YPR122w AXL1 protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445615.1"
                     /db_xref="GeneID:2887217"
                     /db_xref="GOA:Q6FVX9"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX9"
                     /translation="MITDVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENY
                     NSCSLTVAAGSHNDPATVPGLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYT
                     TGEQTSFYFQVPQVANSEGTLAFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENN
                     KTNPGKVLYQATRLLANKNHPFSRFCTGDMNTLKTFPSTENINIRKELISYFNDNFYG
                     ENITLCVRGPQSLNHLVKLCMQNFNDIKPLPVLPTAIGNNRDSDTELFEETLKRLNIL
                     YDVWAPRYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNIC
                     VELLGNEEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVN
                     VLFQTLIPMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLH
                     NRGIKYLLMKSPSFLHNYEEMSKTEKLHYWPLIVEKFKVFLRRHMILPNAKVIIPTSE
                     PFTKTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVIFPYQFSFPGPNEFIP
                     PKYRNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVD
                     GIFSKVVNADIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFS
                     FHLQAALDGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAI
                     RSRYEAATKGSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTHK
                     HTKVFAQSSSTSNIDKIARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHI
                     KLIGRDNDPNNCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAV
                     DGGLVILNNVVGVNVVVVSSTSPEHIEQEIESYYAHVRQYLSDNVDQIWRDYSKIIND
                     RDPLMYLLDHDVWYNIERENSDIPEYSRDHVANCQRVFKYKDLIELLVVDTPISGRHP
                     DYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQLES
                     FLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSIL
                     HIPSKTTAQAKTTSKTTSKSRSAAVTETTATIPAS"
     gene            <462407..>463558
                     /locus_tag="CAGL0D04708g"
                     /db_xref="GeneID:2887151"
     mRNA            <462407..>463558
                     /locus_tag="CAGL0D04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445616.1"
                     /db_xref="GeneID:2887151"
     CDS             462407..463558
                     /locus_tag="CAGL0D04708g"
                     /inference="similar to AA sequence:UniProtKB:P49573"
                     /note="similar to uniprot|P49573 Saccharomyces cerevisiae
                     YPR124w CTR1 copper transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445616.1"
                     /db_xref="GeneID:2887151"
                     /db_xref="GOA:Q6FVX8"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX8"
                     /translation="MSSMSSMSSMSSMMSSMMSSMMSMSMSMSTSSGSMGSMSMSMPS
                     SMSMSMSMHSGMSMDMPMSMSMSMPSSMSMAMDMGSHSHSTMAVDMGHSTNASAMAGM
                     DMGMGMMKNMHMNMWLTPTYNDYPVLFQHLRADTNGKAFGIFLLIVVAAFVYKFITFT
                     SWCLEVHWFKKWNKDSKYASIFPAANKKNNANDPEIMEAHVSGMPRVPNLLRDIFMPS
                     FTDLFHDFIRAILAFISTMIIYCLMLVAMTYVLTYVFAVVTGLALAEVFFNRIKIALM
                     KRWDIQREIALAAACGAKGECECGPNDPRSPSSGTSTEEEYDEKHGGHNHKEFRSASN
                     MDDNCNCETPVIAKSKQEKRIERETLENSRMQEQANTMAPDLTPADGLH"
     gene            <464211..>465512
                     /locus_tag="CAGL0D04730g"
                     /db_xref="GeneID:2887152"
     mRNA            <464211..>465512
                     /locus_tag="CAGL0D04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445617.1"
                     /db_xref="GeneID:2887152"
     CDS             464211..465512
                     /locus_tag="CAGL0D04730g"
                     /inference="similar to AA sequence:UniProtKB:Q06493"
                     /note="similar to uniprot|Q06493 Saccharomyces cerevisiae
                     YPR125w MRS7 suppressor of MRS2-1 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445617.1"
                     /db_xref="GeneID:2887152"
                     /db_xref="GOA:Q6FVX7"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX7"
                     /translation="MMLKRGIRKSYAGITPMIRNEAAMTARFGVYGTLTAYSALGRSF
                     SSTPMYLQMKKSETESKKLTIWDKVKKEARHYWDGTKLLGFEIKISSRILMKSMTGYA
                     LTRREMLQLKRTISDIIRLVPFAAFVLIPFAELLLPIALKIFPNMLPSTYESRSSKQK
                     KLDNLRKTRELVSEIMRENKTQLKPTGINEEQKTVFNSFYEHVRATGEPESREQLVTV
                     ARMFTDDTVLDNLTRPHLVAMAKYMNLQPFGTDVMLRYRIRYKMLQLKNDDVTLYYEG
                     LDQLNEAELKMACASRGIRSAQVEDEVKLRESLRVWLSMRLKEKIPSTLLVLATAYNY
                     GEVLPTNIGRSPADSAAESTDNTSSLYDALCDVLSGIPDELYHEVKVNVVHHDEPAQK
                     LNQLKEQAEIMREEEQQEKNELVHVQDKLSLDELDPVQEKK"
     gene            <466450..>467508
                     /locus_tag="CAGL0D04752g"
                     /db_xref="GeneID:2887110"
     mRNA            <466450..>467508
                     /locus_tag="CAGL0D04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445618.1"
                     /db_xref="GeneID:2887110"
     CDS             466450..467508
                     /locus_tag="CAGL0D04752g"
                     /inference="similar to AA sequence:UniProtKB:Q06494"
                     /note="similar to uniprot|Q06494 Saccharomyces cerevisiae
                     YPR127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445618.1"
                     /db_xref="GeneID:2887110"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX6"
                     /translation="MSKIQQIRNTIRSIGTGYGLMSLTWKAVPTEQEQAFGAMKKAID
                     LARASNHIAFFNVGEFYGKDRVNLHLVRDFFKKYPELREHVIISCKGAMDLSDLHAMG
                     KYDDVVKSVEACTEAIGGFIEIFEPARLDMDICKEGEVYPKESIQALKDLCDKGVIGA
                     ISLSEVDEKVINAVAADFGEYLACVEVELSLFCDDILHNGVAKACSDHNMAIICYSPL
                     GKGILTGQITKNSDIPDGDFRKMLKSFSDEALQHNQEIVSFIRTEIIEKRPAGKEITL
                     PQVALAWIKHWNGDSSYPNAKFIPIPSGSSAARVAENFDEEKSTISDEEFKKLNKYAF
                     NFKPVGARYEFVSDPTKH"
     gene            complement(<467712..>468680)
                     /locus_tag="CAGL0D04774g"
                     /db_xref="GeneID:2887129"
     mRNA            complement(<467712..>468680)
                     /locus_tag="CAGL0D04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445619.1"
                     /db_xref="GeneID:2887129"
     CDS             complement(467712..468680)
                     /locus_tag="CAGL0D04774g"
                     /inference="similar to AA sequence:UniProtKB:Q06497"
                     /note="similar to uniprot|Q06497 Saccharomyces cerevisiae
                     YPR128c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445619.1"
                     /db_xref="GeneID:2887129"
                     /db_xref="GOA:Q6FVX5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX5"
                     /translation="MASLESAFTGAVASSLAATTVYPLDLAKTLIQTQHKNADSGDSK
                     EEEKYKNVIDCIIKIFKKRGFLGLYQGLATNVAANFVQNFIYFFWYSLIRSNYFVFKA
                     GRLQLKDDSKFIELSTIEELALGMSAGAMTQVVTNPISVISTRQQLTKDGEDASLKAV
                     IKQIYEESNGDLTAFWKGFKVALVLSTNPAITYGSYQKLKSMILTAKGLSGSQKISTQ
                     LSAGENFLLGMFSKMISTFVTQPLIVAKITLQGKGSKFKTFQEVLQHIYQNEGFLSLW
                     KGVIPQVSKGVIVQGLLFTYKDEIVRVIRKLLFLYKNIIARNKLVA"
     gene            complement(<469027..>469605)
                     /locus_tag="CAGL0D04796g"
                     /db_xref="GeneID:2887093"
     mRNA            complement(<469027..>469605)
                     /locus_tag="CAGL0D04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445620.1"
                     /db_xref="GeneID:2887093"
     CDS             complement(469027..469605)
                     /locus_tag="CAGL0D04796g"
                     /note="some similarities with uniprot|Q06504 Saccharomyces
                     cerevisiae YPR131c NAT3 N-acetyltransferases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445620.1"
                     /db_xref="GeneID:2887093"
                     /db_xref="GOA:Q6FVX4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX4"
                     /translation="MTSIDPFEPSDLFQLNNVNLDTLTENFPLEFYLEYLILWPELFF
                     KSNETASNNALYSGYMMAKTEGKGPEWHSHITAVTVAPEFRRISLASRLCNTLEAITD
                     ADPHEVNFIDLFVKCNNDLAIKLYEKLGYSVFRRVVGYYNSQKDGYPSSLKKVNDDKD
                     AFDMRKSMPRDKGKSTRKDGRKHKCYPHDVRF"
     gene            complement(<469863..>471011)
                     /locus_tag="CAGL0D04818g"
                     /db_xref="GeneID:2887033"
     mRNA            complement(<469863..>471011)
                     /locus_tag="CAGL0D04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445621.1"
                     /db_xref="GeneID:2887033"
     CDS             complement(469863..471011)
                     /locus_tag="CAGL0D04818g"
                     /inference="similar to AA sequence:UniProtKB:Q06505"
                     /note="similar to uniprot|Q06505 Saccharomyces cerevisiae
                     YPR133c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445621.1"
                     /db_xref="GeneID:2887033"
                     /db_xref="GOA:Q6FVX3"
                     /db_xref="InterPro:IPR017923"
                     /translation="MSDSEVKDVPVAPVEEVEAPVEAPVEAALEPSVEAPVEAPVEST
                     VEAGEPAPERTRKHIESDDDDEEVQAPVEEQVTIDSSEDPKSQRQILEDRLDRLLKKT
                     SGRRQRADEHDLEQYLDEKILRLKDEMNIAAQMDIETLNKRIEEGENKSQDKKPLVAI
                     QKVKLLPKVMSILSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALDD
                     LPIKTEHLKESGLGRVVIFYTKSKRVEPQLARLAEKLIAEWTRPIIGASDNYRDKRIM
                     QLEFDSEKLKRKSALDSAKRKKNKVSKPSSSASKGSSAQTLYEQAAARRNRAAAPAQT
                     TTDYKYAPVSNITSVPTNARTVGVGSSLNNNELYKKLSSRLAKPGKRS"
     gene            <471224..>471373
                     /locus_tag="CAGL0D04834g"
                     /db_xref="GeneID:9487979"
     mRNA            <471224..>471373
                     /locus_tag="CAGL0D04834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999485.1"
                     /db_xref="GeneID:9487979"
     CDS             471224..471373
                     /locus_tag="CAGL0D04834g"
                     /note="highly similar to uniprot|P80967 Saccharomyces
                     cerevisiae YPR133wa TOM5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999531.1"
                     /db_xref="GeneID:9487979"
                     /db_xref="InterPro:IPR019603"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ0"
                     /translation="MFNMGQGESEEEKKLHQQRTQQTLVNATCVAALLWVSPMVWNFV
                     KRQWK"
     gene            <471574..>472164
                     /locus_tag="CAGL0D04840g"
                     /db_xref="GeneID:2886974"
     mRNA            <471574..>472164
                     /locus_tag="CAGL0D04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445622.1"
                     /db_xref="GeneID:2886974"
     CDS             471574..472164
                     /locus_tag="CAGL0D04840g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445622.1"
                     /db_xref="GeneID:2886974"
                     /db_xref="GOA:Q6FVX2"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX2"
                     /translation="MIVAFHLRSCREFAVFECIYRELQRVCGVEYMSVQRSVWAPFSR
                     HDHATLQAVLPGENEVLSEVIPRISGVDVTGGPQDADLHSIARDLAAGETPKGTLFRF
                     TDHIQYMRMKETLETGYYRKHYIAPLLKSHLKSHLKSNPSTTVPIVTQLATHPSDIPP
                     QMAKYIRGMDVTTEMTKKDRDTLDSLLYGGIDGFLK"
     gene            <472577..>475336
                     /locus_tag="CAGL0D04862g"
                     /db_xref="GeneID:2887141"
     mRNA            <472577..>475336
                     /locus_tag="CAGL0D04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445623.1"
                     /db_xref="GeneID:2887141"
     CDS             472577..475336
                     /locus_tag="CAGL0D04862g"
                     /inference="similar to AA sequence:UniProtKB:Q01454"
                     /note="similar to uniprot|Q01454 Saccharomyces cerevisiae
                     YPR135w POB1 DNA-directed DNA polymerase alpha-binding
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445623.1"
                     /db_xref="GeneID:2887141"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX1"
                     /translation="MSVVDKSVFDSGGRTTLALAQDNAHLCVGSKIGIVKILNTERVQ
                     DEPRVLEVVKDLTSVCFGSKDDSKLLVTSVTGDAYLYDARDEGSTGKLLTRSVLPLRD
                     CQIIHSDKYAVFGGDDLQLTLIDLDGGDRNTLKTEEQVSSLSYSKQSNILAVSFINGK
                     VQFFSVSSAVPNKVHELKDYIPKHSYVDSGDDALLTDVLGSDKEDTDVEADTLEDDKI
                     KDPTFCDNNRICTKVAWHPNGLFFALPTKEGGVSIFDIKDYKLQKTLSPTAKGKLFCD
                     LQFDTKNGNYMAAIDLDGQLTVWDWKRGEVKLARKIKQDITHLVWKIQESSGQFDLIL
                     GTWNGSIITIKSVLPVIDSKVEEPLTSAGGEKNLFVEDDGNSDDEAKGSNLVDGEAED
                     DNGEEIDDENLFTQEDDINEGKRKYHFDDEDDFIDDDDGAGYVSEKKYRKFEDTSVNT
                     FHNYNSSRSRYAPKPFKYKPFSAGATPFASGDRRYLTMNEIGYVSTVKNGDQNSVTVS
                     FFDVGRFREYHFEDLFGYDVCFLNENGTLLAQSRMGQINYRPHNSLHSNWTKVIPLLD
                     GERITTIAATPKMVYIGTSFGYFRIFNSFGVPVALEKMTPIVALTAQDYKVFTVHFSP
                     LHGLSYSLFEVHTDTSKYFQRECPLPITMPQAYAGRVEPDFLSSNPLGIKSLFFSSYG
                     DPCIFGIDDVLLVLSKWRSGAQSRWIPVLDSNFELWKMSGGKDHTDVHVWPLSLNYDT
                     LNCILVKGKRIWPEFPLPLPSEMEVQIPVLVKSQLLKEYNKEKKERAEAGLDSDEDED
                     KDEETEVTIPQNLAAEEEFLRSKILSGLLQDTIVNDGELFGNENRIIASLIGMHDKSL
                     LRLFAIACSDQNPERALSIAQELKQDKALTAAVKVSERAEMLSLVQKINDIREARFNQ
                     QMDNM"
     gene            <475678..>477369
                     /locus_tag="CAGL0D04884g"
                     /db_xref="GeneID:2887142"
     mRNA            <475678..>477369
                     /locus_tag="CAGL0D04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445624.1"
                     /db_xref="GeneID:2887142"
     CDS             475678..477369
                     /locus_tag="CAGL0D04884g"
                     /note="highly similar to uniprot|Q06506 Saccharomyces
                     cerevisiae YPR137w RRP9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445624.1"
                     /db_xref="GeneID:2887142"
                     /db_xref="GOA:Q6FVX0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FVX0"
                     /translation="MSGIRENRKRKRQESATPTVTDENITDISSSEEEAANEVDEDEE
                     IDSEEEFEGENPADKRRRLAKQYLENLKTEANEIVNADEAGELDEESRHIDNYNNFDA
                     GDLDREIISSRLKEDVAEQQGRVYRFISDRLDFDNVKTTFTRVGENNPTSLSCYQPQF
                     NKFDASSFGKQSKNKLFCYVVSKDMTLTKYDITNFNSRPKKIRSTKGGKQFIPETKFE
                     YENTSEGHYDEILTVAASPKGDVVVTGGRDRKLIVWSTESLAPIKVIPTKDRKGQILS
                     LTFRRNSDQLYVACADYKIRTYSISQFAQLETLYGHHDIVADISALSMERCVTVGSRD
                     RTAMLWKIPDETRLTFRGGEDPDRLLKKWLKTNATEKENGDLEYPQESEAPLFFGEGS
                     IEVVSMIDDSHFVTGSDNGSISLWSLAKKKPVFIERSAHGLLPAPEVDEISGESSKEL
                     RERQVQDRKLVKPYWITSIYAIPYSNLFVSGSWNGSLKVWKINENLREFELVKELSNC
                     HGVVTKIHYVEAGKHGKEDFRILASVAKEHRLGRWVTRVPGARNGIYSAVLKSKA"
     gene            complement(477723..477796)
                     /locus_tag="CAGL0D04906r"
                     /db_xref="GeneID:2887097"
     tRNA            complement(477723..477796)
                     /locus_tag="CAGL0D04906r"
                     /product="tRNA-Asn"
                     /note="tRNA Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:2887097"
     gene            complement(<478054..>479412)
                     /locus_tag="CAGL0D04928g"
                     /db_xref="GeneID:2886996"
     mRNA            complement(<478054..>479412)
                     /locus_tag="CAGL0D04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445625.1"
                     /db_xref="GeneID:2886996"
     CDS             complement(478054..479412)
                     /locus_tag="CAGL0D04928g"
                     /note="highly similar to uniprot|P53390 Saccharomyces
                     cerevisiae YPR138c MEP3 low affinity high capacity
                     ammonium permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445625.1"
                     /db_xref="GeneID:2886996"
                     /db_xref="GOA:Q6FVW9"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW9"
                     /translation="MLARRGVQYVWDSGIAVSSTAFLVVASALVFFMVPGIGFLYSGL
                     ARRKSALSLLWVTLMASLVGMLQWYFWGYSLALSRTATNNKFIGNLDSFGFRNVYGLN
                     AVWTENLEVAYASFQMMFLCVTLSLVAGSTAGRGRFFPHMVYLFLFATLVYCPIVYWI
                     WAPGGWANKWGVLDWAGGGPVEIVSAISGFVYSYFLGCRNERFLVNFRAHNVSYVTLG
                     TTVLWFGWLLFNAASALSPNLRSVYAFLNTNISAVTGGMTWCILDYRLEKKWSTVGLC
                     SGIICGLVAATPSSGCITLYGSLIQGIVAGICCNFATKIKHFFQVDDAMDLLAEHGVA
                     GMIGLLFNGFFAADWVIGMDGHTTHGGGWITQNYKQMYKQIAYIGAVTGYCAAVSALL
                     CFIIDKIPGLQLRVSADGEEKGTDDDQIGEFAYDFVEIRREFDIWGKEEDEDENEQST
                     DE"
     gene            complement(<479807..>480691)
                     /locus_tag="CAGL0D04950g"
                     /db_xref="GeneID:2887088"
     mRNA            complement(<479807..>480691)
                     /locus_tag="CAGL0D04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445626.1"
                     /db_xref="GeneID:2887088"
     CDS             complement(479807..480691)
                     /locus_tag="CAGL0D04950g"
                     /inference="similar to AA sequence:UniProtKB:Q06508"
                     /note="similar to uniprot|Q06508 Saccharomyces cerevisiae
                     YPR139c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445626.1"
                     /db_xref="GeneID:2887088"
                     /db_xref="GOA:Q6FVW8"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW8"
                     /translation="MEKFSNWRDKGTGIAPFLPPPVPASSKVSVVLNVAWYSVKMVLL
                     LPIMALVMVTGDKFWHRFIYRVLYGLREEIVVVGVKKREVVPWKHYPLRNNVYVCNSS
                     SPWDVLLLGLIAEGPAMFLVPNAGTLYRMNADQYYSYALAGSLDAKLFGKEITSFNDC
                     KGYVCFMFLEGTCSNGKSVLPFEITSKQLGEFLYGKDENDVPVKERINIFTVQLRLNS
                     SIVTPLAIGRREFFLRSIIKGVKAKIKISHEPYSAKNLDSIRAKLMDDDKYKLVSKSL
                     GIEAKRKFVSEFNKKHKL"
     gene            <480931..>482037
                     /locus_tag="CAGL0D04972g"
                     /db_xref="GeneID:2887095"
     mRNA            <480931..>482037
                     /locus_tag="CAGL0D04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445627.1"
                     /db_xref="GeneID:2887095"
     CDS             480931..482037
                     /locus_tag="CAGL0D04972g"
                     /inference="similar to AA sequence:UniProtKB:Q06510"
                     /note="similar to uniprot|Q06510 Saccharomyces cerevisiae
                     YPR140w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445627.1"
                     /db_xref="GeneID:2887095"
                     /db_xref="GOA:Q6FVW7"
                     /db_xref="InterPro:IPR000872"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW7"
                     /translation="MSFYNVLKNGDDMLREYPRRSIIWRILSYGTCLFTYGVSRMILS
                     TLYNFKVFNFERLENAMKRSKAENRGVLTIMNHMSMVDDPFVWATFPIRFYSSVDRFR
                     WCLGAENICFQNAALSYFFSLGKTLSTRRFGAGPFQDSIDATVRLFSTDETLLKDKDP
                     NYKPPVRQKSPPWVHIYPEGFVLQLQPPHSNSMRYFRWGVARTILESTVPPIIVPIFS
                     TGFEKIASEEAKGMMRQLMPRNYGSKIKVTIGEEISDEIIFRYRKEWQVLVEKYKDCN
                     NPDEMPDELKYGEEAEDLRSRLAAELREHVAKIRHDECHFPEEDPRFKSVSWWKKFNC
                     SEGESDPDVKIIGKNWAIKRLQTHLKNNENTKDH"
     gene            complement(<482176..>484254)
                     /locus_tag="CAGL0D04994g"
                     /db_xref="GeneID:2887096"
     mRNA            complement(<482176..>484254)
                     /locus_tag="CAGL0D04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445628.1"
                     /db_xref="GeneID:2887096"
     CDS             complement(482176..484254)
                     /locus_tag="CAGL0D04994g"
                     /inference="similar to AA sequence:UniProtKB:P17119"
                     /note="similar to uniprot|P17119 Saccharomyces cerevisiae
                     YPR141c KAR3 kinesin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445628.1"
                     /db_xref="GeneID:2887096"
                     /db_xref="GOA:Q6FVW6"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="PDB:4GKR"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW6"
                     /translation="MDEPATPAKQTGIGGAGQKRRYTTTPPREIRQYQSRSSFGVNSS
                     GNVDGKSIRSRTHLTSFYKENVMELNELQDKLFQKKGVLDGLKDEYEDLKSRYTALDL
                     KWEQKKEERKLKAQKLELKEKELKKIKDDFANKKTFLEESHKLKLEQLTANKNAELNK
                     MNDEYRSKLEALKYEKIKKFENEKNELIEKIEEIRNKMITNDVALQQRMKDIEADHLE
                     EKEKWLKDYQKEWREVTEKNQESIRKTKELKSEIETVLTPRIDTQNKRLEELKSEIKK
                     LDDTLQNKNEQVGEIRKNIDLEREKKDKLLAEKEEILAYIEKSKKEVEEIKKILVKEE
                     SLRRALHNELQELRGNIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNGDQGMTINRGNS
                     QVIPFKFDKIFDQQETNDEIFKEVGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPGD
                     GIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQENNDRNADS
                     KHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSSRSHSIF
                     IIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLGDVIH
                     ALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASK
                     VNNTKMITRN"
     gene            <484621..>485307
                     /locus_tag="CAGL0D05016g"
                     /db_xref="GeneID:2886997"
     mRNA            <484621..>485307
                     /locus_tag="CAGL0D05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445629.1"
                     /db_xref="GeneID:2886997"
     CDS             484621..485307
                     /locus_tag="CAGL0D05016g"
                     /note="highly similar to uniprot|Q06511 Saccharomyces
                     cerevisiae YPR143w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445629.1"
                     /db_xref="GeneID:2886997"
                     /db_xref="GOA:Q6FVW5"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW5"
                     /translation="MTTLKHKTKKEEETNSSAEEYSGAEASSSDVDASGSEESQGEDN
                     EDEDGDEEEGDEEEDEDFPRKKKAKMNKHDDGSAGFSQALNAILGSHLKAYDRKDPIM
                     SRNKSVLKQNESQKLELKAKKALLAEKKKLLNKTRKKEVIPTVSDENKSGEEIRKIIE
                     KETRLRKIAQKGAVKLFNAILSTQVKTEKEVSEGFTDIKNRKEKKQLITEVSKEKFLD
                     MVKAAADDDE"
     gene            485731..485802
                     /locus_tag="CAGL0D05038r"
                     /db_xref="GeneID:2886992"
     tRNA            485731..485802
                     /locus_tag="CAGL0D05038r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (TCT) cove score=66.88"
                     /db_xref="GeneID:2886992"
     gene            complement(<486065..>487597)
                     /locus_tag="CAGL0D05060g"
                     /db_xref="GeneID:2886980"
     mRNA            complement(<486065..>487597)
                     /locus_tag="CAGL0D05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445630.1"
                     /db_xref="GeneID:2886980"
     CDS             complement(486065..487597)
                     /locus_tag="CAGL0D05060g"
                     /note="highly similar to uniprot|P53043 Saccharomyces
                     cerevisiae YGR123c PPT1 protein ser/thr phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445630.1"
                     /db_xref="GeneID:2886980"
                     /db_xref="GOA:Q6FVW4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011236"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW4"
                     /translation="MGATDADKALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSV
                     YFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVGLLEFKKARADLTV
                     VLKAKPSDAAAKRALDICEKVIREERFRKAIGGGDSDSKPKLCSTLNLSSFDANSDLA
                     KYDGPSLEFEQLKNEKNEYAGVKITNMSQDFITKLVNDVFLQGKNIPKKYAAAIISHA
                     DRLFRDEANLLELSNKESPDHKISVCGDTHGQFYDVLNIFKKYGKVSENHTYLFNGDF
                     VDRGSWSCEVALLFYSLKILFPKNFFLNRGNHETDNMNKIYGFEDECKYKYSQRIFDM
                     FSQSFESLPLATLINKDYLVMHGGLPSDKTSTLEDINKLDRFSQPPREGLYMELLWSD
                     PQQADGLGPSQRGLGFAFGPDITADYLKRNNLKKVFRSHEVRMKGVLFEHNNKLATVF
                     SAPNYCDSQGNMGGIIHIVPGKGKLIQNGNDDEDLLVETFEAVKHPDIKPMAYSNGGL
                     GF"
     gene            <488733..>490334
                     /locus_tag="CAGL0D05082g"
                     /db_xref="GeneID:2886994"
     mRNA            <488733..>490334
                     /locus_tag="CAGL0D05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445631.1"
                     /db_xref="GeneID:2886994"
     CDS             488733..490334
                     /locus_tag="CAGL0D05082g"
                     /inference="similar to AA sequence:UniProtKB:P04838"
                     /note="similar to uniprot|P04838 Saccharomyces cerevisiae
                     YLL039c UBI4 ubiquitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445631.1"
                     /db_xref="GeneID:2886994"
                     /db_xref="GOA:Q6FVW3"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW3"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
                     ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
                     LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED
                     GRTLSDYNIQKESTLHLVLRLRGGY"
     mobile_element  490639..492393
                     /note="relic of gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /mobile_element_type="retrotransposon"
     gene            492459..492531
                     /locus_tag="CAGL0D05126r"
                     /db_xref="GeneID:2887252"
     tRNA            492459..492531
                     /locus_tag="CAGL0D05126r"
                     /product="tRNA-Lys"
                     /note="tRNA Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:2887252"
     gene            complement(<492687..>493013)
                     /locus_tag="CAGL0D05148g"
                     /db_xref="GeneID:2886973"
     mRNA            complement(<492687..>493013)
                     /locus_tag="CAGL0D05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445633.1"
                     /db_xref="GeneID:2886973"
     CDS             complement(492687..493013)
                     /locus_tag="CAGL0D05148g"
                     /note="some similarities with KLLA0D16192g Kluyveromyces
                     lactis and DEHA0C08349g Debaryomyces hansenii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445633.1"
                     /db_xref="GeneID:2886973"
                     /db_xref="GOA:Q6FVW1"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW1"
                     /translation="MNGVIKIPDTRFEQTFRRAIDREVAKQNALSGKSTDDKKSGPSA
                     YVICKVVVRDVLLMPFIQSVLWTGFLLGLKPWLRMVVGFGRRTGEYLNRALYGGRLPG
                     GKTATI"
     gene            <493897..>495498
                     /locus_tag="CAGL0D05170g"
                     /db_xref="GeneID:2887177"
     mRNA            <493897..>495498
                     /locus_tag="CAGL0D05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445634.1"
                     /db_xref="GeneID:2887177"
     CDS             493897..495498
                     /locus_tag="CAGL0D05170g"
                     /note="some similarities with uniprot|P07270 Saccharomyces
                     cerevisiae YFR034c PHO4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445634.1"
                     /db_xref="GeneID:2887177"
                     /db_xref="GOA:Q6FVW0"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:Q6FVW0"
                     /translation="MGEQVEDMDKLYETPIDMQTTIFDQVDNYLHMVNSGLQHDEKED
                     EHREHEDAIDGGASLNMHLYNINDTLNGVSTDNGHFDMVDLHFGPTLTTDDDPTKMAE
                     LQHTTIHHGHLDVNGNRSDSLFSPFDSPLVHDTPSLEARNSIQLTNEGSTSALTTPFL
                     SGKNHYDDHGNSINSQSFNYHNRNSSLSKVSGKFSPISSPALTSTNQEQQHWNTSSRR
                     ASNSSSRSKRVLPSGNSSVSSTSNKVIKNSPYMNASSRRLQKTISNGNSKRDEWDEFM
                     FSLPESSLANDLTTGNDENMDISLPAGHSPTKEYNSYPKVILPSHAAENESMETDNYE
                     RASLLEDSQPDETQNNNPQNNNPHSNGSSISPVGKNDSVMLASGSPVLKPQNSSSNIL
                     QTPYSSKRVFKSPADISSTEQTADEASNDASNDAKSKDKKQRKPSSSGPNKLKRTNTG
                     GSIGRVRSDSASQNSDYVQRKKEVHKYAEQERRNRLNNALSDLNSLLPQDWKDAVTVP
                     SKAITAELACKYIRTLLEELEQYKK"
     gene            <496431..>496802
                     /locus_tag="CAGL0D05192g"
                     /db_xref="GeneID:2887044"
     mRNA            <496431..>496802
                     /locus_tag="CAGL0D05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445635.1"
                     /db_xref="GeneID:2887044"
     CDS             496431..496802
                     /locus_tag="CAGL0D05192g"
                     /inference="similar to AA sequence:UniProtKB:P00127"
                     /note="similar to uniprot|P00127 Saccharomyces cerevisiae
                     YFR033c QCR6 ubiquinol--cytochrome-c reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445635.1"
                     /db_xref="GeneID:2887044"
                     /db_xref="GOA:Q6FVV9"
                     /db_xref="InterPro:IPR003422"
                     /db_xref="InterPro:IPR023184"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV9"
                     /translation="MISSITDLLEELKETIVPVVAEAAEEDPVEDEEEEDEDEDEDED
                     EDEEEGVDQLDALREECKNTEEGKHLVHHYMECVERVTKQQEDPEYENLDYKEDCVEE
                     FFHLQHYLDSCAAPRLFDKLK"
     gene            <498243..>498422
                     /locus_tag="CAGL0D05214g"
                     /db_xref="GeneID:2887045"
     mRNA            <498243..>498422
                     /locus_tag="CAGL0D05214g"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_445636.1"
                     /db_xref="GeneID:2887045"
     CDS             498243..498422
                     /locus_tag="CAGL0D05214g"
                     /note="highly similar to uniprot|P05747 Saccharomyces
                     cerevisiae YFR032ca RPL29"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_445636.1"
                     /db_xref="GeneID:2887045"
                     /db_xref="GOA:Q6FVV8"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV8"
                     /translation="MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHR
                     HALRGTAKTLAAAKK"
     gene            <499006..>500337
                     /locus_tag="CAGL0D05236g"
                     /db_xref="GeneID:2887019"
     mRNA            <499006..>500337
                     /locus_tag="CAGL0D05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445637.1"
                     /db_xref="GeneID:2887019"
     CDS             499006..500337
                     /locus_tag="CAGL0D05236g"
                     /note="weakly similar to uniprot|P43607 Saccharomyces
                     cerevisiae YFR032c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445637.1"
                     /db_xref="GeneID:2887019"
                     /db_xref="GOA:Q6FVV7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSVSRIYIANVSYSSSEEDLREFLKDFNFSSVLIPCHTVRRFRR
                     NEARSFGIAYVDFTSSEEAVRAVEELNGKEFGGRVLRVRTHNPYQPPKPIKERFGTKL
                     QQLKKFAKYEDTAASGERAPTDAQDHPDQPQEGHMSPDVVLVNGTTDEEQQLANVIND
                     PVTNADAPGTEQNISKEKAISEDTVYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKN
                     VSNSRFRFRNRNHTAALVTLSTELPLNKVIEELLGKKLLGTKISIKPAYIYKINEVKK
                     IAEQSHMLATEYRHQNGNSDVVIGTPNEALLNSTQVASQIIGSNPEIEVSNQNSSSIA
                     NVAETNGNVGDTPITKLDSRNNIKIVNIGNPQDKTKKNQPNDNKELNKIDLETKNDSL
                     HLESICDPIISIDMSGMTKQSVGSNKKKNKKKKSARGKEVRKLSVSNTTTQ"
     gene            <500858..>504370
                     /locus_tag="CAGL0D05258g"
                     /db_xref="GeneID:2887085"
     mRNA            <500858..>504370
                     /locus_tag="CAGL0D05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445638.1"
                     /db_xref="GeneID:2887085"
     CDS             500858..504370
                     /locus_tag="CAGL0D05258g"
                     /inference="similar to AA sequence:UniProtKB:P38989"
                     /note="similar to uniprot|P38989 Saccharomyces cerevisiae
                     YFR031c SMC2 chromosome segregation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445638.1"
                     /db_xref="GeneID:2887085"
                     /db_xref="GOA:Q6FVV6"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV6"
                     /translation="MKVEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDA
                     ICFVLGISSMATVRASNLQDLIYKRGQAGVTKASVTIVFDNTDKSNTPIGFSEYPKIS
                     VTRQIVLGGTSKYLINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE
                     ILSLIEEAAGTKMFEDRKEKAERTMQKKETKLQENRTLLKEEIDPQLEKLRNEKRLFL
                     EFQTIQADLETTEKVVIATDYQKMLNSRDSIKTVLETSNSKMDELQKKIDLVNREISN
                     LNEDLQQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNILDGKQKQK
                     RLTVKIEKSKQLLDSKSQLLEDSKSKSRNCEADLTRLNSIFKQKEELLSVLSTGISST
                     GGTEGGYEAQISSVNDKINDNSIEIEKNKMKIELLKKEFMENEEKIGKSQLQVETHMK
                     ERKQLTEICKKLEEDIFSHGFRPEAFKELKNREYELDQAIYKTNRDCEGLRRRVAGIE
                     FQYSKPFESFDPNSVKGVTAELFSIPEQNMKYVIGLQICAGGRLYNVIVDNEKTGSAL
                     LQKGRLRKRVTIIPLDKVISRPLNQNKLKLAKQLAPGKVELALNLIGYSDEVVKAMEF
                     IFGNSLICDDAETAKKITFNPGIRTRSITLEGDIYDPEGTLSGGTRNNTNTLLVDIQQ
                     YNTLKKELLAMNEEKQNIHKQLKILEAKSNETSNLQKELSLKKHRLDILERTMNSEPS
                     LMMQNRNGEIENEVKTLEDSTKQKMLENSSLEAEIEKLRKDMVDFSKNKGAKLKELKA
                     EVHELNEQIKDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEE
                     IKINKMLKTSEEELMSVQNDLNVERKRISNIDDELEELERTIKQKEESKNTYELELKQ
                     LHHDLSKYKNSTDGIEKALNDIQEEHEWVTDEMLVRSICEQNAGVNVNEYRHRMEQLQ
                     KNFDELRRKVNPNIMNMIESVEKKGEALKTMIRTIEKDKKKIEDTISKLNEYKKETLV
                     KTWKKVTKDFGNIFCDLLPNSSAKLVPCEGKDITEGLEVKVKLGNLWKESLVELSGGQ
                     RSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKE
                     GMFTNANRVFRTRFQDGTSVVSIM"
     gene            complement(<504512..>507604)
                     /locus_tag="CAGL0D05280g"
                     /db_xref="GeneID:2887083"
     mRNA            complement(<504512..>507604)
                     /locus_tag="CAGL0D05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445639.1"
                     /db_xref="GeneID:2887083"
     CDS             complement(504512..507604)
                     /locus_tag="CAGL0D05280g"
                     /inference="similar to AA sequence:UniProtKB:P39692"
                     /note="similar to uniprot|P39692 Saccharomyces cerevisiae
                     YFR030w MET10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445639.1"
                     /db_xref="GeneID:2887083"
                     /db_xref="GOA:Q6FVV5"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV5"
                     /translation="MSVVNPFEGPYGPATDAINAVLTAQVKDVFGYRTFSQSDLLFPG
                     DEKAHIRQLDVRAGAGATPLGYASGKAGRAGLVGIIAPSYSLPYFHRALAQAGDSRVV
                     LNVGALGYDSESGAVTNDYVTALDSAAKLGYGVVTPVSTKEVAATTLLTVAVSKFAKA
                     RGAVHLFDGLNYSRAIGVVPALDFDKQADIIKKLEKLLPSIDSNSFEDVLGKFNEVSG
                     LKIHNFQTQNVESAEVIYVTHGSLESELFIDAVKNSFQSNVGVIAVRVPLPFNVEKFT
                     AVIPKTAKKIVVIGQSLTGDSSSLLKSRVSAALFYSNRRDIQVSEYLYKPDFVWSPAA
                     IKQIIETFSPVDTISIGEDSKGTSKSFIYWASDKSINIDLASKLALSFSFTSGSHISF
                     RSKYDNINNAGTYQAQLVNSDHETAILSNIDAADVSIVEDSALLNHFNIIATIKKGGV
                     LVVATSKSTKDVDLSQVESYTENLKFPVHFLNAVAERNINLYVVDKTAIESERFIGYI
                     IQALVWNLTTKRGLEQHIQDVWNSASAEDKTTAPEFADQILKGVESSVKVISTDLYPD
                     FAKLEEPVEEKAETDEEEEDEIRELPIFPIETSFNVSQSSQKLYPEAEVNSKSSIAKA
                     LAFKEAYETTEELRPDLPVKNFVVKVKENRRVTPEDYDRYIFHIEFDISGTGLKYDIG
                     EALGIHARNNEEQVREFLKSYGLDETDIVFVPNKDNNGKLEASSVLHAFIDKLDIFGK
                     PPKRFYEALVEYATDEEEKKKLQKLVTPAGAVELKKYQDVEYYTYADIFELYPSARPP
                     LEELVTIISPLKRREYSIASSQKVHPNEVHLLIVVVDWIDNKGRKRFGQASKYISELS
                     VGSELVVSVKPSVMKLPPSPKQPVIMSGLGTGLAPFKAIVEEKLWQKEQGEEIGEVYL
                     FLGSRHKREEYLYGELWEAYKDAGIITHIGAAFSRDQPQKIYIQDRIRESLPALKSAM
                     VDKEGAFYLCGPTWPVPDITQALQDIYAADAGEKGLKVNLGDIIEELKESSRYILEVY
                     "
     gene            <508364..>509071
                     /locus_tag="CAGL0D05302g"
                     /db_xref="GeneID:2887156"
     mRNA            <508364..>509071
                     /locus_tag="CAGL0D05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445640.1"
                     /db_xref="GeneID:2887156"
     CDS             508364..509071
                     /locus_tag="CAGL0D05302g"
                     /note="highly similar to uniprot|P38145 Saccharomyces
                     cerevisiae YBR256c RIB5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445640.1"
                     /db_xref="GeneID:2887156"
                     /db_xref="GOA:Q6FVV4"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV4"
                     /translation="MFTGIVELMGTVREYNPYDDTESGGQGVSITIENAHDILGDCHI
                     GDSIAVNGICLTVTEFDSDSFKVGISPETIRRTNVASWTPGSKVNLERAVSQEVRFGG
                     HYVQGHVDTVATIMSITNEGNSILFGFKLRDAQYNKYIVEKGFICIDGTSLTVTGIDE
                     DDTFFISMIKHTQEHVVMPLKSLGDEVNIEVDLTGKVIEKQIEVTLQSQIRDENSALH
                     AVIEKLIDEKVKKYLNA"
     gene            <509343..>509861
                     /locus_tag="CAGL0D05318g"
                     /db_xref="GeneID:9487980"
     mRNA            join(<509343..509405,509562..>509861)
                     /locus_tag="CAGL0D05318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999486.1"
                     /db_xref="GeneID:9487980"
     CDS             join(509343..509405,509562..509861)
                     /locus_tag="CAGL0D05318g"
                     /note="highly similar to uniprot|Q3E776 Saccharomyces
                     cerevisiae YBR255C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999532.1"
                     /db_xref="GeneID:9487980"
                     /db_xref="GOA:B4UMZ1"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ1"
                     /translation="MAGKVQPIHHDTQTVQQLTKEIAIAAGIGAVQGALISITTALLL
                     RRYSTIYRNVRTQVRVFYHISWISMGAVFRADKQLIKFQSKYYENEVKRRERILDEAA
                     ERGIFLEEESVAQSTVTK"
     gene            complement(<510087..>512450)
                     /locus_tag="CAGL0D05324g"
                     /db_xref="GeneID:2887058"
     mRNA            complement(<510087..>512450)
                     /locus_tag="CAGL0D05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445641.1"
                     /db_xref="GeneID:2887058"
     CDS             complement(510087..512450)
                     /locus_tag="CAGL0D05324g"
                     /inference="similar to AA sequence:UniProtKB:P38335"
                     /note="similar to uniprot|P38335 Saccharomyces cerevisiae
                     YBR255w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445641.1"
                     /db_xref="GeneID:2887058"
                     /db_xref="GOA:Q6FVV3"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV3"
                     /translation="MNSVREDESSKLQNLANLNTESNLEFGNVNPKRVKLLTKILMDN
                     KYGLLDDLNYSRPLISSADGIQAVGSGRDVPGYENAMNPMAQQITEQDVADSSGVNIQ
                     HLINQQKQLPITGTTKAISRTTKLKADRVRIYLDYYYGILERSIQVDRKDHKHEGVEG
                     VYNPLQIIRNRKLKKKNNDMPVRELGISKTPFIAIKQFSSKPNKKMPWFVDITEKHTD
                     MTWRTSHWDELIGPDGKPWSGKTKHHYSEKIRHRPHIHHHKKQSEKEEHEETENQKQS
                     QQNGPPQINIVGDSTSKGSNDIASYNSSTTDLGSSTSKFQAHSGTNEGTADISTVESE
                     GLAPPTKINSSNSPNESLLSDKRKSSPDSTKNNSNSGKSDDNLHSHLEINATPNTRRT
                     SINSISDQYSNQSVNSSKYGDKNHLHRLEKVIGKKPKKWSKSANKLSKKVNDVTGTTM
                     NIANIPEEIGAPINIVTNGLTDAVNKAITVNSGTNINGTLTGQNSLSNISHAKDLKEA
                     LKEGKNSKEGKSGSHGTETTKSVINSESSSNSSSGIIMGNVQYMSPAEALTNQKKSIL
                     LSDIPVEHLKTDNQFDTIAENSKDGGDDESSNELSIRANIKNTNVDWQLQRYWQDMKY
                     ISSTMTLMKHRRMTHDLVKKKEIHRRNMVKVDHDADATIASTTEVLNNYQNELVKVLK
                     IGNDWTSKLLNDYSIRVDSLISSSDRILSDINTTLTLKLKLFQENSERYGNSKVVHAP
                     KMTKLVYRLLEYTIVGFLWSVWLVVFIVKNIKLAVIVVLKIAKNVLW"
     gene            <513032..>513550
                     /locus_tag="CAGL0D05346g"
                     /db_xref="GeneID:2887145"
     mRNA            <513032..>513550
                     /locus_tag="CAGL0D05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445642.1"
                     /db_xref="GeneID:2887145"
     CDS             513032..513550
                     /locus_tag="CAGL0D05346g"
                     /inference="similar to AA sequence:UniProtKB:P38334"
                     /note="similar to uniprot|P38334 Saccharomyces cerevisiae
                     YBR254c TRS20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445642.1"
                     /db_xref="GeneID:2887145"
                     /db_xref="GOA:Q6FVV2"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV2"
                     /translation="MPQYFAIIGDHDRPLYEAEFTQGPQGFVQEIKELNPFILHASLD
                     IVEDLQWQQNAGTGVAGGAGNSFLRSRNNANTDNCYLGKVDHFYGLVVTAYLTYGGKK
                     FVMLHGSSVPGGNKTTTTTIDDSMVRSFYQEVHELYIKTIMNPFYQEGDELRSPLFDT
                     RVKALAKKYLGK"
     gene            complement(<513884..>514225)
                     /locus_tag="CAGL0D05368g"
                     /db_xref="GeneID:2887146"
     mRNA            complement(<513884..>514225)
                     /locus_tag="CAGL0D05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445643.1"
                     /db_xref="GeneID:2887146"
     CDS             complement(513884..514225)
                     /locus_tag="CAGL0D05368g"
                     /inference="similar to AA sequence:UniProtKB:P32570"
                     /note="similar to uniprot|P32570 Saccharomyces cerevisiae
                     YBR253w SRB6 DNA-directed RNA polymerase II suppressor
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445643.1"
                     /db_xref="GeneID:2887146"
                     /db_xref="GOA:Q6FVV1"
                     /db_xref="InterPro:IPR009332"
                     /db_xref="InterPro:IPR016530"
                     /translation="MSNQALLETLNQTTELLSVKLAELAKLASMETNEDTEDCQLSVV
                     TNGLMMVNNQTLQLVRGVQDLILLTRNIREKWLLTQIPEQLTPKEQDSINHEELTELL
                     ESCVSEIISDV"
     gene            516034..516104
                     /locus_tag="CAGL0D05390r"
                     /db_xref="GeneID:2887131"
     tRNA            516034..516104
                     /locus_tag="CAGL0D05390r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (GCC) cove score=62.73"
                     /db_xref="GeneID:2887131"
     gene            complement(<516301..>517269)
                     /locus_tag="CAGL0D05412g"
                     /db_xref="GeneID:2887126"
     mRNA            complement(<516301..>517269)
                     /locus_tag="CAGL0D05412g"
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /transcript_id="XM_445644.1"
                     /db_xref="GeneID:2887126"
     CDS             complement(516301..517269)
                     /locus_tag="CAGL0D05412g"
                     /inference="similar to AA sequence:UniProtKB:P33759"
                     /note="similar to uniprot|P33759 Saccharomyces cerevisiae
                     YBR251w MRPS5"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS5"
                     /protein_id="XP_445644.1"
                     /db_xref="GeneID:2887126"
                     /db_xref="GOA:Q6FVV0"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FVV0"
                     /translation="MMFQRMFREAPMASRITRQVRLSSTSRDHLLKYYPPNLIKSIEM
                     AEDVIYKGNSKPEFKVPSGVNFAPPYLEDYSKLHPFWDYAKNEPHIHMDSLNEEVRKY
                     QWDDINFQQNSKLPPGTFEKEIVEAHVGKNSGSKTAELARGLNRQTGIDIDYITKKLV
                     MKPLVLKRVSNQTGKGKIGSFYALVIVGDRNGMIGLGEGKSRDEMPKAIFKAHWDAIR
                     NLKEIPRYENRTIYGDIDYRYHGVKLHLRSAKPGFGLRVNHVIFEICECAGIKDLSGK
                     VYKSRNDMNIAKGTIEALIGAQKTLDDIAMARGKKLVDVRKVYYSS"
     gene            complement(<518042..>518767)
                     /locus_tag="CAGL0D05434g"
                     /db_xref="GeneID:2887244"
     mRNA            complement(<518042..>518767)
                     /locus_tag="CAGL0D05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445645.1"
                     /db_xref="GeneID:2887244"
     CDS             complement(518042..518767)
                     /locus_tag="CAGL0D05434g"
                     /note="some similarities with uniprot|P25042 Saccharomyces
                     cerevisiae YPR065w ROX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445645.1"
                     /db_xref="GeneID:2887244"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU9"
                     /translation="MQSNVTLPPISQLLATLPSGLESKLVPGASISLTATSCGTPQPQ
                     VEAPSSPSSVASNNSSLSTASLSSLSSVCTAKSFFENRAYTTTSAMLNSNAVHKKMSF
                     SEDLRTTPLTAQNIALRGLEMNREKSNVSSMSSAVTKAASPRHIPRPRNAFILFRQHM
                     HRKLFPKLTKDKQKSSDNSSSFKTNSECSREIGQKWRNLDPEEKKYWNELARKEKEWH
                     RMKYPNYKYTPTKKNANSSPLVL"
     gene            <521445..>522071
                     /locus_tag="CAGL0D05456g"
                     /db_xref="GeneID:2887102"
     mRNA            <521445..>522071
                     /locus_tag="CAGL0D05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445646.1"
                     /db_xref="GeneID:2887102"
     CDS             521445..522071
                     /locus_tag="CAGL0D05456g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445646.1"
                     /db_xref="GeneID:2887102"
                     /db_xref="GOA:Q6FVU8"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU8"
                     /translation="MEKELKNGTFEPSLKHSCAKKRASRIFFSVRENVFAAQYREKLE
                     ITDFTFQAETGSQDLCFEKPKKCPGDVTTASHRRHSDVYRHSDITVTSPGHFRHDPVS
                     NKPVRAPIFPPYQLPGRKAERADGHFVFFSFLDPRWIRNSGHYSRTFFPNVLFVYFYF
                     PHDYAFEPHTMDGVILPPPLPRRMREKERRETLQTITEQIPSIYQIFF"
     gene            <522559..>524733
                     /locus_tag="CAGL0D05478g"
                     /db_xref="GeneID:2887103"
     mRNA            <522559..>524733
                     /locus_tag="CAGL0D05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445647.1"
                     /db_xref="GeneID:2887103"
     CDS             522559..524733
                     /locus_tag="CAGL0D05478g"
                     /inference="similar to AA sequence:UniProtKB:P41895"
                     /note="similar to uniprot|P41895 Saccharomyces cerevisiae
                     YGR186w TFG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445647.1"
                     /db_xref="GeneID:2887103"
                     /db_xref="GOA:Q6FVU7"
                     /db_xref="InterPro:IPR008851"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU7"
                     /translation="MSSGRGIRTAGGRSGDGPSDASPFIKPDRMRRNFLRNRRNKNIM
                     VKKNDPEDIESREKMMLMGGVEGVKQEEVKPDLSALKDKDNEVYNEFPLRAVSREALE
                     NMRTHLLKFQSKKRIQPTENFHLPVRLHRKDTRNLQFQLTRAEIVQRQKEIAEYKKNQ
                     DGSNAQNMTKPKTTPAALTDHPTASNAPAAPLVNSSATMPTGATPTGQVVASATPTPQ
                     VSLDEKPMGGPVNAVSASATPGPATTNGATPANGTTDPAQPTVPGATILEDAGPAEDP
                     TKVGLVKYDGKEMDSADLAEEPTVDPMADVAPDGGGRAKRGGLRRKTRQLKVLDENAK
                     KLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTAR
                     NKYATLTIDEAEKRMDKKSGEVPRWLMKHLDNIGTTTTRYDRTRRKLKAVADQRTADD
                     EYNHSDNSENELDYDEEFADDEEAPIIDGNEQENKESEQRIKKEMLQANAMGLRDDEQ
                     VSEAEDTELFGEKKIDEEGERIKKALQKTELAALYSSDEDEINPYLSESDLEKEDEAE
                     KEESEDSQSKKGSPKKQEGKSRQGTPSAHTVREQNIRVKSIKDCVIVLKGKPSLLTSF
                     PAGAWNPNAVSLKRTADEVSIKKEPGSESPNKKIKVENGEIPLITEQDIINAMSGGKV
                     NVKEFGKKIRKMFPGPENKKLMFVLVKKLCRKVDDEHMELKA"
     gene            complement(<524950..>526083)
                     /locus_tag="CAGL0D05500g"
                     /db_xref="GeneID:2886971"
     mRNA            complement(<524950..>526083)
                     /locus_tag="CAGL0D05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445648.1"
                     /db_xref="GeneID:2886971"
     CDS             complement(524950..526083)
                     /locus_tag="CAGL0D05500g"
                     /note="highly similar to uniprot|P48362 Saccharomyces
                     cerevisiae YGR187c HGH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445648.1"
                     /db_xref="GeneID:2886971"
                     /db_xref="GOA:Q6FVU6"
                     /db_xref="InterPro:IPR007205"
                     /db_xref="InterPro:IPR007206"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU6"
                     /translation="MPTQLEELVSFLHSPQPAVRQIALDNLVGFSTGPSASIFKYDNY
                     RALDDLKVLMKEKSRTLVQQSATVLANLCDDAVMRKKLADDKEFLEYLTWKICDLGNT
                     SSDIMCILLSNLSKEDSITYVFEIVREDNDKDLPPLDKDVFKSKRVIDCLMDCFVKGY
                     DRELNKFANYDYLSYFFADVSRFKIGRTYFIETQEYDGVVPISKLLVFTEKYDSKTRR
                     EGVASTIKNSLFDSETHERILTDEEINLLPYILLPIASAKDSEIDEEDMFNLPDELQL
                     LPEDKTRDPVPSIVCTHLESILLLCTTKAAREFMRSKSVYPLIRELHKNVEDEDIGEL
                     CYRIVNMLMRGDPNAPVEEMPAKSVEDGDDEDEDDEDALMEVA"
     gene            <526539..>526862
                     /locus_tag="CAGL0D05522g"
                     /db_xref="GeneID:2887091"
     mRNA            <526539..>526862
                     /locus_tag="CAGL0D05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445649.1"
                     /db_xref="GeneID:2887091"
     CDS             526539..526862
                     /locus_tag="CAGL0D05522g"
                     /inference="similar to AA sequence:UniProtKB:Q12431"
                     /note="similar to uniprot|Q12431 Saccharomyces cerevisiae
                     YLL014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445649.1"
                     /db_xref="GeneID:2887091"
                     /db_xref="GOA:Q6FVU5"
                     /db_xref="InterPro:IPR008504"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU5"
                     /translation="MSTDESYSSLNSGSNIMINKKSLLYVQDSTSLVFGLAAGILQLE
                     SWDGFLAFLGCYTTVCLIFILWTCQLKPQKFFQSPIQDIFIESLFRELTGFVMAWTFS
                     YALVG"
     gene            complement(<527482..>530217)
                     /locus_tag="CAGL0D05544g"
                     /db_xref="GeneID:2887232"
     mRNA            complement(<527482..>530217)
                     /locus_tag="CAGL0D05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445650.1"
                     /db_xref="GeneID:2887232"
     CDS             complement(527482..530217)
                     /locus_tag="CAGL0D05544g"
                     /inference="similar to AA sequence:UniProtKB:Q07807"
                     /note="similar to uniprot|Q07807 Saccharomyces cerevisiae
                     YLL013c transcript-specific regulator of mRNA degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445650.1"
                     /db_xref="GeneID:2887232"
                     /db_xref="GOA:Q6FVU4"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU4"
                     /translation="MMPNDGVWGSPADGAHADLLHSLSKTNSRTSDDHNMSTNSYLSL
                     SSMAYGNNANQGHLVDASIDAELASIVSSLSALSHTNTNTMPQQQQQQASLLSSPNLQ
                     KIGTATSSNIGGFRRSSFTSDHNYGPEHIVSETPTASLSVGTAPPYYYSYSNQNNGGN
                     TAGSAGNMQGLTTSLSSQRLNYLNSNQYSASIAGPILFHSNNNGSVSGQNNNQQMGAN
                     SGFFEKFGKTIVEGTKELESANYANDTDTIHSSKSYTSLHNNENTPVVEPIPNHQQAA
                     YLSTSAIDDTASSSSSNSQLTLESPDYVNSNMNMRKGPGGVWKNFTDSQSFKPNHFGP
                     LPYPNFQSPHPNFPMFNPFLPMGIQNHPPGLNNNNNVNINPANTNPGNDTVNRDPNLA
                     NTETQQEQINAQNLNENGDHNLNNSNASPYYYYPINIPNEAQQPINSNASTAPKKKRG
                     GDKKALHKQQQGNMNPYLDSHHQLQRPFAQKKGQTPTSPPAARPMSPLSNQPINFYKK
                     QQQPPSGQSAGTQRTTSSASNSSSQNSKNTANNNNNFHRSALLEELRANPTNTDLTLK
                     SIYGHALEFCKDQHGSRFIQKELATAPPPERELVFNEIRDHALSLANDVFGNYVIQKF
                     FEYGSKTQKDILVEQFRGKMEELSLQMYACRVIQRALEFIDAQQRIDLVRELSHCVLQ
                     MIKDQNGNHVIQKAIECIPIDLLPFILNSLEGHIYHLSTHSYGCRVVQRLLEFGTLED
                     QKRILEELKDFIPYLIQDQYGNYVIQHILQHGSDVNLASEHMRVIKQEIINNVADNIV
                     EFSKHKFASNVVEKAIIYGTDDQKIQLMKMILPRDKEHAANLEEDSPLILMMRDQFAN
                     YVVQKLVVVSQGDDKKLIVVAIRAYLDKLNKSASSGNRHLASVEKLASLVESVEI"
     gene            <531295..>532704
                     /locus_tag="CAGL0D05566g"
                     /db_xref="GeneID:2886989"
     mRNA            <531295..>532704
                     /locus_tag="CAGL0D05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445651.1"
                     /db_xref="GeneID:2886989"
     CDS             531295..532704
                     /locus_tag="CAGL0D05566g"
                     /inference="similar to AA sequence:UniProtKB:Q07804"
                     /note="similar to uniprot|Q07804 Saccharomyces cerevisiae
                     YLL012w or uniprot|Q07950 Saccharomyces cerevisiae
                     YLR020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445651.1"
                     /db_xref="GeneID:2886989"
                     /db_xref="GOA:Q6FVU3"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU3"
                     /translation="MIVSLCRKVFSLVVLHAALTVITVLALVKHFLAIYWINSTTHED
                     SRDTRPASFAKVIDSNLKAINRDEQTTASDQQRTGGDYIHFDHATNNPFDNLILAEDL
                     NLVPNLQYYYNQYNIDIEEFKVLTNDGFLIDLWHLKSRDYKYGAGSPGPRPYEREPVL
                     MLHGLLQSSGSFASSGRKSLAFHLNDCGYDVWLGNNRCGFKPSAKTKLKDFWNWDMTD
                     MVKHDLPALIDFILHQTNRKKLHLVAHSQGTTQGFMALINHNHEYPFSSKIAKFVALA
                     PAVYPGPLLDEKLFVRLMVKYIDSPWVFGNKSFLKTMMVARDLLIGQSSFSFICYVFF
                     NYLFDWNDSLWDKSLRDRHFLFSPVHISVKLMQWWLSPDPNKVSFKNCSHVLFPDDKS
                     WFNKDIDFDENRTNILMIFPRQDRLVDGERLINHFVYHENHNSFKIWYIDEYSHLDVL
                     WAHDVIERVGKPMIDFLRE"
     gene            <533235..>534668
                     /locus_tag="CAGL0D05588g"
                     /db_xref="GeneID:2886998"
     mRNA            <533235..>534668
                     /locus_tag="CAGL0D05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445652.1"
                     /db_xref="GeneID:2886998"
     CDS             533235..534668
                     /locus_tag="CAGL0D05588g"
                     /note="highly similar to uniprot|P33750 Saccharomyces
                     cerevisiae YLL011w SOF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445652.1"
                     /db_xref="GeneID:2886998"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU2"
                     /translation="MKIKTIKRSADDYVPVKSTQESQLPRNLNPELHPFERAREYTKA
                     LTATKLERMFAKPFVGQMGHGHQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMSSREQ
                     IASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDND
                     QVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPRINLWDINRSKPLSDLSWGADN
                     INTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMRVNSMCWNPMEAFNFVV
                     ASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPTGEEVVTASYDKTIRIFPINKG
                     HSREIYHTKRMQHVFQAKFSMDSKYVMSGSDDGNVRLWRAKAWERSNVKSTKELNKLQ
                     YDEKLKERFKYMPEIRRISRHRHVPKVIKKAQEIKNIEIRSIKRREANERKTKKDKTI
                     VPERKKQIVGTVFKYEDKRRKDDDDEN"
     gene            complement(<534849..>536192)
                     /locus_tag="CAGL0D05610g"
                     /db_xref="GeneID:2887089"
     mRNA            complement(<534849..>536192)
                     /locus_tag="CAGL0D05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445653.1"
                     /db_xref="GeneID:2887089"
     CDS             complement(534849..536192)
                     /locus_tag="CAGL0D05610g"
                     /inference="similar to AA sequence:UniProtKB:Q07800"
                     /note="similar to uniprot|Q07800 Saccharomyces cerevisiae
                     YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
                     YLR019w PSR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445653.1"
                     /db_xref="GeneID:2887089"
                     /db_xref="GOA:Q6FVU1"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU1"
                     /translation="MDIISSFFCCADEQVQESGQRKTMNTERTESKPSNRRDLPRNNG
                     DSRQVRSAELYKEENTDTTVSSGSTPKLRDSDSNKKKGDRSRDNAHMDRKHANNKSHI
                     NDADAAENSQKRHSTRRSQVNGKTHDKKRLADSDNKKGDDDVDEITEEEVPVPVNKNS
                     SKKSTSNNSNNVKPSGSDLEKSNSNMDGEKYKKLSTEEEEELANQLEYGTKLSQVNSV
                     GSDNSEENYDSVPTYDEEDLDEVEEEEEYIDLTVLQPGQYHAPGLDTLLSPKGDAFKH
                     KKCLVLDLDETLVHSSFKYLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQRVGELYE
                     VVVFTASVSRYGDPLLDVLDKSNNIHHRLFRDACYTYEGNYIKNLSQIGRPLSEIIIL
                     DNSPPSYIFHPQHAIPISSWFSDSHDNELLDILPLLEDLAKPSLPDIGKVLDVTI"
     gene            complement(<536855..>537022)
                     /locus_tag="CAGL0D05632g"
                     /db_xref="GeneID:2887090"
     mRNA            complement(<536855..>537022)
                     /locus_tag="CAGL0D05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445654.1"
                     /db_xref="GeneID:2887090"
     CDS             complement(536855..537022)
                     /locus_tag="CAGL0D05632g"
                     /inference="similar to AA sequence:UniProtKB:Q12287"
                     /note="similar to uniprot|Q12287 Saccharomyces cerevisiae
                     YLL009c COX17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445654.1"
                     /db_xref="GeneID:2887090"
                     /db_xref="GOA:Q6FVU0"
                     /db_xref="InterPro:IPR007745"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="UniProtKB/TrEMBL:Q6FVU0"
                     /translation="MSEPQKEDKPKPCCVCLPEKEARDQCLLFDGQESAKCKELIEKY
                     KSCMKTYGFNI"
     gene            complement(<537378..>538337)
                     /locus_tag="CAGL0D05654g"
                     /db_xref="GeneID:2887189"
     mRNA            complement(<537378..>538337)
                     /locus_tag="CAGL0D05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445655.1"
                     /db_xref="GeneID:2887189"
     CDS             complement(537378..538337)
                     /locus_tag="CAGL0D05654g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445655.1"
                     /db_xref="GeneID:2887189"
                     /db_xref="GOA:Q6FVT9"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT9"
                     /translation="MRMVRSTLLCCLWFTTVICSLLQPLKLEIIQPVTYHKLERLFYR
                     IEQIGIDGETFRIWTLSGYHNIANEQSNFKYLTTKFVDSFERVLALRGLATRNISLNS
                     LKIQACIIDKIKTQELINTAVELDYLAVTNDIKINNTKYVIKVIFDNIAKNYLGYYLW
                     RLEWLTQRNSQVTEQELYYIYTRVETMVSLVKDKLNQLYSLPLTKFMESVLIPMDGLN
                     CNMSQVVDCLKKRRKKEECRDSKDHKCLESLFHLTFVTLIIPIPLVVLYRVCSVSAGY
                     VCVEGIGVLGLLITKSLTSQFFYLLFTRVKHDCLKWLFEVERL"
     gene            complement(<538678..>540639)
                     /locus_tag="CAGL0D05676g"
                     /db_xref="GeneID:2887094"
     mRNA            complement(<538678..>540639)
                     /locus_tag="CAGL0D05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445656.1"
                     /db_xref="GeneID:2887094"
     CDS             complement(538678..540639)
                     /locus_tag="CAGL0D05676g"
                     /inference="similar to AA sequence:UniProtKB:Q07799"
                     /note="similar to uniprot|Q07799 Saccharomyces cerevisiae
                     YLL007c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445656.1"
                     /db_xref="GeneID:2887094"
                     /db_xref="GOA:Q6FVT8"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT8"
                     /translation="MTIDDADINNELSKVLESATENSLSADYAKCCFEYLRNSARDQK
                     SSSFQHLIWQFVSACPDDVLCSQIIPEDDFWDLIKDCATNMEPELLSSILNYLFNIFL
                     SGQDVHELGFTSLCNHLQKRHNIMEYILINLSLHSLHVNLVADTLRCIASFLKCSMLL
                     SKYDAEKAISIVPSICFLLLEYNFPTVVTLLLSIDELRPLIIDEYLPVKMQLAKFLES
                     KTLQQASIELKQNLYHAIRNTNIFLRSYEMEFGSLNDSMAELNQLNTLQVYDMLSFLD
                     NSNTVFIKNLTEQLLFKSSPFPFFKVIFEVSSEMQNFLNRFDEDDDSKISMAGHILNR
                     ESLLESLMCCILRFWSESQSTSRNDMDSLLQLVPIILDKMYCSIRDTNLKRSGSAFEV
                     GIELLESFDYSTARLWQLEMIRNLHYQQWSGQISGFVDILSNQVHDYVRHQRLLLLQK
                     GTWAYSENPIDEGSTNPRVYFIVVSDNHANLLARRFDHKLDETPFVEDNVICTKSEAN
                     SFPNPNSTIVVPIKIIDSFASKELRAENNAAEVPQVVNISKKNIYTEVKLLDKSQKCL
                     LQMYLDTKEAAYIWLDGLMLISKSKSRANISENTKSQIKTLIDLRKDVQLLNLPFHQE
                     LQESPEDIDEEEFYDLDTLKNLPNEFYYQ"
     gene            <541045..>542340
                     /locus_tag="CAGL0D05698g"
                     /db_xref="GeneID:2886986"
     mRNA            <541045..>542340
                     /locus_tag="CAGL0D05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445657.1"
                     /db_xref="GeneID:2886986"
     CDS             541045..542340
                     /locus_tag="CAGL0D05698g"
                     /inference="similar to AA sequence:UniProtKB:P41800"
                     /note="similar to uniprot|P41800 Saccharomyces cerevisiae
                     YLL006w MMM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445657.1"
                     /db_xref="GeneID:2886986"
                     /db_xref="GOA:Q6FVT7"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027537"
                     /translation="MVSALEVKSIKDSNETLISLDDYIRNTLPSQLHEILLEEFQNQD
                     FSRGQDVSNSTHDQMIDHTLELTSDLLRNALDKQLMEVQSRTLPVRQSNQLISWSFAQ
                     GLIIGQLSVVIFLIFFVKFFIFTDASSKMDNPLPSKVSKSYLKNRRESSSIKDKRKGV
                     LVKEESGETDLHGSLQLNDILEKTYYNVDTHSAESLDWFNVLLAQMIQQFREEAWHKD
                     NILTSLDSFIQKRSSDLPDYLDKITITELDIGEDFPIFSNCRIQYAPNSSDKKLEAKI
                     DIDLNDKITFGMSTRLLLNYPKKCTAALPIDLAVSMVRFQACLTVSLITAEELEFTTG
                     NKIDDNEKNGYYLVFSFTPEYKIDFDIKSLIGARSKLENIPKISNIIEYNIKKWFAER
                     CVEPRFQSVKLPGMWPRSKNTREEVIHKTEDESSKTPHS"
     gene            complement(<542407..>545052)
                     /locus_tag="CAGL0D05720g"
                     /db_xref="GeneID:2886991"
     mRNA            complement(<542407..>545052)
                     /locus_tag="CAGL0D05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445658.1"
                     /db_xref="GeneID:2886991"
     CDS             complement(542407..545052)
                     /locus_tag="CAGL0D05720g"
                     /inference="similar to AA sequence:UniProtKB:Q07798"
                     /note="similar to uniprot|Q07798 Saccharomyces cerevisiae
                     YLL005c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445658.1"
                     /db_xref="GeneID:2886991"
                     /db_xref="GOA:Q6FVT6"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT6"
                     /translation="MDAAIKDHKCVATSNDIYVDTKSWNLTHKLISSFLNTARAGSAH
                     KDADMSVNSFFLGIGASAGYFLFQLFAFSLLRRIASNIYQSNSVLRRYENNSTLDFSN
                     RNPSIWERFTSKYVPRIFKESIDNYEAIVGLDGFLFMRFLKKLILLFSLLSLGIVPVL
                     IPLHLTSSDNNKNDLTRVFNSTQPQSNRIDKINMSNISMKKSDRLVCHFIFALIIIVA
                     FQFFIVAELKYAYGKINTTVITKSYQNIVFVDNIPAEVLKDDSKIMEYFNKIQPNSVV
                     AAARLPNNIFEIRKTHKNIERHAYIIEKIISKIILEKFFKVGHLLLSTNDPSVEIPPT
                     SLMVLSYHQLCQKILFNLRSFDKYFYCELKFKLQKIKPSKYFVYIPQFKRKSALEYQY
                     DSLDREIHYYQKYLDLWLTYFPKKNEPDSSTIPGNEKMQEYSNKAFLLFNSVSQAMQF
                     YQLLQSSSVCQWNYPMIGAHPKDIIWINIVGRNPITITLRKLAGRLIGVLVILGWIVP
                     IAFIGLVTQIPYLTNLLPYSNHFNVTSKCLRDVTKAVFPLVTLIFLTEFVPYIFRVIS
                     YLKGCRTGAEIEMDIQRWFFMFLLVHIFFVVTISSGLSLLLEKLLISPVSIPNILAHD
                     LPKSSNFFCSFILLRGFAYSGGNIIRLKELFFEIVYYRPRMPTPHNKMQRLKKNLFFQ
                     WGSIYPLFTVIGCICIIYSIIAPFILPLAVLSLSLVYYSFKYLFIYQFNSENISETHG
                     KLYPEALSQLYAGIYCMELSLIGLFALFNCYKLSTSMAFMSILTVLIHAEISKKFIRR
                     LHNLHLNSLHDYTSSDSISPRAESLESYIFPPITNEIWVPTDQMGIAENERPYLQASL
                     SLKCDFEKAYITKFGNICINPDISE"
     gene            complement(<545384..>546838)
                     /locus_tag="CAGL0D05742g"
                     /db_xref="GeneID:2887013"
     mRNA            complement(<545384..>546838)
                     /locus_tag="CAGL0D05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445659.1"
                     /db_xref="GeneID:2887013"
     CDS             complement(545384..546838)
                     /locus_tag="CAGL0D05742g"
                     /inference="similar to AA sequence:UniProtKB:P41543"
                     /note="similar to uniprot|P41543 Saccharomyces cerevisiae
                     YJL002c OST1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445659.1"
                     /db_xref="GeneID:2887013"
                     /db_xref="GOA:Q6FVT5"
                     /db_xref="InterPro:IPR007676"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT5"
                     /translation="MKAFAINWAFLFLFLGQVFGQAQEQKPYSGEASEKLAQEKPEWE
                     NLEYQRYLDLSGTGLAEEIRIVAKNVGDKPATDYHMLLPRNVIDNLSVFTATADNSSF
                     VSFRALSATLKQLNNTAIGYGFLGLPRSVEPGETINLRLIYKFNDCGTPKPKKIGLGE
                     DQFLVYETDRLPLSQYPTKMSILKITGSTDMSELDIGSVPEEYQGTFDDNVMTFGPFE
                     DINALNVENKIKLRYLHNLALNEVIYLKRDIWVSHWASTIQFVEYNEYHNKGAELKNG
                     FSRLEVMKNVQAANSPTVRGIIENHLPEQATEHYFVDKVGQVSTSQVLNNLFYLKPRF
                     PIFGGWFYNYTIGWTNELSDFLRVSDMDSEEFILAVPLLNGPKDTAYDEVEYSVYLPE
                     GATVIDTKSPLPVVQTTTSFESSYFDLKNGHTKVTLKFRNLVSELADGKILITYKLTN
                     ANFYGKFLNISLYGFIALMAIFLLNSINLRVSKN"
     gene            <547259..>549880
                     /locus_tag="CAGL0D05764g"
                     /db_xref="GeneID:2887174"
     mRNA            <547259..>549880
                     /locus_tag="CAGL0D05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445660.1"
                     /db_xref="GeneID:2887174"
     CDS             547259..549880
                     /locus_tag="CAGL0D05764g"
                     /note="weakly similar to uniprot|Q12369 Saccharomyces
                     cerevisiae YLL003w SFI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445660.1"
                     /db_xref="GeneID:2887174"
                     /db_xref="GOA:Q6FVT4"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="InterPro:IPR018907"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT4"
                     /translation="MNNEEGSVSTEALLNGDLDAATDSLIAGNVSSLMDKVHISHPVG
                     ESINTIRGGNRSTEYQVVTDSWDVLRDMLDPFFQRIAKFLELNGLSPTFLSVFKIYLR
                     ILKDNNLDPLADDYLLCLQNELGRSLVMSSVLEELLVYFLIRPANMYISMALFEHKQN
                     RSISFSYLKQMESIYLLKSQERKMLLARDHALILRILERWRDELDVKGNLWYEKANEF
                     KDVCSKILGYDLWMKKAESNQNKMKLADEYFMDKSLKRVIKSLQKLKNAEQSLQFVQD
                     KIMLKHYMQIWQLSHRSKQFSVRNNNIMKISIRKWLNRIQCATSKCKIAYRFRERHEI
                     QIAFTRFKNEYDRRQHYNEGLEERGDQLIKRKSFKIFLHTFELRKLLRNVLIRNEYNS
                     QRKYMEIWKRRTNQIKLADDIRLSQLVRKSNQIISMWHKNVILEQLLTKHNTDKLRKQ
                     FILKWRLATKYKVFMRNTDKLLKLHKLEIWKSNSRDLQRANHFRKTKMLQNTYTNLTK
                     IYGKINKMQRNSALLCEYHLKRNTLLQMKIFENKKVVLMGRQQRFVKVKYWKIIKDIY
                     DTDIALKNLEATSLSAKLSRLLLKRYFRIWMENYQDVREIKLTVIENEVTKIMHDHLK
                     KRFLKTLLFAVYAIEADKTYERSLKLNVYLKWLVNSESLKENERQLTTLLAKQKIRHH
                     YLLWKEHSKKVNQLNIILDNKKSTLSSHHLHKYLQIWSNRLKNNSSLIEKIQLRWSRA
                     LLRGCLQSWKEKSKNRGSASLSDELDTAYKTPHRENVRKYDVLNFSDAKYRQAMRTKK
                     IASPIKASSVLESVLKRRVDNPYKLTDENATQMTIENGKEQMKKIESSISKLAFSDVP
                     QLTPNDARLRGSPGRRA"
     gene            <550165..>551436
                     /locus_tag="CAGL0D05786g"
                     /db_xref="GeneID:2887175"
     mRNA            <550165..>551436
                     /locus_tag="CAGL0D05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445661.1"
                     /db_xref="GeneID:2887175"
     CDS             550165..551436
                     /locus_tag="CAGL0D05786g"
                     /inference="similar to AA sequence:UniProtKB:Q07794"
                     /note="similar to uniprot|Q07794 Saccharomyces cerevisiae
                     YLL002w REM50 drug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445661.1"
                     /db_xref="GeneID:2887175"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="InterPro:IPR016849"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT3"
                     /translation="MLQAILKEVLPQDSSFEILHLQSPPSESAPLVNNTSKQNRATTI
                     KTEHLFCLAYKGRIFYGLELYVYITCNHDNEVEKTERLVFVSKADTNGYCDIRVNIKL
                     VTLQLIRYVLSINPDYYLHRVIPKERDYKKSGRTNLITKATNSRKALKILADRLQNHN
                     LIEPEIFNAFYTKFHSGKELVTKIALFTRPADQYLFPNSSKNPNKHNLDGDGLLKWWA
                     SLLDNLLVSDFNLNKTKAKIRIPGEDKYRFRRYTNALKCGIWTHGDIFSDNDSDSVIK
                     CIPMFPDDPKSRFMKQLFEENRIQTTSLDTFWTELQERQEFKLSVVVSVMGISGIYEI
                     DTNYKPSTDVYRCRSKRQFHCIKNYITGEEYDTEEGALESYQNVNDYLSREGTSLLTV
                     TGNADYSKFKQNRTTTSTPVVVNTLQVRRKK"
     gene            <552040..>554370
                     /locus_tag="CAGL0D05808g"
                     /db_xref="GeneID:2887064"
     mRNA            <552040..>554370
                     /locus_tag="CAGL0D05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445662.1"
                     /db_xref="GeneID:2887064"
     CDS             552040..554370
                     /locus_tag="CAGL0D05808g"
                     /note="highly similar to uniprot|P54861 Saccharomyces
                     cerevisiae YLL001w DNM1 dynamin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445662.1"
                     /db_xref="GeneID:2887064"
                     /db_xref="GOA:Q6FVT2"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT2"
                     /translation="MASLEDLIPTVNKLQDVMYDSGIDTLDLPILAVVGSQSSGKSSI
                     LETLVGRDFLPRGTGIVTRRPLVLQLNNISASSPLIKENPDLIMSLNNASRSQSSLNG
                     FQNNNESTTSLNDNNGASSAIGGSNATEIRRDEWGEFLHIPGRRFYDFSEIRREIESE
                     TARIAGKNKGISKIPINLKIYSPHVLNLTLVDLPGITKVPIGEQPPDIEKQIKNLILD
                     YVATPNCIILAVSPANVDLVNSESLKLAREVDPHGIRTIGVITKLDLMDSGTNALDIL
                     SGKLYPLKLGFVGVVNRSQQDIQMNKTVEEALNKEEEYFNRHPVYRTMSHRCGTRYLA
                     KLLNQTLISHIKEKLPDIKTRLNTLISQTEQELSQYGDTGDITKENRAGLVLQLMNKF
                     ATAFISSIDGTSSEISTKELSGGARIYYIYNNIFGNTLKSIDPTTNLTILDIRTAIRN
                     STGPRPTLFVPELAFDLLVKPQIKLLLEPSQQCVELVYEELVKICHKCGTPELSRYPK
                     LKSKLIEVVSDLLRERLFPTRSYVESLIDIHRAYINTNHPNFLTATDAMSDIIQSRKR
                     NQENQRAQKMLEKEKQNEIQENGTASQNSKSDIEPSIDGTELDSSKDATKSKDTFLNY
                     FFGKDKKSQLSLSNRDGRFSELNGYKDDFSSQFQQLNFNSNLNSDDDAFENANHPKLT
                     EREDLECELIRRLIVSYFDIVREMIEDQIPKAIMCLLVNFCKDSVQNRLVTELYRESM
                     FEELLVEDQTLMQDRENALKSLEVYKKASALIGNIL"
     misc_feature    554532..554643
                     /note="Centromere Cen0D"
     gene            complement(<554761..>557355)
                     /locus_tag="CAGL0D05852g"
                     /db_xref="GeneID:2887055"
     mRNA            complement(<554761..>557355)
                     /locus_tag="CAGL0D05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445663.1"
                     /db_xref="GeneID:2887055"
     CDS             complement(554761..557355)
                     /locus_tag="CAGL0D05852g"
                     /inference="similar to AA sequence:UniProtKB:Q07895"
                     /note="similar to uniprot|Q07895 Saccharomyces cerevisiae
                     YLR001c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445663.1"
                     /db_xref="GeneID:2887055"
                     /db_xref="GOA:Q6FVT1"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT1"
                     /translation="MNIFVLIWFIGWTCAVGRNGRGQDEHDDFPFTTVVDILSQNVEF
                     STFLTLIQKGGYIPYLNELDNFTLWAPVNSAFVEDEQELLMGTFDIDNYIIRDCMVIT
                     SDIGNSTQFLSENVKFPFFLSRRSPESAYVNGIEIIEPDLLPNVQNATVQGISSLINN
                     PPGFAELIDREHRKDLGIFKTLTNNLYATLESMIQNRTILMIEDMAFDDAFNEIELNY
                     LLDRFNSTNSIGEDISRTWKEDSLRLMQAMILREMVAGSLEEEAISFDLNNKMIRVDS
                     ISNGNQVKINDTIESTKGNLLYNRGVSHIFRDFSGLNSTVEFNAEKYLHGLNKSEFVK
                     ELYFRKLQNMITSDENLTIFVSEDGNDDVTGYTKPSLLYHFAEEKIWIEREITSEGSQ
                     ASKLYDSAFCSSNKRLGGHCQKFKITKKGDDYFINDRYKITSIAPMVIKNTLIYTISD
                     NLQLPGDLVSAIPPLYHCYKSLRFLNELNLLDLEANHNGYTIFLPCFQSWDIMELNLE
                     YLSGNKTALNELMRNLIIDGLHYTNNDTTEFTAHNKFGDEVTVDFSKSDTSEGVINVK
                     MDSMDGILKIESLHDVFFNQGVIHPIDQIIFPHSLNISLNDLMKSDDCSVFKHLLKSI
                     NQIGEILNNDDEYSILVPTSSSIISDGLSVNTTNLEKILKIHIIPGNYTQSLLDCNSV
                     SKSLSGDSIYCRKASQTSRLLSFMDGQDKEVRILKMGCSSSKSNSCIFLIDKPISPDW
                     LKIPRTRLDLPGVALGIGVLLGSLFVVLLLGFIILMRMNSRADRLLANTPTSESSSPD
                     DTERNPLLQQNAAHGDQYNSISATNAGNNASQNSQSFEASYSANAQRLPIKQQRSTNS
                     TIANARFS"
     gene            <557894..>559723
                     /locus_tag="CAGL0D05874g"
                     /db_xref="GeneID:2887017"
     mRNA            <557894..>559723
                     /locus_tag="CAGL0D05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445664.1"
                     /db_xref="GeneID:2887017"
     CDS             557894..559723
                     /locus_tag="CAGL0D05874g"
                     /inference="similar to AA sequence:UniProtKB:P47083"
                     /note="similar to uniprot|P47083 Saccharomyces cerevisiae
                     YJR002w MPP10 component of the U3 small nucleolar
                     ribonucleoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445664.1"
                     /db_xref="GeneID:2887017"
                     /db_xref="GOA:Q6FVT0"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="InterPro:IPR012173"
                     /db_xref="UniProtKB/TrEMBL:Q6FVT0"
                     /translation="MSFLESLSDPVKVVEVSSEAPLEFVKDHVDNVIKLSKQSGLRNK
                     FDLEEVTISGLDANQVWWQAKIVQDNIEGELLDRIQELREVLGAGEASDVSGEESEEQ
                     VSEDEEDDEDGSETEPLEQDQAVEQELSEEEDVESDNGEIEGTDLSDKEEQEAEVSEG
                     DEVIAESRHDKSDEEVIPESKQTESEVNDQFFNIDEFNKQTDDSKDPLAPKVEDDDED
                     DIDYFGDIPSEDDEEAIYYDDFFDKPDAKSSRKLNRNDKEAENNESEDEFMDEPDLED
                     DDYYNEAMDSAKLDLFADAEDESEEDGENDEEKLSTFEKRQLELKKQIEQLEKEAIAE
                     KKWALKGEVKAQDRPDDTLLTEELEFDRTAKPVPIITQEVTESLEEMIRRRIKEYNFD
                     DLQRRTVADLNLGMRREKFELSDAKSSKSLAEIYEEDYKGVSEETAASEELQKEHDEI
                     SDMLTNLFYKLDALSSAHFVPRPAKQSLEVKVESAAIAMEDAQPLTMTTASTLAPQEV
                     YKVGKAEKDTEIRLKDGTVMSKEELSREDKTRLRRAAKRKRSKALQNKSQQPQKKSKK
                     SDVIDTLSKAKNVTVIDNKGQKSDVGGKALKDKKSQQADFIKL"
     gene            <560448..>562775
                     /locus_tag="CAGL0D05896g"
                     /db_xref="GeneID:2887018"
     mRNA            <560448..>562775
                     /locus_tag="CAGL0D05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445665.1"
                     /db_xref="GeneID:2887018"
     CDS             560448..562775
                     /locus_tag="CAGL0D05896g"
                     /inference="similar to AA sequence:UniProtKB:P53297"
                     /note="similar to uniprot|P53297 Saccharomyces cerevisiae
                     YGR178c PBP1 PAB1P interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445665.1"
                     /db_xref="GeneID:2887018"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS9"
                     /translation="MKGSKGRTDFNQRKNFNAVSQSSGSGLFHETGDVTRGFSDRLDY
                     LLVNGIGSNVKVTTTAGIQYEGVLAAANTESTNGIDVVLKHAKVIDNGMVKDIDALAK
                     SIEDTLLIQGEDVAEVDLKSIDFSLDEKWEAAQQQLEEKKAAAVEAEAAKKAASPPSR
                     STSNTPAEGKTGFRTDVDISRANKDIRERELQKWTPDTDSAFNVDTVALEDSNEKWDQ
                     FAVNEKKFGIKSSFDEHFYTTKINKDDPNYAERLKEAERIAKEIESQDASGNVHLAED
                     RGIAIDDSGMDEEDLYSGVDRRGDELLASLKSNAKPAAPKPKKYVPPTLRNQPHHMDP
                     AIISSTGTKAVSPVTKHSAGLPRKEHRHKKVPNSKEAQIEELRKFSEKFKVPYDMPKD
                     MPTSSKSTSSSESAATEASVDTPNTTTQSQPQATVNSGSNLKSDPSLPPKPVNKSSST
                     KSSVPPTPSTAKGELKKSSSSTSGASPSSATSPQATAHGVSPAGGRASVSSRRRNAGS
                     FFGSKKLQSKDNVRKAFATSFNMFLRSKEAHDQKVAEHAASSSDEKKHEKSPAVTEQF
                     FIEKPYFTAPTWASTVEKSFKEFFPDERKALQKAQSRLQKRQMNAMNAGMMGSHAPGV
                     MNPHMGVMGGMGGRGNMSNFAMAPMSGSGANPAMMNSFGGMYMPFQPQPVFYPGMVPM
                     MGTSTSANTGRGNAGAHSDESAVPSGSMSPQAMSPHIPPAYMAGAPMAYPAPPGAAPF
                     HGMMGGMPDRSHGNYYHNNHGHRNNHHHYHSKQYN"
     gene            <563388..>565082
                     /locus_tag="CAGL0D05918g"
                     /db_xref="GeneID:2887255"
     mRNA            <563388..>565082
                     /locus_tag="CAGL0D05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445666.1"
                     /db_xref="GeneID:2887255"
     CDS             563388..565082
                     /locus_tag="CAGL0D05918g"
                     /inference="similar to AA sequence:UniProtKB:P53296"
                     /note="similar to uniprot|P53296 Saccharomyces cerevisiae
                     YGR177c ATF2 alcohol O-acetyltransferase or uniprot|P40353
                     Saccharomyces cerevisiae YOR377w ATF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445666.1"
                     /db_xref="GeneID:2887255"
                     /db_xref="GOA:Q6FVS8"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS8"
                     /translation="MAPNTKSIEQPLISKAKISGKGPDGFAIEESLLERGHSRRMGHL
                     ENYFAIMQRQKLYTNFNMYGELNKEVTREQLAVAIRQILLRHPIMMQAIIPKKFPEHE
                     EYYTSDDYYNTPFPENDFLRVITSKIKLSDIIINEQSEDYGEIIDMILSEYKKNGYKF
                     DAYMQELIGNIVIPIGNPNKPNWRLLCLPSAEGGGAQWKKFVYISNHCCSDAISAVNL
                     FQDIAENVSLIEQNSWAVPYADDVIVDYEQDVADIAKLPAPITERVEYRPPLSKLPKI
                     MLVSFLKTALNFKSDALETRCNDEYSGEPETSAVQMGDVCYDSILNYTCEEVAVIRDR
                     IKHNVHGKCTVTPFIQAAFFVAMHQSRKLLGQKQGFKEWMSEWGVDMATPSSTRRYLP
                     EDPEVRDMYKYGSNVGGIHYLYMISGMKVEREETEKFWSLVEYYHDILLASHSNGDQT
                     VGLGTLMLDVIVDKKNVDKLIRDEYLYQKRGGVIMSNAGYFHQDPAQAYHVTDLVFGQ
                     RPGALKFSFGVNVVSTNIGGMNLNVGMVRRTLRDRAEFREFIGILDRVIRDFTGLN"
     gene            <566095..>567564
                     /locus_tag="CAGL0D05940g"
                     /db_xref="GeneID:2887028"
     mRNA            <566095..>567564
                     /locus_tag="CAGL0D05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445667.1"
                     /db_xref="GeneID:2887028"
     CDS             566095..567564
                     /locus_tag="CAGL0D05940g"
                     /note="highly similar to uniprot|P32476 Saccharomyces
                     cerevisiae YGR175c ERG1 squalene monooxygenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445667.1"
                     /db_xref="GeneID:2887028"
                     /db_xref="GOA:O13306"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /translation="MSLTNADETVTYDALIVGAGVIGPCVATALARKGKKVLIVEREW
                     SQPDRIVGELMQPGGLRALRSLGMIQSINNIDAYPVTGYTVFYNGEHVDIPYPYKADL
                     KPVEKLPGLVRDGNDKVLEDATVHKKDFEDDERERGVGLVHGRFLNNLRNICAAEPNV
                     TRLQGNVVEILKDKKNEVVGAKVDVDSRGKVDFKAHLTFVCDGIFSRFRRELHPDHVP
                     TVNSSFVGMSLYHAHMPHDMHGHVILGDKHMPILVYQISPEETRILCAYNAPKVPTDL
                     KSWMTKDVQPYIPKTLRPSFDDALAQGKFKPMANSWLPARQNDVTGLCVIGDALNMRH
                     PLTGGGMTVGLNDVVLLIKKIGDLDFSDREKVLDELLDYHFERKNYDAVVNVLSISLY
                     SLFAADSKNLKALQKGCFKYFQRGGDCVNLPVAFLAGVLPKPLLLTRVFFAVAFYTIY
                     LNMEERGFLGLPMALLEGIMILITAIKVFTPFLVRELIG"
     gene            <568044..>568502
                     /locus_tag="CAGL0D05962g"
                     /db_xref="GeneID:2887002"
     mRNA            <568044..>568502
                     /locus_tag="CAGL0D05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445668.1"
                     /db_xref="GeneID:2887002"
     CDS             568044..568502
                     /locus_tag="CAGL0D05962g"
                     /inference="similar to AA sequence:UniProtKB:P37267"
                     /note="similar to uniprot|P37267 Saccharomyces cerevisiae
                     YGR174c CBP4 ubiquinol--cytochrome-c reductase assembly
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445668.1"
                     /db_xref="GeneID:2887002"
                     /db_xref="GOA:Q6FVS6"
                     /db_xref="InterPro:IPR008954"
                     /db_xref="InterPro:IPR012420"
                     /translation="MDTPVWRRWLKIYIYGGSIILGGVLLFKYTTPTDEKLIASLSPE
                     LRLQYEKERKLRQEEQRELMRIVQETAKSNEPIWKTGPIDSPWEKKKGGEVVKNENFF
                     DKIQKTRAEEAQKDELQRIREELDSLRAQSMKKTSDIVNERKSKDWWKIW"
     gene            569043..569113
                     /locus_tag="CAGL0D05984r"
                     /db_xref="GeneID:2887078"
     tRNA            569043..569113
                     /locus_tag="CAGL0D05984r"
                     /product="tRNA-Gly"
                     /note="tRNA Gly (GCC) cove score=62.73"
                     /db_xref="GeneID:2887078"
     gene            <569398..>571182
                     /locus_tag="CAGL0D06006g"
                     /db_xref="GeneID:2887079"
     mRNA            <569398..>571182
                     /locus_tag="CAGL0D06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445669.1"
                     /db_xref="GeneID:2887079"
     CDS             569398..571182
                     /locus_tag="CAGL0D06006g"
                     /inference="similar to AA sequence:UniProtKB:P06779"
                     /note="similar to uniprot|P06779 Saccharomyces cerevisiae
                     YJR052w RAD7 nucleotide excision repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445669.1"
                     /db_xref="GeneID:2887079"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS5"
                     /translation="MYRSRNRNRQGGPNSIKGPSSALTQFLKEEGISAEAIRNRWLQR
                     QVKGGDKKEGSPDEDKDTAFTTNNDEEVKKDYDSESTLSDEPRLKREALEANIVSDEE
                     DEEDVEYKEITPAKDESVSYEERMKRFNQDSDEEEYDESASASIEPLVLPEKKVDKAT
                     IEKKARTVIQNRRKKQRRAANLLDRKSNAVLSLQALCIAKISQNIYKWQKDSEENRNN
                     DHNVMFSHLREVLGGVSTENLNNLANALSKNRALNDQTLQLFLKTDLEALTFHDCSKV
                     SFDGYKTLAIFTPHIKKLSLHMCGQLNNESLLYIAEKLRNLTSLYLDGPFLINEKTWV
                     QFFEIMKGRLEEFHVSNTHRFTDKSLASLLINCGSSLKALGLSRLDGLFNYALIPQYL
                     CNEEFHSLELGYPYNDEDITDEVVINILGQIGHSLKRLVLCGCSDLSDSVIINGIGAF
                     IGENNRLEEIGLEELDQISNDSLLYLFSQIQFPNLRVCSFRRSIQIGDDTIMELFQNA
                     AVNTLEILNLNSLNSLTKESLLLLSCPHLKHLDVAFVRAVDDEVVGRLGKQNPKLSLM
                     EVFGDPLVTEKAKIRPGITLTGRQSDSI"
     gene            <571551..>573284
                     /locus_tag="CAGL0D06028g"
                     /db_xref="GeneID:2887228"
     mRNA            <571551..>573284
                     /locus_tag="CAGL0D06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445670.1"
                     /db_xref="GeneID:2887228"
     CDS             571551..573284
                     /locus_tag="CAGL0D06028g"
                     /inference="similar to AA sequence:UniProtKB:P47113"
                     /note="similar to uniprot|P47113 Saccharomyces cerevisiae
                     YJR053w BFA1 spindle assembly checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445670.1"
                     /db_xref="GeneID:2887228"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS4"
                     /translation="MSIRPANMMDYDLPETSFEDIDATFSRDVPTSSVRNTLDMQQSM
                     PVEDRKVLQEIVQPTPSSITTSDTGTIFSGSRKQSWLNNLASDEDKSDGFEDGEEFLS
                     DFQEFQNRKDDFDEAIKSHFNLQKRSCRGDYDLATDFERKVNINPNSQRRSLRQPRSM
                     MDMHPLRSENSFNPHRLQNSISTNNLHRPNRLGSLHFKKSMPSLSSYNPVIEEEPRYW
                     KKSWDIEEAEEDDDYFDEDFDEDGQETFDLDEKTLKNRVQSNIPTSKTPFKISPTQFD
                     IIQQDDLLTPRLHKKQKELRYKHNLEAFKETSKARRRRHTAKSKIQTIKQQIDHNTPM
                     KSGLMYYNPKKMAWEGNERVLDKFQDIISIDKRPLLIRNKSNISPNETLTYTGSDNNN
                     VQDNGSNSTFSSTTNPRVVGKMMFDERNLRWVSVNNDEIDPFAEIEENIPEPILGKPK
                     RSSPFLRSRSQLISSNNPEVSFTESDVPGNDKFAIGVKKRDRYASTSAAISKRAGDRA
                     DMERVYRLSSKELERLYHEENRWQRKVGGWFVLGDGDQQDRTMAQYDPSDKGNNFMYE
                     IRKMVINSTKN"
     gene            <573888..>575462
                     /locus_tag="CAGL0D06050g"
                     /db_xref="GeneID:2887107"
     mRNA            <573888..>575462
                     /locus_tag="CAGL0D06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445671.1"
                     /db_xref="GeneID:2887107"
     CDS             573888..575462
                     /locus_tag="CAGL0D06050g"
                     /inference="similar to AA sequence:UniProtKB:P47114"
                     /note="similar to uniprot|P47114 Saccharomyces cerevisiae
                     YJR054w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445671.1"
                     /db_xref="GeneID:2887107"
                     /db_xref="GOA:Q6FVS3"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS3"
                     /translation="MLGNDWKYSINSRTFDDLEEEEFKNYKFKTVLSYIFEIGVMNGL
                     KVAFFVSDIYTCVKLLAYNSWSNNVIKPYISFKVTKWLFTACIFASIVILLIEAAIGF
                     RIYRTRNISLTYVNNFSRNTYSIKSYSKFCVYNKITPKGFFQKVSFFTFFELRNCIRL
                     LFTDTPRQVFNALTLWSVLVTVNNGADLGRLETFHGLINKIKTIADTNHAEAVILSFM
                     LFSFVLWAFFMFKFCLALLSSIFVYYNLIRRHRYGSLKAFVCITIDKKVDEMVKQHKS
                     KSAFQSITKTTLLQSNSMLDIKQDLEKNTAETTYEIYKKPNYDSVRSNLHLVNSSIED
                     GSTSEEYELMYEEPMVRNSVIDGNDLLLDSKFNAKRDFNQYYQNAARNQSNSQDVIKE
                     EYEPNFDVMDYAYSNGSNECHDDDTVWKDSVRSGISDNINYGHSSSRELDDVTQSVYP
                     PQTIEISRQMPINMSTHTLEHVSSSVTLDQQPRRSRIPPPPIKTAFIDQDIQQLHVYT
                     PDQAYFNEFTRNQHKF"
     repeat_region   575804..576767
                     /note="solo LTR of gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /rpt_type=long_terminal_repeat
     gene            576832..576903
                     /locus_tag="CAGL0D06072r"
                     /db_xref="GeneID:2887215"
     tRNA            576832..576903
                     /locus_tag="CAGL0D06072r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (CCT) cove score=70.13"
                     /db_xref="GeneID:2887215"
     gene            <577169..>577645
                     /locus_tag="CAGL0D06094g"
                     /db_xref="GeneID:2887137"
     mRNA            <577169..>577645
                     /locus_tag="CAGL0D06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445672.1"
                     /db_xref="GeneID:2887137"
     CDS             577169..577645
                     /locus_tag="CAGL0D06094g"
                     /inference="similar to AA sequence:UniProtKB:P46973"
                     /note="similar to uniprot|P46973 Saccharomyces cerevisiae
                     YJR055w HIT1 required for growth at high temperature"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445672.1"
                     /db_xref="GeneID:2887137"
                     /db_xref="GOA:Q6FVS2"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS2"
                     /translation="MSSGKECQICKKDDFKYKCPKCGIKYCSLACYKNEELHIHKDAV
                     TTELKTEQEDKTSAKDKTESSVIKFKTEKYQNIYDNSPEIRELLNYNTVKFHLAKVHK
                     ILTTTVADSNDSTTSMSSEAKKQLAIDYLNTLRYGGIHYNEALEEFCQLTVAKLHK"
     gene            578043..578115
                     /locus_tag="CAGL0D06116r"
                     /db_xref="GeneID:2887138"
     tRNA            578043..578115
                     /locus_tag="CAGL0D06116r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (TGC) cove score=76.57"
                     /db_xref="GeneID:2887138"
     gene            <578612..>579634
                     /locus_tag="CAGL0D06138g"
                     /db_xref="GeneID:2887248"
     mRNA            <578612..>579634
                     /locus_tag="CAGL0D06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445673.1"
                     /db_xref="GeneID:2887248"
     CDS             578612..579634
                     /locus_tag="CAGL0D06138g"
                     /note="highly similar to uniprot|P05373 Saccharomyces
                     cerevisiae YGL040c HEM2 porphobilinogen synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445673.1"
                     /db_xref="GeneID:2887248"
                     /db_xref="GOA:O42768"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /translation="MHTADFLDIEPTEISSILSGGYNHPLLREWQSERQLKKNMLIFP
                     LFISDIPDEATPIDSLPNIKRFGINKLVDYVKPLVEKGLRSVILFGVPLKEGTKDPVG
                     TAADDPEGPVIQAIKLLRKEFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSR
                     IAAVAVNYAKAGAHCVAPSDMIDGRIKDIKKGLISAGLAHKTFVLSYAAKFSGNLYGP
                     FRDAACSSPSNGDRKCYQLPQAGRGLARRALARDKNEGADGIIVKPSTFYLDIMRDAS
                     EICEDLPICAYHVSGEYAMLHAAAEKGIVDLKSIAFESHEGFLRAGARLIISYFTPEF
                     LDWLSN"
     gene            complement(<579863..>580138)
                     /locus_tag="CAGL0D06154g"
                     /db_xref="GeneID:9487982"
     mRNA            complement(<579863..>580138)
                     /locus_tag="CAGL0D06154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999487.1"
                     /db_xref="GeneID:9487982"
     CDS             complement(579863..580138)
                     /locus_tag="CAGL0D06154g"
                     /note="weakly similar to uniprot|P53182 Saccharomyces
                     cerevisiae YGL041c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999533.1"
                     /db_xref="GeneID:9487982"
                     /db_xref="GOA:B4UMZ2"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ2"
                     /translation="MDQIHANPAVMEKLEKVSKIMIEKNLINSDNHDANGQRSFKPMQ
                     MIKILMDKDLRLAMNEFKSSLDKAGIQLGPDQLAPLMTVLGIEKEKK"
     gene            complement(<580707..>581627)
                     /locus_tag="CAGL0D06160g"
                     /db_xref="GeneID:2887111"
     mRNA            complement(<580707..>581627)
                     /locus_tag="CAGL0D06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445674.1"
                     /db_xref="GeneID:2887111"
     CDS             complement(580707..581627)
                     /locus_tag="CAGL0D06160g"
                     /note="highly similar to uniprot|P07273 Saccharomyces
                     cerevisiae YGL043w DST1 TFIIS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445674.1"
                     /db_xref="GeneID:2887111"
                     /db_xref="GOA:Q6FVS0"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR016492"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:Q6FVS0"
                     /translation="MMDAKDVVVHVRNLEKSKGNDESVLEILRILEKEVVPTEKLLRE
                     TKVGVEVNKFKKSENAEISKLVKRMIGAWKDAINKHKKAKLRQQQPPQQGVSASSGGA
                     ADGSNNDGAKSGDEPRKTDKFVSSKIRNTKNDGVDPNVHNNKLRDQVIRALYDALAKD
                     SEHPPKSILQTSIAIEEEMHKLNDSSIKEKEYKDKYRVIYSNIISRNNPDLKVKIANG
                     DLSPEQLVNSDPKDLAPEHLKKKMEEIKKQNLFNAQGATIERSVTDRFTCGKCKEKKV
                     SYYQLQTRSADEPLTTFCTCEACGNRWKFS"
     gene            <581992..>582834
                     /locus_tag="CAGL0D06182g"
                     /db_xref="GeneID:2887039"
     mRNA            <581992..>582834
                     /locus_tag="CAGL0D06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445675.1"
                     /db_xref="GeneID:2887039"
     CDS             581992..582834
                     /locus_tag="CAGL0D06182g"
                     /inference="similar to AA sequence:UniProtKB:P25299"
                     /note="similar to uniprot|P25299 Saccharomyces cerevisiae
                     YGL044c RNA15 component of pre-mRNA 3 -end processing
                     factor CF I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445675.1"
                     /db_xref="GeneID:2887039"
                     /db_xref="GOA:Q6FVR9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR026896"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR9"
                     /translation="MAPSQGNAVQNNPPSRVVYLGSIPYDQTEEQILDLCSNVGPVVS
                     LKMMFDSQTGKSKGYAFVQYQDLESSASAVRNLNGYQLGSRLLKCGYSSNSDITDQGV
                     GNANNSAMDEYNEEMLSNSINRRFPQLPQGVDVNINMTTPAMMISSELAKKSPQEQKN
                     LLKVFQKWTRENPEDAVYLLQECPQLSFVIAELLLTTGISKVDELTQLAESNQTGSQG
                     NITSDILNNDKTIDPAVRAKKIELLRQVLQLSDGEIAILPYDEKMVIWDLKQKALRGE
                     FGAL"
     gene            complement(<583144..>585093)
                     /locus_tag="CAGL0D06204g"
                     /db_xref="GeneID:2887003"
     mRNA            complement(<583144..>585093)
                     /locus_tag="CAGL0D06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445676.1"
                     /db_xref="GeneID:2887003"
     CDS             complement(583144..585093)
                     /locus_tag="CAGL0D06204g"
                     /note="some similarities with uniprot|P53180 Saccharomyces
                     cerevisiae YGL045w RIM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445676.1"
                     /db_xref="GeneID:2887003"
                     /db_xref="GOA:Q6FVR8"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /translation="MAFIKLLRKTKDEPSRLAKAVRHLQVTLDDPHATYRPRDVLFGQ
                     VLLDLKQNVANVRVRLTFIGEVKSKYGTAHKRGGCFMEKSTVLYGDDGDLDTDEMEPT
                     VNGLTKGVHKFPFSIRVPSGKKIHSSIKFERGSVSYHLMAVFESVVEPEGVSAKVRTK
                     VNILVPIDVYRYSDVVVKTILLNSNAKSKSHKINSNDHNGHLNGDVTTLTTSDGSSEG
                     TKKTISESQIINNLSQRQVLQKSKSEGSKSESIQASTGQINQLPETSSQVSYNAVLTN
                     GMNRDADNQTVKIDVRLPHSGFVQGEYIPLTINVSHYREYYHPAGVIATLVRVCKVAS
                     GRKEDTKEIYRKDICQSISPLLIESNKLENTISTYLKVPNDIIASMTSLPEHFTFQYF
                     VEVVINLSRKLEIYSHSQKPLSYILEKQKTKKPLTIPRDLKELNLPASVNENGAWEVP
                     RPSLNNEKSNGGIDSSRNDFQSKFGSAFNKSTLFGLKNIDEIHVAEQTIIFDDMVDVE
                     RLKRMRNVAGLSIETIIGNKRSSPAIDLAKLEISKLSQGKVMKSNGTSKNTSSSGSIE
                     SNSIVRYRYISFEQDTQSSTDSYDEDITKMGNQLNEWLSPANAYEEYYPVPEYSANEN
                     VFASEDKQELEYKRLHELESDPPQF"
     gene            complement(<586395..>588725)
                     /locus_tag="CAGL0D06226g"
                     /db_xref="GeneID:2887004"
     mRNA            complement(<586395..>588725)
                     /locus_tag="CAGL0D06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445677.1"
                     /db_xref="GeneID:2887004"
     CDS             complement(586395..588725)
                     /locus_tag="CAGL0D06226g"
                     /note="some similarities with uniprot|P39712 Saccharomyces
                     cerevisiae YAL063c FLO9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445677.1"
                     /db_xref="GeneID:2887004"
                     /db_xref="GOA:Q6FVR7"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR7"
                     /translation="MLAQVLVYLLVLSLGAIQGNAQESTRTIKVTTTITTRICPSCVI
                     KTVLSPSSIPPNIPNIVDPPPMIPEDLPPTKPEDPPPHAAEVTITVTITETTRTTRTD
                     LETSLTTLTEVETTVTTETKLTTETATEVTTELTTETKLTTETETEVETTVTTETKLT
                     TETATEVTTELTTETKLTTETETEVETTVTTETKLTTETATEVTTELTTETKLTTEVE
                     VITEIQIDTQVTTKTELTTITQLATKFTTTTTIEVETLLTTETKFKTQTEIEIKTTLT
                     TETKSTTEIQKTTETITNTASITETYSETIYITSVTHTTDVVTRTDITSRTITSYVNE
                     TITNIVYDTKYLSVNSIDYSILYITSTIIDRSTTTTTEFENQTITETDFETVTNTVQK
                     TTFKEATHYTTKEVFSTITELISLTLSTIETVKMTDTATVTVTDTAYLNITSFIQLNN
                     TTWVTAVETQTKTETAVESILSTLTTNVTFTYNRTETVLTTFTVFDNEFLACPPAVYT
                     DCENTPDTVTTTTTAQRTLTTTSTLTVLPERCRYNSTWSISVTTPHAIESMIITTVYK
                     TTLQQNLAATNISINSPWNNASNEIHTGKDSALVSNYITVTTVLRETVTHTINGNISV
                     LSTISENAPITVTKYIKETVHATVTGISMIPVELEAGPPESIYVGSAKTVTITEHSCP
                     VTAVITQAKSTAPIPSTKTAVEKSPARETVESAGETSTPDSESDLPTSPTIVSPVGSS
                     RTVTSSHSVSIFEGEATTLKSFWRLILIIFTLVIHI"
     gene            590298..590371
                     /locus_tag="CAGL0D06248r"
                     /db_xref="GeneID:2886967"
     tRNA            590298..590371
                     /locus_tag="CAGL0D06248r"
                     /product="tRNA-Val"
                     /note="tRNA Val (AAC) cove score=68.42"
                     /db_xref="GeneID:2886967"
     gene            complement(<592585..>593181)
                     /locus_tag="CAGL0D06270g"
                     /db_xref="GeneID:2886968"
     mRNA            complement(<592585..>593181)
                     /locus_tag="CAGL0D06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445678.1"
                     /db_xref="GeneID:2886968"
     CDS             complement(592585..593181)
                     /locus_tag="CAGL0D06270g"
                     /inference="similar to AA sequence:UniProtKB:P53178"
                     /note="similar to uniprot|P53178 Saccharomyces cerevisiae
                     YGL047w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445678.1"
                     /db_xref="GeneID:2886968"
                     /db_xref="GOA:Q6FVR6"
                     /db_xref="InterPro:IPR007235"
                     /translation="MSAFVTCGATVPFPALVEAVLAPEFVGCLSREGYRVLCVQFGRG
                     YDFEAQFTSVTCTRMPLESAEVSELRQLVRDERVTVMGYKVQDVVVLGFAYSNNILQI
                     IDRYGDVVISHAGTGSILDSLRLNKKLIVVVNHTLMDNHQKQIAEKFQNLGHILATNP
                     TAIELCDAMKRLKHEDLIPLSSETNTEFMERLKSIAYS"
     gene            <593556..>594758
                     /locus_tag="CAGL0D06292g"
                     /db_xref="GeneID:2886965"
     mRNA            <593556..>594758
                     /locus_tag="CAGL0D06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445679.1"
                     /db_xref="GeneID:2886965"
     CDS             593556..594758
                     /locus_tag="CAGL0D06292g"
                     /note="highly similar to uniprot|Q01939 Saccharomyces
                     cerevisiae YGL048c SUG1 26S proteasome regulatory subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445679.1"
                     /db_xref="GeneID:2886965"
                     /db_xref="GOA:Q6FVR5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR5"
                     /translation="MISKGMVHESGIKPYFEHKIQETELKIRGKTENLRRLEAQRNAL
                     NDEVRFIKDELRLLQEPGSYVGEVIKVVSDKKVLVKVQPEGKYIVDVAKDINVKDLKA
                     SQRVCLRSDSYMLHKVLVNKADPLVSLMMVEKVPDSTYDMVGGLTKQIKEIKEVIELP
                     VKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELVQKYIGE
                     GSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGGGSGGGDSEVQRTMLELLNQLDG
                     FETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARAEILRIHSRKMNLTR
                     GINLRKIAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVGKVMNKNQETA
                     ISEAKLFK"
     gene            <595855..>598827
                     /locus_tag="CAGL0D06314g"
                     /db_xref="GeneID:2887000"
     mRNA            <595855..>598827
                     /locus_tag="CAGL0D06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445680.1"
                     /db_xref="GeneID:2887000"
     CDS             595855..598827
                     /locus_tag="CAGL0D06314g"
                     /inference="similar to AA sequence:UniProtKB:P39935"
                     /note="similar to uniprot|P39935 Saccharomyces cerevisiae
                     YGR162w TIF4631 or uniprot|P39936 Saccharomyces cerevisiae
                     YGL049c TIF4632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445680.1"
                     /db_xref="GeneID:2887000"
                     /db_xref="GOA:Q6FVR4"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022745"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR4"
                     /translation="MQNENPEPSKEDNTNTSYTNGNDKVNNGGNNYNNYNNYNNRNSY
                     HSNNYSRNYQQRNTGGRYNNPNKFNNGGTRVNSKNVNQQNNYNNYNASGTNRYMNNYN
                     KHNRNQKGTPGINPAAAMQWAGYYGNQMYYFPQGMAAMGNPAGMDMAAMMAAQQGMMT
                     SPQPGVTASETPSPPPIKIEITKKTGEHLDLDEIRAQHKAAAANKEKSPSASIENDVA
                     DKKESEKEGSSIVESKDEEKDKQEVNATKPEPEQKEDASEVRRLFLEQVKLRKAAIEK
                     AKRGESTEASEASDSTDKAVGNNEPSTDESDSNNKDAENSEDQDTFFDSKDTITEKDN
                     ELESGSKDSSPRPLTFAEKLKLKKKQTEEHKEEDSNKEEHEQVNIDTTENSGDNNQHV
                     NEVELESKEKNESDVPIIKKVTLEEPIKDTTETVEGVTNDEENVTGPLAKQPADILTM
                     TEFLAKLKEVEPVDDIYTFTYPPEFEEPDPKYKKQTVKYTYGPSFLLQFKEKARAFPD
                     DPWQLSTAAKIVIPPSISKSKSRDSNRFNNGPSGRMGEFRNGSMRNMDMRSGSKVSSK
                     RKSKRMDDRKSTRTSYTSRKDRERMAEENRRDEPKVEVAPLVPSANRWVPKSKQKKET
                     EKKLAPDGTELLDKEEIERKMKSLLNKLTLEKFEPISNDILAMGNQSKWETEGETLKL
                     VIEQIFLKACDEPHWSSMYAQLCGKIVKELDASIYDNTNEGKTGPKLVLHYLVARCHT
                     EFEKGWTDKLPTKEDGSPLEPEMMSDEYYQAAAAKRRGLGLVRFIGFLYRLNLLTGKM
                     MFECFRRLMRDLTGNPSEEILESVVELLETVGEQFETDSFRTANATLEGSALLDSLFQ
                     ILQSIINEGKISSRIKFKLIDVKELRELKHWNSSKKDAGPKTIQQIHEEEERQRMLKS
                     NSRQSSRRVNNNSMGNHNNRDRGFYRRENTMNSRDNFQSTRSPSTRYNSKDTKEDQAP
                     APKTTNMFSALMDTDEEE"
     gene            complement(<599074..>599883)
                     /locus_tag="CAGL0D06336g"
                     /db_xref="GeneID:2887001"
     mRNA            complement(<599074..>599883)
                     /locus_tag="CAGL0D06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445681.1"
                     /db_xref="GeneID:2887001"
     CDS             complement(599074..599883)
                     /locus_tag="CAGL0D06336g"
                     /inference="similar to AA sequence:UniProtKB:P53177"
                     /note="similar to uniprot|P53177 Saccharomyces cerevisiae
                     YGL050w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445681.1"
                     /db_xref="GeneID:2887001"
                     /db_xref="InterPro:IPR003827"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR3"
                     /translation="MSKQNAFDQKKLAILQEINSDQLDLSPKGTIDVLCLPIIDLINS
                     SPDMVTTSSCSGRISVFIEGQKAINGDVKVGGKGDGGVWLFVSHEFKDIDNWFDRTTA
                     SKNLNWVIDASNTKDINDDGSSSMILYKYEPFILHVKCRDFESASKLYNTAMACGFRE
                     SGIGSNFIVAIRINIKLDVPIGYVKENGHLALIVDPSYITVLDRITKAKFIENEKKMT
                     VLFAKIKSEIVESPKDVNTQVKEETKEERRERKRREGLEKQRLLQQKQIGK"
     gene            complement(600222..600293)
                     /locus_tag="CAGL0D06358r"
                     /db_xref="GeneID:2887065"
     tRNA            complement(600222..600293)
                     /locus_tag="CAGL0D06358r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (TCT) cove score=66.88"
                     /db_xref="GeneID:2887065"
     gene            <601040..>602083
                     /locus_tag="CAGL0D06380g"
                     /db_xref="GeneID:2887262"
     mRNA            <601040..>602083
                     /locus_tag="CAGL0D06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445682.1"
                     /db_xref="GeneID:2887262"
     CDS             601040..602083
                     /locus_tag="CAGL0D06380g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445682.1"
                     /db_xref="GeneID:2887262"
                     /db_xref="GOA:Q6FVR2"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR2"
                     /translation="MKVSNINSVLFLASQLASAAGGEIVTVTETSTVCSTKTLTVPMT
                     VTVTPKPAPPVRPSKVAKLANEMNFIFNMAGAIKSCLPDSGITVPPSWARVQCTFYVF
                     NLMLSLTINIIGGKDHHEFWKKRQQQWREWEEKYWQEAGDGEDEGDCSDEEESSTDPH
                     GNAVATNDNALLSFKTTKMLMDKLGVQVYPYMNETTLQECVHYKFVKDRYKDLLGQDL
                     VEGTVCLSQHGLATFVKLPDNSAEDTEDGKDSGTGATGGELLDYQSFMNKLRPQMYVK
                     KFDKYLHNIKQAKFMTTWQLINFKQYSKDIMRELAYVTDQLRDPDHKHISFELKNKED
                     PADLTPMMSFNIL"
     gene            <602973..>604301
                     /locus_tag="CAGL0D06402g"
                     /db_xref="GeneID:2887059"
     mRNA            <602973..>604301
                     /locus_tag="CAGL0D06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445683.1"
                     /db_xref="GeneID:2887059"
     CDS             602973..604301
                     /locus_tag="CAGL0D06402g"
                     /note="highly similar to uniprot|P06106 Saccharomyces
                     cerevisiae YLR303w MET25 O-acetylhomoserine sulfhydrylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445683.1"
                     /db_xref="GeneID:2887059"
                     /db_xref="GOA:Q6FVR1"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR1"
                     /translation="MPSHFDTLQLHAGQENPDDNNHRPRAVPIYSTTSFVFNDSQHGA
                     QLFGLEVPGYIYSRFQNPTNNVLEERIAALEGGAAALAVSSGQAAQTLAVAGLAHNGD
                     NIVSTSFLYGGTYNQFKVAFKRLGIEARFVEGDKPEDFEKLFDERTKAVYLESIGNPK
                     YNVPDFENIVAVAHKHGIPVVVDNTFGAGGFFCQPIKYGADIVTHSATKWIGGHGTTI
                     GGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTVYNETYGNLAYIVHVRTELLRDLGPG
                     MSPFAAFLLLQGVETLSLRGERHGQNALALAKWLEKNPHVAWVSYPGLPSHSHHENAK
                     KYLSNGFGGVLSFGVKDLPNADKETDPFKLAGAQVVDNLKIASNLANVGDSKTLVIAP
                     YFTTHQQLSDPEKLASGVTKDLIRVSVGTEFIDDIIADFEQSFAKVYGSN"
     gene            complement(<605107..>607440)
                     /locus_tag="CAGL0D06424g"
                     /db_xref="GeneID:2887143"
     mRNA            complement(<605107..>607440)
                     /locus_tag="CAGL0D06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445684.1"
                     /db_xref="GeneID:2887143"
     CDS             complement(605107..607440)
                     /locus_tag="CAGL0D06424g"
                     /note="highly similar to uniprot|P19414 Saccharomyces
                     cerevisiae YLR304c ACO1 aconitate hydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445684.1"
                     /db_xref="GeneID:2887143"
                     /db_xref="GOA:Q6FVR0"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q6FVR0"
                     /translation="MLSARTVVRNTGVRRLATVSNLTRDSKVNQNLLEDHSFINYKQN
                     IEYVDIVRKRLGRPLTYAEKILYGHLDDPHGQQIERGVSYLKLRPDRVACQDATAQMA
                     ILQFMSAGLPEVARPVTVHCDHLIQAQIGGEKDLKRAVDLNKEVYDFLASASAKYNIG
                     FWKPGSGIIHQIVLENYAFPGALIIGTDSHTPNAGGLGQLAIGVGGADAVDVMAGLPW
                     ELKAPKILGVKLTGRMNGWTSPKDIILKLAGITTVKGGTGKIVEYFGEGVDTFSATGM
                     GTICNMGAEIGATTSVFPFNKSMIDYLKATRRDKIAEFAQLYHKDLLSADQGAEYDEV
                     IEIDLNTLEPYVNGPFTPDLATPISKMKEVAVENNWPLEVKVGLIGSCTNSSYEDMSR
                     SASIIKDAASHGLKAKSIFTVTPGSEQIRATIERDGQLETFKEFGGIVLANACGPCIG
                     QWDRQDIKKGDKNTIVSSYNRNFTSRNDGNPQTHAFVASPEIVTAFAIAGDLRFNPLT
                     DKLKDKDGNEFKLKEPFGNGLPERGYDPGENTYQAPPKDRNAVDVKVAPTSDRLQVLK
                     PFKPWDGKDALNMPILIKSLGKTTTDHISMAGPWLKYRGHLENISNNYMIGAINAENK
                     KANSVRNVYTGEYKGVPDTARDYRDEGIKWVVIGDENFGEGSSREHAALEPRFLGGFA
                     IITKSFARIHETNLKKQGLLPLNFKNPADYDKINPDDKIDILGLTELAPGKNVTMRVH
                     PKNGEAWDCELTHTFNSEQIEWFKYGSALNKIKADKA"
     gene            complement(<608505..>614213)
                     /locus_tag="CAGL0D06446g"
                     /db_xref="GeneID:2887144"
     mRNA            complement(<608505..>614213)
                     /locus_tag="CAGL0D06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445685.1"
                     /db_xref="GeneID:2887144"
     CDS             complement(608505..614213)
                     /locus_tag="CAGL0D06446g"
                     /inference="similar to AA sequence:UniProtKB:P37297"
                     /note="similar to uniprot|P37297 Saccharomyces cerevisiae
                     YLR305c STT4 phosphatidylinositol-4-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445685.1"
                     /db_xref="GeneID:2887144"
                     /db_xref="GOA:Q6FVQ9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ9"
                     /translation="MAIATRTLRGEALKKLAQCVGSSNVHTDTTKNDMNDADDTLEMI
                     IKALPIYYSTSPAKLYTIPLNMNEWEIIVGICASVPDSLSRTLEILENTVAPYFLHSP
                     RQRISDLMYSKFRMRSLKNPNELCTFELTRFLIRSARKFPEVVPVVEKLFAQFVASVT
                     EVIFDNNTCLFSLLGFLNAFILEETPLKLSYIVWDLVSNFFINQNFFKDLDNVLSSNN
                     GFDKSLLIQYFDAGAEISSVKFWELLSSMQVKILRTMLEVPESYELVSEYLLDLQYQH
                     FKDMHKPVSERKESAKFEKFKRLLRDNHKMLLSLCQFSLSAYEAKEYYDLSNETRSNY
                     TFGTDAYLLQMLSVIPFLDFEANRERFMDVVVMMVSSGLEKNLLFEESIPFLIKTLIS
                     VSSILNYFVKEVSLIQLRFFPILIASQHISMDIIANVTRNFSMGLKPLSEDAIVSTIY
                     SINNLLALTEDGLIMPIIKERKQTITSSSDREVLNQPSAHILEGFDLKATTASIHPVK
                     SSVQDLTGTPATYHRMLFRNCVTAITRIASHYNTQSITALTISVLSQKVNVVSKELDD
                     IILQSMAKLAPYIGVNEFTLFLKFLKLTENAAIKQNNEALFNCLIRSKITLSAVLLEK
                     SFNTDHYKFYLHDLLESITSSGDVERSDHHRTQSEITRVADQIVIYLKPLAALLPPIS
                     QKPLDLSTDAKTTTMFRNIWFNMVIHGFYFESDIVKINYNQLQRIAINSPPLTSDFPS
                     NNKELSIDLNSILRRSSSSANIKQQRQSISEYLNSNIVQARTVSTPKVMFLAAAKLLE
                     TIRCEVGDCSKLVQYLSDPAMTSSSVENCISFMTIAMIKKYAEIAKRETTEQFNSTRI
                     ADQLNNLLLCLAHRDENLQNIAFQACDLFIKSIPSSLLHHHSLYTLLDLLTTLFDSIE
                     DCERTKFDPNYEFLLKYSQVRVLLPGSIYWRKETLARLHKSARTWLLIILETANQNSK
                     ILLNTYISGVAQFYRSNTIEYGVSFAIEMAGSILNADRELSKMSFGGFQRPNAVAGFI
                     SQQSWRSKFLADTSISFTPEVFADEIQKQADDIRVKVQAKRFVSGQEVSDLLDFCAAL
                     LIIGNYNGKSVLYNLVRIPFEVFTSFSMKSATNIWLTVITERPDLAHVILSDVILCWK
                     ESIISKKGLFDREHDLLPEDYQMMEYAPYDKVKIDRDARIASSTFEPHRHIIKFFSSH
                     FAGTQHQSDHLLNLFTTCFIYGVQEFSKASLHPFARLIRNEYLLFGISILRANVRRNT
                     NTVSSLCRLIINAGLEWFRKPFSWPFGSNELKIRADLSILSDVYKATDSLSSVFSEHS
                     GKSFKLFEYFIAHEIQQIQVWLTPLDKIQGANSNDLPLNMLQTAFDINPDLALNIAQR
                     YQSKKLDQALVDMIIKEPLKSVTTASALSLYLDERRLNKNSDLHHILYWVPVAPLKAI
                     NLFLPNWNQNEFILQYSIFALESHDVNLTFFYVPQIVQCLRYDKTGYVERLIMETAKI
                     SMLFSHQIIWNMLANCYKDDEGIIEDDIKPILDRVRTHMVSEFDQPALELYQKEFSFF
                     NEVTGISGKLKPYIKKTKAEKKKKIDEEMSKVVVKPGVYLPSNPDGIVIDIDRKSGKP
                     LQSHAKAPFMATFKIKKELQDSKTGDRITVENWQAAIFKVGDDCRQDVLALQLISVFK
                     TIWSSIGLDVYVYPNRVTATAPGCGVIDVLPNSISRDMLGREAVNGLYEYFVSKFGHE
                     NTIEFQKARTNFVKSLAGYSVISYLLQFKDRHNGNIMYDGDGHCLHIDFGFIFDIVPG
                     GVKFEAVPFKLTKEMVRVMGGSQNTQAYQDFEELCIKAYLAARPHMDMILSCVEPMLG
                     SGLPCFKGSKTMRNLENRFQPHRTDQEAANYMKQLINKSYESVFTKGYDEFQRITNGI
                     PY"
     gene            <615364..>615927
                     /locus_tag="CAGL0D06468g"
                     /db_xref="GeneID:2886969"
     mRNA            <615364..>615927
                     /locus_tag="CAGL0D06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445686.1"
                     /db_xref="GeneID:2886969"
     CDS             615364..615927
                     /locus_tag="CAGL0D06468g"
                     /inference="similar to AA sequence:UniProtKB:P52491"
                     /note="similar to uniprot|P52491 Saccharomyces cerevisiae
                     YLR306w UBC12 E2 ubiquitin-conjugating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445686.1"
                     /db_xref="GeneID:2886969"
                     /db_xref="GOA:Q6FVQ8"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /translation="MLKLRQLQQQKQQQLAKNAGSSVKANTNSTSPAKLRLQKDIEEL
                     ELPPTVRVNIISLDNHKEMSLNIIIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNN
                     KIFHPNIDPHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNK
                     DKLEFGNLVRLAMSGAMVGSTYYECVI"
     gene            <616117..>617181
                     /locus_tag="CAGL0D06490g"
                     /db_xref="GeneID:2886993"
     mRNA            <616117..>617181
                     /locus_tag="CAGL0D06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445687.1"
                     /db_xref="GeneID:2886993"
     CDS             616117..617181
                     /locus_tag="CAGL0D06490g"
                     /inference="similar to AA sequence:UniProtKB:Q06703"
                     /note="similar to uniprot|Q06703 Saccharomyces cerevisiae
                     YLR308w CDA2 sporulation-specific chitin deacetylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445687.1"
                     /db_xref="GeneID:2886993"
                     /db_xref="GOA:Q6FVQ7"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ7"
                     /translation="MCAKNMLCSYLLCNFSFGFHLCLRHAAYTSTVVFHVKIKLYSFH
                     AMLINKMRELLVYKLLVLTTISNLTKIVTAYSVLNKMNTELEQQFSKAPFPEWLAQFT
                     QLQDWPGMDPPYIPLDFIDFSKIPEATHYNQLQCETVPRDICSFDCHKCVATDDILSC
                     DSLTQTFDDGPTPATTDLLGNLNHKATFFTLGINIINYPQIYKAIIQRGHDVASHTWS
                     HAHLPSLSNEKIIAQLQWSIWAMNATGNHIPRYFRPPFGGMDNRVRAIARQFGLQAVL
                     WDRDSFDWQLLTPNPKTEEDILKDVCLWKKHDGRGIILEHDTTKQTTDLAIKIERIIG
                     LSQKTVAQCVGGSNYIRQFQ"
     gene            complement(<617453..>621379)
                     /locus_tag="CAGL0D06512g"
                     /db_xref="GeneID:2887256"
     mRNA            complement(<617453..>621379)
                     /locus_tag="CAGL0D06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445688.1"
                     /db_xref="GeneID:2887256"
     CDS             complement(617453..621379)
                     /locus_tag="CAGL0D06512g"
                     /note="some similarities with uniprot|P04821 Saccharomyces
                     cerevisiae YLR310c CDC25 or uniprot|P14771 Saccharomyces
                     cerevisiae YLL016w SDC25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445688.1"
                     /db_xref="GeneID:2887256"
                     /db_xref="GOA:Q6FVQ6"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ6"
                     /translation="MNTPNTPKPEVGFKPIDIVRAISDYYIHDEIKDHNKLTFFKGDI
                     IYIVTKLDSGWWDGVLVEDNLVYTSRGSKTGSVVRGWLPSSYVRSLILTTDTANKPGS
                     IYSGTEVVPEIITPDISVLNNTEKLRNSITSMINEAPKAAKLKPDPECYDDATSYYIP
                     ADRNLFYLNDSDIVTWNQLFVVLNHYLDKTKECFTKSYDEVSHISEKRKSYRPEFRYN
                     YTLLGAYVTYLIQACEILKESTPPETIDPVKKHKVIKLLSEDLIHCLGVISESAHVWY
                     NHSYYTSYSRSSHQQGNYSTNDTDIDKTLIISRCYDVALESFDKIHDQFNILFDMLNE
                     FSVRHKSFIIPQLFPRFMRLSFNGGSWSNPFLLPPNKLASQNPISSYYPPAIENVLGR
                     TSGYHRNKRRNSVLSSPFSGTNSLGSSRNSSSGNLSAAGQQRSSAGSFSTTSKHTDKP
                     SRKSTGLFAQYLHANKNYPVVNPSNINACKDKFKNYDNKIGKFPLSRDTLELLEKRKG
                     QIHVSFSEFNELDKNEEEDIPVKPSSIETMTSTAPSRSKVIQSLEANFRTYKEINTTV
                     LIINILENLDLTMFTKMRHIVVNGGIYGWEFEKYQDLMRHTLVSVAYSVEEFYKIKQT
                     FHDIAMRLIMCSQHTTLEDPYVFSTMKSNYPVGALDPISIDTLTICSKADISAYGSYL
                     LKKEDIIRKSLYERLLREDAEFNYDTYYSVCADFRDARQKYVEMADAACAVVSKLVEE
                     RDKILNYAARTMQSELVAKLLEDEEINEYIEEEDSYYKNESNVVVCPDDKIEFVPWYL
                     QPNYTAEVIFDSKGRMKGANKRDLFEYLFQSSSLDMPFAITMLITFRTIFTSTEFIVN
                     IIERFEEAPPENLSYEEYNDWIEKKYLPNKERVIYLLWKLFTFFWNERYMDFPVALLE
                     NCIKTAQRENIAYANELYTSLNEIKANNQTSEYSYWSLLEPSTEILEYNNDLKRIGFS
                     NLVHDAKFTANVYESILDIPAENVAQQLALIEENLYEKITIFDCLDRVWGCKQCDFGG
                     SKNISEFISFANSITKYVSYKILQYDTAAKRGQAIGYFIKVARISYEINNFSSMTAII
                     SGIYASPVNRLHESWKLVSRELQNTLRELDDLMISTKNFLKYRLTLKNVGNRPCIPFF
                     GVYLSDLLFTHNGNPDYVDKSRGTVNFTKRFRIFDIIQEIFHYKKVKYEYKADLDIIH
                     HIMNVAENVPDVENQYHLSLQLEPRSKSTSTSSSGDTATIVDVKKEEESQQTPKKGIR
                     KHFHMKSKNPENKVLVNKGKEKSRKKSSGFRFFGSRKSRSISTDAS"
     gene            complement(<622178..>622492)
                     /locus_tag="CAGL0D06534g"
                     /db_xref="GeneID:2887202"
     mRNA            complement(<622178..>622492)
                     /locus_tag="CAGL0D06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445689.1"
                     /db_xref="GeneID:2887202"
     CDS             complement(622178..622492)
                     /locus_tag="CAGL0D06534g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445689.1"
                     /db_xref="GeneID:2887202"
                     /db_xref="GOA:Q6FVQ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ5"
                     /translation="MVLCSFLLQVFSCHVVNTRVKGIFQSFCGTDSYVQQPDLSFPTA
                     QPTRLALPPQTTSVATHYQPASSLHLPAFDHSVPPCAGTSPPPLKSSEQTRTHLDAQK
                     SI"
     gene            <623770..>625431
                     /locus_tag="CAGL0D06556g"
                     /db_xref="GeneID:2887114"
     mRNA            <623770..>625431
                     /locus_tag="CAGL0D06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445690.1"
                     /db_xref="GeneID:2887114"
     CDS             623770..625431
                     /locus_tag="CAGL0D06556g"
                     /note="highly similar to uniprot|P04802 Saccharomyces
                     cerevisiae YLL018c DPS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445690.1"
                     /db_xref="GeneID:2887114"
                     /db_xref="GOA:Q6FVQ4"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ4"
                     /translation="MSAEEAKAASPEAPKEVILGEDGQPLSKKALKKLQKEQEKQKRK
                     QERAAQLEAEQKEREQAKANEVDHSAENYGPAPFVQSQFRTGEKRVKFEDLSKEDADK
                     EVLFRARVHNTRQQGATLAFLTLRQQSSLIQALVKADKAGEKISKNMVKWAGSLNLES
                     IVLVRGIVKVVDEPIKSATIQDLEIHVTQIHTISETPETLPILIEDASRSEAEAEAAG
                     LPVVNLDTRLDNRVIDLRTVTNQAIFRIQHGVCALFREFLANKKFVEVHTPKMLGAAS
                     EGGANVFEVTYFKGKAYLAQSPQFNKQQLIVADFEKVFEIGPVFRAENSNTHRHMTEF
                     TGLDMEMAFEEHYHEVLDVLSELFVFLFTELKKRYAKEIELVRKQYPVEEFKLPKDGK
                     MVRITYKEGIQMLKEAGKDIGDFEDLSTENEKFLGKLVREKYDTDFYILDKFPLEIRP
                     FYTMPDPEDPRYSNSYDFFMRGEEILSGAQRIHDHKMLMERMKVHGLDPEDPGLKDYC
                     DGFSYGCPPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPKRLRP"
     gene            <625655..>625915
                     /locus_tag="CAGL0D06578g"
                     /db_xref="GeneID:2887132"
     mRNA            <625655..>625915
                     /locus_tag="CAGL0D06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445691.1"
                     /db_xref="GeneID:2887132"
     CDS             625655..625915
                     /locus_tag="CAGL0D06578g"
                     /note="highly similar to uniprot|Q3E731 Saccharomyces
                     cerevisiae YLL018C-A COX19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445691.1"
                     /db_xref="GeneID:2887132"
                     /db_xref="GOA:Q6FVQ3"
                     /translation="MSSGNPGGALRALSPTPPERGSFPLDHDGECAEYMQKYLQCMRL
                     AANENAHNCRLLAKDYLKCRMDHQLMDKDEWKNLGLPPDDKQ"
     gene            <626571..>628748
                     /locus_tag="CAGL0D06600g"
                     /db_xref="GeneID:2887133"
     mRNA            <626571..>628748
                     /locus_tag="CAGL0D06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445692.1"
                     /db_xref="GeneID:2887133"
     CDS             626571..628748
                     /locus_tag="CAGL0D06600g"
                     /inference="similar to AA sequence:UniProtKB:Q12399"
                     /note="similar to uniprot|Q12399 Saccharomyces cerevisiae
                     YLL019c KNS1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445692.1"
                     /db_xref="GeneID:2887133"
                     /db_xref="GOA:Q6FVQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ2"
                     /translation="MLGFKRKRTNTNNNNNNTMNFAPDLLDDLMLDDRYLDENAILDD
                     YDTAEAALDPVRYKKQRTVSLPQLPHSRLSYSYFVNTLDGSNSAAMTHATANLSSANM
                     GTANQGLPHQALGSAYTHHRYPADDNDMSSLLDASLYMGQNAHAALAQPALKSGNWVT
                     PPARIQNDDELLHLTGSSSKTLEGNRSVQLKVAHSVSPFTNENSTGAASGISAGFKNS
                     FKRLLSHEQQPYDDNIPRRSSIASRRRSSVKRVQDAQGSLPNMNYFQTDKDGHYIYQE
                     NDVFGSNGQFVVKELLGQGTFGKVLKCVDTYSPNNKFVAVKVIRAVDRYREAAKTELR
                     VLSTILENDPVGQFQCLLLRDCFDYKNHICLVTDLYGRSVYDFMCSNGVARFPGSHIQ
                     AIARQLIRSVCFLHDMGIIHTDLKPENILLVDESYVEYDLPQNVIDSMSNRRRAASQG
                     KRKILTNPEIKIIDFGSAVFHKEYHPPVISTRHYRAPEIVLGLGWSFPCDVWSIACVL
                     VELVIGESLYPIHENLEHMAMMQRINGTPFPTKLIDKMFYKVRHKLGNLPSDLNTTVV
                     RHFNRQSLTLQWPEKNKRGEIVTTEKSMKRVMESCDRLDVYISRVLKQDYGERLSINW
                     NLSPDKNWSLVSSKLLWRGHQHYDGNIYEGSHMFPPQHKLDKDSFLFWYWFVDLCRKM
                     FEFDPTKRITARKALDHEWFNLGIFDEGITNFANPRANYRNSI"
     gene            complement(<629323..>632859)
                     /locus_tag="CAGL0D06622g"
                     /db_xref="GeneID:2887119"
     mRNA            complement(<629323..>632859)
                     /locus_tag="CAGL0D06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445693.1"
                     /db_xref="GeneID:2887119"
     CDS             complement(629323..632859)
                     /locus_tag="CAGL0D06622g"
                     /note="weakly similar to uniprot|P23201 Saccharomyces
                     cerevisiae YLL021w SPA2 involved in cell polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445693.1"
                     /db_xref="GeneID:2887119"
                     /db_xref="GOA:Q6FVQ1"
                     /db_xref="InterPro:IPR013724"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ1"
                     /translation="MSELTQSQLEDIKGYFVALKTFFNATNSNKDRSSSSRAQKARAK
                     LLKLSPSQFYELSTDVSDELNRRINEDQDQPEYLLPKTNFHVKRNQARQKLAKLSQTR
                     FNDLIDDILFEIYRRDYHNGSTKKPDGFDNFGNEKQSTKSEMPFDPKDDTVDNYNRVD
                     DNGDNTVNRHSNTDENSSSNNETTTSTTVQPIVVIPKKASIDWSSEEEDNNENLDGIT
                     KQVKPITETDDVTSNTKNESTNLSDLIEKTFNNAEAVQEEEEEAHNKMSTRSTDNDDF
                     NLNDTPVTKNSNEEKNNLASKLFEFDQPQDVYSSTNDFSSLYRSAEDISDVKEGDQSL
                     ELGNGDDSSNHIEHRYQKDFIQLNSQIRDLSIENEQLKQRISELELEMKSPTKSVKRE
                     TYLPPVDTKKTLKNLMEDNLLNDSDNLQKFFDPNGYISFEHVDTVRKNVNLIYSTIYA
                     NYKSEQEHFDVQGKTLFKYLAYISDAISRVLSELQLPEFHDQNVIVKAAVSHAITTLR
                     YYTTYGPLIPVVTLQASITEILFSFCTLIKSAKIKYDGKEIARLNSDNTNNMAKSEST
                     KLPTFPSTPVVDEKQKMTPFFQKPGELDSFLDQNEESPVKPLKITQKAINSPKLTPAS
                     TSRKPSGTGLFSLKIESKSVDTLSRWKEENNGPDLTPSKISRDVKESGHLEIKTPSKD
                     VTKDIDNNPKTSNPASSVDPNIAGKSIPVVELKNQTDSNKTNDNTFQLQAEPAPISTN
                     KKSEVEPVIDTVQSSRVATEPTSSMNNLKPDPSSTELTEPSIEKPSPPKGLSLMGSFT
                     KSSLRKVDLSGEQNKRDTDISKDQHPIELKKFESTSAKESSLAPKSDSESHSRSSFEG
                     DDSVQYEPLTKSQGTANNSGLKDDIRAGPNTMEGITSHETKNLMAVDSIKKNVDIKKP
                     DEPTKTIEDIKKDNVKKVSSITTADTLNSVIESPQQNTIHTSKNAETKTDSEEEDGND
                     NEAGDEDEDDDEEDDEDEDDEDEDDEEDEDEDEDANENASDINFDIDAFDIENPDNTL
                     SELLLYLEHQTMQVISTIQSLLTSIKEPQATKGNLRSESNAINEVIGQMVDATSISMN
                     QSRNANLKEHGSWVVQSLQDCAMRLTVLCKLNKNGTLIHEDNDGDYADKNFKQRLAGI
                     AFDVAKCTKELVKTVEEASLKEEIDYLNARLK"
     gene            <634224..>636926
                     /locus_tag="CAGL0D06644g"
                     /db_xref="GeneID:2887161"
     mRNA            <634224..>636926
                     /locus_tag="CAGL0D06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445694.1"
                     /db_xref="GeneID:2887161"
     CDS             634224..636926
                     /locus_tag="CAGL0D06644g"
                     /note="weakly similar to uniprot|P32336 Saccharomyces
                     cerevisiae YOR373w NUD1 cell cycle regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445694.1"
                     /db_xref="GeneID:2887161"
                     /db_xref="GOA:Q6FVQ0"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="UniProtKB/TrEMBL:Q6FVQ0"
                     /translation="MNNTDTSLLGNMLLPRGNGTKAYVTNNEFSDSKFMSQLKEEDEI
                     EDTGIDDGLNSNSSNSDSVQRGNQMENENENSVMYATVQQRSKKYNSSNDDIPQFRAF
                     LGNPNDQQNHNNTHVTMDLTSSNINNDIEIRKELPNELVVTQALDDISGYLNTNTFKR
                     HDKQNIGKDKRVEEHSNISAHYNDTDPALEAVNIFQNVLKNQKSNYAFNERIVSNPTV
                     SDSSYSDDLSASRLTRSNGINADHVNISRQEVTSANKPLGGKKQSRPESEYHPSDRNN
                     SSSESLSNMSTSSQTPPTSAENYTNVTTSRKPKPQQISELPLITPESIGLIFNQENGV
                     WQEPDSHNHDITNSHTVENTTSNSTTQNTEDSSIHIDTHLAENSNEDIRVHRRRINSR
                     ILQRDDQSLQIRGPVKPKFQNIHEEDEADYLSDDTPLDPPKINKKFLRKHSDYLQEGI
                     LTGDRKIYQDVDYRETQFTEEENIKFNENLERLTSSQEGGIAKRSSSPLHHPGDLSYR
                     QNKTDLVSVLTDKLKDISDWEAVKEIVLSEENLPSVVGLNAFLPNLKHFEICNSRLST
                     LEGTPEGVVELFASKNCLSSTHILSTKFNHLEVIDISFNTISSLYHCFDGLLHLRKII
                     AHHNNISSIAGLYDIPRLQCLDLSHNSFEGVIDFSMLQDLTGEYPSWMNSLKFLDFSN
                     NPISDMRRINHLTALESLDITNTNIKELECQNTYSSTNLTSIYFDAKLSIERCLFNNS
                     FSSVIKLIVSGTPNFQLSDIPKHIQRLAIRGESKDQLDNSKLSEFMGYIDGQSYDIKT
                     TDKIYHGNDSNPLLVHLEITGHLKLNKLPVTLQQKLPFLKTLNLDSNALDSAYNIIES
                     IPTTYIQDLYLTNNSLCSPFSSLSSSKLEEALRIACPNIKEVLI"
     gene            <638537..>638737
                     /locus_tag="CAGL0D06666g"
                     /db_xref="GeneID:2887125"
     mRNA            <638537..>638737
                     /locus_tag="CAGL0D06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445695.1"
                     /db_xref="GeneID:2887125"
     CDS             638537..638737
                     /locus_tag="CAGL0D06666g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445695.1"
                     /db_xref="GeneID:2887125"
                     /db_xref="GOA:Q6FVP9"
                     /db_xref="UniProtKB/TrEMBL:Q6FVP9"
                     /translation="MKMYKLALIIKQQISAIADVWHDKLHAYKVKCTPFRGFLRLWML
                     QQKRPPLAVVPHLLKFTPSIML"
     gene            <639883..>641457
                     /locus_tag="CAGL0D06688g"
                     /db_xref="GeneID:2887157"
     mRNA            <639883..>641457
                     /locus_tag="CAGL0D06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445696.1"
                     /db_xref="GeneID:2887157"
     CDS             639883..641457
                     /locus_tag="CAGL0D06688g"
                     /note="highly similar to uniprot|P46367 Saccharomyces
                     cerevisiae YOR374w ALD4 or uniprot|P40047 Saccharomyces
                     cerevisiae YER073w ALD5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445696.1"
                     /db_xref="GeneID:2887157"
                     /db_xref="GOA:Q6FVP8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FVP8"
                     /translation="MFRSTTSNVLTRALRTRNAGVSSVMVLRAYSHLPLHVPIKLPNG
                     LEYEQPTGLFINNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQAADTAFK
                     NGSWTDIDPFERGQALYKLAELIEKDKEIVASIESLDNGKAINSARGDVQLVINYLKS
                     SAGVADKIDGRLVNTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTV
                     VLKTAESTPLSALYVSKYIPKAGIPPGVINIVSGFGKIVGEALTTHPKIKKIAFTGST
                     ATGKHIYSSAAQTLKKVTLELGGKSPNIVFADADLKKAVQNIILGIYYNSGEVCCAGS
                     RVYVEESIYDEFAQEFKTASEALKVGNPFDESTFQGAQTSQMQLDKILSYVEIGKKEG
                     ATLITGGERIGEKGYFIKPTIFGDVTEDMRIVKEEIFGPVVTVTKFKDLDHVVQMAND
                     SEYGLAAGIHTTNINSAVKVADRLKAGTVWVNTYNDFHQNIPFGGFNASGLGREMSKE
                     ALDGYLQAKAVRVKLD"
     gene            complement(<641982..>643127)
                     /locus_tag="CAGL0D06710g"
                     /db_xref="GeneID:2887265"
     mRNA            complement(<641982..>643127)
                     /locus_tag="CAGL0D06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445697.1"
                     /db_xref="GeneID:2887265"
     CDS             complement(641982..643127)
                     /locus_tag="CAGL0D06710g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445697.1"
                     /db_xref="GeneID:2887265"
                     /db_xref="GOA:Q6FVP7"
                     /db_xref="UniProtKB/TrEMBL:Q6FVP7"
                     /translation="MKSHALTGYLIRQLAYAINRSVTSSNSRVNISKIFLLSLILLTI
                     YPVLGSNVSAFDLCETTAKSKSDIFSIGTLAQRDMGIEFLKDKVNQPNIRELINNVLH
                     YDVDLDLEMRIFFESIDLESIDYNVNHISVRWLSKRQCYILYSVLSIYRRNEQPNDFR
                     HDIVIGRLFDEGWNELHGRIITHTDVGLPENFKSRLELLYREFNLSELCFWRDDGNQI
                     NLENDVNECILKLRNLDPSRSEELNTLISDVFIAFPNIIKPMTLSYWGKNYIDQMMFL
                     IAKKKDEPILVYSERPDSANSNKRFFLAMPFHKRFTTLELFIPKMFANIIDDNWKIKL
                     PEIIENNFQDDFLLDTNAFLFDINGKSEHKLFCQPELALCNSDLHLD"
CONTIG      join(CR380950.1:1..651701)
//
DBGET integrated database retrieval system