GenomeNet

Database: RefSeq
Entry: NC_006029
LinkDB: NC_006029
Original site: NC_006029 
LOCUS       NC_006029             927101 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome F complete sequence.
ACCESSION   NC_006029
VERSION     NC_006029.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 927101)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 927101)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380952.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..927101
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="F"
     gene            <19572..>21284
                     /locus_tag="CAGL0F00187g"
                     /db_xref="GeneID:2887595"
     mRNA            <19572..>21284
                     /locus_tag="CAGL0F00187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445982.1"
                     /db_xref="GeneID:2887595"
     CDS             19572..21284
                     /locus_tag="CAGL0F00187g"
                     /inference="similar to AA sequence:UniProtKB:P40988"
                     /note="similar to uniprot|P40988 Saccharomyces cerevisiae
                     YMR319c FET4 low affinity Fe(II) iron transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445982.1"
                     /db_xref="GeneID:2887595"
                     /db_xref="GOA:Q6FUW2"
                     /db_xref="InterPro:IPR007251"
                     /db_xref="UniProtKB/TrEMBL:Q6FUW2"
                     /translation="MGKVGEFFGHPGRRPMFRHRANIPVIKSDCEYEESCNEKNDPKN
                     DETICRVDSFNNSSSDSSLNDVHLQDDGNILTTHNFTGLSTSRTDKVLDWMVMVAGSQ
                     FMFFLIWIILIIWIVTGIIYNGPFNWQVVMQDGQSIQCYVWDTLLMRQQLNSTHEQIL
                     IISDIRSRLASFSGFFERLSFACIKGSKESDVDTTAQGVDESSNKSDINCDCEDKNET
                     TEFIKTGELPVENWYDNLCTKASYIIGSIPMMIAFWLGVMVWIVCGIIPKDAGNSPPF
                     TGETTGSNPKLKKFSDTWQMYINTAVAVSLLICSTFLQNIRARHDKFIAKFLLQIYDL
                     EHEIDTKLRTALNDYDTLHPIIEVAPVKRSKLEVIIDWYADVIGTGIGVVVAIIVFGV
                     WIGIGQPLHWNDNWWLIIGTYTGLVGFLDGYIIRQVYFKIIQHEENNFQMLADEDMAL
                     FQRYNIPCEDEYFGIKGPVKMNWNLKISTYINYLCASQWSVVCSVLIILGLIGAASGL
                     KWSTTGQLIANTPTMIIEEFFLIVLIQAHNEADLERRKEVTALYMRRKLLLNYVKKEL
                     GISH"
     gene            complement(<22109..>23731)
                     /locus_tag="CAGL0F00209g"
                     /db_xref="GeneID:2887643"
     mRNA            complement(<22109..>23731)
                     /locus_tag="CAGL0F00209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445983.1"
                     /db_xref="GeneID:2887643"
     CDS             complement(22109..23731)
                     /locus_tag="CAGL0F00209g"
                     /note="weakly similar to uniprot|P53322 Saccharomyces
                     cerevisiae YGR260w TNA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445983.1"
                     /db_xref="GeneID:2887643"
                     /db_xref="GOA:Q6FUW1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FUW1"
                     /translation="MIESFDDDDSKKRNEISHVEDSSKYDLTVHLSSKDEDSSLQNVD
                     DIKGDFEEEAIPLFVSKDEIPESLKDYTTEELEILDKKTRRKMDLRILIMLCWIYICN
                     YLDRSNIASARLGGLEEDLHLSSQQYQTAISILFVGYITMQIPCNIILNRLGRPSVFL
                     SVIMTAWGIVSTCTGAVQSYGGLLAIRVILGFVESGFFGCSLYYLSCWYTKKELGLRN
                     SILYSGSLISGAFSGLISAGIIEHMDGTRGLRAWRWCFIIEGAITVGTVPLAYFILPD
                     NPDNSKFLTETERDLVMWKLRMEVGDSDSDKEMLGESGHNSFWYALKLALTDTKVWLL
                     TGCLTFLVAAAGVTNFFPSVVKTLNYGRIKTLCLTAPPYLIAIITTFGWSWHSDRTGE
                     RFWHIVCPLFIALAAFIIAVSTLNTGARYFAMCLMPTGLYCSYTIIISWMSSSVPRPP
                     LKRAIALSVMNCVCNSTSIWNAYLYPLSNAPRYVIAFSSNCGFIAASICCAVLMRLYL
                     LHLNRKIKNGTMDWFKEFGNDGSKVKNFQYPV"
     gene            <29705..>30628
                     /locus_tag="CAGL0F00231g"
                     /db_xref="GeneID:2887716"
     mRNA            <29705..>30628
                     /locus_tag="CAGL0F00231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445984.1"
                     /db_xref="GeneID:2887716"
     CDS             29705..30628
                     /locus_tag="CAGL0F00231g"
                     /note="highly similar to uniprot|P23641 Saccharomyces
                     cerevisiae YJR077c MIR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445984.1"
                     /db_xref="GeneID:2887716"
                     /db_xref="GOA:Q6FUW0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FUW0"
                     /translation="MSNQLPQYSYSDYAKFALAGAIGCGSTHSSMVPIDVVKTRIQLE
                     PTVYNKGMVGSFRKIIAEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFKKFFIDTLG
                     YDTAARYKNSVYIGSAAAAEFLADIALCPLEATRIRLVSQPTFANGLVGGFSRILKEE
                     GVGSFYSGFTPILFKQIPYNIAKFLVFERASELYFSLAPPKDTLSQTSLTAINLLSGL
                     TAGLAAAIVSQPADTLLSKVNKTSKAPGQSTVGLLFQLAKQLGFVGSFAGLPTRLVMV
                     GTLTSLQFGIYGQLKKSLGCAPTIEIAGGGH"
     gene            complement(<31114..>32568)
                     /locus_tag="CAGL0F00253g"
                     /db_xref="GeneID:2887965"
     mRNA            complement(<31114..>32568)
                     /locus_tag="CAGL0F00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445985.1"
                     /db_xref="GeneID:2887965"
     CDS             complement(31114..32568)
                     /locus_tag="CAGL0F00253g"
                     /note="highly similar to uniprot|P00937 Saccharomyces
                     cerevisiae YKL211c TRP3 anthranilate synthase component
                     II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445985.1"
                     /db_xref="GeneID:2887965"
                     /db_xref="GOA:Q6FUV9"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV9"
                     /translation="MKRVVLIDNYDSFTWNIYEYLCQEGADVQVFRNDKVTVDEVVAL
                     KPDVLVISPGPGHPSTDSGISRDAIRQFAGKLPIFGVCMGQQCMFEVFGGEVAYAGEI
                     VHGKTSPIFHDNKGFFKNVPQGVAVTRYHSLAGTPESLPDVLEVTARTEQGIIMGVRH
                     KKYTIEGVQFHPESILTEEGHLMIQNILKVTGGTWDEYEANEKNTSTGNNQESILDKI
                     YAKRKSDIASQSKVPGFTMRDMEFNYKLGLAPSQIDFYSKIKSAKQRAVVLSEIKRAS
                     PSKGDICIDALATEQGLRYARAGASAISVLTEPHWFKGSLQDLINIRRALDIEFKTHP
                     EDRPCLLRKEFIFSEYQILEARLAGADTVLLIVKMLGEEELKRLYNYSKTLGMEPLVE
                     VNCEKELEKALSLDAKVIGVNNRDLHSFNVDLNTTSSLINSVPAETMLIALSGITSPS
                     DADKYKEEGVRGFLVGEALMRTSEPESFIKALCQ"
     gene            <33830..>35044
                     /locus_tag="CAGL0F00275g"
                     /db_xref="GeneID:2887867"
     mRNA            <33830..>35044
                     /locus_tag="CAGL0F00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445986.1"
                     /db_xref="GeneID:2887867"
     CDS             33830..35044
                     /locus_tag="CAGL0F00275g"
                     /note="highly similar to uniprot|P32458 Saccharomyces
                     cerevisiae YJR076c CDC11 septin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445986.1"
                     /db_xref="GeneID:2887867"
                     /db_xref="GOA:Q6FUV8"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV8"
                     /translation="MSGIIDASSTLRKRKHLKRGISFTLMIVGQSGCGRSTFINTLCG
                     QQVVDVSTTVMLPTDTSTEIELQLREETVELEDDEGVKIQLNIVDTPGFGDSLDNRKS
                     FDIISDYIRHQYDEILLEESRVRRNPRFKDGRAHCCLYMIVPTGHGLKEMDIEFMRQL
                     GTLVNIIPVISKADSLTQEELKLNKKLIMEDIDRHNLPIYNFPFDEEDISEEDYETNT
                     YLRSLLPFSVIGSNEVFDVGNSTMIRGRKYPWGMLDVEDTSISDFVVLRNALLISHLH
                     DLKDYTHEVLYERYRTEALSGETSFNFRNDIPPQSLPRGDVSHLPHGSQSPMPPSSQS
                     ITGQDASSSDTYTAREEQIRLEEERLKAFEERVQQELILKRKELLQREQELREIEERL
                     EREAKQKQEQAY"
     gene            complement(<35347..>36531)
                     /locus_tag="CAGL0F00297g"
                     /db_xref="GeneID:2887672"
     mRNA            complement(<35347..>36531)
                     /locus_tag="CAGL0F00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445987.1"
                     /db_xref="GeneID:2887672"
     CDS             complement(35347..36531)
                     /locus_tag="CAGL0F00297g"
                     /inference="similar to AA sequence:UniProtKB:P47124"
                     /note="similar to uniprot|P47124 Saccharomyces cerevisiae
                     YJR075w HOC1 suppressor of PKC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445987.1"
                     /db_xref="GeneID:2887672"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV7"
                     /translation="MTMARKRSNFKILRIFFFLIAGLAGIALLLKLSSNARASDIQKI
                     LQNLPKEITQSINVANSNQKADADVMAKFAKLAEDIKLKQEEQSKQFERQRKVLERKL
                     RNMKQISTDATLREKLAYNFEYDGKSRFPAFLWQTWSGSQTPEEVLHVKATWQEKNPG
                     FVHEILTPEMMNALVHHYYSIVPEVVEAYKLLPDNILRIDFFKYLVLLARGGTYADID
                     TSPLQPIPNWIPETVEPSDIGLTVGIEHDAQAVDWRSHYVRRLQFGTWVIQAKPGHPV
                     LREVVAQIVEHVLNNKDDLSTVNVRNDLSVMKFTGSALFTDAIMTYLNDFIKSGLDRK
                     VTWRDFTKITSPKLVSDILVFPEFSFNVPENFDKEDPLRAQFFISHKGEKFWKAAPKV
                     AS"
     gene            complement(<36920..>37489)
                     /locus_tag="CAGL0F00319g"
                     /db_xref="GeneID:2887660"
     mRNA            complement(<36920..>37489)
                     /locus_tag="CAGL0F00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445988.1"
                     /db_xref="GeneID:2887660"
     CDS             complement(36920..37489)
                     /locus_tag="CAGL0F00319g"
                     /inference="similar to AA sequence:UniProtKB:P47123"
                     /note="similar to uniprot|P47123 Saccharomyces cerevisiae
                     YJR074w MOG1 GSP1-interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445988.1"
                     /db_xref="GeneID:2887660"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV6"
                     /translation="MSTCTTQLYGGAITTVLPLGFMDVSMLREVPDTQEVFVNSRTPQ
                     ECAHAEDGLAENESIIIDLLQMVEAPSDDEALNVHIEDVTSLNGGDAWDTVKKETQPD
                     GTITCILTESVHKWGKQDMRETLAICLALKRMKDVETDALISINVPLKAEEVELLSKT
                     EEVKRLTASYDVLKNIVKEFKVLDKSLFA"
     gene            <37817..>38098
                     /locus_tag="CAGL0F00341g"
                     /db_xref="GeneID:2887734"
     mRNA            <37817..>38098
                     /locus_tag="CAGL0F00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445989.1"
                     /db_xref="GeneID:2887734"
     CDS             37817..38098
                     /locus_tag="CAGL0F00341g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445989.1"
                     /db_xref="GeneID:2887734"
                     /db_xref="GOA:Q6FUV5"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV5"
                     /translation="MSSVYLVPAKIELVGNAGVPEEIKFEEVAQLRGKELHGEDLIQH
                     LDGYHGQLVKDGKIEELSSVVDFEREEEIFKQELNAFKETADILSALHN"
     gene            <38589..>39242
                     /locus_tag="CAGL0F00363g"
                     /db_xref="GeneID:2887699"
     mRNA            <38589..>39242
                     /locus_tag="CAGL0F00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445990.1"
                     /db_xref="GeneID:2887699"
     CDS             38589..39242
                     /locus_tag="CAGL0F00363g"
                     /inference="similar to AA sequence:UniProtKB:P05375"
                     /note="similar to uniprot|P05375 Saccharomyces cerevisiae
                     YJR073c OPI3 methylene-fatty-acyl-phospholipid synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445990.1"
                     /db_xref="GeneID:2887699"
                     /db_xref="GOA:Q6FUV4"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV4"
                     /translation="MFGADFVEDKVIQFENFVEGLMYSVDYDAPYFYSALLFIIFNPL
                     FWNIVARLEYHTHFLTKIAGSPKRGCYFLAATIFSLGIARDLTFEKALRHQEVSPLLD
                     TPKITNIGYAFLIVGQILVISSMYQLGITGTYLGDYFGILMNDRVTAFPFNVSNNPMY
                     QGSTFSFIGTSLIAGKPAGLILAFFVHAMYYMALKFEEPFTAEIYAKRDEEKKSKKQ"
     gene            complement(39475..39546)
                     /locus_tag="CAGL0F00385r"
                     /db_xref="GeneID:2887798"
     tRNA            complement(39475..39546)
                     /locus_tag="CAGL0F00385r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (CGT) cove score=76.93"
                     /db_xref="GeneID:2887798"
     gene            <41539..>42507
                     /locus_tag="CAGL0F00407g"
                     /db_xref="GeneID:2887799"
     mRNA            <41539..>42507
                     /locus_tag="CAGL0F00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445991.1"
                     /db_xref="GeneID:2887799"
     CDS             41539..42507
                     /locus_tag="CAGL0F00407g"
                     /note="highly similar to uniprot|P47120 Saccharomyces
                     cerevisiae YJR070c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445991.1"
                     /db_xref="GeneID:2887799"
                     /db_xref="GOA:Q6FUV3"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027517"
                     /translation="MSTNFEKHFEENVDDCNLEQLRDILVNKEGKSALANRFRALFNL
                     KTAASEFEANPSDAEKAVQYMGETFGDNSELLKHEVAYVLGQTKNLKAAPLLRKTMLD
                     LAQQPMVRHEAAEALGALGDKDSLEDLEKCLKNDPHVAVRETCELAIARINWQHSDAP
                     TKESLQQSLYSSIDPAPPLALEKEYDLEELKKLLNDQEKPLFLRYRAMFRLRDIGTDE
                     AVLALASGFNDPSALFKHEIAYVFGQMGSTAAVPSLTEVLGRKEEAPMVRHEAAEALG
                     AIASEDALPILKQYLNDEVDVVRESAIVALDMWEYENSNELEYAPA"
     gene            <43066..>43644
                     /locus_tag="CAGL0F00429g"
                     /db_xref="GeneID:2887788"
     mRNA            <43066..>43644
                     /locus_tag="CAGL0F00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445992.1"
                     /db_xref="GeneID:2887788"
     CDS             43066..43644
                     /locus_tag="CAGL0F00429g"
                     /inference="similar to AA sequence:UniProtKB:P47119"
                     /note="similar to uniprot|P47119 Saccharomyces cerevisiae
                     YJR069c HAM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445992.1"
                     /db_xref="GeneID:2887788"
                     /db_xref="GOA:Q6FUV2"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /translation="MAPTEITFVTGNANKLKEVQMLLAAEDKKGSITLKNEPLDLDEL
                     QDVDLKAIALTKCKQAVKELGVGTPVFVEDTALTFDEFNGLPGAYIKWFLKSMSLEKI
                     VKLLEPYSNKGAEAITTIAYCDENGEYHIFQGITKGKIVDSRGPTNFGWDSIFEPLEG
                     KGMTYAEMEKDFKNTLSHRGKAFVEFKKFLYA"
     gene            complement(<43750..>44808)
                     /locus_tag="CAGL0F00451g"
                     /db_xref="GeneID:2887613"
     mRNA            complement(<43750..>44808)
                     /locus_tag="CAGL0F00451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445993.1"
                     /db_xref="GeneID:2887613"
     CDS             complement(43750..44808)
                     /locus_tag="CAGL0F00451g"
                     /note="highly similar to uniprot|P40348 Saccharomyces
                     cerevisiae YJR068w RFC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445993.1"
                     /db_xref="GeneID:2887613"
                     /db_xref="GOA:Q6FUV1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUV1"
                     /translation="MFEGFGQNKRRKINTESAAEAEHNKPWVEKYRPKKLDDVAAQDH
                     VVNVLKKTLSSANLPHMLFYGPPGTGKTSTILALTKELFGPELMKTRVLELNASDERG
                     ISIVREKVKNFARLTVSKPSKHDLENYLCPPYKIIILDEADSMTADAQSALRRTMETY
                     STVTRFCLICNYVTRIIDPLASRCSKFRFKSLDSSNALQRLKYVAEEEGVKVKAGSLE
                     TILDISAGDLRRAITLLQSASKNIGYSGEDEVSKELVEELAAVVPESSIKQIVELVAT
                     RDFNKISEYIQEFTRNGWSAASVVSQLHDYYIKSSEYDTAFKNKVSIILFDTDSKLTN
                     GTNEHIQLLNMLIKISQV"
     gene            <45204..>45638
                     /locus_tag="CAGL0F00473g"
                     /db_xref="GeneID:2887898"
     mRNA            <45204..>45638
                     /locus_tag="CAGL0F00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445994.1"
                     /db_xref="GeneID:2887898"
     CDS             45204..45638
                     /locus_tag="CAGL0F00473g"
                     /inference="similar to AA sequence:UniProtKB:P47118"
                     /note="similar to uniprot|P47118 Saccharomyces cerevisiae
                     YJR067c YAE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445994.1"
                     /db_xref="GeneID:2887898"
                     /db_xref="GOA:Q6FUV0"
                     /db_xref="InterPro:IPR019191"
                     /translation="MADLLDDVWGSGDDLDESTRELSPDLLKLKDNHSKRGYLDGIVS
                     AKEENLQDGFDMSFPLGAELGLRVGKIIGRLQGLEYRYGKDDEELKKDFNNAKQELQI
                     KNILTKRIFTEDYNLEDSKHPVVSKWEEIVTKYCEKYNVKTE"
     gene            complement(<45806..>53176)
                     /locus_tag="CAGL0F00495g"
                     /db_xref="GeneID:2887695"
     mRNA            complement(<45806..>53176)
                     /locus_tag="CAGL0F00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445995.1"
                     /db_xref="GeneID:2887695"
     CDS             complement(45806..53176)
                     /locus_tag="CAGL0F00495g"
                     /inference="similar to AA sequence:UniProtKB:P35169"
                     /note="similar to uniprot|P35169 Saccharomyces cerevisiae
                     YJR066w TOR1 phosphatidylinositol 3-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445995.1"
                     /db_xref="GeneID:2887695"
                     /db_xref="GOA:Q6FUU9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU9"
                     /translation="MSSLKLEDRDSSESAALLRSAVIGTPNEQSMSPVPILDYDSGSA
                     SNFTKGESTMLESDVLPDLESLPMLMDYILELLKSPNVRLRLSATNKLKTVLISLAHE
                     ISIEQFQSFNHKLDNKIYQMVHSKDVRSQIAGVLSVDCLIWYYSQTEELPNYTTKLAG
                     YLKVLIPSKNLDLMKQAIEILGKLAIPTSSITSEFLQHEVKNCIEWLTTSPESKFSTQ
                     TQELRKHASLQIITVLSKNSPTVLYPYINSILDNIWRALRDPDNLMRFDAAKVVGCCL
                     RIISKRDESACKEWIIHLMQGCAFGLTLKTTDAIHATLLVYHELLELDSECLNDFFDD
                     IYYVTMSFKDHRSPLIREEICSIVSLLASLNPVMFSNLYLDKVMNHFLDLLQNITTYN
                     ISNKERSHIFISIGDIADNVGEMMFEFLEPTLITLKESLRTRYRTRKDYEEGVFYCIG
                     KLSSAIREDLQKYLEGGLLKLILECPLSDHMQKTLSILSANTPDYAKHIDKELLDLLC
                     IHLSGDHFIEPGTPIKGKPFSPNAARVWRNQNVYHQIGIANDDLNDAQILIQTLKIFR
                     ETKFKVVLTEFVKNVIIYYIEHENQLVRKLAALTSCEIFINDSICKETSLNSLNTVSE
                     VLEKLLTVAVTDLNPEIRLEILKHLSSPFDSHLAKPENLQLLFTALNDELIAIQIEAM
                     KIIGRLVTVNPAYVIPSLRNYLLSLITELKYPNFSTRKDEAATLLCTLIQSSKNVTKP
                     YIEPILNVLLPKLDDNSSTVASIALKAIGALAVVGGEDMKQNNSTLFPLMIKTLQDQS
                     NSFKRDAALKSLGQLAASSGYVIRPFLDYPDLLSVLIGILRAESAQNIRRETVRLIGI
                     LGALDPHKQRDVEVNLKTKLAVEQNQPPIDVALLMQGNSPSNDDYYPTVVIVSLMKIL
                     KDPSLSSYHTSAVQAIMQIFQIMGLKCISFLDKIIPGIISVMHMCPSNLLDFYFQQLC
                     QLTVIMKQHIRPYVDEIYDAIIEFFRFENLQVTILSVINSLCYALKGEFKRFIPLTLN
                     LLLGVLEKDRSAGRENSIRVLQSFVIFDTNLELYAHTILPSILKLTEFSTGHLRKAAI
                     ITVGKLSKCINLSEMASRIVHSLARVLYVNDDELREVTLNTLSLLLLRLKRNYIIFVP
                     VVNRILVDCSIKHAIYDDLVTKLLNGEALPNTIILEDDTEQKQLSLSNIAETTDKKLP
                     INQNGLKSVWDCSQLRTKEDWQDWIRRLSIQFLKESPSPALRTCANLASIYHPLAREL
                     FNASFSSLWSELYTQYQESLIGSLCSALSSPQNPPEIHQVLLNLIEFMEHDDKPLPIP
                     INTLGQYAERCHAYAKALHYKEVKFIKEPVSSTIESLISINNQLHQTDAAIGILKHAQ
                     QHHSYQLKETWYEKLQRWDDALDSYTKRAEAGDNSIEVTVGRMRSLHALGEYETLSQL
                     AENKWKTSNLQVRKKIAPLAAGAAWGLGEWDEIEKYISVMKENSPDKEFFDAVLCLHR
                     NRFDEAEKHIFAARDLLVTEISALINESYTRAYGVVVRTQIIAELEEIIDYKKASHNS
                     AKRTHYRNLWDQRLLGCQKNVDIWQRILRVRSLVVKPKQDMHIWIKFANLCRKSGRMS
                     LAQKALYSLLEDGSDPNQPNTAKAPPPVVYAQLKYLWATSSHEEVLHHLIGFTSRMAH
                     DLGLDPSNMIAQSVPQNATVAPQHIETYTKLLARCFLKQGEWRVAIQPNWRVQNPDAI
                     LGSYLLATHFDKNWYKAWHNWALANFEVISMLTSKNKNEDTNGAQVNGDWRIENSIMG
                     TDYFSNDESKFSPEIIQRHVVPAIKGFFHSISLLKASSLQDNLRLLTLWFTFGGVEEA
                     NKAMHDGFGMIKIDNWLEVLPQLISRIHQPNPVVSKALLSLLSDLGKAHPQALIYPLT
                     VAIKSESVSRQKAALSIIEKMRIHSPILVDQAELVSHELIRLAVLWHELWYEGLEDAS
                     RQFFGEHNTEKMFATLEPLHELLNCEPETLREATFKKSFGRDLNDAYEWVLNYKRTKD
                     VSNLNQAWDIYYNVFRRISRQLPQLQSLELQYVSPKLLAAHDLELAVPGTYSATKNVI
                     KISYFEPTLTVISSKQRPRKIWIHGSDGVEYQYVLKGHEDIRQDNLVMQLFGLVNTLL
                     RNDSECFQRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLISEHRDAKKIPLNIEHWV
                     MLQMAPDFDNLTLLQKIEVFTYALDSTKGQDLYKILWLKSRSSEAWLDRRTTYTRSLA
                     VMSMVGYILGLGDRHPSNLMLDRTTGKVIHIDFGDCFEAAILREKFPEKVPFRLTRML
                     TFAMEVSGIEGSFRITCEHVMRVLRANKESLMAMLEAFAFDPLIHWGFDLPPQKITEM
                     TGIQLQLSNTNELLRRGAITLEQANKMEKEQQAEIKNARALLVLRRIINKLTGNDFKR
                     CKDLGINEQVDKLIQQATSVENLCQHYIGWCPFW"
     gene            <54743..>56107
                     /locus_tag="CAGL0F00517g"
                     /db_xref="GeneID:2887664"
     mRNA            <54743..>56107
                     /locus_tag="CAGL0F00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445996.1"
                     /db_xref="GeneID:2887664"
     CDS             54743..56107
                     /locus_tag="CAGL0F00517g"
                     /note="highly similar to uniprot|P47117 Saccharomyces
                     cerevisiae YJR065c ACT4 actin related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445996.1"
                     /db_xref="GeneID:2887664"
                     /db_xref="GOA:Q6FUU8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU8"
                     /translation="MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNT
                     KKSTVVNKSSAGGADSSGSGYFGNSTSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYI
                     GNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPL
                     NPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSPKVTDRSLTGTVIDSGDGVT
                     HVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERGEQDTSLKTAERIKQEYCYVCP
                     DIVKEFNKFDRDASKFAQFVVESQEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP
                     LPTVVDETIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEAL
                     SGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYDEYGPEIVRNFSL
                     FNMV"
     gene            complement(<56293..>57990)
                     /locus_tag="CAGL0F00539g"
                     /db_xref="GeneID:2887927"
     mRNA            complement(<56293..>57990)
                     /locus_tag="CAGL0F00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445997.1"
                     /db_xref="GeneID:2887927"
     CDS             complement(56293..57990)
                     /locus_tag="CAGL0F00539g"
                     /note="highly similar to uniprot|P40413 Saccharomyces
                     cerevisiae YJR064w CCT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445997.1"
                     /db_xref="GeneID:2887927"
                     /db_xref="GOA:Q6FUU7"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012718"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU7"
                     /translation="MAQPQQQMMEMPDLSNAIVAQDEMGRPFIIVKDQSNKKRQHGLE
                     AKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNQIAKL
                     LVQLSKSQDDEIGDGTTGVVVIASALLDQALELIDKGIHPIKIANGFDEAAKLAVSHL
                     ESVTEDITAIEFEKDSKLLNDYLFKAAKTSLGSKIVSKVHDKFAQMAVDSILSVMDKE
                     RKDVDFDLIKLQTRVGGSLEDSSLIKGVLLDKEFSHPQMPSKVLPREGQKSVKLAILT
                     CPFEPPKPKTKHKLDISSVEEYKKLQTYEQDKFKEMIQYVKDSGADVVICQWGFDDEA
                     NHLLLQNELPAVRWVGGQELEHIAISTNGRIVPRFQDLSPDKLGECSSIYELEFGTTK
                     DRMLVIEQPEESKTVTCFIRGSNKMIIDEAQRALHDSLCVVRNLIKDSRIVYGGGAAE
                     VTMSLAVSEEADKQRGIHQYAFKAFANALDTVPMTLAENSGLDPIETLSTLKSKQLKE
                     NIPVFGVDCLGKGSNDMKELFVVDPFISKKQQIMLATQLCRMILKIDNVIISGKDEY"
     gene            complement(<58585..>58971)
                     /locus_tag="CAGL0F00561g"
                     /db_xref="GeneID:2887783"
     mRNA            complement(<58585..>58971)
                     /locus_tag="CAGL0F00561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445998.1"
                     /db_xref="GeneID:2887783"
     CDS             complement(58585..58971)
                     /locus_tag="CAGL0F00561g"
                     /note="highly similar to uniprot|P32529 Saccharomyces
                     cerevisiae YJR063w RPA12 DNA-directed RNA polymerase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445998.1"
                     /db_xref="GeneID:2887783"
                     /db_xref="GOA:Q6FUU6"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU6"
                     /translation="MSAVGSLIFCDDCGNLLDNPEDKINNSNVIECSQCQAEYAKSQF
                     TNLKVVTSTSEDAFPSSLRLKRSVVKTHLKRDELKDDGATIKEKCPKCGHDEMRYQTL
                     QLRSADEGATVFYTCIKCNYKYRTNN"
     gene            complement(<59518..>60636)
                     /locus_tag="CAGL0F00583g"
                     /db_xref="GeneID:2887666"
     mRNA            complement(<59518..>60636)
                     /locus_tag="CAGL0F00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_445999.1"
                     /db_xref="GeneID:2887666"
     CDS             complement(59518..60636)
                     /locus_tag="CAGL0F00583g"
                     /inference="similar to AA sequence:UniProtKB:Q04410"
                     /note="similar to uniprot|Q04410 Saccharomyces cerevisiae
                     YDR517w GRH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_445999.1"
                     /db_xref="GeneID:2887666"
                     /db_xref="GOA:Q6FUU5"
                     /db_xref="InterPro:IPR007583"
                     /db_xref="InterPro:IPR024958"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU5"
                     /translation="MFKIAKNLVKTFEQTLSLSDQDRLDGFFQSIPPNLLESQIHSNT
                     DMSTLSDVLSGLRVVYVDELQLQLESYFDFIVGIDDDPLPLMNNQHGYLYPDYNEIIR
                     LLNIHAEQASPVKLNVWSAKGGTFRDEYMSLSAIPSDENQMEDINLSNDTPHHQLSSK
                     IFSPLGFKVQWTPLIAATYTYHVLQLNIEGGPAHAAGLIPDEDYIIGSQDGLLATGGE
                     TLLQDLIRSRANHDLILYVYNKVVDCVRPVTVNIGPDGRLGCGVGYGFLHRIPTVRKQ
                     EDGNTSMHSNKGITNAPTAAIPVPTFDQPMSSETFVPGIAKPPPTSKSSKKHAVNIST
                     MGDYFSEGKDQSPTPKPSTGDKDASIPPPPSKNTEETQ"
     gene            <63354..>64841
                     /locus_tag="CAGL0F00605g"
                     /db_xref="GeneID:2887872"
     mRNA            <63354..>64841
                     /locus_tag="CAGL0F00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446000.1"
                     /db_xref="GeneID:2887872"
     CDS             63354..64841
                     /locus_tag="CAGL0F00605g"
                     /note="highly similar to uniprot|P17709 Saccharomyces
                     cerevisiae YCL040w GLK1 and highly similar to
                     uniprot|Q04409 Saccharomyces cerevisiae YDR516c EMI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446000.1"
                     /db_xref="GeneID:2887872"
                     /db_xref="GOA:Q6FUU4"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU4"
                     /translation="MSFENFHKATSEQLTKAVDELCKEFEVTPKMLDELTAYFIESME
                     KGLAAEADSENKGLPMIPSFVTGMPNGTENGVLLAADLGGTNFRVCSVTLNGDNTFKM
                     EQMKSKIPDELLDDEGVTSEQLFGYLGRRTVAFVKKYHPEFLNKGDDIPPIRLGFTFS
                     YPVDQTSLNSGTLIRWTKGFKIEDTVGKDVVQLYQQQLDAQGLGMIKIVAMTNDTVGT
                     FLSHCYASGSHSSSGGEISEPVIGCIFGTGTNGCYMEEIENIKKLPEDMRHQLANEGK
                     THMCVNTEWGSFDNECRYLPTTKYDVDIDQKYSANPGFHLFEKRVSGMYLGEVLRNVL
                     VDLHSRGLMLTQYRDYDQLPHRLKTPFELSSEVLSRIEIDDSTGLRETELSFLQSLRL
                     PTTPSEREAIQKLVRAISRRSAYLASVPIAAILIKTNALNKRYHGEVEVGCDGSVIEY
                     YPGFRSMLRHALSLSPIGADGERKIHIRIAKDGSGVGAALCALVA"
     gene            complement(<65516..>67393)
                     /locus_tag="CAGL0F00627g"
                     /db_xref="GeneID:2887786"
     mRNA            complement(<65516..>67393)
                     /locus_tag="CAGL0F00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446001.1"
                     /db_xref="GeneID:2887786"
     CDS             complement(65516..67393)
                     /locus_tag="CAGL0F00627g"
                     /note="weakly similar to uniprot|P25567 Saccharomyces
                     cerevisiae YCL037c SRO9 or uniprot|Q12034 Saccharomyces
                     cerevisiae YDR515w SLF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446001.1"
                     /db_xref="GeneID:2887786"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU3"
                     /translation="MSQEENVETVPVTVTGKADSASQAAPESTTDVDIKKSKKADAKE
                     PGVDASKLVPAPIPTSSPWKAVSQTGESVNASEVSLEEEIENTRKQKERKNGGSANTM
                     KPTGSNVKWVPMKASITVSSGNGGSKRSGRRSGNKGKDTKKTGNSNSTSDSQGTNATS
                     SSSQSKKKNTKQAKSNNVKNNNKKKDDENNTSSTDTDKDNTKSSEVKTKSDVKSSSET
                     VNGGSSHAHHHHHGNNHNHNHSHSQHNHQHHHGHKHEQNKQKDVNTKDINEEKETASV
                     QETESKTPTGQRASSGSGQKENYSTENTNEQNVGEPSSKHVRRHSYHHQQGGSYGHTG
                     RQFNNHHSTNYSYNTSNTNFHDKTQRNGYYPRQNQKPYVPHNRNFNNNMHYVPYVQNS
                     YNAQYYNTMHALITAVQNVSKQIEYYFSEENLSRDSFLKSKFSDAGFVPIDLIAKFFR
                     VVNMSFGGDPTIILAALREIAANEDSVVEVVRGKSNAEEHEAKGQDNFYGPEYNINNY
                     FVRAKNWEKWLNETNQDSFAVAIEKTLAGTDLDQFTINSSLLPAQPYMYGRSYRPNGY
                     KRGQSYSRGGKQRYNSNSSPDNHRSQVGDGANEENDDPVNDNSTPVDTKSAEKSENDE
                     Q"
     gene            <71961..>73505
                     /locus_tag="CAGL0F00649g"
                     /db_xref="GeneID:2887573"
     mRNA            <71961..>73505
                     /locus_tag="CAGL0F00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446002.1"
                     /db_xref="GeneID:2887573"
     CDS             71961..73505
                     /locus_tag="CAGL0F00649g"
                     /inference="similar to AA sequence:UniProtKB:P38623"
                     /note="similar to uniprot|P38623 Saccharomyces cerevisiae
                     YLR248w RCK2 Ca/calmodulin-dependent or uniprot|P38622
                     Saccharomyces cerevisiae YGL158w RCK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446002.1"
                     /db_xref="GeneID:2887573"
                     /db_xref="GOA:Q6FUU2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU2"
                     /translation="MSLYSYNSMSSSSFGNDTDDLSFNNPLYSDQTTIFRDGDLFKEQ
                     LDLRSPHFGNEIQFEEQEDLNNYRIISKIGEGAFSRVFKAVPLHNNLALPKFVAIKVV
                     PKEDFHDHNLKKTSKLQTLNELNIHLKLTKANVPNVVKLLEFQVSKKYYYFIQEYIEG
                     GEIFNQIVKYTYFSEDLTRHVIRQVATAVKGLHENNIIHRDIKPENLIFEPIIKEQTI
                     HRYQKLRKSDDPKTKLDEGKFIPGIGGGGIGKVRLVDFGLSRLMDPAESGARTPCGTF
                     GYLAPEVLNQYKVDPRTSNTSYSYKVDIWAIGCILYTMLCGFPPFYEDEFSKESLGDK
                     ISRGNYKFLAPWWDEISIEAQDLIRNLLQVDPAKRYDIDQLLAHPWLNHYDCETSRPE
                     SFYEAELLDKTHLNYVLTSQADRKTNAHQDKDILLFDLDDVSDYSTQSSPFDSSNGLN
                     LHSTQKEQIRNFFNTATGIQQENFKVETEKATCNKSNFFKNHFKLKLSSATIINRRKK
                     MKLQTD"
     gene            complement(<73893..>78593)
                     /locus_tag="CAGL0F00671g"
                     /db_xref="GeneID:2887842"
     mRNA            complement(<73893..>78593)
                     /locus_tag="CAGL0F00671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446003.1"
                     /db_xref="GeneID:2887842"
     CDS             complement(73893..78593)
                     /locus_tag="CAGL0F00671g"
                     /note="highly similar to uniprot|P19524 Saccharomyces
                     cerevisiae YOR326w MYO2 or uniprot|P32492 Saccharomyces
                     cerevisiae YAL029c MYO4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446003.1"
                     /db_xref="GeneID:2887842"
                     /db_xref="GOA:Q6FUU1"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU1"
                     /translation="MSFEVGTRCWYPSKELGWIGAEVTKNDLKDGTYHMELALEDGKS
                     VNIETKDLTDESDESLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTY
                     SGIVLIATNPFDRVDQLYSQDMIQAYAGKQRGEMEPHLFAIAEEAYRLMKDNKENQTI
                     VVSGESGAGKTVSAKYIMRYFASVEEENSMTVQHQVEMSETEQKILATNPIMEAFGNA
                     KTTRNDNSSRFGKYLEILFDKDTSIIGAKIRTYLLERSRLVYQPETERNYHIFYQMMA
                     GLSPKEKAELHLKGAEDYYYMNQGGDVKIEGVDDKQEYNTTVDALTLVGISNETQQHI
                     FKILAALLHIGNIEIKKTRNDASLSSDEENLKIACELLGIDSFNFAKWITKKQIITRS
                     EKIVSNLNYSQALVARDSVAKFIYSALFDWLVENINTVLCNPAVVDKVASFIGVLDIY
                     GFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCID
                     LIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRFGQTKFVVSHY
                     ALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILDTLERNANKLEDAKKAEQE
                     SKPAKPGPMRTVQRKPTLGSMFKQSLIELMTTIRSTNAHYIRCIKPNNDKEAWKFDNL
                     MVLSQLRACGVLETIRISCAGFPSRWTFNEFILRYYILLPASEWSFIFTKKDMTEDDV
                     IGLCNKILAVTVKEKEKYQIGNTKIFFKAGMLAFLEKLRSDKMHISSVLIQKNIRAKY
                     YRREFLRIMSAITSLQQRVKGEVRRSIIDREFKNKAATEIQSLLRGYRRRSQILSIIS
                     SIRCIQLKVRKELNRKHAQVQHETDAAVAIQSKVRSFKPRKAFLEDRRKTVVVQSLIR
                     RRFAQKKLKQLKADAKSVNHLKEVSYKLENKVVELTQNLAAKVKENKSLSARVVELQT
                     SLEESALLQEELKQIKSKHDAELLEQKDVFAEKGKQIEEELNAANLQVEEYKSKLLDL
                     TQEYEEHKATTKSYLEELEKTKAELIEVQTFNSDLQNEVNSLKEELSRLQTQISLGTV
                     TANVLPQTPSKDIHMQRNVTNGTDIGPGSELNVRPVNSKDAGSVSNMGMDSYASDSNA
                     LTQINEELFRLLEDIEVLNNEITDGLLKDFEVPAAGVGMQLSRRDVVYPARILIIILS
                     EMWRFGLTKQSEGFLAQVLTTIQKVVTTLKGNDLIPAGAFWLANVRELYSFVVFAQHS
                     ILTEESFKSGMTDDEYKEYVSLVTELKEDFESLSYNIYNIWLKKLQRELQKKAVNAVV
                     LSEALPGFSAGQSGGLLNKIFSSGEEYTMDDILTFFNSIYWSMKSFQIENEVFHKVVT
                     TLLNYVDAICFNDLIMKRNFLSWKRGLQLNYNVTRLEEWCKTHGVPDGTDCLQHLIQT
                     SKLLQVRKYSIEDIDILRGICSSLTPAQLQKLITQYQVADYESPIPQEILKYVADIVK
                     SEASLSASSKAPTHSNDIFITPETGPFNDPFADIETHKFDQVEAYIPAWLVLPTTKRI
                     VELVAQQVSVQESQ"
     gene            <79324..>80691
                     /locus_tag="CAGL0F00693g"
                     /db_xref="GeneID:2887611"
     mRNA            <79324..>80691
                     /locus_tag="CAGL0F00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446004.1"
                     /db_xref="GeneID:2887611"
     CDS             79324..80691
                     /locus_tag="CAGL0F00693g"
                     /note="highly similar to uniprot|P54885 Saccharomyces
                     cerevisiae YOR323c PRO2 gamma-glutamyl phosphate
                     reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446004.1"
                     /db_xref="GeneID:2887611"
                     /db_xref="GOA:Q6FUU0"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:Q6FUU0"
                     /translation="MSSAEKIAKQARVAGNVLKTISDENRSKILYRIRDALANAKDEI
                     ESANKEDLEQARAGGLADSLVKRLDLFKGDKFDVMLQGISDVADLEDPVGKVKMAREI
                     DNGLMLYQVTAPVGVILVIFESRPEVIANITALCIKSGNAGILKGGKESVNTFKAMAK
                     VVNQTIEQYKDETGVPVGAVQLIETRQDVSDLLGQDEYIDLVVPRGSNSLVRQIKDST
                     KIPVLGHADGICSIYVDRDADLEKAKRIVLDAKTNYPAGCNAMEGLLLNPDFSQWDDV
                     LHHLITEGGVTIHATTDVKEAFLKKLQDSGKLNDDIKAKIVDAKDGDFDKEFLSLDCA
                     VKFIPNTVDAINHINEHSSKHTDAIITESKEDAEKFLKGIDSSGVYWNASTRFADGFR
                     YGFGTEVGISTSKIHARGPVGLDGLVTYQYQIRGDGQVASDYLGAGGNKAFVHKDIDV
                     TNIKL"
     gene            complement(<80864..>81796)
                     /locus_tag="CAGL0F00715g"
                     /db_xref="GeneID:2887968"
     mRNA            complement(<80864..>81796)
                     /locus_tag="CAGL0F00715g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_446005.1"
                     /db_xref="GeneID:2887968"
     CDS             complement(80864..81796)
                     /locus_tag="CAGL0F00715g"
                     /inference="similar to AA sequence:UniProtKB:P10962"
                     /note="similar to uniprot|P10962 Saccharomyces cerevisiae
                     YAL025c MAK16 nuclear viral propagation protein"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_446005.1"
                     /db_xref="GeneID:2887968"
                     /db_xref="GOA:Q6FUT9"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT9"
                     /translation="MNVSDDLIWDIINHGFCATKIKTKVGQTFDRDPYNVTGLFTRQS
                     CPLANSKYATVREYGDKGRLYLCIKTPERAHTPAKMWQRIRLSNNYSKALKQIDEHLM
                     YWNKFFLHRCKQRYVKLSQIKLVERRQLKLQMNGEQKRLVGIAPKVKRREMNRERKAL
                     VAAKIEESISKELLNRLKSGAYSNADKTLTPLNVDENIWNKIMGKLGEEDMEGVSADE
                     EEEESDVEREIEYIEDTEEEEEVDLDNLEKWLEDKSDHSDKDEDDSDFSSTDDEGDDD
                     ESYQRKLKDIKKKSIEVELEFENENEQQQSTVSN"
     gene            <82773..>85160
                     /locus_tag="CAGL0F00737g"
                     /db_xref="GeneID:2887836"
     mRNA            <82773..>85160
                     /locus_tag="CAGL0F00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446006.1"
                     /db_xref="GeneID:2887836"
     CDS             82773..85160
                     /locus_tag="CAGL0F00737g"
                     /inference="similar to AA sequence:UniProtKB:Q12502"
                     /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
                     YOR322c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446006.1"
                     /db_xref="GeneID:2887836"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT8"
                     /translation="MLNFQRLGRIQSNDNSNSTAQSQSKFGSPVKLRRGSEVHTPGKP
                     EDVSGRPPCKLPIDLELNLESPPCVLYGSATDSAGAVLCGQFVLRVKDPQSENFIYSV
                     DNQEHGGRNATQHETGYNNITITSVHLKFVQKVTYNKPFIPDSSISASSTALQLPANA
                     TGNIINCKNCKVKYTSLKSWNIQSTKKLITIGKHAYPFSYLVPGSVPSTSALGLSANT
                     KIQYELVGNVSYYDPVHKDKEYMLNIKMPIPVTRSIHRGPDKNSLRVFPPTQLTAAAV
                     LPNVVYPKSTFPLEMKLNGISSPSTGKGSDKRWRMRKLAWRVEETTRVKTNVCTQHKP
                     DLKKLEDQVKLKEEERSKKPPVPIKRYGDIGPQIRIALSSPSNMPLSGGRSGPQPTLT
                     SSEEAPNSATLSSREGEAGNIDTDENETTDQFVHPSDDAMRQELLQQQQRQREQQLKQ
                     ELKNSSALFSEEVRIISKGEMKSGWKTDFDSDNGKVELVTDIDLLHSNSGVSNPIMHT
                     STTHPYKKKPDLPPVTIACDIQDPNLGIYVNHTLAIEIVVAEEALQYANGQPIRNGGS
                     RRSSVIPEGSKPEGTTENMNDDDDDSREMDQRLLELSPMFANRNAQRAKPVEYNDLSP
                     VNSRSSTRSGNNTGRITPHMSSTPRIVSVPTGAARVLRMQFRINVTERSGLGISWDEE
                     VPPMYHEIQTNAPPSYEAALKDSGGVQIVDNSEDLGEEPEHQTPIIAFPPMAHHNNSN
                     IRNNLTTVQSPQLENIISIQGAVPYGRGSPLTPNNTIEMGIRNLSEVLDTDRITQ"
     gene            complement(<85452..>87656)
                     /locus_tag="CAGL0F00759g"
                     /db_xref="GeneID:2887973"
     mRNA            complement(<85452..>87656)
                     /locus_tag="CAGL0F00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446007.1"
                     /db_xref="GeneID:2887973"
     CDS             complement(85452..87656)
                     /locus_tag="CAGL0F00759g"
                     /inference="similar to AA sequence:UniProtKB:P31382"
                     /note="similar to uniprot|P31382 Saccharomyces cerevisiae
                     YAL023c PMT2 or uniprot|P47190 Saccharomyces cerevisiae
                     YOR321w PMT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446007.1"
                     /db_xref="GeneID:2887973"
                     /db_xref="GOA:Q6FUT7"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT7"
                     /translation="MDSELRARKAPSVSEVKVEHDHGHDLANDNKEQKASNKQFWLRL
                     ERVAMPIVFTLLALLVRLYRLDVVKKVTWDEAHFGKFGSYYLRHTFYHDVHPPLGKML
                     VGFSGYLAGYNGSWDFPSGQPYPDYVPFVKMRIFQGAVSALCVPMTYFAAKAIGFSLP
                     TVWLTTILVLCENSYTTLGKLILLDSLLLFFTVATFMCFQKFHSYHRKPFSFQWCLWL
                     FLTGASMGCAISVKMVGLFVITLVGIHTIVELWTLLGDKNITWKRYANHWIARIICLI
                     VTPFLIFALCFKIHFALLWGSGPGDHEMPPRFQAALNGTNIGQGPRDVSIGSTITLQN
                     MKPRGAYLHSHHQTYPEGSKQRQVTCYNYVDGNNDWIVYRPHGKPIWHVNDTEHEAIR
                     NGDTIRLVHKGTGSNLHSHQVEAPLNKLDYEVSGYGNLTIGDLKDHWVVEIIKDDGNE
                     DKNLIHPITTHVRFRHAVLNCYLAQSNEHLPEWGFSQAEVRCIREPEKNDIKTMWIVD
                     THTHPNLEAPENFIYPRRSFWSDFFELNKRMMATNNALTVSKDKHDYLRSESWEWPTL
                     YRSLRINSWNENDTRYLLLGSPASTWPSTVAVLFLVFALLYKVLKWNRQMQIFQNEHD
                     EELFIYGGVYPLLGWFLHFFPFVIMGRVKYVHHYLPALYFALFVLAYIFDAGLRYYNK
                     TKTQRIIKFCIYAGYMSVVIGGFILFAPFSYGMTGKLENYKHLNWMKNWDVV"
     gene            <88454..>90970
                     /locus_tag="CAGL0F00803g"
                     /db_xref="GeneID:2887620"
     mRNA            <88454..>90970
                     /locus_tag="CAGL0F00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446009.1"
                     /db_xref="GeneID:2887620"
     CDS             88454..90970
                     /locus_tag="CAGL0F00803g"
                     /inference="similar to AA sequence:UniProtKB:P19659"
                     /note="similar to uniprot|P19659 Saccharomyces cerevisiae
                     YOL051w GAL11 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446009.1"
                     /db_xref="GeneID:2887620"
                     /db_xref="GOA:Q6FUT5"
                     /db_xref="InterPro:IPR003101"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT5"
                     /translation="MSLDVSVRERTRNMNQLMRILMDINHLNGGDSGVLEKLRLSARN
                     FESAIYEKSSTKQEYMASMREKIEGMQQTLQQKKHTPATPSQQVPPPQQQQQQQGSQP
                     RITLTPQQQQLLLSKMQLAVIPQQLLSKIPNLPAGVSTWKDVTELASKNMLDQRTMEI
                     VRGVYKVHQQLLLKASFEQQRKRQPPQQQQPQQPQQQQQQQQQQQQQQQQQQQQQQSP
                     QNVTNGNLFHILLRLFQDEFLSSKYQEQLSKLFKMEEIKHIIQQAIEVGKKYATQRYQ
                     LGHMLTNEERVVFFKKFLNHVILKKMEETKGSNKTDATMMNLTDNHTQMGTGQESTVP
                     QQFNTDQVISNNQMPVNNFNMNMNNNQMPQQPFQQQMPQLTLQQQQNLFQQQLQQQQQ
                     QQQQQQQQQQQAQIQAQQQQQQQQQQQQQQQQQQQQQQQLLMQNLAATKLDIEEIRNI
                     SMKAAKLQLQLTDLTNTLTNEEKDAIRSRLKTNQKLFVQVSNFAPQVYMMTKSKNFLK
                     EVFQLRIFVKEILEKCANGIFVVKLETVDKLIMKYQRYWDSMRVQLLRRQSQTKQQEI
                     QGALQQMQRVEAQNNNNNNNYNNNNNNNSTNNNTNNNPQMPNLNNSNIITNFSTPFQV
                     PIATPNNITNAVKKESRKPSVSASNASTPGTTSGKAKPKSRSNRQNSRSNSINEVSSD
                     STKQPQTTEAVSKEEAAKIHEANVRKSEILSRFKHRQKLFITSPADLFLSTLGDCLGL
                     KCEEIETSYKIPKNMADFINGVKISKTEQRIRTQDTVVTSVVDNKLLMQSKTGGDKRT
                     YGIDPAALSAVFKGVQGTTNMNTLQLFSSSSLSPVTEENA"
     gene            <91832..>93283
                     /locus_tag="CAGL0F00825g"
                     /db_xref="GeneID:2887757"
     mRNA            <91832..>93283
                     /locus_tag="CAGL0F00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446010.1"
                     /db_xref="GeneID:2887757"
     CDS             91832..93283
                     /locus_tag="CAGL0F00825g"
                     /inference="similar to AA sequence:UniProtKB:Q08220"
                     /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
                     YOL049w GSH2 Glutathione synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446010.1"
                     /db_xref="GeneID:2887757"
                     /db_xref="GOA:Q6FUT4"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT4"
                     /translation="MTEPIVPQALTNEELEKQILPETYQWALSNGLLMYPPDFQLTQA
                     QIAPFTLYPTPIARKNFEEAIEVQQSFNELYAEISRDQGEHWLSQETEKLAHSDEGFT
                     GKLWDLYKSVRNEGIAQKLRLGIFRSDYLIDKNIDQIKQVEFNTVSVSFVGFSTRVGE
                     VHKYLNDSGAYGKSSYADKDIPVPTSVQEMTKSFADAFQKYDALNDEKKIILMVVQRG
                     ERNVFDQRIIEYSLQKDYGIRVIRMTFDDIISRLTSDNADKNRLFFKETGDEIAIVYY
                     RTGYTTTDYQNEQDWEARKFLEKSYAIKAPDLLTQLSGAKKIQQLLTDDNILSQFVKS
                     ENSRRALQKTFVKIYPLDDSELGNIGKKLAFDEPHRFVLKPQREGGGNNVYKEDIPSF
                     LSTIGESKWDAYILMEIIDPLPYENNVIIRGNEIFKESIISELGIYGSILFDDEKIHF
                     NRNSGWLLRSKFTTSNEGGVAAGFGCLDSVVMY"
     gene            complement(<93453..>94456)
                     /locus_tag="CAGL0F00869g"
                     /db_xref="GeneID:2887911"
     mRNA            complement(join(<93453..94160,94301..>94456))
                     /locus_tag="CAGL0F00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446011.1"
                     /db_xref="GeneID:2887911"
     CDS             complement(join(93453..94160,94301..94456))
                     /locus_tag="CAGL0F00869g"
                     /note="some similarities with uniprot|Q08219 Saccharomyces
                     cerevisiae YOL048c or uniprot|P31379 Saccharomyces
                     cerevisiae YAL018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446011.1"
                     /db_xref="GeneID:2887911"
                     /db_xref="GOA:Q6FUT3"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT3"
                     /translation="MGIAGYLQQYLFTPVLDHAKLRQKRYLFKMDLIKQGFNKDLFLS
                     STYKYPLKGLFNVITRPYYWKPLGIFAGSYLVIFAVVAGAYYVTIMPFILGGALLTMG
                     PIGLVLAHIQWLVQSNSIAAYICRNLMLEKLNTEVFDLTLAKNGQQKLVSDAKYLSRK
                     TTKSRRSIWSAHTIIYSFLSAKVTSLGQSIVLSLVSLIPVLGPLIVNQITAPDRALSY
                     LSRYLFLKQYTSPDIKKFKYKNLGQLACFGVSAGLFELIPLASMVTIMSNTVGAAIWS
                     ADLVKKEQKVL"
     gene            complement(<94950..>95597)
                     /locus_tag="CAGL0F00891g"
                     /db_xref="GeneID:2887683"
     mRNA            complement(<94950..>95597)
                     /locus_tag="CAGL0F00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446012.1"
                     /db_xref="GeneID:2887683"
     CDS             complement(94950..95597)
                     /locus_tag="CAGL0F00891g"
                     /note="weakly similar to uniprot|Q08218 Saccharomyces
                     cerevisiae YOL047c or uniprot|P31379 Saccharomyces
                     cerevisiae YAL018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446012.1"
                     /db_xref="GeneID:2887683"
                     /db_xref="GOA:Q6FUT2"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT2"
                     /translation="MTMVYSLFLGPIAIALVIVQVILVSNYLALMDTRRDTDKLGALV
                     LGNVFTTLNLNQFVVFTQTINIFQGDTNIRLWRRITSAEFLVDTLPNFLIDRSIEILD
                     YIFIVACFFIPFFGITIVQLIFAGQNGFAYFQPYFKELRKMDEKELRKVYYQNYSKWY
                     LYGVACAVIESLPFLSGYLQPSLFVGASLWSARELKEEVKLRTKKFGPIQPQEST"
     gene            <97023..>100643
                     /locus_tag="CAGL0F00913g"
                     /db_xref="GeneID:2887905"
     mRNA            <97023..>100643
                     /locus_tag="CAGL0F00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446013.1"
                     /db_xref="GeneID:2887905"
     CDS             97023..100643
                     /locus_tag="CAGL0F00913g"
                     /inference="similar to AA sequence:UniProtKB:P31374"
                     /note="similar to uniprot|P31374 Saccharomyces cerevisiae
                     YAL017w FUN31 or uniprot|Q08217 Saccharomyces cerevisiae
                     YOL045w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446013.1"
                     /db_xref="GeneID:2887905"
                     /db_xref="GOA:Q6FUT1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT1"
                     /translation="MPYAGTSDSSRAAFKAFQEKHITKDTIFNKKFDLASIPSSASAS
                     DTSLSFKNISRGNSYVDLQRPSPFYRHENGSSESVKSSSEKFDYKELISLPNESTHAY
                     SCNPLSPISLYVRLSILKRALDIMANDPDMLEESKAVEPLKRMKASNTADVTHVAHLQ
                     EMINEKNNEEDMVTLPKRGSVTKWNSHAATLEAFVSNSMDKSAQPNSKYGDLTNEDSQ
                     IPERPVQMQRAVSLAVLPQSISNHSNNSPFKKDFNFRGTQSGTKFRHNKDILEGLRKL
                     LDDTLEKKSMSNASKLHKLSLLNIDKLDLTSVPTDGNDDTINDVEEKGNKLKRALLDS
                     LAEPFIEFGRENDNMQDDQYKKLNEQDLNINMSEVVRQYRYNKVLHPFTSGKNSAPQA
                     IFTCSDQHPWNFKAANDLACLTFGINKNVLKALTLLDLIHTDCRNFALNKLISIQDDQ
                     DIVFSGEIIAIVQPNSENKAGLIWATIWARRIKGSLVCVFEKIPCDYADIMLNLDDFS
                     VENINDSTGLLSNLDQNTENDITVTESDELEKKKTVKFANEVHDIKKVSKSLSKLIKD
                     VCTGNYDMDEDDKLVPLSIRVSNEINRRRYFTLNHSNYNISCAVSSSVLENELKLKIH
                     SAAYQVGLFIIERETLKLVSCNKSICKNMFGYHTSEIINSDITTLIPDLAKILAFIQY
                     QYPILDFSAEENRGLVLTEHFFRKIVSEMHSDPGSFYSSVGLDGLHKDGNNIKVDFQI
                     RVLDENIFLLWISQTRDLLFENYDSNPSQLSMLKESELSLVSSRSSSSSSKRPTECLA
                     LSALKRIDSLAIADQGIEDETCEHNENRCNSIEKQSVAISNSNKEAHPPKNSELKNTV
                     DIIDNDLISDPTIRANIELARRYTNNKSDFVKEDNFKLDEEMIKKIVNTEIPEVANAD
                     SNLAPEELLKVLNIKEPIVIGAQKRKKKYSDFVVLQKMGEGAYGKVNLCIHKEKKYIV
                     VIKMIFKERILVDTWVRDRKLGTIPSEIQILATINKRPHENILGLLDFFEDDDYYYLE
                     TPPHGQTGSVDLFDIIEFKSNMTEFEAKLIFKQIVSGIKHLHDQGIVHRDIKDENVIV
                     DSKGFVKLIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGNPYEGKSQDIWAIGILLYT
                     LIYKENPFYNIDEILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDVWL
                     QI"
     gene            <101230..>102354
                     /locus_tag="CAGL0F00935g"
                     /db_xref="GeneID:2887619"
     mRNA            <101230..>102354
                     /locus_tag="CAGL0F00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446014.1"
                     /db_xref="GeneID:2887619"
     CDS             101230..102354
                     /locus_tag="CAGL0F00935g"
                     /note="weakly similar to uniprot|Q08215 Saccharomyces
                     cerevisiae YOL044w PEX15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446014.1"
                     /db_xref="GeneID:2887619"
                     /db_xref="GOA:Q6FUT0"
                     /db_xref="UniProtKB/TrEMBL:Q6FUT0"
                     /translation="MQLKEDTVNMSNVLPESTMTTVQNLLDDDDFSDEPAMSPYQNDD
                     NTSDEYYNCLDLFIKGEPKQCLEAMLSCGLLNESQIFQNMDSVELFINACSRVSDLAT
                     LGISLQNKIIQLFIYSEILEFVRRNSPAASALALITKLHGNIIRAIGLMRGSRDERYQ
                     IIADEKDALIHDIGFHVKKRTNESRRQYNVEMLMLAELYLFDVQIQLEGKKKSPKLYE
                     DLCDKVLQLKSVFDETVLDEKPLSQIILAKLEQKKDSVEKKKSSSRKSLRESTKVLQA
                     IPTPSDEVRDQIKMDNLALSKGAFSSITSHIPQKWLKALTTQKWIYKNMKQLSLVLVV
                     AVILLVKRYRMITKWFGEIPSTLSQLKPAIVEILRLLSSL"
     gene            <102956..>104791
                     /locus_tag="CAGL0F00957g"
                     /db_xref="GeneID:2887576"
     mRNA            <102956..>104791
                     /locus_tag="CAGL0F00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446015.1"
                     /db_xref="GeneID:2887576"
     CDS             102956..104791
                     /locus_tag="CAGL0F00957g"
                     /inference="similar to AA sequence:UniProtKB:P31383"
                     /note="similar to uniprot|P31383 Saccharomyces cerevisiae
                     YAL016w TPD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446015.1"
                     /db_xref="GeneID:2887576"
                     /db_xref="GOA:Q6FUS9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS9"
                     /translation="MADNQNGNEGDLHPLALLMDELKHDDIANRVEAMKKLDTIAIAL
                     GPERTREELIPFLTEVAQDDEDEVFAVLAEELGKFVPLVGGSQYINVLFPTLEILAAT
                     EETLVREKALASLNKVVKDMTIEQLLHDYVPLLDRLANADWFSSKVSACGLFKVVISR
                     VKDDTLRKNLLALYSQLIQDDTPMVRRAAARNLPSIIDQLRENPGLSCEDDWEYVSEM
                     FKKVITDNQDSVKFLAVESLIAILKFFNAKGDSSHTEALLAYALKLAKDEAWRVRYMV
                     AEKFEDLADEISQLDKVVDHLLEPFLSLCEDNEGDVRKAIAGHVSGFSKHIKDASIIE
                     AKIIPAIYTLSIDENETVRASLAQSITGMSSLLPKESVTENLLPIVLNMLKDEFPDVR
                     LNIIASLKNINKVVDTKILSESLIPAINELAKDINWRVRMAIIDYLPVIGEQLGKSFF
                     DEQLIDLCMTLLWDPVYAIRNATVKILTKLTEFFGSDWCRDEILTKLLTVDAETLENF
                     IYRFTVLSALRELTSAVSSDITLEHILPYIVKLSDDKVPNIRFNVAKAYTVICENLKN
                     NKTKNLKEIFEEKMLPSFKKLQGDSDVDVKYFANENLEKCQLLIN"
     gene            complement(<105064..>106242)
                     /locus_tag="CAGL0F00979g"
                     /db_xref="GeneID:2887709"
     mRNA            complement(<105064..>106242)
                     /locus_tag="CAGL0F00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446016.1"
                     /db_xref="GeneID:2887709"
     CDS             complement(105064..106242)
                     /locus_tag="CAGL0F00979g"
                     /inference="similar to AA sequence:UniProtKB:Q08214"
                     /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
                     YOL043c NTG2 endonuclease III-like glycosylase or
                     uniprot|P31378 Saccharomyces cerevisiae YAL015c NTG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446016.1"
                     /db_xref="GeneID:2887709"
                     /db_xref="GOA:Q6FUS8"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS8"
                     /translation="MVPRKRTRRYLEVDVEGNPAEGVVQSKYFKKEETVTVKHEPVSD
                     YKDFVDEVDIEWIKSLDTQAFFDYIDDRTSEDPQRWLKPLDEDSLGLKPLEIAKLPKS
                     FIPIYNRVRLMRAQLKTPVDKVGCALMPIFIAENCGLHKEQILPKNYRFQLLIAVMLS
                     SQTKDEITAEAMLNIMRYCLNELHDPNGMTLESVLMMDESIIDEKIKSVGFHRRKATY
                     IYKSVRMLRDNFDSDVPTNVNDMLSLPGVGPKMTYLALQRAWGKMDGICVDVHVDRLC
                     KMWRWVDAKKCKTPDHTRKALQTWLPKCLWYEINTVLVGFGQVICMARGKRCDICLAN
                     DICNARDRKLLSKLQFEEDIDEAFWKLSKTTRGNFDEYILYLKKKLKSDKYPIKAEGP
                     "
     gene            <106796..>107875
                     /locus_tag="CAGL0F01001g"
                     /db_xref="GeneID:2887962"
     mRNA            <106796..>107875
                     /locus_tag="CAGL0F01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446017.1"
                     /db_xref="GeneID:2887962"
     CDS             106796..107875
                     /locus_tag="CAGL0F01001g"
                     /note="highly similar to uniprot|Q08213 Saccharomyces
                     cerevisiae YOL042w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446017.1"
                     /db_xref="GeneID:2887962"
                     /db_xref="GOA:Q6FUS7"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS7"
                     /translation="MLARQFIPIGANVLKNSAKPLFTLLSYNLLSPSYMWPQVYTYVP
                     EKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYSNFWKKALQTNMNYGSNYIAKT
                     PPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLGVFSNNELEYLEKKPVTLTD
                     GAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINTHLYWKYDDVKLTQCMII
                     MRELARIIEKHLVGLENVTDDKIKILFTGDLNSTSDSLVINFLKGQIVSHDNLNVINP
                     MKPYLEHCVYDDVPEELFTHTCYSGKLKGIFDYIWYHDTDFKLRRILSGREVSHELAA
                     LNQFGLPNENHPSDHIPLFTEFEIL"
     gene            complement(<108155..>109345)
                     /locus_tag="CAGL0F01023g"
                     /db_xref="GeneID:2887717"
     mRNA            complement(<108155..>109345)
                     /locus_tag="CAGL0F01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446018.1"
                     /db_xref="GeneID:2887717"
     CDS             complement(108155..109345)
                     /locus_tag="CAGL0F01023g"
                     /inference="similar to AA sequence:UniProtKB:Q08208"
                     /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
                     YOL041c NOP12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446018.1"
                     /db_xref="GeneID:2887717"
                     /db_xref="GOA:Q6FUS6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MNLFPETVATDDKVSQLFKTSNALDKKATPLIKVQKIEVIKKTD
                     KDADGDEKMEDAASDDAKVKKPSKKKLAKKNKETKTPEQVPEEPEKLVEEGKESKKST
                     KEDEIEKASRTIFVGNLSNEVIISKSTYKLFQKLFNNIDDDDENKKLPIQSIRFRSVS
                     FEDALPRKVAFVQQKLHKSRASVNAYIVYKEQSPLLNKLIKRLNGQVFSNRHLRVDSI
                     THPAPHDKQRSVFVGNLDFEEDEESLWKHFGACGSIEYVRIVRDPKTNMGKGFAYVQF
                     NELQSVSKALLLNEKPMISQNEHLKKRKLRVTRCKNIRKVEPTLKSGKYMTDGQKTKL
                     GRAKKILNKAERSKLLKELTVEGIRATKDDSKPVLKKGKKERSKTGRVTKRSQAFKKS
                     QQKK"
     gene            complement(<110519..>110950)
                     /locus_tag="CAGL0F01045g"
                     /db_xref="GeneID:2887961"
     mRNA            complement(<110519..>110950)
                     /locus_tag="CAGL0F01045g"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_446019.1"
                     /db_xref="GeneID:2887961"
     CDS             complement(110519..110950)
                     /locus_tag="CAGL0F01045g"
                     /note="highly similar to uniprot|Q01855 Saccharomyces
                     cerevisiae YOL040c RPS21"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_446019.1"
                     /db_xref="GeneID:2887961"
                     /db_xref="GOA:Q6FUS5"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS5"
                     /translation="MSQATGAKSKRVFKTHSYRGVDLEKLLEMSTEDFIKMTPARVRR
                     KFSRGVSGKPNGFMKKLRAAKLACPENEKPAVVKTHLRNMIIVPEMIGSVVGIYNGKV
                     FNQVEIRPEMLGHYLGEFSITYTPVRHGRAGATTSRFIPLR"
     gene            <112286..>113305
                     /locus_tag="CAGL0F01089g"
                     /db_xref="GeneID:2887649"
     mRNA            <112286..>113305
                     /locus_tag="CAGL0F01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446021.1"
                     /db_xref="GeneID:2887649"
     CDS             112286..113305
                     /locus_tag="CAGL0F01089g"
                     /note="some similarities with uniprot|Q08199 Saccharomyces
                     cerevisiae YOL031c SIL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446021.1"
                     /db_xref="GeneID:2887649"
                     /db_xref="GOA:Q6FUS3"
                     /translation="MVAKVWSRVILIFIATVMVFASSQQGDANKVNTASPPGANGIAY
                     ASVVAGGSNHVSAAGSVTGDGVQLPNAEVDIDWLEEHLEDSHDYEKGYDLVEQHFNKL
                     LVGNNADASFKVRELASRLILGTLRNNPPVKRLIWDQHPLFVSQVFDLYIGNALKQGS
                     GNPLKYPLLKRYLSILLELIPFNRDFRFEEDYKDILDKLYTESDVPSDIKIKVLELIT
                     LDYSNIKGASGWIDRITNVLTDSEMGLDELHKRTFFNAMHALKSEDPKLKLPTNFLNW
                     LAQETKERAHNLKLAQAQADDNDLKVRDLEQEEFDQRLVDSRHSVFGNPMAARMKDPY
                     IVDEL"
     gene            complement(<113528..>114250)
                     /locus_tag="CAGL0F01111g"
                     /db_xref="GeneID:2887929"
     mRNA            complement(<113528..>114250)
                     /locus_tag="CAGL0F01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446022.1"
                     /db_xref="GeneID:2887929"
     CDS             complement(113528..114250)
                     /locus_tag="CAGL0F01111g"
                     /note="highly similar to uniprot|Q08202 Saccharomyces
                     cerevisiae YOL032w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446022.1"
                     /db_xref="GeneID:2887929"
                     /db_xref="GOA:Q6FUS2"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS2"
                     /translation="MFAAIASGNPLQMSEEVPNSNGMQHTIVLSSTKPKNYSHISLFI
                     LPNVTFPAEYIATVYFKLTPTEDFKLFGYLSTEKPSAIFKVKLPQSQTTPTPNDGLGE
                     IDMGDDDDISMPANGPTTNHNISQLIIGISIENRNEGMTKIMEWKQQQQLASSTGTNS
                     LVLARGNNNLGINTVGQLAKVYPLLTQELAGKIVQHAYNYLTGFLDDNGNVSIKRFDG
                     WWDKFKNRLANDGSFLDEVTAT"
     gene            complement(<114888..>116486)
                     /locus_tag="CAGL0F01133g"
                     /db_xref="GeneID:2887963"
     mRNA            complement(<114888..>116486)
                     /locus_tag="CAGL0F01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446023.1"
                     /db_xref="GeneID:2887963"
     CDS             complement(114888..116486)
                     /locus_tag="CAGL0F01133g"
                     /inference="similar to AA sequence:UniProtKB:P48525"
                     /note="similar to uniprot|P48525 Saccharomyces cerevisiae
                     YOL033w MSE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446023.1"
                     /db_xref="GeneID:2887963"
                     /db_xref="GOA:Q6FUS1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS1"
                     /translation="MLLIKRIESCRQYSSTVLSSILKSKKTSILPKHPSKGHANHVCE
                     PAVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYN
                     SLKWCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVP
                     PTNVSYDRHCAHLSEGEIKSKLDQGIPFTVRFKAPEKYPPFEDLLHGKIDLQPQQNPS
                     DIRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEWLPSTPKHIALYEAFGWEP
                     PKFTHLPLLTTTEDKKLSKRRNDMSVMSLKEQGILPEALVNFSVLFGWSPPRELASKN
                     HECFTLQEFENLFDLDSLTKGNAKVDMKKLWFFNKQFLGKKLEDPTFIDAVLPTIVKT
                     IKDKYGNVTELEEKVKTILIENGKVLSNINEFDTVFYYFFEKPNFESNEQSQEFLSKY
                     DNKVASTILQYTRSILSEGSLTKDLVNDLSSKFNVPKKTIFQTLRFALAGSHPGAAVP
                     VLFKVLGVSEAQERIANAIQILEQ"
     gene            complement(<116762..>120079)
                     /locus_tag="CAGL0F01155g"
                     /db_xref="GeneID:2887943"
     mRNA            complement(<116762..>120079)
                     /locus_tag="CAGL0F01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446024.1"
                     /db_xref="GeneID:2887943"
     CDS             complement(116762..120079)
                     /locus_tag="CAGL0F01155g"
                     /inference="similar to AA sequence:UniProtKB:Q08204"
                     /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
                     YOL034w SMC5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446024.1"
                     /db_xref="GeneID:2887943"
                     /db_xref="GOA:Q6FUS0"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUS0"
                     /translation="MPTINLASYVDDVDDLTPSRKRLKIKPVDYDVFKPGSIVKIRLE
                     NFVTYNYTEFNLSPSLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQVEDFIKNG
                     QDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGRNLEKRR
                     TQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRPEKLLDETIRAI
                     DSELLSMFEVLKKLQLQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLLNEYQETLDT
                     LDKHKKLLPYLKIQDHREKLLTYKRQVEGAKKQLQEFQKEREPYMQVLASLNESDAQL
                     NIEKENIEEKKVSTKRKLEKTVSKLNALREEIEKKNLQIEYYKGRSNKLKIKIETKKE
                     DIDNIKRKISDIETPEESEVTELERKRNDLIERESQVNSEIDEVDTQMSTQNHNLAIL
                     ERKMVDKKSSLTSTDNIHLLDQLNDRDLKRAVLFLRKNNEARKVVLEPPVLTVSVTHK
                     DFAPYLAQCIDYNTSKAFTLINEQAYNTYGKEILKHFTANTRQLTGRTNSPPVSRERL
                     RQLGFEGYLSDFVKGDSNVIKMLCEFQGIDQIPVSRKKFSAEQLEALIKPQSNNQPLF
                     RKFIHGTNMLNVRYSNMTKQMYSVEIVVKPTNLYQGYVLSSDEKQRINNEMNDLKKQI
                     EGIKNTMNQSAGKKAQLKMQLNEISTAMNDINKKSRYISNLKRQRSQYEEQLRFEKEK
                     LEEYKKDIRKDTAPKIQQIEKLIGESLKSEIDCTIELENIGRSLRHIQIKNLQADIAI
                     FEHNNKKTVVKSFLQSFEEKKNELRAKYDELKNKYKELRDTEEYRQWRRDIDAYNQET
                     KQVLNDLAEKYRDEDKFNLIYVEQIVNKLESKIQLSNHDRSAVALLEQTKAKIADLED
                     KLPTQVRKCNTIRKEMSDKQKVLEPRLESIVSGIGRKFSELFKDVGTAGGVTLNRKSK
                     LFSDWKLEIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEIN
                     QGMDTNFERLVHKAMVQNACEEGTSQYFLITPKLLTGLNYHEKMRIHCVMAGSHIPNP
                     SEDIHMAHLGEVSNYDI"
     gene            complement(<121015..>123471)
                     /locus_tag="CAGL0F01177g"
                     /db_xref="GeneID:2887951"
     mRNA            complement(<121015..>123471)
                     /locus_tag="CAGL0F01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446025.1"
                     /db_xref="GeneID:2887951"
     CDS             complement(121015..123471)
                     /locus_tag="CAGL0F01177g"
                     /note="weakly similar to uniprot|Q08206 Saccharomyces
                     cerevisiae YOL036w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446025.1"
                     /db_xref="GeneID:2887951"
                     /db_xref="GOA:Q6FUR9"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR9"
                     /translation="MTNPMSNEVPAATSSPTSGLTAVNSHLHDIKEEKEDHENTVIHH
                     SPVDYIPEIEEETRLDDTGDVSIESQDMINDTAEGDAEEEEKKLTNSFDELSLLPPLP
                     HNDLSFDVIRAQQLENMENAAALQELDQRGMLLPEHTRNGLDALAESPESILRAHSSN
                     SPDRSASPPHRMPSLRSSTPLSPIVVPSAVKDSRTSKMILDDLVSNNDELINIQSSLD
                     YNLKNSQELNVEEIQYPLENPNTSFDLSKALEIPNSSSSLGNKGSSPLNTTQESNISV
                     PPSPKITSPKASLKKKFSNTLLTTGGELPNINTNTNGNINGILTSQKHSPTEFPQLSK
                     VATATSNTSLASHSATPVQARTSISSRPRRSTSITNSVQRLVLETANNDTKKPLTERK
                     PSLKRYTSSINTPNTDLDNVSRLEAQLYNLPAVTGTISRAPSVNSGRARSQSQSVQQK
                     LGSTDMQPLGLAISTTDLNSIDSKTKRPPFLRRASSALMRKASMKMGNENASSPMSPV
                     TPLPTPVTAIDKKPYIRSTLGRQLSSTSIATDANIDYSGKTGRNVSTPLMRTSSFSHK
                     MKRGLTRIMSTNGSSARISNKPPAEVVPSRHSQDFLRHTVPDNNSTIDNYTLRNGSNG
                     DNSDNSVLYMAVDKRYNGAVPKSNSADSANMDYFNFPKTEIIDPNFKTMAIDMDAWKS
                     QVPVINVTDGTSINMPARPRFDTECSKVFCLENVNVPRHNSNNSTPLSVSTNSSQAKS
                     NTKEENQPDSIKVMDLKDYIKFLFKQKTLEDSTYEKIEKQFMESGWCSNSDLVNIRHK
                     RYSVNKKWDDVINFYQSKVG"
     gene            complement(<124304..>125068)
                     /locus_tag="CAGL0F01199g"
                     /db_xref="GeneID:2887923"
     mRNA            complement(<124304..>125068)
                     /locus_tag="CAGL0F01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446026.1"
                     /db_xref="GeneID:2887923"
     CDS             complement(124304..125068)
                     /locus_tag="CAGL0F01199g"
                     /note="highly similar to uniprot|P40303 Saccharomyces
                     cerevisiae YOL038w PRE6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446026.1"
                     /db_xref="GeneID:2887923"
                     /db_xref="GOA:Q6FUR8"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR8"
                     /translation="MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVL
                     GCERRSTLKLQDTRVIASKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLED
                     PVTVEYMARYVAGVQQKYTQSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSW
                     CAQAIGRNSKTVREFLEKNYNREEPPSNKEECIRLTVKALLEVVQTGAKNIEITVVEP
                     NNQVRALTNEEIAKYVETIEQEKQQEQERRKAKSQE"
     gene            <125516..>125893
                     /locus_tag="CAGL0F01221g"
                     /db_xref="GeneID:2887583"
     mRNA            <125516..>125893
                     /locus_tag="CAGL0F01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446027.1"
                     /db_xref="GeneID:2887583"
     CDS             125516..125893
                     /locus_tag="CAGL0F01221g"
                     /note="some similarities with uniprot|Q08176 Saccharomyces
                     cerevisiae YOL026c MIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446027.1"
                     /db_xref="GeneID:2887583"
                     /db_xref="GOA:Q6FUR7"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR7"
                     /translation="MIRENSVLSTSTSSSDLRELEEVEASDVRGVRWVLRYLVGSSIN
                     LVLPFLNGLMLGFGELVAHELCWQYKWFYHGRDSAHKIFPVSRKLQAPAQTHEQDQEH
                     ISKAQHGYARLRERWTSMKSKFL"
     gene            <126136..>127767
                     /locus_tag="CAGL0F01243g"
                     /db_xref="GeneID:2887959"
     mRNA            <126136..>127767
                     /locus_tag="CAGL0F01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446028.1"
                     /db_xref="GeneID:2887959"
     CDS             126136..127767
                     /locus_tag="CAGL0F01243g"
                     /inference="similar to AA sequence:UniProtKB:Q08179"
                     /note="similar to uniprot|Q08179 Saccharomyces cerevisiae
                     YOL027c MDM38 or uniprot|Q06493 Saccharomyces cerevisiae
                     YPR125w MRS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446028.1"
                     /db_xref="GeneID:2887959"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR6"
                     /translation="MMISTVLRVRAPVYASVCAPRTIAIGYRRFYSDKKLDAVKKAPE
                     TKVKEKEPLWDRVKHEVKHYVNGTKLLGYELKISTKLLAKSMQGYELTRRERNQLKRT
                     VGDIFRLVPFSAFVIIPFAELLLPVALKLFPNLLPSTYESTSDKQSKRKKLIEIRQNT
                     SEFLHKTLEESQFISYKNIENEEKKKTFLNFFQKLYALKESNKSTGPIIFTHQEIVTI
                     AKMFKNDTVLDNLSRPQLAAMCKFMSIRPFGNDPMLRYQIRYKLKSIMEDDKTIDYEG
                     VKSLTPEELYQACVSRGMKAYGVSKEDQIDNLKVWLDLRLRKKIPSVLMVLSSTFTFG
                     GPQQSRSEDSSCSLHLTATEPEVSEDGKCLIFEGEKSNYEKLLDLYYDGILQVLSSIP
                     DPVYNVAKLDLNEVVKPVETISEVESVAEEGPSKQEESIAKELREIAKEVAEEPTLSN
                     SAKETREVEVDMENKASEEAGLAEGSSKKDDNEFKLNVLKEQEELIKKEQEEAEARAT
                     RESVSDDITLDEEEEVSQPPVPLDQAAKTSITKKN"
     gene            <131725..>133596
                     /locus_tag="CAGL0F01265g"
                     /db_xref="GeneID:2887954"
     mRNA            <131725..>133596
                     /locus_tag="CAGL0F01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446029.1"
                     /db_xref="GeneID:2887954"
     CDS             131725..133596
                     /locus_tag="CAGL0F01265g"
                     /note="some similarities with uniprot|Q08182 Saccharomyces
                     cerevisiae YOL028c YAP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446029.1"
                     /db_xref="GeneID:2887954"
                     /db_xref="GOA:Q6FUR5"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR5"
                     /translation="MSDRNWYYQTPYDDSARMYQVVQAPYYVYPRVIYDSQGSPSGAS
                     PNGANVPGTSVSSVSGAVPNVSGALSGVSNANGASSGVRTQSTGDYLYSYSNVPNYIN
                     SRPMLLSKDQRGSTGSIASLPHAVGSASEGTMHSVTSTGTSMSGPTTNVSMNGNAATS
                     TMSDDMGSKKVSKLKFKSSVMKDGDVEKNEYTLDMSDTAARRRRQNREAQRAYRERKA
                     TRINELEKTVSLLQDTIKEYELQMNTIHMRLQTLQEKNDILEKINQELITNKGSQSIP
                     QEQLQQLQQQMQAQSTQGNPPPSTHIQHVGYQHVVQADQPNRNLMESINEFKPMTAVT
                     LKREDQVNKITEDNESQKRSADKAFLQLNPKFQKQLSTPVSPDVNSLLLANNETVNVE
                     ENEIDMNYMAKKAKTVKEGKCSGSSDCCSKKRQEAGVDPKNSNWKPGSCGTCSSDPYS
                     KAFCQSMFAERRKLNQGREPNLTPDEVQKLRSDMMNAASETPTDQNIYAGTPAEDNVK
                     ANVERQSANASNVNDNAAGRGNAVTPISPPSVADTASATTKERKQSIEKLEVTSERDV
                     SNWENRSNSDGSATSAQDQPTRSTFDRIKKHMEYKRNFPTNSGNSPSNLDNILAKPV"
     gene            complement(<134033..>135475)
                     /locus_tag="CAGL0F01287g"
                     /db_xref="GeneID:2887966"
     mRNA            complement(<134033..>135475)
                     /locus_tag="CAGL0F01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446030.1"
                     /db_xref="GeneID:2887966"
     CDS             complement(134033..135475)
                     /locus_tag="CAGL0F01287g"
                     /note="highly similar to uniprot|Q08193 Saccharomyces
                     cerevisiae YOL030w GAS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446030.1"
                     /db_xref="GeneID:2887966"
                     /db_xref="GOA:Q6FUR4"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR4"
                     /translation="MVSVKQLFAVALASTVFAADSKNGSTPVIEIKGNAFFDSSSNER
                     FYIRGVDYQPGGSSNLTDPLADKEICSRDIPVFKDLGINTIRVYTVDNSQDHSECMQM
                     LQDAGIYLILDVNTPDSSISRHNPSCSYNADYLQNIFATVDEFAKYDNVLGFFAGNEV
                     INMVNNTATATYVKAVVRDMKKYLKARNYRQIPVGYSAADIASNRQLTAEYFNCGDDA
                     DARIDMFGVNDYSWCGDSSFVVSGYKTKVDLYKGYSVPIFLSEFGCNQVPGARPFTEI
                     KSIYSTQMSSVFSGGLVYEYSNETNNYGLVQIDSPTNVTKLQDFANLKSEYASVSNPQ
                     GDGGYSESNQHSTCPPYQEGIWEANNTLPEMPSAASVYFESGAGQPFGTGIRTQDSCG
                     KDDDDIENQSDDDNSNANSTDTSSSSSMANSSSSSTQSSSSATTLSTSASSTSASSSS
                     SKAKKAKNGAAALEIPAVFRALFEVANFVL"
     gene            complement(136462..136534)
                     /locus_tag="CAGL0F01309r"
                     /db_xref="GeneID:2887868"
     tRNA            complement(136462..136534)
                     /locus_tag="CAGL0F01309r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:2887868"
     gene            complement(<136707..>138878)
                     /locus_tag="CAGL0F01331g"
                     /db_xref="GeneID:2887942"
     mRNA            complement(<136707..>138878)
                     /locus_tag="CAGL0F01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446031.1"
                     /db_xref="GeneID:2887942"
     CDS             complement(136707..138878)
                     /locus_tag="CAGL0F01331g"
                     /inference="similar to AA sequence:UniProtKB:P32606"
                     /note="similar to uniprot|P32606 Saccharomyces cerevisiae
                     YOR017w PET127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446031.1"
                     /db_xref="GeneID:2887942"
                     /db_xref="GOA:Q6FUR3"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR3"
                     /translation="MMGYHGLRNSLPNGRALILKGYQFSNFQIKIELISKIRVRNYSP
                     SKYVRRSNNKRTTTVSEISAKDSSQQGILPSQTQSINTWNKKHDQRIDFRLNISDINH
                     ETVRTDEFKDSKLPFKRPPSLGHGLKSVLHQPVSLHSLRDSRTGIYNYSKILNDIKPE
                     HLERQIENESEPLFITPHKDTRLLVLAKECGKKYASSTSSMTSILSQLHFLLSSNRKL
                     NITNSSISSNFPQKGTDYSQSAHYPASVILRKVSVPNKGDIISIDSDKSLDREIILSI
                     LGHSLENFLTDNKTNKFTDSYIYSMVDKFLLRSQLDAHDDSLPNYGTFDLKTRAASAI
                     RHDLAFIEKGKNKTNYQMNKVWGEFESLEREYYDLIRTTLLKYSLQARIGKMDGIFVA
                     YHNISNIFGFQYLPQEELDCIIHSYLDKDFEKLVKLRKSKFMSIYGVEEYLLNYERNE
                     QAIASAVASAEFKFSMTLLRKLLGIIEHELERTIGPDWACCKLFFKTEFESKRGSTWK
                     KPSLTVIAIPLDKSYEDKPLHIKGLSDFEIKRKLLDIENEMSKTLAKSDGKLIGLKCQ
                     VVHDYKLNPESVVIPDFAKDNSQVLPRNLRKFVKDELRADRYSSYCKTGLETPNFFHE
                     MDVKTWKVHAITEPITSQAEISDVYKKFTREKLDALESQSIVKLTRDHNDKKEIYDRI
                     EKAWAQSVNGKISKKPRKATDTGEYASDFQHILRSYGNRTT"
     gene            complement(139131..139239)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0F01353r"
                     /db_xref="GeneID:2887700"
     tRNA            complement(join(139131..139167,139203..139239))
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0F01353r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2887700"
     gene            complement(<139522..>141711)
                     /locus_tag="CAGL0F01397g"
                     /db_xref="GeneID:2887953"
     mRNA            complement(<139522..>141711)
                     /locus_tag="CAGL0F01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446032.1"
                     /db_xref="GeneID:2887953"
     CDS             complement(139522..141711)
                     /locus_tag="CAGL0F01397g"
                     /note="highly similar to uniprot|P38903 Saccharomyces
                     cerevisiae YOR014w RTS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446032.1"
                     /db_xref="GeneID:2887953"
                     /db_xref="GOA:Q6FUR2"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR2"
                     /translation="MMRGFKQRLIKKTTGSSSSKKKDKEKEKEKESKHATPTRKSSSS
                     SIKSGSEKSNKATGNSGVSSSHGSKSHTSSGLTSRSPTVSATTSSSSISSKTGNSQGA
                     DDTQTETPNQHQKVSHETPSITISDDNTAKSTPKAHPTLLGAATAISPSSPQSPGSAS
                     FGHGVSSGINDDNNSPSYGGSSPGIDIPRSSHSFEKLPTPTKLNPDSDVDLIRTPQRH
                     YSSRFEPSRYTQLTKLPNFDEVSPEERIPLFLAKVDQCNTLFDFNDPSFDIQGKEIKR
                     ITLQELIEFIVTNRFTYTHEMYAHIVNMFSINLFRPIPPPVNPIGDIYDPDEDEPVNE
                     LAWPHMQLVYEFFLRFVESPDFNHQIAKQYIDQEFILKLLELFDSEDIRERDCLKTTL
                     HRIYGKFLSLRSFIRRSINNIFLQFVYETERFNGIAELLEILGSIINGFALPLKEEHK
                     IFLVRILIPLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKINSTKEI
                     MFLNEIEDIFEVIEPLEFIKIEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCI
                     ENAEVILPIIFPALYELTSQLELDGTNGEESISDPYMLVEQAINSGSWNRAIHAMAFK
                     ALKIFLETNPILYENCNSLYLSSVKETQQRKVEREENWSKLEEYVKNLKISESASGQN
                     LDSASNEGSTEQMTIDVEQKDTHMSSLQSDDDYHETNAVLANDAAEK"
     gene            complement(<142623..>146819)
                     /locus_tag="CAGL0F01419g"
                     /db_xref="GeneID:2887947"
     mRNA            complement(<142623..>146819)
                     /locus_tag="CAGL0F01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446033.1"
                     /db_xref="GeneID:2887947"
     CDS             complement(142623..146819)
                     /locus_tag="CAGL0F01419g"
                     /note="highly similar to uniprot|Q08409 Saccharomyces
                     cerevisiae YOR011w AUS1 or uniprot|P40550 Saccharomyces
                     cerevisiae YIL013c PDR11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446033.1"
                     /db_xref="GeneID:2887947"
                     /db_xref="GOA:Q6FUR1"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUR1"
                     /translation="MSLADYFTPVPNASVTFEGTTVNLNETATGSAHSHAEDPEFGEK
                     LPLPSVSPCENGQVVDLTFQATAGEMVLVLGAPTSGIFKSLFHAHKHLSYSPQGSIRF
                     KDNEFKAYSSKSPHQIIYNNEQDVHFPFLTVNQTVDFALSCKFDIPKEERENMRNELL
                     REFGLSHVGDTIVGNDYFRGVSGGERKRISIIETFIANGSVYLWDNSTKGLDSSTALD
                     FLTILQKMARTTRSVNLVRISQASDKIVEKFDKILMLSDSYQVFYGTVDECLHHFRDN
                     LGIKKDPNDCIIEYLTSILNFQFRTKSLDITGSSEDLDLKDTDHNEQTFSGIASSLCS
                     EVDLYTQWKKSSYYQDIKEQIGAFNVENKADGNHINPEDVTKTFDIPLKKQILYCTKR
                     AFQRSLGDKAYMISQVISVIIQSLVIGSLFYDIPMTTIGSFSRGSLTFFSILFFTFLS
                     LADMPIAFQRQAVVKKQTLLHFYFNSVETLATTLFDYCFKFCLVVIFTIILYFLAHLQ
                     YNAARFFIFLLFLSVYNFCMVSLFSLTTMFTPTISLANLFAGILLLAIAMYASYVIYM
                     KDMHPWFVWIAYLNPAMYAMESILANEMFNLKLDCTESVVPRGPTYQNVPVTNKACAW
                     QGATLGNDYVRGKDYLKNGLSYKYSHVWRNFGILIGFLCFFIAMNLFASEYIKPLFYN
                     DGPEAVQHFINRWFRRSATHSTTSSSSPENIKLKEDVVVKSASLSSTSSLSSSETAKS
                     NPFADKTVQAQKHVISWKNINYTVGGDKRLINNVSGYIGSGLTALMGESGAGKTTLLN
                     VLSQRTESGVVSGEILIDGKPLTNENAFRRSIGFVQQQDIHLELLTVKESLEISSELR
                     GDGDMEYVESISELLKLPLDSLVRELNPTQRKLLSIGVELVTKPSLLLFLDEPTSGLD
                     AEAALTIVQFLKKLSLQGQAIFCTIHQPSKSVISYFDNIYLLKRGGECVYFGPTSEAC
                     GYFMSYDKSLTYDPESDNPADFVIDVVGNNESMEEMDDKADFAIREENPWSTRWENSH
                     ERKNIDETVVRLEQEAAASGVDFTTAVWEQPSYMKQLIMITKRQYTCTRRDRSYIAAK
                     YLLNGGAGLFIGFSFWKIKHTISGLQDTIFFCFMALCVSSPLINQVQDKALQSKEVFI
                     ARESRSNTYHWTCLLLAQFIIELPLAMSSSTLFFVCAFFCCGFDNSGKVAGVFYLNYI
                     LFSAYYLTLGLWLIYTAPNLQTAAVFVAFIYSFTASFCGVMQPYALFPGFWKFMYRVS
                     PYTYFVDTFVSTLLHNRKVICNTGEMVPGQPTGGKTCGQFFKAYIDEYGGWLKNPNTF
                     TVCAYCTYDTGDDFLKQQNMSHSHIWRNYGIEWAFVAFNFFAMFAGYYLTYVAKVWPK
                     VFKFIMKLIPTGIKSRASKD"
     gene            <149905..>150570
                     /locus_tag="CAGL0F01463g"
                     /db_xref="GeneID:2887624"
     mRNA            <149905..>150570
                     /locus_tag="CAGL0F01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446035.1"
                     /db_xref="GeneID:2887624"
     CDS             149905..150570
                     /locus_tag="CAGL0F01463g"
                     /inference="similar to AA sequence:UniProtKB:P10863"
                     /note="similar to uniprot|P10863 Saccharomyces cerevisiae
                     YER011w TIR1 or uniprot|P33890 Saccharomyces cerevisiae
                     YOR010c TIR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446035.1"
                     /db_xref="GeneID:2887624"
                     /db_xref="GOA:Q6FUQ9"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ9"
                     /translation="MAYTKTALLVSALAAFAVAQDATQLAELNAILQDFSSHLSDYTG
                     LLANPNSGITAADLPAGVLQLGLAIQTATDKSYTSLYPSVDFKGIEALLPKLPWYSSR
                     LLPAINAALSSATPAPSSSSAAPSSSAAPSSSAAPSSSSAAPSSSAAPSSSARPSSSA
                     APSSSAKPSSSAAPSSAAPTTTKAISQIGDGQIQAHQTTNGAGKVAAGMGAGVLAAAA
                     MLL"
     gene            complement(<151321..>152334)
                     /locus_tag="CAGL0F01485g"
                     /db_xref="GeneID:2887690"
     mRNA            complement(<151321..>152334)
                     /locus_tag="CAGL0F01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446036.1"
                     /db_xref="GeneID:2887690"
     CDS             complement(151321..152334)
                     /locus_tag="CAGL0F01485g"
                     /inference="similar to AA sequence:UniProtKB:Q12218"
                     /note="similar to uniprot|Q12218 Saccharomyces cerevisiae
                     YOR009w or uniprot|P10863 Saccharomyces cerevisiae YER011w
                     TIR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446036.1"
                     /db_xref="GeneID:2887690"
                     /db_xref="GOA:Q6FUQ8"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ8"
                     /translation="MKFSTVAPLAFAAAVAHASNPTPMQLAELNAVMEDLKTNLQDYM
                     NLAMDPNSGFSLADMPSGLIQLGMAVGTATDDSYTSMYSDVDFAGVDKMVTMVPWYSS
                     RLKPLIDSLYAAENPAPSTSSASQATPAPAASSSAAPAAGSSTPAPAPVSSAAPSSYA
                     PAPMVNSTMPMANGTTTQTTTHLSTKTSTICDEECHKSMSTATAFKNVTDTQTTTYCP
                     ESSLFKNGTSTVTNMHTTTSTVCETCISKPATSSAKPATSAKPASSAKPAVSSAKPAV
                     TSAKSSAGKTTVTTSTIKVSLTSSKAAAPSSVVIQHQTVNGAAKVAAGMGAGVLAAAA
                     LLL"
     gene            <153593..>154864
                     /locus_tag="CAGL0F01507g"
                     /db_xref="GeneID:2887711"
     mRNA            <153593..>154864
                     /locus_tag="CAGL0F01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446037.1"
                     /db_xref="GeneID:2887711"
     CDS             153593..154864
                     /locus_tag="CAGL0F01507g"
                     /inference="similar to AA sequence:UniProtKB:P54867"
                     /note="similar to uniprot|P54867 Saccharomyces cerevisiae
                     YOR008c SLG1 required for cell wall integrity and for
                     stress response"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446037.1"
                     /db_xref="GeneID:2887711"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ7"
                     /translation="MMMLLILAVLAAVTRAQSDYTYMNCYVSLPSDFSSDNTYAYQTS
                     SYCYSRCQQKGAAYFALFNHNQCFCGNTSPSSQTSSSCNTYCFGYAQEMCGGNSAYSV
                     FQIGNGNPSQSSSNTNSNSNTNTNTNTNTNSNSNSNSNSNTNTNTNTNTNTNSNTNTN
                     TNTNSNSNSNTNTRPTSTLSSSRLVALGTGLSIEPSSSVEPTTQATTIASSTVNNGVT
                     SIVYSTSLKTISGSVIYRTSTIVQSAAPTDAGNSTSSDDDSSGKNNSGKHKKKANVGA
                     IVGGVVGGVVGACVVAVAALLILRHINLKREQERMEKEYQEAIKPVEYPENNELFPSP
                     YSSNRDPSSGSFDEELRNKAMYPPATGTDPYENNDLMAMPDRKPSTNNHLAVANPFDD
                     SRRISNGSLVPGSPPLGNNNVLTVVNPDETD"
     gene            <156044..>158317
                     /locus_tag="CAGL0F01529g"
                     /db_xref="GeneID:2887593"
     mRNA            <156044..>158317
                     /locus_tag="CAGL0F01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446038.1"
                     /db_xref="GeneID:2887593"
     CDS             156044..158317
                     /locus_tag="CAGL0F01529g"
                     /note="highly similar to uniprot|P25039 Saccharomyces
                     cerevisiae YLR069c MEF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446038.1"
                     /db_xref="GeneID:2887593"
                     /db_xref="GOA:Q6FUQ6"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLLVPRVPVVMQGKCGLLKISRPLQGSLSRGFHFSRAHRSEYDE
                     EKVVIDEINKKLTPVDIQNQQKLRNIGISAHIDSGKTTFTERVLYYTKRIKEIHEVRG
                     RDNVGATMDFMDLEREKGITIQSAATYCSWDKDKNSYHFNLIDTPGHIDFTIEVERAL
                     RVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGANPFKAIEQLNSK
                     LKLPAAAVQVPIGAESELKGVVDLLDMKAYYNKGDNGEIIESGPIPEELKSLAEEKRQ
                     VLIETLADVDEHMAEIFLEEKEPTIQEMKDAIRRATIARKFTPVLMGSALANTGVQHV
                     LDAIVDYLPNPSEVLNTGLDIAHEEAKVNLIPSVQQPFVGLAFKLEEGKYGQLTYIRV
                     YQGRLKKGSYITNVKTGKKVKVSRLVRMHSNEMEDVDEVGSGEICATFGIDCSSGDTF
                     SDGTLQYSMSSMFVPDAVVSLSITPKSKDSTNFSKALNRFQKEDPTFRVRFDPESKET
                     VISGMGELHLEIYVERMKREYNVECITGKPQVSYRESITIPSEFDYTHKKQSGGAGQY
                     ARIIGDLSPVEGGNKSNVFETHVVGGRIPDKYLSACAKGFDEACERGPLIGHKVLNVK
                     MLINDGAIHSVDSNELAFKVATLTAFRDAFLKAQPVIMEPIMIVSVTSPNEFQGNVIG
                     LLNKLQAVIQETDNGHDEFTLRAECSLSTMFGFASSLRASTQGKGEFSLEFSHYAPTA
                     PHVQKELIAEFQKKQKK"
     gene            complement(<158675..>159133)
                     /locus_tag="CAGL0F01551g"
                     /db_xref="GeneID:2887922"
     mRNA            complement(<158675..>159133)
                     /locus_tag="CAGL0F01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446039.1"
                     /db_xref="GeneID:2887922"
     CDS             complement(158675..159133)
                     /locus_tag="CAGL0F01551g"
                     /inference="similar to AA sequence:UniProtKB:Q12247"
                     /note="similar to uniprot|Q12247 Saccharomyces cerevisiae
                     YLR068w FYV7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446039.1"
                     /db_xref="GeneID:2887922"
                     /db_xref="GOA:Q6FUQ5"
                     /db_xref="InterPro:IPR009149"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="InterPro:IPR017265"
                     /translation="MAEFGRNKKSNGKKFTKEYKVKAIQQNITRKARLKKEYLKALKE
                     EGYAVPEKETSRREVNVKKLKEDKRLEGKKKIDEKKELKKQRKREQREKLEERRRKEE
                     EKVKIIRQKEQEREQKRRKMTKRTRSGQPLMAPKIEDLLSKIKNDDTYTL"
     gene            <159685..>162543
                     /locus_tag="CAGL0F01573g"
                     /db_xref="GeneID:2887955"
     mRNA            <159685..>162543
                     /locus_tag="CAGL0F01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446040.1"
                     /db_xref="GeneID:2887955"
     CDS             159685..162543
                     /locus_tag="CAGL0F01573g"
                     /inference="similar to AA sequence:UniProtKB:P32522"
                     /note="similar to uniprot|P32522 Saccharomyces cerevisiae
                     YLR067c PET309 required for stability and translation of
                     COX1 mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446040.1"
                     /db_xref="GeneID:2887955"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ4"
                     /translation="MKLPLVVPKIAKTCVPKVLPAAMDQSIRSMICKQEKNMSQTEMA
                     TLTSYFTDTFPIQQLSAGNRQLVMKWLAKRNAYEVLAKLETDYLYSASKLLKDERESP
                     QATLQEIRLYLKALARLRRYDELDHLMSSLIKKYALTKTRDMLLLIGTVCHECCSPAL
                     GKNSSDVIEFYKRWPAWMKLLTGHADFSQKKENRYNIGTIISTINVVKKLDGQIYKVF
                     DYLKDTHGPTLCSEFGSTLMSILNRDKDTKMIQLIWEYKHAHQLPLSSYDLTRIMQTK
                     IVERDYKGAVNVYINNPSAHLDVKQFDYLLIALSKTYDWSALQDQFNALFGIGKLPSI
                     EQYGIVMAALATQGELESVDQLYQQLLRRGLIPNFMVIRALLEVHFRSGDYRGCFEHF
                     ELFDKYGISPSMGTYTVMFNVYKKINDIDGALRFLRKITNTNKSMIREKHFLVLMQLC
                     SKFTNHLIAEELFNIMQTNYDITPSASSVAVLIKVYLDSEQDMKALSLFKKFRKETEN
                     PFKYIEVFNAILPYFIKTHQIQECESLFKEMSIHCERLDAEYMRNFIKYFIDAKKDVD
                     AAKDLLFSLIKSNRSLVDETLFERVMEKYDELENDQMIIELYRLTNEIDMPINSKILL
                     YLMKASYRVHVIQEENLNKFLELFEQTLTSVSSGTLNITTNSIHPSIINWFVRSLSKS
                     HLTDRAIELLNKYTNILFDDKSPDKLRFDNQFTTMRSKLVYYGECEQWDNFEDIFEDF
                     LNRIEYLENRPSRTVKNLRMKSIFNGILTYRLRNLVARKKFEEIPKLIEYLHKHEFTI
                     TNQFLNEAVSYMFLDSRTIEEALRISNDKLIHGFNLLNKKKHLQANEYRYNRHDTSWL
                     LAQVKKNPGKFSTDMHMTWATFTDATCAIDRYLNKFSLEKKDNILRNFIEKYPYFMKS
                     YLMKERELVKDWKQIESNHANYFKKLRDTKRTVFVSEF"
     gene            complement(<163020..>163679)
                     /locus_tag="CAGL0F01595g"
                     /db_xref="GeneID:2887917"
     mRNA            complement(<163020..>163679)
                     /locus_tag="CAGL0F01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446041.1"
                     /db_xref="GeneID:2887917"
     CDS             complement(163020..163679)
                     /locus_tag="CAGL0F01595g"
                     /inference="similar to AA sequence:UniProtKB:Q12133"
                     /note="similar to uniprot|Q12133 Saccharomyces cerevisiae
                     YLR066w SPC3 signal peptidase subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446041.1"
                     /db_xref="GeneID:2887917"
                     /db_xref="GOA:Q6FUQ3"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ3"
                     /translation="MYSLSQRINQVFNVAVLYGGVIVVLVALVSQWQLIHDNAFGLSS
                     SIGGVSPSFNVRTSRYYGSVKGQPKENMRIEFDLDADLSPLFNWNTKQVFVYLTASYN
                     GTEKARGHTVNTVTLWDKIIKTPKEAELHLEHAKGKYPVWDLEDKFSGKDLTFELQWN
                     IQPWVGILTFGQTTGSEVVKVEPKKKPSPTPNADASQQEQQQQHQQPKKKKRVPKNAN
                     A"
     gene            <163924..>164445
                     /locus_tag="CAGL0F01617g"
                     /db_xref="GeneID:2887956"
     mRNA            <163924..>164445
                     /locus_tag="CAGL0F01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446042.1"
                     /db_xref="GeneID:2887956"
     CDS             163924..164445
                     /locus_tag="CAGL0F01617g"
                     /inference="similar to AA sequence:UniProtKB:Q99382"
                     /note="similar to uniprot|Q99382 Saccharomyces cerevisiae
                     YLR065c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446042.1"
                     /db_xref="GeneID:2887956"
                     /db_xref="GOA:Q6FUQ2"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ2"
                     /translation="MAGKATKKQAASNSNTLNTLHKVAGPVLVLAFLRTVLGSNNTYI
                     KFVMFNLPMCACLYILEKTGRPQYDSKGKVVREGMDLSQAGGMTEYMFDLIYLSIIAN
                     VGRIIFNTNKWWYLLLLCPIYVGYKLYSLKQQYFGSTPGPVIPDKMPEETKSKRQMKR
                     EKRGDDKVKYKYR"
     gene            complement(<164750..>165544)
                     /locus_tag="CAGL0F01639g"
                     /db_xref="GeneID:2887964"
     mRNA            complement(<164750..>165544)
                     /locus_tag="CAGL0F01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446043.1"
                     /db_xref="GeneID:2887964"
     CDS             complement(164750..165544)
                     /locus_tag="CAGL0F01639g"
                     /inference="similar to AA sequence:UniProtKB:Q12144"
                     /note="similar to uniprot|Q12144 Saccharomyces cerevisiae
                     YLR064w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446043.1"
                     /db_xref="GeneID:2887964"
                     /db_xref="GOA:Q6FUQ1"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ1"
                     /translation="MARQRSVAPFLTVLQSRIRQPQFFWFLGHFMVLYHGLKIHLRLF
                     GVKNTQYHYRCCLAYLTVTYGIVLYQFVKSGQLDFQFATIRRRLLELDTLQYFVLLTS
                     LYILSYGGFIDLNILNSLHIYSFFHCLNYFKENLLPFISLIPVQTRTTLNQSITFFIE
                     SSNRLCLRIAHDFEMSCVFMLSVRAIFYALSAPLYPTKCRLIGALIYIWFFKLRYIQN
                     EQLRKDVDDKIAMVEKAPFMIQNPQLQHLWFSVKNTYLYVLKAMPV"
     gene            complement(<166126..>167058)
                     /locus_tag="CAGL0F01661g"
                     /db_xref="GeneID:2887895"
     mRNA            complement(<166126..>167058)
                     /locus_tag="CAGL0F01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446044.1"
                     /db_xref="GeneID:2887895"
     CDS             complement(166126..167058)
                     /locus_tag="CAGL0F01661g"
                     /inference="similar to AA sequence:UniProtKB:Q12291"
                     /note="similar to uniprot|Q12291 Saccharomyces cerevisiae
                     YLR063w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446044.1"
                     /db_xref="GeneID:2887895"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FUQ0"
                     /translation="MSKQLPITFDGENLPPQETVDLYATTFENELSPLNEETLKSQIQ
                     AVKGLLYNRDYLNAFDDQINRAAYVSRWSPSRSLCYTTLFTHLKPVYELLSQGSSHVL
                     CVGGGAGGELVSLANIFTMANVSDNAFDGTMKVDLIDIANWDDIIQRLVTSINTKWLY
                     QADRSQRFMVNFQNKDALMMNDIELLGDLDLITILFTANELFTEQRAPTLQFLQRLSK
                     HCKPGCKLLIVESAGSYSHITMPSGKKFPIQFLLDTVLVGTSSSQKSKKQDREGDWDL
                     LEQDDSTWYRGDTKVMYSLKLENMRFFYRLYQHK"
     gene            complement(<167401..>168297)
                     /locus_tag="CAGL0F01683g"
                     /db_xref="GeneID:2887585"
     mRNA            complement(join(<167401..167751,168286..>168297))
                     /locus_tag="CAGL0F01683g"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_446045.2"
                     /db_xref="GeneID:2887585"
     CDS             complement(join(167401..167751,168286..168297))
                     /locus_tag="CAGL0F01683g"
                     /note="highly similar to uniprot|P05749 Saccharomyces
                     cerevisiae YLR061w RPL22A or uniprot|P56628 Saccharomyces
                     cerevisiae YFL034ca RPL22B"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_446045.2"
                     /db_xref="GeneID:2887585"
                     /db_xref="GOA:Q6FUP9"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP9"
                     /translation="MAPNTARKQKVVKTFTVDVSAPTENGVFDPASYAKYLIDHIKVE
                     NVVGNLGNAITVEEDGSVVTIVSTTKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNS
                     YRLAFYQVTPEEEEEDEE"
     gene            complement(<168842..>170629)
                     /locus_tag="CAGL0F01705g"
                     /db_xref="GeneID:2887944"
     mRNA            complement(<168842..>170629)
                     /locus_tag="CAGL0F01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446046.1"
                     /db_xref="GeneID:2887944"
     CDS             complement(168842..170629)
                     /locus_tag="CAGL0F01705g"
                     /note="highly similar to uniprot|P15624 Saccharomyces
                     cerevisiae YLR060w FRS1 phenylalanyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446046.1"
                     /db_xref="GeneID:2887944"
                     /db_xref="GOA:Q6FUP8"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP8"
                     /translation="MPTVSVNKQQLFDLLGKNYTNDEFDELCFEFGIELDEDTTEEAL
                     KTGEEPELKIEIGANRYDLLCIEGIAQSLNEYLGRSSTPTYKLTAPTTKLYIEKSTEQ
                     VRPYATAAILRNFKFTEKNYASFIALQDKLHSNLCRNRSLVAIGTHNLDSIQGPFYYK
                     GLAPKEINFIPLNQTKKFNGEELIEFYKTPEQKNNIGRFVHIIENSPVYPVILDSNDV
                     VCSLPPLINSEHSKINLETKNIFIEITANDKTKAEIVLNQMVAMFSRYCDEPFTVEPV
                     EIVSEHNGESRMAPDFSERKMDVSIPYINSALGLQQTPEEIIQCIKKMSLHGEASKTD
                     EAVLHVTIPITRPDVLHPCDIMEDAAIGYGYNNLPKGEKLSNANFIASPLPINKISDI
                     FRVASSQASWLEVLPLTLCSHDENFKFLRLEDDGKQVVKLENPKTLEYQVVRTTLLPG
                     ILKTVKENRKHSLPIKVFETGDVVFKNEALERKSYNERHWGAIYAGKNSGFEIIQGLL
                     GKIMQTFRTQWVADYGKASTGRGYWIEQDDTLATYFPGRGAKIMFRSKEGEQAKQIGH
                     LGVLHPEVMSNFEVPYAASYVELNAEVFL"
     gene            <171213..>171965
                     /locus_tag="CAGL0F01727g"
                     /db_xref="GeneID:2887971"
     mRNA            <171213..>171965
                     /locus_tag="CAGL0F01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446047.1"
                     /db_xref="GeneID:2887971"
     CDS             171213..171965
                     /locus_tag="CAGL0F01727g"
                     /inference="similar to AA sequence:UniProtKB:P54964"
                     /note="similar to uniprot|P54964 Saccharomyces cerevisiae
                     YLR059c YNT20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446047.1"
                     /db_xref="GeneID:2887971"
                     /db_xref="GOA:Q6FUP7"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP7"
                     /translation="MFRSGIGRALSYLSRTQAKSQPYLLKPKLRKMETSNTKPLVWID
                     CEMTGLDHVNDEIIEICCIVTDGELKNLDTETKEQCYESVVHCPKEKLDAMDQWCLDH
                     HGSSGLMDKVLASKKTKEQVEEELLNYLQKWIPEKRVGILAGNSVHMDRLFMLKDFPR
                     VVQYLHYRIVDVSSIMEVARRHNPSLTAVVPKKEAAHTAKSDILESISQLQWYMDHYL
                     KSEEETKEFVESQNEKRPSEEPIDQPQKKQCQ"
     gene            <172820..>174229
                     /locus_tag="CAGL0F01749g"
                     /db_xref="GeneID:2887952"
     mRNA            <172820..>174229
                     /locus_tag="CAGL0F01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446048.1"
                     /db_xref="GeneID:2887952"
     CDS             172820..174229
                     /locus_tag="CAGL0F01749g"
                     /note="highly similar to uniprot|P37291 Saccharomyces
                     cerevisiae YLR058c SHM2 serine hydroxymethyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446048.1"
                     /db_xref="GeneID:2887952"
                     /db_xref="GOA:Q6FUP6"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /translation="MPYALSDKHLKMVSGHLSETDPEVEQIIKDEVDRQKHSIDLIAS
                     ENFTTTSVFDALGTPLCNKYSEGYPGARYYGGNEHIDRIERLCQQRALEAFHVTPDRW
                     GVNVQTLSGSPANLQVYQALMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFES
                     FPYRVNPETGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMV
                     DMAHISGLVAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGIRSVNQKTGKEIP
                     YDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKEYQTQVLKNAKALENEFQ
                     TLGYRLVSNGTDSHMVLVSLREKGVDGARVEYVCEKINIALNKNSIPGDKSALVPGGV
                     RIGAPAMTTRGMGEEDFHRIVRYIDQAVKFAEQTQSSLPKEANKLKDFKAKVDEIADQ
                     LAPLKKEIYDWTAEYPLAV"
     gene            complement(<174544..>176967)
                     /locus_tag="CAGL0F01771g"
                     /db_xref="GeneID:2887950"
     mRNA            complement(<174544..>176967)
                     /locus_tag="CAGL0F01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446049.1"
                     /db_xref="GeneID:2887950"
     CDS             complement(174544..176967)
                     /locus_tag="CAGL0F01771g"
                     /inference="similar to AA sequence:UniProtKB:Q12205"
                     /note="similar to uniprot|Q12205 Saccharomyces cerevisiae
                     YLR057w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446049.1"
                     /db_xref="GeneID:2887950"
                     /db_xref="GOA:Q6FUP5"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP5"
                     /translation="MALHKSLFRRLKNVLPLSITIVLLFYYTFRNEIDILNSFAETNH
                     VPTTVETLQTSAKGTHEELSVDDLLDKNRFYPLLVSNKDIDPFQDPRLLTSKGRMGAR
                     IYPVLNKVEVPVHMISSEKVAPIQSDKLVQEGAAHDMLDRVRNLFLKSYSQLKNQKNL
                     YENPLNWPIDLIDTLDTLHIMNLTNEFDDLVDNVIAKINFKNPTISMKEDEITFIDVA
                     DISQRVLSSMISAFDLSKNQVLLNKARDLADYLLTIFDTPNGLPLIDYPVNSKLVNRF
                     PYREINPARLTSMTVEFVRLTHLLKEDKYFNAAYHIYKTIAESTDQFAINYLFPNIVD
                     PSGCELLTDDEIKQGKHLKSNILKTIDENYKFAFCKQTNGLARSEVKVVRDVDKVIKT
                     QKRKQVITLDGTTIPLYQNLIKIMPMLKNHDILRLHEITFEEEDGVIGKRDKIVASKE
                     DNSLLQEKNDVRLLSSKGLFFGLMQHVRDLMIYRPITPLKLDNGEAPLFLSSIETYTR
                     YIPTSNELEIEMLRQFDHKSDACSFASMMIYGAKLFEKEKDFDFQLLGKEVNHIAAEL
                     AESCYKLSKEFKGYSPSHILFDPCLMKEKEGRCIFDENEKIQKIVGGYYKSDIASSSD
                     EEDVDTDKDHHLAVKVKNDKNSNTKANSKDPQKEYSRRVMLFSKKESPGHLLKDVNKN
                     SIDVGSKKWKNHPDWPLWLNKMDQKHLLASDTILSILHMYRITGDSIWRDRGFDLFEE
                     LERSIDLKAAGPKGLWKLTEEGHTQGEYPSTWLSQTLKFYYLLGSKPDDISLDNYVIS
                     MGGHLIGIN"
     gene            complement(<177696..>178790)
                     /locus_tag="CAGL0F01793g"
                     /db_xref="GeneID:2887958"
     mRNA            complement(<177696..>178790)
                     /locus_tag="CAGL0F01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446050.1"
                     /db_xref="GeneID:2887958"
     CDS             complement(177696..178790)
                     /locus_tag="CAGL0F01793g"
                     /note="highly similar to uniprot|P32353 Saccharomyces
                     cerevisiae YLR056w ERG3 C-5 sterol desaturase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446050.1"
                     /db_xref="GeneID:2887958"
                     /db_xref="GOA:P50860"
                     /db_xref="InterPro:IPR006694"
                     /translation="MDLVLETLDHYIFDDVYAKIAPVELQRGIDDSLVNALSLNKIVS
                     NSTLLHETLSITNSLKRVNKDVYGLTPFLFDFTEKTYASLLPRNNLIREFFSLWAVVT
                     VFGLLLYLITASLSYVFVFDRTIFNHPKYLKNQMYLEIKLAVSAIPTMSLLTVPWFML
                     ELNGYSKLYYDVDWEHHGLRKLLIEYATFIFFTDCGIYLAHRWLHWPRVYKALHKPHH
                     KWLVCTPFASHAFHPVDGYFQSLSYHIYPMILPLHKISYLILFTFVNFWSVMIHDGQH
                     MSNNPVVNGTACHTVHHLYFNYNYGQFTTLWDRLGGSYRRPEDSLFDPKLKMDKKVLE
                     KQARETAAYIQEVEGDDTDRVYNTDKKKTN"
     gene            complement(<179470..>180414)
                     /locus_tag="CAGL0F01815g"
                     /db_xref="GeneID:2887945"
     mRNA            complement(<179470..>180414)
                     /locus_tag="CAGL0F01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446051.1"
                     /db_xref="GeneID:2887945"
     CDS             complement(179470..180414)
                     /locus_tag="CAGL0F01815g"
                     /note="similar to KLLA0D01243g Kluyveromyces lactis and
                     DEHA0E07447g Debaryomyces hansenii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446051.1"
                     /db_xref="GeneID:2887945"
                     /db_xref="GOA:Q6FUP3"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP3"
                     /translation="MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDD
                     FYVKHPAGFPDHPHHGQETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSE
                     IPVQMESGEACHGLQFWVDLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSY
                     GVDSVRDLAYTPIHMYHYLTNKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTA
                     VFFNTDGDAVKGEFATDDAQFAIMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGI
                     NGFERAKGWQSSIIHGITEKQVRENEAKGLYKLDHERD"
     gene            <181178..>182980
                     /locus_tag="CAGL0F01837g"
                     /db_xref="GeneID:2887833"
     mRNA            <181178..>182980
                     /locus_tag="CAGL0F01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446052.1"
                     /db_xref="GeneID:2887833"
     CDS             181178..182980
                     /locus_tag="CAGL0F01837g"
                     /inference="similar to AA sequence:UniProtKB:P38915"
                     /note="similar to uniprot|P38915 Saccharomyces cerevisiae
                     YLR055c SPT8 transcriptional adaptor or co-activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446052.1"
                     /db_xref="GeneID:2887833"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP2"
                     /translation="MDEVDDILDQNLEEEEDDVDVDVDADAEQDDSDEDGEEGEEGEE
                     GEEGEDEDADGDEDADGDDGDGEDEADGNGNGNGKKEQTDDSDNHVVHDNDKIYNYYK
                     QMRLNSKLAQSYTISPFAAIPIQTDVNALAVSKGLRNLFLGGADGYIRKFDLLGTLEG
                     KTTLTIIQKHSLAESIEYAGILQSYWENEIPQKKSQITPTANGKEYIPKVSPVNSLAV
                     HDECLFLLSGLENGGITLQGVRYMEGKIGHYFYPGGPKRNGHSNVVNLLQLGADQTKF
                     LSGSWDKKILEWDLNGTGSISNEFKGANSELSSLEFRPLFSSVVVEDFGKPEEQYPMP
                     SAEGDNKSTIGNGDAEAEEDDEMNSLFGDDEEEDEEMKDAVENIEDLNERQESKVAEQ
                     EDQQANSNSPKTEKQDSKSPTNLSKSELEEISKSSLKIEYDESVFMTSGLNGSVQIWD
                     RRINTAPVLNMMKSSTTPPWCQSACWGTDGDTVYAGRRNACVEEFSLRMPSEPKSTLK
                     LPSISGPVTCIQSMPNNSHILCASRDNIRLFDIRQAEQKSKSPFLIVPGHHGGAISNI
                     YVDPTCRFMISTSGNRGWQGTATDTTFIYEIDLE"
     gene            <183385..>185772
                     /locus_tag="CAGL0F01859g"
                     /db_xref="GeneID:2887879"
     mRNA            <183385..>185772
                     /locus_tag="CAGL0F01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446053.1"
                     /db_xref="GeneID:2887879"
     CDS             183385..185772
                     /locus_tag="CAGL0F01859g"
                     /note="some similarities with uniprot|Q12202 Saccharomyces
                     cerevisiae YLR054c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446053.1"
                     /db_xref="GeneID:2887879"
                     /db_xref="GOA:Q6FUP1"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP1"
                     /translation="MSKENVCLVVGDTPATQFLAWRLNSAGSTTILIGPYVSSDGLIA
                     WKTTKLGANFYTPKVFTRNIDELPYKLENYRKYHTLGEIHAMIISAISFEDLAKTCTV
                     LSQFSNENTTIFVNGSYGVELEEFVLRYFENKCKCVISIVCEMECRQLSLGSYALVND
                     EHCLVSIGLSYTPALSSKNEVLLRNSISAEAELSKGKGSVTSIIIDQLKDINWVEIKV
                     YKPEEQLALKIWEVVIPKISLVILSIVHEELDYEKMLLNDSVRTIFENVSQELFKVCQ
                     LQCNEKSTCFYNSNSGIIDNNLILQYCMKQTKALNDTTSSEYPEYLSLPFEAYCFYHR
                     LEYPAEILLTQPINLAKRYDVGYSNLNFLFSVYSRLLSMCGLSIKGGRADKSHISFFD
                     TKVGISPSKIEDSKVKSVINDTSTKGNSKKNNKKNNKKKRKLKKKDHQKDKHDSKNSN
                     AVTSTHSLPIISSALEEGSGILPPDLENLYLDSQRFNLISPKSPGLPPTFNKFQQQGT
                     KITTNEVKANNGSQIDLDGKNQIASGTEVKSTRSGSISTTSSDSSSVTTSSDEYEEAQ
                     DMLCRDCGVQLNQNSSNRVRACGYDDVVSVNNEIEDDSLSIFNDRTKFEKSRDQLTTL
                     ESIGTISLPHFFKRFTPNTSEKKKRYQGLSFDKATTMNLELQIRQRDSFFLTHYEAIG
                     KDAPNTITLDKDLSRQHHLEQGQQFWKLKRHYNIYRGSVTIPRATPYDNMLEHLELLN
                     RANAGGILNFTTTRYGEVDTYFNFLKQRKNLAHILKDAHYRFKTLKDNEVKHIDL"
     gene            <186169..>186711
                     /locus_tag="CAGL0F01881g"
                     /db_xref="GeneID:2887781"
     mRNA            <186169..>186711
                     /locus_tag="CAGL0F01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446054.1"
                     /db_xref="GeneID:2887781"
     CDS             186169..186711
                     /locus_tag="CAGL0F01881g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446054.1"
                     /db_xref="GeneID:2887781"
                     /db_xref="GOA:Q6FUP0"
                     /db_xref="UniProtKB/TrEMBL:Q6FUP0"
                     /translation="MKDLLDYSFSMEDLSVLETEFHGNSSGDTELVDFDEFLNIGDGL
                     QLMTPPDVVTNSKEHSVTGDNSEPRGNALKNYQIEQKHAGKINENSEENIDLSTFLSL
                     RSKNLQMKRSKSAQSVLQRSRSRSYGPSTLQTPPSSSSSMNYSATKVKRNPFYSPSGK
                     VLKLIEKEKKKQQVSQESEK"
     gene            complement(<187276..>188118)
                     /locus_tag="CAGL0F01903g"
                     /db_xref="GeneID:2887889"
     mRNA            complement(<187276..>188118)
                     /locus_tag="CAGL0F01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446055.1"
                     /db_xref="GeneID:2887889"
     CDS             complement(187276..188118)
                     /locus_tag="CAGL0F01903g"
                     /inference="similar to AA sequence:UniProtKB:Q12345"
                     /note="similar to uniprot|Q12345 Saccharomyces cerevisiae
                     YLR052w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446055.1"
                     /db_xref="GeneID:2887889"
                     /db_xref="GOA:Q6FUN9"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN9"
                     /translation="MSYEELIKNDLQLQYARNAVRYYKSNTVPEFLEKDPHKKSVIQR
                     LSDTVNSQASSVNVSRNSTPAPSLGPMSTAGSASANTTSNGPGGNVRRHIISVDDSLK
                     INYEMVKNVPGNFPSRIGIRTPDEMDMHEEELQDKLALENEANTVKTKIYKQKLFDDN
                     DTVLELVGTQLSHFQDPHTPSDQSKPRLSLREQLECLQKIQDNLLQDYKDSQKEEKKW
                     FVLKELLLEANTELDLFSSQDYPNKVINLGDGASTSQHSDTALVFNRNKRQKLSNGSY
                     SSIF"
     gene            <188438..>189094
                     /locus_tag="CAGL0F01925g"
                     /db_xref="GeneID:2887846"
     mRNA            <188438..>189094
                     /locus_tag="CAGL0F01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446056.1"
                     /db_xref="GeneID:2887846"
     CDS             188438..189094
                     /locus_tag="CAGL0F01925g"
                     /inference="similar to AA sequence:UniProtKB:Q12035"
                     /note="similar to uniprot|Q12035 Saccharomyces cerevisiae
                     YLR051c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446056.1"
                     /db_xref="GeneID:2887846"
                     /db_xref="GOA:Q6FUN8"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN8"
                     /translation="MDEIDALFEQLKEVSSKENGTSKTKVDELNEDKVIFDDEDSKEK
                     EFLRIEKELRRLPKLETGFDSLAQTKKGEVKKHEMGLTEEERRKREKMIKDAQKKKTS
                     EEWFTLPKPDDKAKREIQRDLLLIKHRAALDPKRHYKKDRWKVPDRFSVGTIVEDKTE
                     FYSSRLTNKQRKSTMLETLMTDDTTNKYFKRKYSQIQEQKMSGKKGHYKKMKAARHKK
                     "
     gene            complement(<189377..>190858)
                     /locus_tag="CAGL0F01947g"
                     /db_xref="GeneID:2887935"
     mRNA            complement(<189377..>190858)
                     /locus_tag="CAGL0F01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446057.1"
                     /db_xref="GeneID:2887935"
     CDS             complement(189377..190858)
                     /locus_tag="CAGL0F01947g"
                     /note="highly similar to uniprot|P09624 Saccharomyces
                     cerevisiae YFL018c LPD1 dihydrolipoamide dehydrogenase
                     precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446057.1"
                     /db_xref="GeneID:2887935"
                     /db_xref="GOA:Q6FUN7"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN7"
                     /translation="MFRAVSRRGFSSSSYLAAIKKQHDLVIIGGGPGGYVAAIKAAQL
                     GLDTACIEKRGSLGGTCLNVGCIPSKALLNNSHLYHQIKSDTKNRGIDVKGDVEINVE
                     QFQKAKDTVVKQLTGGVEMLFKKYKVNYYKGVGSFESENSVKVTPVEGIKGTVEDETI
                     IEAKNIIIATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAVIGGGIIGLEMGSV
                     YSRLGSKVTVLEFQPKIGASMDGEVAATSQKFLKKQGFNFKLSTKVVSAERNGDVVDI
                     VVEDTKSGKTENIQADVLLVAVGRRPYIEGLGAEKLGLEVDKRGRLVIDEQFSTKHPH
                     IKVIGDVTFGPMLAHKAEEEGIAAVEYIKKGHGHVNYGNIPSVMYTHPEVAWVGKTEE
                     QLTEEGIKYKVGKFPFIANSRAKTNMETEGFVKILIDAETERMLGAHIIGPNAGEMIA
                     EAGLALEYGASAEDVARVCHAHPTLSEAFKEANLAAFDKPINF"
     gene            complement(<191278..>192624)
                     /locus_tag="CAGL0F01969g"
                     /db_xref="GeneID:2887567"
     mRNA            complement(<191278..>192624)
                     /locus_tag="CAGL0F01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446058.1"
                     /db_xref="GeneID:2887567"
     CDS             complement(191278..192624)
                     /locus_tag="CAGL0F01969g"
                     /inference="similar to AA sequence:UniProtKB:Q12110"
                     /note="similar to uniprot|Q12110 Saccharomyces cerevisiae
                     YLR049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446058.1"
                     /db_xref="GeneID:2887567"
                     /db_xref="GOA:Q6FUN6"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN6"
                     /translation="MMEQYVPPGKRLFQARHRVSRRDLQHYGETDWTTVKDEVVKDDD
                     LLGYAVPIIDNGDPRIARPFKQAKQLPYKAKAGSLAAPLAYPAQNRSALSIDGTGSPA
                     SSTSSIFSVQNSCPEVGDRYSSSTMDSLVEGLDPTLKFNMQRNISVDSLIQDNNKRIS
                     EHRDSLALLKEYEYNERKESNRSSKDYYQSGIDRIEHETKRELRRLRYENRALLQRED
                     ALAKVWRSIRNCKDDGALLLALRKHHVYWFGIPSDLRLKVYKLCLYQDGVAPPVHSLG
                     AALCKRLGDVNIVKQIIANINKEVPWLLRISGTGSKSQDSRTSPSEKSQAAVLETKMY
                     GSYPGLYYHLKDKLHLDICEQFMKPLLRTVLLRILYQCPHDVATLELLDIVVVSMHYH
                     ELQTVLLDQMLNAILQECHFKFFHESLHAINNEIKSTELDVFRFLETLRKPHAEHL"
     gene            complement(<193057..>193596)
                     /locus_tag="CAGL0F01991g"
                     /db_xref="GeneID:2887754"
     mRNA            complement(<193057..>193596)
                     /locus_tag="CAGL0F01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446059.1"
                     /db_xref="GeneID:2887754"
     CDS             complement(193057..193596)
                     /locus_tag="CAGL0F01991g"
                     /inference="similar to AA sequence:UniProtKB:Q12155"
                     /note="similar to uniprot|Q12155 Saccharomyces cerevisiae
                     YLR050c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446059.1"
                     /db_xref="GeneID:2887754"
                     /db_xref="GOA:Q6FUN5"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN5"
                     /translation="MISSLSVFEEKFYYYYCLVHIPITVLVDSSVAVPDKWVLLPGLV
                     QWHIRQNNDFLLHEKPMWLQLFVWWELVFQLPLFFYFAHQFKKIWALRSKDTKNAKAE
                     RATTKKSLYLWLRVYGLNAALTTWICIVVILYRGYYPFTLDASRIAGTKLEVRDTLAL
                     MGLYLPTFLLPLRLCMLQQ"
     gene            <194261..>194989
                     /locus_tag="CAGL0F02013g"
                     /db_xref="GeneID:2887910"
     mRNA            <194261..>194989
                     /locus_tag="CAGL0F02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446060.1"
                     /db_xref="GeneID:2887910"
     CDS             194261..194989
                     /locus_tag="CAGL0F02013g"
                     /inference="similar to AA sequence:UniProtKB:P43582"
                     /note="similar to uniprot|P43582 Saccharomyces cerevisiae
                     YFL010c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446060.1"
                     /db_xref="GeneID:2887910"
                     /db_xref="GOA:Q6FUN4"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN4"
                     /translation="MPQSKDDPPNVPSGWKAVFDDEYQTWFYVYLATKRSQWEEPEGT
                     TWNKISKPPMPPPSYKSKEEYARGSVSPPHSARRAQPAPPPQTTYRSQPPAPVSPQPY
                     YSPQVPQQQPMPMYPPQQPMPMPMYAPQQPVYGGAPMPQPVYQQAPVAQQKSSSGVGK
                     KAFFGSLAGAGVGVLGAEAISHAFDHHHDQDTTVVENNYYDNGPGGYDNGYGGGGGYD
                     NGYDQGYNDGFDDGNYDGGDGGDW"
     gene            complement(<195254..>196375)
                     /locus_tag="CAGL0F02035g"
                     /db_xref="GeneID:2887586"
     mRNA            complement(<195254..>196375)
                     /locus_tag="CAGL0F02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446061.1"
                     /db_xref="GeneID:2887586"
     CDS             complement(195254..196375)
                     /locus_tag="CAGL0F02035g"
                     /inference="similar to AA sequence:UniProtKB:Q02732"
                     /note="similar to uniprot|Q02732 Saccharomyces cerevisiae
                     YPL018w CTF19 involved in chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446061.1"
                     /db_xref="GeneID:2887586"
                     /db_xref="GOA:Q6FUN3"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN3"
                     /translation="MEFTSDLEQRKQQDKSSSSIFASSTTENEVSSSDSEGINDAVER
                     SRISEDELKKLELIEKKNELLEKRNQLLTEVNQLERESVEMIDKANKTIDKNALDVLN
                     DLLSFSQKQSQDLEVNKLINGESLERLSSSVNVHGDTSVDDELKNKYDSLPLLNMKLR
                     LKYLSQYLYKDIKIIITSNSKNEGSNVSLNVELYFQRFENITFSVTIKIVYDEVNEVM
                     KDFTIISVSDQVRLAVQPLLQVRNPSFFLLACFEFDKIRQRRFKILRRLRDKFIKRVK
                     TCELPRSGEYILLHTHDSLKERDISLRIDFQVFFEAKKLSYSPFPTSRLTYELKKNGK
                     RMLDNMVENIADGLIKEYGVEKGLEELCNACLFADLYKH"
     gene            complement(<197149..>199689)
                     /locus_tag="CAGL0F02057g"
                     /db_xref="GeneID:2887821"
     mRNA            complement(<197149..>199689)
                     /locus_tag="CAGL0F02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446062.1"
                     /db_xref="GeneID:2887821"
     CDS             complement(197149..199689)
                     /locus_tag="CAGL0F02057g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446062.1"
                     /db_xref="GeneID:2887821"
                     /db_xref="GOA:Q6FUN2"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR018060"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN2"
                     /translation="MSKTPPYKTGRGIHDIDHITAHAVYLLKNEVDRIISYNPWSISW
                     VREHDKPILSRGAKKFIDFKNSDLFSCDVDYRNIVQKEAHKLSKVIYRPPEDICSSDS
                     DARHLILNQREAEKWIQIANATTLIAYSVVNAHLDLEVDPQVRTTPLPDVKSSISKRK
                     RTTNHSKSKEGSSSSDTVTTAATSTVAPTAPTAPTAATPTNIPPNPTVTDRTVTALAV
                     LLAFTAAAQGHPILDGVNTNFKINDSAAESADKELGDSSEENGQIFSSDNKESSTSIS
                     PEGTPPNPTLVGKLPVEIQAPEVTVRRPRTTKAELQTKKFDASITLEAYLVRGLSLPP
                     EPLAAFVGISYYHFHRSFKKYVGVTIADYTSLCRKVFYHNQDEMENYRNYKVGFNMIT
                     LGHGSVVRDNKFLRDELFTSIPDRNIEKTDVLLSECIIALDVKKDNDGNIIKTKKGEE
                     NDRGNKSRRDRRQNINKLSVTLRKFSAADLFLGKHRKDKHGYNSDLSSSRYLFDSNTI
                     GRTVDPQPINTFVATNSEDTNKNPKENSGVKSTTQNHVDSKDNTTIAISENSNVMVTS
                     SVALNSHNDSTVLSEDDNDRLADKHNETDTGKDNSKDVSLETMRTTQTDNINLSLVEI
                     MPTFPNSIACENNKLDGPSTKPLAEQNFIYSQRDQITPPILSVNNYFLLPSSWETPKD
                     LINCNNSEQGMDKALLATPPSSTEAQNIPLNSSSNESNTEQGTSSNSNSFRESPSFDV
                     SANEELMDFDSLFDFSMPFLANQDFLPEDYMNLNENDLDALNEINFNLDNITENNGDN
                     DINMHLAINENDADIDITNKIRIEDIWEDHDITLVDDFVSNSDPLTLT"
     gene            <201002..>204673
                     /locus_tag="CAGL0F02079g"
                     /db_xref="GeneID:2887737"
     mRNA            <201002..>204673
                     /locus_tag="CAGL0F02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446063.1"
                     /db_xref="GeneID:2887737"
     CDS             201002..204673
                     /locus_tag="CAGL0F02079g"
                     /inference="similar to AA sequence:UniProtKB:P32908"
                     /note="similar to uniprot|P32908 Saccharomyces cerevisiae
                     YFL008w SMC1 chromosome segregation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446063.1"
                     /db_xref="GeneID:2887737"
                     /db_xref="GOA:Q6FUN1"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN1"
                     /translation="MGRLVGLELYNFKSYKGTVNVDFGDSNFTSIIGPNGSGKSNLMD
                     AISFVLGIRSSSLRSSALKDLIYRDIISRENTPTGADNDENGNRTAYVKAFYEYDGKV
                     VELMRLISRLGDTSYKLDGNTVTYKEYSQFLESQNILIKAKNFLVFQGDVEQIASQSP
                     LGLTKLIEEVSGSMQYKKEYEELKDQYDKICQASTESIKKRRRIHAELKTYKEGMSRD
                     EEYRKYVQKKKRVQTNLSLWQLYHMEDERYQCLQKLEESQNDVDVIREKLEAEEKNLE
                     VFKKALSKEAVLLTKKKNHIRSISKEKEKAESDLKVVKIPQNASINRLKNLDKRVDSL
                     QKDLEREEANLEKYKHQLKVVTDSKNAFEQEILSKSKNNNKFTLSEDDLKLYDELKGE
                     YLNNGGIEIEDTLNLLDNKKEEITADLKIINDKVEISKQRIEDELVTKKEEQDAKIRD
                     STLLLNEKNDLHSHKLDELRKTQKDIEYWNNKEFDLNHKLRDTLVKLDDLNATQRESN
                     KERKLRENVAMLKRFFPGVRGLVHELCKPKRDKYKLAVSTVLGKNFDSVIVDSLSVAQ
                     ECISFLKKQRAGVISFIPLDTIDAATPRMPVPESETYTLAINTVEYKDDLVRAMYYVC
                     SDTIICDNLDIARDLKWNKNANVKIVTLDGALINKTGLMTGGITSDSANRWDKDEYQS
                     LLDLKDKLIVDVEEAANKSRQSTLIARELEISLSSLTSEISYIRTQITQTKRAVEETE
                     TEINHHNNLIDREFIPQVKDLENKISGLEDEIRDWNTKREALQEKCFARLTEKVGFTM
                     KDYESHTGEMIRKQTKELQILQKQILNLENKVEFETGRCNATKDRLQNVQETKNSVQH
                     ELNELVDQEKSIKLSIETLEGELDGKNEELKSIKAAFDSKQKDASATEDIISEYNNRL
                     ASIESDRNEIKDDITRLDLEKMSILKNCQVSGIIVPVVSEVGLEELPASKVDDEAIEI
                     AKKIEIDFSKLPRKYKEATSAAVKQDLNNQIRDIDDVLEELQPNARAVERFDDAKSRF
                     DEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFEKINEHLDAIYSELTRNVNSTS
                     ILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYLSGGEKTVAALALLFAINSY
                     NPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVFR
                     QQQENSSKIVTLDLNQYAT"
     gene            <205206..>211595
                     /locus_tag="CAGL0F02101g"
                     /db_xref="GeneID:2887707"
     mRNA            <205206..>211595
                     /locus_tag="CAGL0F02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446064.1"
                     /db_xref="GeneID:2887707"
     CDS             205206..211595
                     /locus_tag="CAGL0F02101g"
                     /inference="similar to AA sequence:UniProtKB:P43583"
                     /note="similar to uniprot|P43583 Saccharomyces cerevisiae
                     YFL007w BLM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446064.1"
                     /db_xref="GeneID:2887707"
                     /db_xref="GOA:Q6FUN0"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:Q6FUN0"
                     /translation="MTDNIHAPVPSKKGALAQMKIMETPQRPASGGDVRNRIKSPRGG
                     MLAAAARNLRARSETPTLLDERSFNGMDSEKVMSQRLEAYGLDYVTDERLHRENIYDP
                     DSRWYSRKVKPKFIIADYLPYNVESHLDQAKYLCHVIVNLYIAIKSLDIEGLISISSK
                     DLAEFKGSVDDLAMKTDMFRLSGDTVHVEDAGYTTDQLDDDDIQGEFYGESIYSDIDR
                     PGSGKITASSATIININHWTNELKNCLQFDFPVHLRKALATVYYYVSLCQGQNIHRKM
                     FVEMFEALVDTDDQGTDFTVMLKEDGMVLDYKALYDLLWEFLPYPDSDYCRYDLSSKE
                     DLQFFRLLLRLSLSCRPFFDESDDTILENIMKKLLSNLAPSTMSAVLPILSSSVPFHY
                     NDKAKITDYFSLCFSLWGSVSANVAIDTHMYDLTGMVSEDAHVRLLKEDGSWKTDYIN
                     FGKFGIFTEDQLNFMFNRLQGHLRSDGQIHSYTRTARPFIHSINGKFADEFFEKLDEL
                     TSAIETFVHPSNTGFWTSPIAKFIHSFVKMYHARYSEEKAANFHTEFCLTPYCHVKLT
                     DSLLNIINIGSQNKSSDVSNYYISCLAYLLDLNPKNRHLIFNKIINDLNDALAGEYVN
                     SRHRIISSLKQFTRTVRYMVEDSLYRIHVTNIISNLVSKLDTNDIELTGQIVNALATV
                     FCFVPIKNLVSKDEFMTFESTTLPFLTEHYYHMKLNDTQDFKVDEEVLLNAFRASTTI
                     FETMIKVFVDKLYDFVDVDIEGSLVTKMNQTTIIMQESMDNEMFEKFFKFYSDKFWTN
                     ENFKGNEPHHELITIPLAAFVRRDSSLAKSLVPMLVYHIKDQIEKGAGSLRSSTEVQA
                     RDVKLVLYLTALNDVLRQTHATTLDLSNDIMDFLDFIYENITNPPIDVLTSIILHNML
                     FTLIATEVVDTRLFPESSAIPDIKRWGGLQFSDKKYEEENLNIKWHVPTDMEVELALM
                     VIEKYTNLAFTKLDEIINGANKSKGYKDEIEKYLLLLTHCLSGASLLFDPDFNKNKVN
                     ESKGFSYGETLLLLKQIRDSNCDSEELDIDLEQIRSDKGDDEYISYKDSDDERNEHSD
                     TIEIRDDDPELILDDQTSEAPSGVSTPVPGFHNDFTSSINAGVAFRELDMFQYNYHYG
                     SSVTDKFRNPGYFKVHKIRSKVGLTLHKVLKFLVKNAENNTYLFQILLHAIKVWFTDV
                     GQETVFNEDPTAFLSLDFIENIQYLAHLDEPYTRTFLAVRADVFHQNRVLLRSTNRKP
                     SKIEVQLLRDVLDLAMSIYPDINKPAQGTMVHCMKQIIGSYSIIMKKLLTEIHVALKA
                     SEFKQLAVLLQILRIKKINKKLFSDYKNIETVFINLVKCLDIDEYDVGTLAESILDDL
                     ISGLKLPSSICLLDETTGSSIRPPDPHISIQVEAVLSAKSKKRKDYYRIITHLQNSMS
                     KVLGNNQGYSWKRSLLLVRFLTKLQSSMEMVPERDTIKVIFDQLSLNHPKVTHLTIKS
                     LIMIANRILSLSDYNYDTMNAYKTSFLPGYMTKIETSDPTFSQSFSKEMTNFKDSNYF
                     IDAKCFVGWLSWGSSMYVVKTSKYPINLRENEEGILSDFGKYLSVDLLRELCHGFVED
                     NESKNVFSSSNVSFFVLVLLLISDELCDLKICDICGLCREFYKRDSKASMIMSAEIFG
                     ALVSGSKFMTEVEKKDRDVFLDEFLPECLVNDLNHDAFEVWSTITWWLPAVVDIRRCE
                     PFYKHFSNMSNLKDIDSAFYQSSRIYMWRGILMGLEYRMPSICSDFSYLAFDHQYDQV
                     RSAIGKTFSTIIQNVSNPGYESTYLLLNQKDKSTDGLNLQLKRVPKYIDDIIKKIFSD
                     VFSEAAKLDDKMTPQEVLKTRYFYLTSTVIYWMTEMLRGPNKILLIPYLFGYIVPFLA
                     LLMKNKEMCFLAGIDPSKIFMRLAFVPVGHRILGDIVDIICSDEYLHTTNQIKLQLTF
                     VEHFESLQLLQLSKEDKKKILDFVVGHLYNSQSIEIRTTAGKVLSGIVHNLADRKQLE
                     RLISKFDDQLENHSYKEKKELSRNDINVHGSVLGLSAIVSAFPYAFPLPKWIPAQVSI
                     LASWARTSGMAGSTAKETLSNFKKVRADTWQFDREAFTYDELEDLEGVLWKSYYA"
     gene            <212117..>212764
                     /locus_tag="CAGL0F02123g"
                     /db_xref="GeneID:2887974"
     mRNA            <212117..>212764
                     /locus_tag="CAGL0F02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446065.1"
                     /db_xref="GeneID:2887974"
     CDS             212117..212764
                     /locus_tag="CAGL0F02123g"
                     /note="highly similar to uniprot|P07560 Saccharomyces
                     cerevisiae YFL005w SEC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446065.1"
                     /db_xref="GeneID:2887974"
                     /db_xref="GOA:O42819"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSALRTVSGSSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVEDK
                     FNPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDV
                     TDERTFANIKQWFKTVNEHANDEAQLLLVGNKSDMDTRVVTYEQGEALAKELGLPFIE
                     SSAKNDDNVNEIFFTLARLIQEKIDSNKLSGPNSGKDGNISINANKGDSSKSNCC"
     gene            <213561..>216011
                     /locus_tag="CAGL0F02145g"
                     /db_xref="GeneID:2887813"
     mRNA            <213561..>216011
                     /locus_tag="CAGL0F02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446066.1"
                     /db_xref="GeneID:2887813"
     CDS             213561..216011
                     /locus_tag="CAGL0F02145g"
                     /inference="similar to AA sequence:UniProtKB:P43585"
                     /note="similar to uniprot|P43585 Saccharomyces cerevisiae
                     YFL004w VTC2 or uniprot|P47075 Saccharomyces cerevisiae
                     YJL012c VTC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446066.1"
                     /db_xref="GeneID:2887813"
                     /db_xref="GOA:Q6FUM8"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM8"
                     /translation="MLFGVRLASEVYPPWKQSYIDYDGLKELLKEDGKSWSESDESRF
                     TEALDKELEKVYSFQMKTYHEIMDRLNALEKSTNTEEGLQNLDTEQFQRTLEESLSEA
                     NELDNFSRLNYTGFMKIVKKHDKLHPKYPSVRSLLEVRLKELPFHSEEYSPILYRISF
                     LYNILRSNFNTVSTSLASVPKLSSVNENDELDVSFKSFKFWIHKDNLMEVKTRILRHL
                     PVLVYASAPTENDDLIDRFESEVMNADEHVQSSDSASDNSFDGIHHQHKSYDPVITTI
                     YFDNEFFELYNNKLLKRNCCPTLRLRWTGKFSEKPDIFLEKRMFIENKDTGNSDFEEI
                     RLQMKPKFINGFIFDDDKSYKKNVLRKLTESGTPESELKKIENNFNEIQNFIQEEKLE
                     PVIRTTYTRTAFQIPGDDRIRITIDSNVTYIREDAFDKDRPIREPKNWHRTDIDSNVA
                     NPMRFLRPGEYSNFPYSVMEIKIKNPSANLSSESNIDFSGVQLPKKHGGWIQELTNSH
                     LVKEVPKFSLYIQGVAALFAEEEKLDILPFWLPELNTDIRKDPKQAYEDEQKKINKQK
                     DIHSKIESMRRLSRVPKPSSDITSSTVTEVSTNRAADLEDHESSDEEDSLSTRERITG
                     QKKKSKTKLTFLQILGAGRDSKLIGVDSEDEEIELPEGVKKPTSYIKNAGPVKVEAKV
                     WLANERTFLRWLSVTVLLSVLTFSVSNSVRRAEFPNLAKRLADLYFAATVFTALWAYY
                     SYKKRLRIISERSGEYLDAPFGPQLVAFFLFFTLIINFVSVFRETGRKQATAEVDLES
                     LHPHLESIFNFVYKIVKE"
     gene            complement(<216080..>218767)
                     /locus_tag="CAGL0F02167g"
                     /db_xref="GeneID:2887759"
     mRNA            complement(<216080..>218767)
                     /locus_tag="CAGL0F02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446067.1"
                     /db_xref="GeneID:2887759"
     CDS             complement(216080..218767)
                     /locus_tag="CAGL0F02167g"
                     /inference="similar to AA sequence:UniProtKB:P40965"
                     /note="similar to uniprot|P40965 Saccharomyces cerevisiae
                     YFL003c MSH4 meiosis-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446067.1"
                     /db_xref="GeneID:2887759"
                     /db_xref="GOA:Q6FUM7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM7"
                     /translation="MSEENLSSFLNPRIFESKTGSRMTHSQNLNEKKTKCSSPGNSTY
                     SDGKKFAMSGKRKLPASNSYPKTKQSRYCQSPSYTNTISGLEATVSTNRTTRTGNKSI
                     KSVFSVPDTVIFSIYESSKEVDTTIGISLINFSTGEIILTEYVDSQLFIRTMNKIQLY
                     EPTDILIPCHSVRPHMSKLATILKLNINHEIKIHIAKSSCYNNRRSIEFIKASSINKA
                     DGIQILLAKLYEKRHCLFSLAAATEFLQSKNSVKGLTPKKNKVLSDYSRFRIRYEAIE
                     NTLLIDSKTVTNLELIRTLEGDEKLSLFGTLNTTCTKMGYRNLRGAILQPLTDLNGIT
                     NRLKSVEELTECEFLNGIRLVLRQLPDLDIVFSKLLTAGKKSIGVTQKINYALLIKDA
                     IKTLEDIRQILLKFHPKSTLLSEIRNSFVNCTLQDFGILIQKYIKPDSSWASNSLELQ
                     NQRLYCLNEESNSLLGTLRSLYSKISEEILNDISCFGEKHCIHASPNFRTGVGFFIKV
                     SDSDYIKIEKNRVNIINKVNKRGHVEFTTLPLTKKNIRLNTLITEIETLSESLVTELL
                     YTLSKSVEELFILTESSALLDLLCCFAHNAIEYSYCFPKFSDKIFVIDARDPVMERLI
                     KNYIRNDISSTLYSSRLQIITGANMTGKTAFLRQIPLLCIMAQMGSPIPAENAILPVY
                     ENIHTRLCNDSMEMTSSNFSFEMKEMAYILECCNAESLIIIDELGRGTSIGDGFAISL
                     AILNYLSKLESTTFISTHFDVIPMILKNKPSIRHLHMKAQIINCNEIIKEYKASSVEI
                     TSIPKIDGISCVRNIFDEDIINSAINMSKAINKMGSFSTLSEQHYLGSATTSETEVLF
                     MKKIMDMVEILKELNKNNGNLSHNAIKRIQYEFLENFTK"
     gene            219170..219267
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0F02189r"
                     /db_xref="GeneID:2887832"
     tRNA            join(219170..219207,219231..219267)
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0F02189r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:2887832"
     gene            complement(<219504..>220955)
                     /locus_tag="CAGL0F02233g"
                     /db_xref="GeneID:2887580"
     mRNA            complement(<219504..>220955)
                     /locus_tag="CAGL0F02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446068.1"
                     /db_xref="GeneID:2887580"
     CDS             complement(219504..220955)
                     /locus_tag="CAGL0F02233g"
                     /note="highly similar to uniprot|P43590 Saccharomyces
                     cerevisiae YFR006w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446068.1"
                     /db_xref="GeneID:2887580"
                     /db_xref="GOA:Q6FUM6"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM6"
                     /translation="MVGPNDIPEALKGHKYPAKSHNKKVKDILLKTRDDLKSDDVAVF
                     IAGEEVEGWKYCDTDRDFRQNRYFYYLTGCDIPGSALLYNFKNDNLTLVLPNIDWDDV
                     IWSGLPLSLEEAKKEYDADDVVHMKDLENVLQKQLSDVSKFKIYTTDLDNVHNETLKK
                     HLIPSDKDFFFALDEARLIKDWYELEVLKHAAKISDTCHLAVMSALPIELNEVQIEAE
                     FSYHALRQGARSLGYDPICCSGPACGTLHYIKNSEDLEGKSSILIDAGAEWRQYTSDV
                     TRCFPINGKFTKEHREIYETVLDMQTQAMELIKPGANWDDLHILTHKVLIKHFLDLGI
                     FKKDFSEEEIFQRRVSCAFYPHGLGHLMGLDVHDCAGRPNYEDPDPYFKFLRLRRTLE
                     AGMVLTNEPGCYFNEFLIEEFLKKFPERVEVVDQEVLKKYMYIGGVRIEDDIIVTETG
                     HENMTKITSDPDEIEKIVSKGLERSRSEFHALV"
     gene            <221723..>222163
                     /locus_tag="CAGL0F02255g"
                     /db_xref="GeneID:2887827"
     mRNA            <221723..>222163
                     /locus_tag="CAGL0F02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446069.1"
                     /db_xref="GeneID:2887827"
     CDS             221723..222163
                     /locus_tag="CAGL0F02255g"
                     /inference="similar to AA sequence:UniProtKB:P43587"
                     /note="similar to uniprot|P43587 Saccharomyces cerevisiae
                     YFR003c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446069.1"
                     /db_xref="GeneID:2887827"
                     /db_xref="GOA:Q6FUM5"
                     /db_xref="InterPro:IPR011107"
                     /translation="MNQVSEGSRTVSVEEMPRVLQLRAANTNITEGESTSQSRNVRWE
                     EDVVDNENMNKKKTKICCIFHPAQEEEDPEQLCPSDHEHSSSSSSSSSSESDDDDKYN
                     SEQRRQRRIERRRRRQKTNRPASPNAYEIQPDYSEYRKRMNANV"
     gene            complement(<222382..>224904)
                     /locus_tag="CAGL0F02277g"
                     /db_xref="GeneID:2887782"
     mRNA            complement(<222382..>224904)
                     /locus_tag="CAGL0F02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446070.1"
                     /db_xref="GeneID:2887782"
     CDS             complement(222382..224904)
                     /locus_tag="CAGL0F02277g"
                     /inference="similar to AA sequence:UniProtKB:P34077"
                     /note="similar to uniprot|P34077 Saccharomyces cerevisiae
                     YFR002w NIC96 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446070.1"
                     /db_xref="GeneID:2887782"
                     /db_xref="GOA:Q6FUM4"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM4"
                     /translation="MTDLQSSNNVAFPDANGNNTSKLVQSLLESAKNLPSSSSELGSI
                     QLSVNEVRRRVSQLRSKKPSTNDNTGAYYLLAGDGLVLEDINSVVNELKGQKSKRPRP
                     IEIDNEIVEVGFTNREEDILSSIEKQLLFAAHDFDNSINKTLKLDWSHKKQKIEDNFR
                     ALIQRRKQSKHVHHSLSAVENAESTLGLKTPTYNINSNYDERIKFEQYAKIIEKFNQS
                     CLDKSNHSTTLLGEMLDNFQKRGLNNGNNLQFMDALSVLVDHQRGANYDHKVSMKYLE
                     SELWSYIVDLGHHNYNSQLLENTVDYIKIFIDKKLKNHDGTWKVPNLVMANEDPLWMI
                     AFYLLRSGHISECIEYLNSMKTFLKKIEQPIITYLKAKAANENGQLTGDFLNKIQMEY
                     NQHIKSSIDGDPYRNALYRIVGRCDLSRKNFSSITFSIEDWLWLHLCLVTNEPKKLEK
                     STQYCLSDLQNLIVSYGSNKFANSYLKILVLTGLYENAADFAFALSSIDAIHFALFLK
                     DNCLLKLPPSEDSISTSESGYLTSVKDKYYFNTSRMLADYIDQFKFSDPRVAAQYIIH
                     MKSPDSVSSIELCKSFLENLVLDTREYALLLGKVNEDGSKLCGLIEKLYPLVDNTDPQ
                     DFILHVADAASRRTSSDSKDFDNIQLYMLLNQPGKIFDMLNKQISDVLSATPYNQEIA
                     GLEDFTGFDPILLAYKLINSYKSNSEQFVERARDVCVTLTSIFEIKGLVTKKLWTEAL
                     NAIKDLDIIPLKDEVLSREKANEYPIIDSNIAKCIPNLLVLTMLTLKNKHVLSGTSTS
                     DKNSYIEMAKSLMVYAGLIQYKMPRDTYAILNKYDISRLVMT"
     gene            complement(<225354..>225965)
                     /locus_tag="CAGL0F02299g"
                     /db_xref="GeneID:2887670"
     mRNA            complement(<225354..>225965)
                     /locus_tag="CAGL0F02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446071.1"
                     /db_xref="GeneID:2887670"
     CDS             complement(225354..225965)
                     /locus_tag="CAGL0F02299g"
                     /inference="similar to AA sequence:UniProtKB:P43586"
                     /note="similar to uniprot|P43586 Saccharomyces cerevisiae
                     YFR001w LOC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446071.1"
                     /db_xref="GeneID:2887670"
                     /db_xref="GOA:Q6FUM3"
                     /translation="MGSIKKTKGKSQSTKRVVTPEVFADQQARNQLANAPNLTEKSER
                     RKANKLQVKKEQARARLYGKKKKESTYSEKDLDLPSLNKAVNPGVKLRRGKKGKKFID
                     DHDSLTLHRLIKTIGDKYDDITESKLEKDRRLEVIRELKRQEIERKEAAKQSQLEEKK
                     DELKKKSSIARSMRRKNRRDQERDLHTTSNDKVQRKKKSVSFA"
     misc_feature    226190..226299
                     /note="Centromere Cen0F"
     gene            <226725..>227762
                     /locus_tag="CAGL0F02343g"
                     /db_xref="GeneID:2887809"
     mRNA            <226725..>227762
                     /locus_tag="CAGL0F02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446072.1"
                     /db_xref="GeneID:2887809"
     CDS             226725..227762
                     /locus_tag="CAGL0F02343g"
                     /inference="similar to AA sequence:UniProtKB:P43591"
                     /note="similar to uniprot|P43591 Saccharomyces cerevisiae
                     YFR007w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446072.1"
                     /db_xref="GeneID:2887809"
                     /db_xref="GOA:Q6FUM2"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVDVNRLKEEVIASYREICKENYRLLVFIVGPPGSGKSTIAEKL
                     KDAINTSYLDYLKEIDRKTLRCENYNHINIDQFVQGIEGETISSALEDERHENFDSVE
                     NVDFICKKKRLKDGSYTITGRGGQLNAIKVRQPTSQEKNLEGNTTIAEVLPMDGFHLS
                     RECLDHFSDPQWAHLRRGSSLTFDSNNFLKLCEIMAKTSRIFPSIGYDGDDFTAFDAI
                     SSSFDCSVPSVEVPGFDHSLKDPQPSQHTISFKSRIVIFEGLYLLYNKENWSKIYNIV
                     SNSNAKLFYKILACEDQIESRVAKRHLKAGLVASIEDGKDKFRKNDLLNARDVEKNSI
                     SSEDIRLIRND"
     gene            <228030..>228725
                     /locus_tag="CAGL0F02365g"
                     /db_xref="GeneID:2887633"
     mRNA            <228030..>228725
                     /locus_tag="CAGL0F02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446073.1"
                     /db_xref="GeneID:2887633"
     CDS             228030..228725
                     /locus_tag="CAGL0F02365g"
                     /inference="similar to AA sequence:UniProtKB:P43592"
                     /note="similar to uniprot|P43592 Saccharomyces cerevisiae
                     YFR008w FAR7 involved in G1 cell cycle arrest in response
                     to pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446073.1"
                     /db_xref="GeneID:2887633"
                     /db_xref="GOA:Q6FUM1"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM1"
                     /translation="MYLLNDFTLLYKLSEKRSNRIKPQIIKDIMEGNVPPQAPQQLYM
                     TPQSENLTHLYKLLEQLIQQLATNNEKKENILVAVDTLSNRVNSSETSVNDHYSSSAR
                     LIQQFLDRIDPVPDSQSSKDKNRVEETLRQQNKQLKEILLNSQSITRESYDILKYHEE
                     CLHEVIGHLRADILKDQRKVVNEIRTRFNKDVKALEDIEFQSYIDNVNEIQKLMDISY
                     VYRTLLRLVTQTS"
     gene            complement(<229207..>232065)
                     /locus_tag="CAGL0F02387g"
                     /db_xref="GeneID:2887602"
     mRNA            complement(<229207..>232065)
                     /locus_tag="CAGL0F02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446074.1"
                     /db_xref="GeneID:2887602"
     CDS             complement(229207..232065)
                     /locus_tag="CAGL0F02387g"
                     /inference="similar to AA sequence:UniProtKB:P25360"
                     /note="similar to uniprot|P25360 Saccharomyces cerevisiae
                     YCR037c PHO87 or uniprot|P39535 Saccharomyces cerevisiae
                     YJL198w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446074.1"
                     /db_xref="GeneID:2887602"
                     /db_xref="GOA:Q6FUM0"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6FUM0"
                     /translation="MRFSHFLKYNAVPEWQNHYMDYSELKNLIYTLQTDELKNGPIGN
                     QPPERGPVVEEEDEVIASSSKHFAEKLKKKFFSKKPSSNTTGSHLATEQSSSHAIHHS
                     KNKDGNKEASVEEETYELKDINQASAITNAGSLAANNNSKEGKNSKSSPLRKVKEKFF
                     ESRRSSLSSEGQTLFNTYDAFVTSLTVEKFKVDDFYKRIEAKFYERFETLSKDLEKEG
                     MVIVTRHPSLSHTENVDSPFADAMNKDTQVDEHGNVAPITSIDKNNSYLEVSEDGEDE
                     DDFVDEDVFSESGDNTALLNYSQFNVKSQRKSILKQSIINLYVDLCQLKSFIELNRMG
                     FSKITKKSDKVLLLNTREELIHSGEFFKDTYVFQDSTLMILNGKIAQLVEFYAMITGH
                     ERGNIAQAKQELKSYLHDHIVWERSNTWKDMLGLLSQSKDITTDIDGAVANAHSISKL
                     DLEYYEYPLPRPIPLKFTTIYKLQVPKLFFTLKAFKIAFIFVATAILLAVPTFHDPAQ
                     HRCMALVECVAFLWASEAIPLHVTAFLVPLLVVLFKVLKDSNGHVMKAAEASTLILST
                     MWSSTIMILLAGFTLGEVLAQYNIAKVLASWLLAFAGTKPRNVLLMAMSVVFFLSMWI
                     SNVAAPVLTYSLLSPLLDPLDASNQFAQSLVLGIALAANIGGLSSPISSPQNVISMQY
                     LKPYGIGWGQFFAVALPTGILSMLLVWGLMCMTFKINLTKLDKFTPIRTRFTLKQYFI
                     IVVSIGTILLWCVESKIEGAFGSSGIIAALPIVLFFGTGLLSTHDLNTFPWSIVILAM
                     GGVALGKAVSSSGLLSTIARALQKRIDHDTALAVLCIFGVLMLVVGTFVSHTVSAIII
                     IPLVQEVGDKLNDPKAAPILVFGCALLASAGMGLASSGFPNVTAISKLDKKGNRYLSV
                     GTFLSRGVPASLLVFVCVITLGYGIMHSVLKAPTQSAT"
     gene            233357..233429
                     /locus_tag="CAGL0F02409r"
                     /db_xref="GeneID:2887761"
     tRNA            233357..233429
                     /locus_tag="CAGL0F02409r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:2887761"
     gene            <234061..>236418
                     /locus_tag="CAGL0F02431g"
                     /db_xref="GeneID:2887762"
     mRNA            <234061..>236418
                     /locus_tag="CAGL0F02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446075.1"
                     /db_xref="GeneID:2887762"
     CDS             234061..236418
                     /locus_tag="CAGL0F02431g"
                     /note="highly similar to uniprot|P39533 Saccharomyces
                     cerevisiae YJL200c or uniprot|P19414 Saccharomyces
                     cerevisiae YLR304c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446075.1"
                     /db_xref="GeneID:2887762"
                     /db_xref="GOA:Q6FUL9"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR006248"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL9"
                     /translation="MFRAVGRRNLATVSRNIPSVPENLRAYTPPYAKLLNNLDKVKQI
                     LNNEPLTLAEKILYSHLCNPEESLTSSRVADIRGQKYLKLNPDRVAMQDASAQMALLQ
                     FMTTGLSETAVPASIHCDHLIVGKDGETKDLRNSIKTNQEVFDFLESCAKRYGIQFWG
                     PGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPWELK
                     APKVLGVKLTGKLHGWSAPKDVITMLAGKLTVRGGTGYIVEYFGEGVETLSCTGMATI
                     CNMGAEIGATTSTFPYQAAHKRYLEATGRGFVATAADAALANYNFLRADEGAQYDEVI
                     EINLSELEPHVNGPFTPDLSTPITKYAERSLEEKWPQNISAALIGSCTNSSYQDMSRV
                     IDLVNQAEKAGLKPRIPFFVTPGSEAIRATLDRDGLIKKFEDNGAIVLANACGPCIGQ
                     WDREDVPKESSETNSIFTSFNRNFRARNDGNRNTMNFLTSPEIVTAMSYSGNAQFNPL
                     TDAIPLPNGGEFRFNPPVGEELPSKGFEHGRDKFYPAGKLSADPNVEVKVSPTSDRLQ
                     LLEPFKPWNGKELRTNVLMKVEGKCTTDHISAAGVWLKYKGHLENISYNTLIGAQNKE
                     TGEVNKAYDLDGTAYDIPGLMMKWKEDGRPWTVVAEHNYGEGSAREHAALSPRYLGGQ
                     MILVKSFARIHETNLKKQGMLPLTFADEADYDRISGGDTLETVGLIDLVAQDGNNGGF
                     LDVKVTKPNGESFIIKTKHTLSKDQIDFFKAGSAINFIGEQRRNH"
     gene            complement(<236632..>238476)
                     /locus_tag="CAGL0F02453g"
                     /db_xref="GeneID:2887844"
     mRNA            complement(<236632..>238476)
                     /locus_tag="CAGL0F02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446076.1"
                     /db_xref="GeneID:2887844"
     CDS             complement(236632..238476)
                     /locus_tag="CAGL0F02453g"
                     /inference="similar to AA sequence:UniProtKB:P32525"
                     /note="similar to uniprot|P32525 Saccharomyces cerevisiae
                     YJL201w ECM25 involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446076.1"
                     /db_xref="GeneID:2887844"
                     /db_xref="GOA:Q6FUL8"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL8"
                     /translation="MEEVINLNNIFYKSYSVDPNTGHSIYVFDSTYLPSAAELGVNDK
                     NDYDEMITELMDMLVKKLPQAPFSLVIFSSGFSAKKISWVYGVKMYSKLPKLFKKYLQ
                     ETYIVHESFFVRTVYQVLSNAMNFKFLTNNKSEQNGTVEDESRNGNAIRHVSTLSELA
                     CMIDITRLRISLNVYLHDSEVTGEYFLSLPDYYTEKLSPTSKRQYRQIIFDKIFNRLK
                     YDALTNELVFQRPGSYKKVNILLSIIERNNYIDLSQWDIYSLASIFTNFLKNKSKPLI
                     PIDLIELPIHDNFEYTFQVFKEIVRYNNYYDILCAIFPLFISILNAGDITRHDSRSLS
                     RALTPTLCKEKVSMMSSDRLAIGNKYIRNLFEHFHDIIKVLETNEKRNEKISKSDIAE
                     LANLTINTHININSRSSSGSSDLLLDINSDRSGSVSSSPKIPPKLPPRRNASSELKLA
                     KEESSIQRPVRAISLSHTNSEDESNTSLPSVNSTFSKASSSTDSTNIEQENKNTDINN
                     DNTNDKDSPVKTERNNNDIQNMITDGFADVDVSQVVLKKDKIQEFDKELQKKKKLAGE
                     ENTVKTIKFSTESYSDIKTNKVSKLAALYEERLMGLQVMNEIRHQNSV"
     gene            complement(<239243..>240391)
                     /locus_tag="CAGL0F02475g"
                     /db_xref="GeneID:2887815"
     mRNA            complement(<239243..>240391)
                     /locus_tag="CAGL0F02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446077.1"
                     /db_xref="GeneID:2887815"
     CDS             complement(239243..240391)
                     /locus_tag="CAGL0F02475g"
                     /note="some similarities with uniprot|P32524 Saccharomyces
                     cerevisiae YJL203w PRP21 pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446077.1"
                     /db_xref="GeneID:2887815"
                     /db_xref="GOA:Q6FUL7"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR022030"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL7"
                     /translation="MTVNDIPQQTKEDINKTVEYLRQYGPEFLEKLRGDVRFEFIEEN
                     SPYHSYFISQYQDNNNSHLPDSVLSSNGEADEEGKEVEEPYEFRFSRYSRSLTKRDFE
                     IIRQVALLCAINEDVKYLDKIRQAYGSDEKLSFLNKQHPLNSVFFDLLQQYKLIIKQD
                     IIPPAIAFPKNNKKNKKHIDLKQIVLDRCFRRAEYAEYTKKLQDVKHKIAHERKIHFA
                     AIKWTEFKVIASMAKLHREPKPAIKFNELIISTIDGKNSALSVFDTATGKEIPLLEQR
                     EEASAEKKTNKKKMKIRAAGETRLNKRKASEAPSDDHPAEKKGKRMVRCPITNNLIEE
                     DKFDQHIRTILNDPTIYAEEKKKYKQSHSLSNLTSDEVYQNIKRLVKR"
     gene            <240801..>243302
                     /locus_tag="CAGL0F02497g"
                     /db_xref="GeneID:2887800"
     mRNA            <240801..>243302
                     /locus_tag="CAGL0F02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446078.1"
                     /db_xref="GeneID:2887800"
     CDS             240801..243302
                     /locus_tag="CAGL0F02497g"
                     /inference="similar to AA sequence:UniProtKB:P39531"
                     /note="similar to uniprot|P39531 Saccharomyces cerevisiae
                     YJL204c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446078.1"
                     /db_xref="GeneID:2887800"
                     /db_xref="GOA:Q6FUL6"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL6"
                     /translation="MINDLDANATVVEDLFKVPSITVYIASLLNTKDYINFRQVNKRV
                     YHEVLTDDLDRTIWMDKLAVIGLFKSTEAGEVDKKDEIEQQQELLIEVTDQNNDIDAT
                     NVFDRLSSFTDKNAKDVFKLFFDLLEKFCSKLYHNNMSHFFPAKYEKDPLSQAKILNN
                     IQRYNKCNINDIDYYTKIEQNLVILKEIFINSVLQEAERTYQNADYKSTATFISVLLL
                     LNEEVYAVEFYKSKIDYTDFENWLPEGLLVKKEEKSNTSLLESETELSKMETSSSNKG
                     DDQVIFDYDKLSDALEKLQNYLNDNIDTIDILFGNKYPMILNIIETFIQEVILTPINQ
                     LLGDNEEYIVLFFPRVYTMITKMLCEDLHDSINGGETFHKVVKEFLNIYLTDNIVKYL
                     NLTPMYVRNEISKEFKAHDEKVRSEEMQKNEEIYNSLRNQSEIGTDIGTDKNDFLSSF
                     TKLFKMSNAQSDRQNMEDQLKLAYNLNTISNNLKNIKTLVSLDLCYKVVQLVKEKIDE
                     VNYFTEIDTIANIVKTKCQALFKILVNELCEAHVKPAFEKGTKLLQQYDPNEIDKIDI
                     NLQAFQTAKVEPLVNFTELMNICDIILQMISIFYKNELLGKNIIDKNRDFLNDVVQAK
                     KKFETVVDDYVAEGLNIGISKLMDKINFVFNTVQLPDDFNPEVGSSGASTLEIKPTQC
                     AMQVVELLENHCFLLNGATDKGTVDVYQQEIGERFFNEVVKHIKGSLISEDGGIILIC
                     DLNYYYDFFSKKLRQKSLVRLYQGLKNIGQLYIISGKDSKDLGKMISDLGKFQGLFTQ
                     EEIYEFVQRRADWIRVKRDVEKVMYGLGVKDCVIM"
     gene            <243506..>243725
                     /locus_tag="CAGL0F02513g"
                     /db_xref="GeneID:9487986"
     mRNA            join(<243506..243534,243602..>243725)
                     /locus_tag="CAGL0F02513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999492.1"
                     /db_xref="GeneID:9487986"
     CDS             join(243506..243534,243602..243725)
                     /locus_tag="CAGL0F02513g"
                     /inference="similar to AA sequence:UniProtKB:Q02820"
                     /note="similar to uniprot|Q02820 Saccharomyces cerevisiae
                     YJL205C NCE101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999538.1"
                     /db_xref="GeneID:9487986"
                     /db_xref="GOA:B4UMZ6"
                     /db_xref="InterPro:IPR024242"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ6"
                     /translation="MKPAPYLIGRIADPTIALIFGISSYYLYERNTGRPENYKLNNLL
                     REKYLK"
     gene            <245120..>247618
                     /locus_tag="CAGL0F02519g"
                     /db_xref="GeneID:2887967"
     mRNA            <245120..>247618
                     /locus_tag="CAGL0F02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446079.1"
                     /db_xref="GeneID:2887967"
     CDS             245120..247618
                     /locus_tag="CAGL0F02519g"
                     /note="weakly similar to uniprot|P39529 Saccharomyces
                     cerevisiae YJL206c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446079.1"
                     /db_xref="GeneID:2887967"
                     /db_xref="GOA:Q6FUL5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL5"
                     /translation="MEKKNNLSMKPKLFVLSPDMTTNQLVARTQRLSRACDLCKKRKT
                     KCQGGNPCQSCRKANIQCIYREIASHDKSHDLILGSPNKIKKRSGPLLAVKVKKSLKV
                     NNGDTIHSANYQQDVPKLSQSKPKHNLNGNESAEIESFSPESVSTSPERYYSQSKSQI
                     DNSLYQDIVKAIFPPLQLDKILNSPSFDRESFINIISSHISNSSLNINSVINTYIPSR
                     ARVPLPPKDVALKLIMKTWDCVCILFRFYHRPTIVKLLESLYEDNDSQNKTYNNEQLK
                     VLPLIYSVLAVGALFCKDDVNGKDVSTREFYEDEGQKFFLEAKRLIDIANADDIYSIQ
                     TIFMMTLFLQCTAKIKICYSYVGIAMRALVKNGFHRTTSLIGPTPIIDETRKRLFWSV
                     FKVDMYLNCIMGIPFGLSDSDVNQDLPADVEDENIREDGIIYKKCQFGLSSAGANNQH
                     TKLILIMSHICKALRNLHHSNYSLSAVEEKVKYFENELFGWYASLPNVLRADDDQLIK
                     TRCGERCLKAKKLLYLDYLLTKLLLYKPFSHYIIMHPSQYPTVSFHFGNAIKCFETAH
                     AIIKLAEEMIKEGFLNGSYWFSVHTIFYSVSCLEFFSFQYNKGNISGNPLSFSVQETS
                     KIGMEILLHLRQGSDASNTTFNVLKPLFEELNQRTSEASTRTLLQMKSHIATFQDRES
                     DYQDGRNEFNHRTNNLTTTPLYHEWQDSKTNSTEKQGGPANNMTGFYGMTSRRTSNNI
                     ERGQGSHHLLSLDGTPSSRNVTEQFTVSADNNYPYEENYYDASTSLLKPEDFFRKFLD
                     DYANESSKSANIDIKSLLSSSNHDENVNSMTAQF"
     gene            <248281..>250173
                     /locus_tag="CAGL0F02541g"
                     /db_xref="GeneID:2887685"
     mRNA            <248281..>250173
                     /locus_tag="CAGL0F02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446080.1"
                     /db_xref="GeneID:2887685"
     CDS             248281..250173
                     /locus_tag="CAGL0F02541g"
                     /inference="similar to AA sequence:UniProtKB:Q04177"
                     /note="similar to uniprot|Q04177 Saccharomyces cerevisiae
                     YDR398w UTP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446080.1"
                     /db_xref="GeneID:2887685"
                     /db_xref="GOA:Q6FUL4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL4"
                     /translation="MTDTSPIIRSCYNGDGQYLCYVSVELDKQRVSVVPTSSYDSSVE
                     LPSLLIDESGLRVTQLCWFGAQDIQCVLIGLSNGEIWIYSPLANEIVTKLSTTNGHAI
                     TGMDVNSAYIWCCDANDMLYQFDAKSYQLLKHFKVDNVKALTQLTIFNDEQLLLASHS
                     IYLVSLSDKKVLLTYPGHITPVSKLTKLNNQYFISSASSDRFLNIYDVQSGETKNILV
                     SNSNIVNYRADKENDIIVTTESGSVEVFKDVLVSSDITSTKKRSRVKKSKQPDNIINL
                     VSEQDQKKSFPVLDVFIKSRLLSLVWFSNVTIPRFVDLNLENIPRDYQHPVDSKLRQK
                     NFNDSRSLYGNDVASTKAYKEGNATITSGDNYRHVTQAIQDWEKELQEKEKAGEDTSG
                     DLSLQDKLEASNFSKLSNNFAKNKISTSSDKLTKSAIVAGTVTTVLAQALQSNDHSLL
                     ETVLNNRDERVIRDTILRLKAPLAIILLERLAERIARQSHRQGPLNIWVKWCLIIHGA
                     YLVNIPNLMSSLASLHSTLRKRAELLPKLMGLEARLNNVVISPTSKEDLEDEVTVEFD
                     EDEEDVEYNEELDDAGLIDDGEEEYETGSEEEDDDSEVEGDDKQALEEDDDSEAEEEG
                     YSDVEV"
     gene            <251143..>251790
                     /locus_tag="CAGL0F02563g"
                     /db_xref="GeneID:2887671"
     mRNA            <251143..>251790
                     /locus_tag="CAGL0F02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446081.1"
                     /db_xref="GeneID:2887671"
     CDS             251143..251790
                     /locus_tag="CAGL0F02563g"
                     /note="highly similar to uniprot|Q04178 Saccharomyces
                     cerevisiae YDR399w HPT1 hypoxanthine guanine
                     phosphoribosyl transferase or uniprot|P47165 Saccharomyces
                     cerevisiae YJR133w XPT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446081.1"
                     /db_xref="GeneID:2887671"
                     /db_xref="GOA:Q6FUL3"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL3"
                     /translation="MSDEDKQYISYNNVHQLCQIGAERIKNFKPDLIIAIGGGGFIPA
                     RILRTFLKEPGVPTIRIFAIILSLYEDLHTAGSEVEQVGVKVNRTQWIDYEQCKLDLV
                     GKNVLIVDEVDDTRTTLHYALHELEKDAADQAKAKGIDLEKNPEQKTNFGIFVLHDKL
                     KPKKADLPAELLNDPNRYFAARQVPDKWYAYPWESKDIVFHTKMAVQQGNDIFMD"
     gene            <252513..>253526
                     /locus_tag="CAGL0F02585g"
                     /db_xref="GeneID:2887722"
     mRNA            <252513..>253526
                     /locus_tag="CAGL0F02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446082.1"
                     /db_xref="GeneID:2887722"
     CDS             252513..253526
                     /locus_tag="CAGL0F02585g"
                     /inference="similar to AA sequence:UniProtKB:Q04179"
                     /note="similar to uniprot|Q04179 Saccharomyces cerevisiae
                     YDR400w URH1 uridine ribohydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446082.1"
                     /db_xref="GeneID:2887722"
                     /db_xref="GOA:Q6FUL2"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR015910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL2"
                     /translation="MTATEIPIWLDCDPGHDDAVAILLACCLPAFKLVGLSTCFGNAP
                     PENTDYNARSLLTALGKTDVPVYLGAQRPWIRKPHYAPDIHGETGLDGTSLLPVPVVE
                     VNKEVNFIDAIEKAILESDGELSFVSTGATTTIATVLREKPYLLEKIKYISIMGGGLG
                     VGNVNKGLSAEFNVWIDPHAAKFLLTDPGIKRKCILIPLNLTHKALATDEVMKRVLGD
                     GKSNIRRLFYDLFLFFKKTYEHAQGFESGPPIHDPLTLLPLLELYGWETKEVINFSYR
                     RLDIDVDIDIHSDHAGKLIILNEYEQEEVQKGVIVGYELNFDYFWDKLYFCLEEAEKT
                     STI"
     gene            complement(<253736..>255232)
                     /locus_tag="CAGL0F02607g"
                     /db_xref="GeneID:2887696"
     mRNA            complement(<253736..>255232)
                     /locus_tag="CAGL0F02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446083.1"
                     /db_xref="GeneID:2887696"
     CDS             complement(253736..255232)
                     /locus_tag="CAGL0F02607g"
                     /inference="similar to AA sequence:UniProtKB:P21595"
                     /note="similar to uniprot|P21595 Saccharomyces cerevisiae
                     YDR402c DIT2 cytochrome P450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446083.1"
                     /db_xref="GeneID:2887696"
                     /db_xref="GOA:Q6FUL1"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6FUL1"
                     /translation="MLNILVFGFICLVLCWILTICFPPISFPNNIPTIPFYSVFIPQY
                     YNIDQVQFYNLYIREKLEKYGAVKFYFGSRWNILVSRPEFLNNIFKNEDTFAKSGNQQ
                     KIPYSVLAAYTGDNVISAHGVNWQKYRKPIKDGLQHFDIGILLKNAMKFCELIKEDMR
                     PFKYHCNFKIIPYIQRLTLDNICRVGLGFEFGAIDEDNNSLHRQLIQIKKQIFDPFYL
                     NFPMFDRLPIPSRLLAFQNVENFRSSLVDKVQKQLIKTYKFEQANTSGSALVRAYNNG
                     ELTYKQLTDNIVILLVAGHENPQLFISNLIYLLGKYHDTWQVDIRNEILNNEENNLSE
                     LPLLNSFLYECLRYYPPLSVIINRKTTKRCMLGPGIVVPKDTYVGYHNYSTCHDSNFW
                     GHTSDIFDPTRWGKDIETINKAWKTTKNNCILNTFHGGKRACLGEKLVFVSTRIIIAE
                     FLSSFEWKLSPLWVEQMTHAGPLCPKDLALDIRVRDTSMQIQKLNKYL"
     gene            <256597..>258162
                     /locus_tag="CAGL0F02651g"
                     /db_xref="GeneID:2887632"
     mRNA            <256597..>258162
                     /locus_tag="CAGL0F02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446085.1"
                     /db_xref="GeneID:2887632"
     CDS             256597..258162
                     /locus_tag="CAGL0F02651g"
                     /inference="similar to AA sequence:UniProtKB:P21623"
                     /note="similar to uniprot|P21623 Saccharomyces cerevisiae
                     YDR403w DIT1 spore wall maturation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446085.1"
                     /db_xref="GeneID:2887632"
                     /db_xref="GOA:Q6FUK9"
                     /db_xref="InterPro:IPR007817"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK9"
                     /translation="MTLGSSIDIASTPKGDSETESNHSTFNKIIAIYTRDFYGKLYAI
                     EIKKECTIEREWQEFYELFACLDGKSSMITNDVIEFHISKELAKRYIHDLQTPIKISE
                     YQKEGEQQIRGCVSKVEVASAFNDWFIYHVLDGCRLENNSFPLISHDIKYDEMFTSFF
                     EQQLKNSVVDEKWYETGREYFKSRVRYFTQRYRRIECILPAFPCKSSNKNKVFSTIPD
                     KGEELALKRLIFATQQVRSFYPPGMKVWIVSDGHVFSDCIGVDDEVVSEYTSQLHTLY
                     KNLSAQEPDAIGFCGLKELLFEGKSAKLFKSEWVAEVEMEHHTGTNICKYSDLCRQIL
                     MCGCDTDAGLLKKQISTPGHPRLFLFRGFSKFMMEDLALLPYFQNSSRKAFKKTISKI
                     AFNMIKRNDAYSNLVELVFPNHLRISIHAHVNSGPKFGIKVIAPEQCRTIKSLENIDE
                     PKFEDLLHIPTPWHNCIVKIEKDYDNGNELYMIKSKIIKDVIDQGKYVGYWEPGNIEK
                     GKGGHFILRKTKP"
     gene            complement(<258826..>259341)
                     /locus_tag="CAGL0F02673g"
                     /db_xref="GeneID:2887598"
     mRNA            complement(<258826..>259341)
                     /locus_tag="CAGL0F02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446086.1"
                     /db_xref="GeneID:2887598"
     CDS             complement(258826..259341)
                     /locus_tag="CAGL0F02673g"
                     /note="highly similar to uniprot|P34087 Saccharomyces
                     cerevisiae YDR404c RPB7 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446086.1"
                     /db_xref="GeneID:2887598"
                     /db_xref="GOA:Q6FUK8"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK8"
                     /translation="MFFIKDLSLNVTLHPSFFGPRMKQYIKTKLLQEVEGSCTGKFGY
                     ILCVLDYDNIEIERGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQ
                     VGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDIITIKSRIRVKIEGCISQVSSIHAI
                     GSIKEDYLGAI"
     gene            <259987..>260601
                     /locus_tag="CAGL0F02695g"
                     /db_xref="GeneID:2887612"
     mRNA            <259987..>260601
                     /locus_tag="CAGL0F02695g"
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /transcript_id="XM_446087.1"
                     /db_xref="GeneID:2887612"
     CDS             259987..260601
                     /locus_tag="CAGL0F02695g"
                     /inference="similar to AA sequence:UniProtKB:P32387"
                     /note="similar to uniprot|P32387 Saccharomyces cerevisiae
                     YDR405w MRP20"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /protein_id="XP_446087.1"
                     /db_xref="GeneID:2887612"
                     /db_xref="GOA:Q6FUK7"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK7"
                     /translation="MPRLVGKSVSDHILGLAQKGIEENAAHFKVGGKKLYFPKARVIL
                     LRPNAKHTPYQAKFIVPKSFNKLDLRDYLFHVYGLRAMNVTTQLLHGRYERAGNIASP
                     RYRGPQIKKMTIDMNEPFIWPEEDTENSLWDHKFAQELNKYREETMMKLGSDKLKPHK
                     AFDGALGPFNDNMIAQPFIPKQLKRRMLNQKPQDPDYLKINQFL"
     gene            <261361..>265989
                     /locus_tag="CAGL0F02717g"
                     /db_xref="GeneID:2887804"
     mRNA            <261361..>265989
                     /locus_tag="CAGL0F02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446088.1"
                     /db_xref="GeneID:2887804"
     CDS             261361..265989
                     /locus_tag="CAGL0F02717g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446088.1"
                     /db_xref="GeneID:2887804"
                     /db_xref="GOA:O74208"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /translation="MNTPDDSSVSSVDSHQPYMGFDDNVEKRIRELARSLTQQSLTSS
                     NRSVNKEAPADGSAPLDRVSTRASSIFSADFKGVNPVFSDEEEDDYDARLDPNSDEFS
                     SKAWVQNMAKITTGDPEFYKPYSIGCCWKDLSASGESADVSYQSTFLNLPVKLLNAVW
                     RKARPARESDTFRILKPMDGLLKPGELLVVLGRPGSGCTTLLKSISSTTHGFQISKDS
                     VISYNGLTPNEIKKHYRGEVVYNAEADIHLPHLTVYQTLVTVARLKTPQNRVKGVTRE
                     DFANHVTDVAMATYGLSHTRDTKVGNDLVRGVSGGERKRVSIAEVWICGSKFQCWDNA
                     TRGLDSATALEFVRALKTQAHIAKNVATVAIYQCSQDAYNLFNKVSVLYEGYQIYFGD
                     AQHAKVYFQKMGYFCPKRQTIPDFLTSITSPAERRINKEYLDKGIKVPQTPLDMVEYW
                     HNSEEYKQLREEIDETLAHQSEDDKEEIKEAHIAKQSKRARPSSPYVVSYMMQVKYIL
                     IRNFWRIKNSASVTLFQVFGNSAMAFILGSMFYKIQKGSSADTFYFRGAAMFFAILFN
                     AFSSLLEIFSLYEARPITEKHRTYSLYHPSADAFASVISEIPPKIVTAILFNIIFYFL
                     VNFRRDAGRFFFYFLINVIAVFAMSHLFRCVGSLTKTLQEAMVPASMLLLALSMYTGF
                     AIPRTKMLGWSKWIWYINPLAYLFESLMVNEFHDRRFPCNTYIPRGGAYNDVTGTERV
                     CASVGARPGNDYVLGDDFLKESYDYENKHKWRGFGVGMAYVIFFFFVYLILCEFNEGA
                     KQKGEMLVFPHSVVKRMKKEGKIRDKTKMHTDKNDIENNSESITSNATNEKNMLQDTY
                     DENADSESITSGSRGGSPQVGLSKSEAIFHWQNLCYDVPIKTEVRRILNNVDGWVKPG
                     TLTALMGASGAGKTTLLDCLAERTTMGVITGDVMVNGRPRDTSFSRSIGYCQQQDLHL
                     KTATVRESLRFSAYLRQPSSVSIEEKNEYVEAVIKILEMETYADAVVGVPGEGLNVEQ
                     RKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWATCQLMKKLANHGQAILCTIHQPSA
                     MLMQEFDRLLFLQKGGQTVYFGDLGKGCKTMIKYFEDHGAHKCPPDANPAEWMLEVVG
                     AAPGSHANQDYHEVWRNSEQFKQVKQELEQMEKELSQKELDNDEDANKEFATSLWYQF
                     QLVCVRLFQQYWRTPDYLWSKYILTIFNQLFIGFTFFKADHTLQGLQNQMLSIFMYTV
                     IFNPLLQQYLPTFVQQRDLYEARERPSRTFSWKAFILAQIVVEVPWNIVAGTLAYCIY
                     YYSVGFYANASQAHQLHERGALFWLFSIAFYVYVGSLGLFVISFNEVAETAAHIGSLM
                     FTMALSFCGVMATPDAMPRFWIFMYRVSPLTYLIDALLSTGVANVDIRCSNTELVTFT
                     PPQGLTCGQYMTPYLNVAGTGYLTDPSATDECHFCQFSYTNDFLATVSSKYYRRWRNY
                     GIFICFIVFDYVAGIFLYWLARVPKTNGKIAKNGKTAKVNFIRRLIPF"
     gene            complement(<266337..>270113)
                     /locus_tag="CAGL0F02739g"
                     /db_xref="GeneID:2887888"
     mRNA            complement(<266337..>270113)
                     /locus_tag="CAGL0F02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446089.1"
                     /db_xref="GeneID:2887888"
     CDS             complement(266337..270113)
                     /locus_tag="CAGL0F02739g"
                     /inference="similar to AA sequence:UniProtKB:Q04183"
                     /note="similar to uniprot|Q04183 Saccharomyces cerevisiae
                     YDR407c TRS120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446089.1"
                     /db_xref="GeneID:2887888"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK5"
                     /translation="MDFLSSNLSFVNPCKVRTLVVPIGKWKKRDFLNQFETLRANNEV
                     RLLDITPIDCPLFTPQAFPNGRVFYDFTISQHADALDLFLYDFEPFRKIFVIIGLVND
                     KSDPVDNMNILKERYPTVISHNLLYTDKSLINSDVENQDISNIFHYNSDKLENYETIL
                     CDITRNFLVALNHYYSSYKHVTLRSPGAIGGNAVRKTSLLMSALPGNQSRGSGSLYNS
                     NSTNTNKRLSSFEMTTNNIKRSASLKLSTSLASTDNKIQTRAQGRQYKILGNFQLLAG
                     RVSDALNSFNEAVILLYRVRDLLWLGSALDGVAICAVILSYLQMPFKIPHIVALICPM
                     ESPNNSIEALSPRNSLTNSVQSPRNSLTLATSEANIDVDMSNLPVLVKAILDKALHYY
                     DESLSHNSEYAPQIVYSQFLSRTLSFMLCCNSAVVQSQNVASSIINCNYSNKPLKDCE
                     NLSFSNSDVYSFCGKVLLLKIDDMELEEQSSIFSLLSKAYASLQLTRKQAFTLRLLLV
                     SISSHAEGLKWQHSFQNFLDTVMRLYDIHESADSNEVKSNSLEWRELQKDIIELCLQI
                     SVSMKAESNMRDYGLLMLNKYNDMLSETEQKEILQVILKPLIQNLKIKEYWDPFILRG
                     VTISRLETDSASYDTLRIPNENSIATAQKINPHEVFNPFKQANSLNLKTSGSSDSKPK
                     LFLVDDRAEFSCTIQNPYGFDITISDIHLPDEITDYCELDTRSSVKDNPYVIGAKSVR
                     NITLPIKIKKSTADDFLFLRYLRLSVLDLPLSRFDVYPMPQNGGIISPLNINLRTTPP
                     LESEALTFKILPEQPELEVMNNGKVTGNSWMLLDGTKSQFTILIRNKSLSKSIDQLNV
                     TAVTNIEHALKADYWKKMQPDDLNILESNIMWMKNECIKILNKPEHVQPNEIFELKLE
                     IDTVRAPFEFESFIVVVEYGMQEEDKSCFYMKKLKIPYEVTLRRSIEVPNMDLIPLNH
                     MNFTNTSDSSWIAYIQSLSNKSNDAFSYSAKDYMLLLLDFRNSWIDGIHIEVTYEDFV
                     SKGHLVESNRNLRIIVPIRKIDVEKINFSNKPIPRIFKERQFLQSGMDENTEITMREC
                     FWTREYILERLSCRWELSTDSLIRGEVDFRKYIEKFDNRTVANLYKGKLPFSITLSSS
                     SKSSTTGELNRISCQISPQTVQRQHSRIQQTALLNFFIFEHFSSKLLPKSNRRLLYNG
                     SLSQKFSTNSESTVCLDVIPIEPGCYEICVCISETESVDKVLQFNPDSILVEVN"
     gene            complement(<270750..>271382)
                     /locus_tag="CAGL0F02761g"
                     /db_xref="GeneID:2887708"
     mRNA            complement(<270750..>271382)
                     /locus_tag="CAGL0F02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446090.1"
                     /db_xref="GeneID:2887708"
     CDS             complement(270750..271382)
                     /locus_tag="CAGL0F02761g"
                     /note="highly similar to uniprot|P04161 Saccharomyces
                     cerevisiae YDR408c ADE8 phosphoribosylglycinamide
                     formyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446090.1"
                     /db_xref="GeneID:2887708"
                     /db_xref="GOA:Q6FUK4"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK4"
                     /translation="MKRVTVLISGSGSNLQALLDAEREGKLPGISITHVISSSKKAYG
                     LERAAAAGVPTTIHSLYNYTKSIPKEDVAQKKLARRQFEKDLAQVVLESKPDLVVCAG
                     WLLILGPDFLAILKGIPILNLHPALPGQFDGTTHAIEMAWNKCQEDNKPLKAGCMVHY
                     VIEEVDKGEPLVVKELEIVPGKETLDQYEERVHKAEHVAIVEATLKALAN"
     gene            <271798..>274317
                     /locus_tag="CAGL0F02783g"
                     /db_xref="GeneID:2887721"
     mRNA            <271798..>274317
                     /locus_tag="CAGL0F02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446091.1"
                     /db_xref="GeneID:2887721"
     CDS             271798..274317
                     /locus_tag="CAGL0F02783g"
                     /note="some similarities with uniprot|Q04195 Saccharomyces
                     cerevisiae YDR409w SIZ1 or uniprot|Q12216 Saccharomyces
                     cerevisiae YOR156c NFI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446091.1"
                     /db_xref="GeneID:2887721"
                     /db_xref="GOA:Q6FUK3"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK3"
                     /translation="MDYNIPLGDDRCLVCNACNRLSLLDLDGLDALIRYLSEYKALKV
                     DLGTGNSENVGIADKRNGLCLFLLRYLKKDRSKSYEIRAVIRAIDAIYRKQKLPSMME
                     LTMLVRKYTNKYDPYGYWDNVDEFNPMDVVTKQMIEFMNISNNPKSPNFVRSPFYEIL
                     SIIPDTTRRLPAIEVKNVAECKFKFEKNVWTKLTDEKYPLKLYLFSRKDSKDPETGDY
                     IPNKDEDTPIAFPTPIEVWVNNEKIKANFKGLKNRDGSVNPVDLTPFLKSWRAQNVVK
                     IIHVFNKECYSSYCALIKPIAPQEILTTILNKPVIPYTSALENVKKLFGEQTDNELIT
                     TSTIISLKCPISYTRMSYPVRSKYCEHLQCFDGLWFLHSQLQVPTWMCPVCQISLKPA
                     DLYVCEFSMRVLNSCANNVEQIELAPDSTWKPIYEKEDQSDCSDEEDTSKDTMTEVLK
                     HEMVTDTITNKTSRNNSQLNVVSLLSDEEDDTTTTKSKDRGSKLVPTSKNYNSSSTGN
                     VVRKSIGNEKNGAVSQSIAIAASTTLHNDTNHDDEDDDLPLSAVARKRGSPREFSYGS
                     YEINGTLASLSNNATLPQNSHTHKKPHLQRLAPKLLAKEPLKNTNGADANPIFGINSK
                     FKNDNQLSKKTLDPKATSQPTINPSFDSAQQYSMRISSQAGLGSRSILSSNSNLTTSD
                     CNPFVSEQQLAYEGKNGRASSEIMQKPIRNENRQSQQRVTPDLKHVNDYKRTNKKGKI
                     KNIVNDQKAEELTQLANGRLKTDKAPELPILPKLPQIAGQSHSTSKIASEPSLDKINR
                     VSIKTKPPSALPIVNPFLTSKSKPNNTKGAEIVKGNSPWFV"
     gene            complement(<274470..>275234)
                     /locus_tag="CAGL0F02805g"
                     /db_xref="GeneID:2887597"
     mRNA            complement(<274470..>275234)
                     /locus_tag="CAGL0F02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446092.1"
                     /db_xref="GeneID:2887597"
     CDS             complement(274470..275234)
                     /locus_tag="CAGL0F02805g"
                     /inference="similar to AA sequence:UniProtKB:P32584"
                     /note="similar to uniprot|P32584 Saccharomyces cerevisiae
                     YDR410c STE14 farnesyl cysteine
                     carboxyl-methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446092.1"
                     /db_xref="GeneID:2887597"
                     /db_xref="GOA:Q6FUK2"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK2"
                     /translation="MTGSNKSEKFVPDAEGLPVIINGKAYPDIRRNPLDDIAVTSFAL
                     GILLGIFVGLLTFTQFRNFNVYIIALSIFHFLEFYVTAKVNPGKVNSDSFLLNNGIGY
                     LGAHMFGVLECLVESIFFPNMKKISNSWVAIFLTIIGVILILLGQVSRSMAMYQAGKS
                     FSHILKTEKLDDHTLVTTGIYGYLRHPSYFGFFWWAIGTQLLLLNPIALIVFVGVLWS
                     FFNKRILIEEKYLIQFFGEQYINYKKRVKVWIPLID"
     gene            complement(<275536..>276567)
                     /locus_tag="CAGL0F02827g"
                     /db_xref="GeneID:2887766"
     mRNA            complement(<275536..>276567)
                     /locus_tag="CAGL0F02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446093.1"
                     /db_xref="GeneID:2887766"
     CDS             complement(275536..276567)
                     /locus_tag="CAGL0F02827g"
                     /inference="similar to AA sequence:UniProtKB:Q12743"
                     /note="similar to uniprot|Q12743 Saccharomyces cerevisiae
                     YDR411c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446093.1"
                     /db_xref="GeneID:2887766"
                     /db_xref="GOA:Q6FUK1"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK1"
                     /translation="MAGNIHSLGNTTPRNGNGPSSEGPATFSSFWYSVPPVSRWLVTC
                     CITVNTLCHLHLIGYQHFAFTWFQTFQRLQIWRMLFSSLILPANLMPALMEGYNLYVR
                     STELEQGFYYSSKRISLSSHNFAFYLFSCLVVMTTIAGFLFGTMVPLYLTSAFTACLT
                     YTWSLYNTDKKVMFYGLIPVWGRYFPVLQLFTGFVLGSRFDFYLSLIGIIAAYIYNCV
                     DTWTLGPLYGLLIKTNVANYGYEPRGKVQAPGWFIKIYNLFSGETTPSIVTDGNILKS
                     TGISSILKTGGQRLGTRTEGDNPSPSLAGQSASIRSSSSVRTSGASRTQTSMGSRMFP
                     GKGKRVGDD"
     gene            <277229..>277975
                     /locus_tag="CAGL0F02849g"
                     /db_xref="GeneID:2887702"
     mRNA            <277229..>277975
                     /locus_tag="CAGL0F02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446094.1"
                     /db_xref="GeneID:2887702"
     CDS             277229..277975
                     /locus_tag="CAGL0F02849g"
                     /inference="similar to AA sequence:UniProtKB:Q04031"
                     /note="similar to uniprot|Q04031 Saccharomyces cerevisiae
                     YDR412w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446094.1"
                     /db_xref="GeneID:2887702"
                     /db_xref="GOA:Q6FUK0"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:Q6FUK0"
                     /translation="MAVKSNREILTRGKNYATKQAKKFGADEVSFDKDSRLDFLTGFH
                     KRKVQRQKKAQEFHKEQERLQKIEERKKIRDERKQQIEEQLKQFKSKLDIELEEVAGD
                     QDWEDNTKKKKNQKSEVKEEEEEEWEGFQSDQDTKIDEDDKDESGVKPILKKNAVASE
                     YSDNTVVEIETLEPNENFAYLAEVNNVKLEQSEKVLKQSITRATKYAKFLGMGDDEDN
                     KKKKKKKFRYLTKGERRVNQMKANANKRRK"
     gene            complement(<278122..>279228)
                     /locus_tag="CAGL0F02871g"
                     /db_xref="GeneID:2887902"
     mRNA            complement(<278122..>279228)
                     /locus_tag="CAGL0F02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446095.1"
                     /db_xref="GeneID:2887902"
     CDS             complement(278122..279228)
                     /locus_tag="CAGL0F02871g"
                     /inference="similar to AA sequence:UniProtKB:P16151"
                     /note="similar to uniprot|P16151 Saccharomyces cerevisiae
                     YDR414c ERD1 required for retention of luminal ER
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446095.1"
                     /db_xref="GeneID:2887902"
                     /db_xref="GOA:Q6FUJ9"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ9"
                     /translation="MIILEEEKESISLLRYLVNVPPAQLINVLLLLAAFLWAWIVRFL
                     LRHSIDIGAVVQLSHPWDQFAANNARLKTQSTRFTTYLARVILPLTLLTNILHSYIEE
                     NKDANALVVLMYTLLPLGQAAFLILSILKTCGVVRYCVKRCLVIESSPRALRNVYILF
                     SDTVTSFNKPIIDFALYLTYLLGIQITHFDLFLAVIPPLIRLCQCLKEYKTTKEFTLL
                     ANALKYSCHLPVVLCLWYSRVYGDDSLTIRDYNILKVMMFIQSTYSYIWDVRKDWTIT
                     SISSIRYQKSRVLFPKFYYHIAIVMDGIMRYWWLWIIILAPYDVSGKPTALFFEKEAQ
                     FIELIRRAGWVVFKLESEYSTRDSDAINYQKESR"
     gene            complement(<279526..>280659)
                     /locus_tag="CAGL0F02893g"
                     /db_xref="GeneID:2887577"
     mRNA            complement(<279526..>280659)
                     /locus_tag="CAGL0F02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446096.1"
                     /db_xref="GeneID:2887577"
     CDS             complement(279526..280659)
                     /locus_tag="CAGL0F02893g"
                     /inference="similar to AA sequence:UniProtKB:Q04033"
                     /note="similar to uniprot|Q04033 Saccharomyces cerevisiae
                     YDR415c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446096.1"
                     /db_xref="GeneID:2887577"
                     /db_xref="GOA:Q6FUJ8"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ8"
                     /translation="MLLKNLVYIGSVAALPWSSSWSSLLQDDDSVRTIDVGDGQLRQV
                     TEYDKLKLRRRGIKFFDVTDVLFFRSEEDPVVADYNYPMQMHQRDTVHGVLDKIDKES
                     MYADLSKLTSFYTRYYKSAEGVKSADWVLSRITNITNGLEKDLVQIEQVSHKGWDQYS
                     IVVRFKGTSLPDNIVVIGSHHDSINLLLPSVLPAPGADDNGSGTTTVLEALRVYVEYY
                     IKQNQRPMNTIEFHFYSAEEGGLLGSLDVFTRYARDQKKVVAMLQQDMTGYVRDPAKE
                     HVGLVTDHTTPKLNNFLKLVMNEFLSIPYVETECGYACSDHGSAVKNGFPAAFVIESD
                     FKKTNRYIHSTMDTLDRLSLDHMAEHAKLVLGTVIELGQWLGF"
     gene            <281010..>283517
                     /locus_tag="CAGL0F02915g"
                     /db_xref="GeneID:2887745"
     mRNA            <281010..>283517
                     /locus_tag="CAGL0F02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446097.1"
                     /db_xref="GeneID:2887745"
     CDS             281010..283517
                     /locus_tag="CAGL0F02915g"
                     /inference="similar to AA sequence:UniProtKB:Q04048"
                     /note="similar to uniprot|Q04048 Saccharomyces cerevisiae
                     YDR416w SYF1 synthetic lethal with CDC40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446097.1"
                     /db_xref="GeneID:2887745"
                     /db_xref="GOA:Q6FUJ7"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /translation="MADIDQYILDDSDIAFEYELQKSPSVEVWQRYIAHWEAQVCEDG
                     VRSARHILWLYERMVTQFPTLTVWEQYIGWFRRQYKLDQYLDTFKLYERCINSVKGPL
                     GVFAVEVMLFCISTFDLDIIMKGLQLVLHRCNKDEVERIWNIVLGFALEHVLPSEEGP
                     NNIDFSAFNDRNYEDLRLDIYKLLFLGGDQTEIEDDEEDEDVDKWTASLLRYYLQVAN
                     EDKYDETLRLLIRTKDIKIIKECFDLYIFNDKTGKNNRESKKEYDFDLYIYYLDTLDK
                     LRLDKDYKSVFDNLLEKYPQHRVLLTLKLADFHMKRADFDKMEKVLTKALSETVKTNE
                     FIAIYTYHVNFEQAYVETIFDEMRDDPEIQVQKKWKSEMDDHLIILGDLTSRYHLLVN
                     DLKIRQNPNSVSNWLERTTLFEDFDKKCEVFVEAIKTIDPIKVKDKEYGMLGKLWCDY
                     AKVYWSNKSYEEARTIYESATKVPFPDLQDLEIVWHTWAVNEFQIHNIERALKILRKA
                     LTVPPSYESIIDRFKSENRRLPSQTILFTSKRLWNYYIDLLESIPTIDANDVIRAYDT
                     LMTLKLITPVGILNYATFLKQNNNLHGSLQVYEKGINMFPPEICYELWTLLLDEVMEP
                     AHQATKERIRELFEQCLQQLGNTDININSIYVKYSDFEIHNKLFSRAIDLLMSGARRP
                     YTNKEQLKQRVDLWESAISKCEEFLGPDSLRQLLSECIQELPNSKAITYVLKFTKLEM
                     SLSDYTRARELLQYGAQLLPPIKNEELWGLWEQFELEHGDKSYYKEMLLLKQKLEKEM
                     KVDTEEVSKGQGNVQFVASSVKNQEAKTNPDEIEIDI"
     gene            <284659..>285156
                     /locus_tag="CAGL0F02937g"
                     /db_xref="GeneID:2887769"
     mRNA            <284659..>285156
                     /locus_tag="CAGL0F02937g"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_446098.1"
                     /db_xref="GeneID:2887769"
     CDS             284659..285156
                     /locus_tag="CAGL0F02937g"
                     /note="highly similar to uniprot|P17079 Saccharomyces
                     cerevisiae YEL054c RPL15B or uniprot|P17079 Saccharomyces
                     cerevisiae YDR418w RPL15A"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_446098.1"
                     /db_xref="GeneID:2887769"
                     /db_xref="GOA:Q6FUJ6"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ6"
                     /translation="MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKDKNVKHSG
                     NVALDEIIEIARQMKEKSFGKNLASVTKEILGTAQSVGCRVDFKNPHDIIEAINAGEI
                     EIPEN"
     gene            <286337..>288244
                     /locus_tag="CAGL0F02959g"
                     /db_xref="GeneID:2887824"
     mRNA            <286337..>288244
                     /locus_tag="CAGL0F02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446099.1"
                     /db_xref="GeneID:2887824"
     CDS             286337..288244
                     /locus_tag="CAGL0F02959g"
                     /inference="similar to AA sequence:UniProtKB:Q04049"
                     /note="similar to uniprot|Q04049 Saccharomyces cerevisiae
                     YDR419w RAD30 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446099.1"
                     /db_xref="GeneID:2887824"
                     /db_xref="GOA:Q6FUJ5"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ5"
                     /translation="MGHSKFTWKDLIDLNNKDKAYLSNLACLAHIDVNAFFAQAEQIR
                     CGYSKDDPVVCVQWKSIIAISYAARKHNISRMHTIQEALKKSSDIIPIHTAVFKKGEN
                     FWQYHDGYGSWNEDPAKQLPPEEYKVSLEPYRRESRKILKIFREFCDHVEKASVDEVF
                     LDLGRLCFRDLMFPNVEATDDDDYNIVAENPLRELFVNGDYKLDMPLPPVPEALKKLS
                     YCGLVYNHEEAPVIQDWDDVIFALASKNTQLIRKTIQDNLGYTTSCGIARNKILCKLG
                     SNYKKPDAQTVIRNNDILEFLDQGGFEITSFWTLGGALGRELEGLLNLPEKDTIKHIR
                     ETWPANHKQLRDYIETELDEAENKKKYPVVAGSKLEVLSDKLFSMVRGTFSTPITPKP
                     LIQSMMSNKNLRGKSCNSLVDCISWLEVFNGELTARIVDLEQDYNKIVVPRTVSLNLR
                     SYTGDVRRKSGPLVINNSKYLSRDLLKTCVKLMQEIHDKFAAKDPSKFYPLINLNVII
                     SNFDILDHQKTVLDMFGNQKQVFNTKTISPKIEPVTEVEDKDEDAKKFSCEKCKVHFD
                     NLKEYDEHKDYHAALKLSESLNGVESTSKNLSIGEKRLLFSKEKRVKKKPISKNKVNS
                     SGNIYNFFNKK"
     gene            288415..288496
                     /locus_tag="CAGL0F02981r"
                     /db_xref="GeneID:2887596"
     tRNA            288415..288496
                     /locus_tag="CAGL0F02981r"
                     /product="tRNA-Ser"
                     /note="tRNA Ser (AGA) cove score=86.17"
                     /db_xref="GeneID:2887596"
     gene            <289923..>293480
                     /locus_tag="CAGL0F03003g"
                     /db_xref="GeneID:2887960"
     mRNA            <289923..>293480
                     /locus_tag="CAGL0F03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446100.1"
                     /db_xref="GeneID:2887960"
     CDS             289923..293480
                     /locus_tag="CAGL0F03003g"
                     /note="some similarities with uniprot|P32334 Saccharomyces
                     cerevisiae YGR014w MSB2 or uniprot|P41809 Saccharomyces
                     cerevisiae YDR420w HKR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446100.1"
                     /db_xref="GeneID:2887960"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ4"
                     /translation="MRKLLLLVRSLLLVAVTATTSANDTPVPNPISEDISSVLSASIQ
                     PEIPSAQPSVQSEIQSIPSVQSEIQSVPSVQSEIQSVQPSEVQPSPVANSIESNTNTN
                     TNTNTYPDAGSSIQPNSVSNSIVSQPSDDINTDDLNFLDDGSSQQGPSSILSINPSVQ
                     PSSIDYHSSSKINVESSSSVIPVFAPSEARAPAKPPAFEISSSASSVQVSSQQQQPSI
                     QPSSVEPVQSNSPSPSSVVPSPSSVIPLVPPEVQVSPSSAAPLIPPEVQVSPSSVLPS
                     SSISQLGPSILVSPPVSSPPTSSIPSQQISSQEINFSEFSGSFNVPSWLLSSNAPSSS
                     FSEQLSPSSLDYSQAIHSRVADSSTTTLPLIVPPTTTTTPTLVSESSTLSNFLKPSAD
                     REFSVHFPVLSPSSIENEPPSSIQSVASSTILSQAAPLSPAQAASIPSSILEPTGSSV
                     ASEYISSNSLSQIPVEAVDAKQAPSSSSLSSILSNTDNIEAISSNLEQATPSRPVDNN
                     ATPTANSGTVLDSASQINSQSISRDDASYAEIAQSSVNVQNSASNFANSVPSADSSNT
                     IPQPEDNTPTTSTVSEFTASNVDVSSVHIASKDADSSPNSVSNHDALNSVAPSVDVDI
                     VSSNSIPTQVLTEPSSAVPPNVGFDISSDINIPSENIESDSNLVVTSTSRPSQGTFQN
                     NPTNSRTITNQIPSSASPPPATPTGPKTLSSDENWLPSGIIFQSDFATTVSSSFNPTA
                     TKSLPQFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPF
                     SSYAPNDFPINSLIDDNALAFLDSNLFNASTISVHGIVPLLIPGHEFFVSVVEVYFPN
                     DLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGLISGSSIESTSNSDADYN
                     SDQSGNTRQSRKGKGLPSNLSIVGSLDNYDKNPEKEEHKNRVISIVLPTVLPLGLLFI
                     WCLFFILMSRTQRRRKGNATIEKSNIKVDNTSGYHDNGRSNYKDNVYDGILDEKHYSS
                     SEGVSNGSTMAGLAYAFNNFVGGPNMYSSYDTGALADSTLYSSSNQLQIPRENSSPWP
                     AQYITAPSRKSQHSTEEVSPITLVPRIDSDVYNLQKQEMMAESVSGTFSLGSDIFIDD
                     DEDENVKDLQIEDVDEFDEELYKRLSKFTDYRDVNNISL"
     gene            <295783..>298569
                     /locus_tag="CAGL0F03025g"
                     /db_xref="GeneID:2887689"
     mRNA            <295783..>298569
                     /locus_tag="CAGL0F03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446101.1"
                     /db_xref="GeneID:2887689"
     CDS             295783..298569
                     /locus_tag="CAGL0F03025g"
                     /inference="similar to AA sequence:UniProtKB:Q04052"
                     /note="similar to uniprot|Q04052 Saccharomyces cerevisiae
                     YDR421w positive transcription regulator of ARO9 and
                     ARO10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446101.1"
                     /db_xref="GeneID:2887689"
                     /db_xref="GOA:Q6FUJ3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ3"
                     /translation="MDNKIVKPVPKKKSRSTTPVGGSSSSQGQKHKNTFGACLRCKYK
                     KIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKLGNILDSQGLQSSQSTSPTS
                     ASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEGVSLNSPNTALIEACDRV
                     KSDTAWKLELTSMQSALEFLAKATKLRNDYKNNEPFGSTRSDAASTTSETRDLSEKDN
                     GNESDSTTNSTSKDTSTRSSYPSIEAIKPEVPTPSNHNYDLLGDGKLVTMDEARMLVN
                     IFFNFMHPFYPYIPLHLQDFDELFKYPLLLHCILAISARYNPFDKVGFDNGIEGNRNV
                     IIHNKLWTHCQQLLSQTVWSQASTRSIGTTLAFLLFTEWNPRAIHWEVSDTAHYLSDN
                     NVSSSKEDPDGLGGIATVKRSDRMAWMFTGTAIRLAQEMDILENNAKIYTAANIAEIC
                     YASNMNLKPTLGESLVSIDGGMKEFEIDNPKSQDDIENEDLLKFVQLVAQNKESTKKW
                     AIHKAYSDKLKEENPDLIIDLETEFLNDEYSINYLDENSSFLKNPIPYTTYQKAQLEL
                     LRIVTITYQTIYYEKMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKP
                     VIISLDDLSKFKRTANIRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARF
                     VEQAYRAAKEILKSAIRVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLCDHSMATNS
                     EAKSILKLSGILVDDTVHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDERKRD
                     NENLMTGNGLNNDPSLESQTTHKESLEASNHDTISSDAQEPPSENDSSHDTTTQGTAN
                     STRKVGPNSIDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGFQ
                     DFDQLFDEFAIRPS"
     gene            complement(<298906..>301140)
                     /locus_tag="CAGL0F03047g"
                     /db_xref="GeneID:2887682"
     mRNA            complement(<298906..>301140)
                     /locus_tag="CAGL0F03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446102.1"
                     /db_xref="GeneID:2887682"
     CDS             complement(298906..301140)
                     /locus_tag="CAGL0F03047g"
                     /inference="similar to AA sequence:UniProtKB:P32578"
                     /note="similar to uniprot|P32578 Saccharomyces cerevisiae
                     YDR422c SIP1 multicopy suppressor of SNF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446102.1"
                     /db_xref="GeneID:2887682"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ2"
                     /translation="MHSLFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGSALH
                     ISSPGPSNATVQTIKREVTHGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVA
                     EAAAAKRKNLPFRTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGR
                     RSSNRLVNSKPYLYNYEPSGVPVGDPDGGMLQGTDVVLNQELLEQALKRDMKRKRADT
                     MQSSTVELNKKVDTNTSKNSNHTEIMKNPPETAEPTSATAAMMMRLYGDRTLLNQQIT
                     KQKEDENKYSHTITNAAYKKLKPFSGVKRKILSNPNLNLQPLEPIRPNEPPTSGQRTP
                     NNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGK
                     LLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQ
                     GNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTTLEGMENNGFQGSSDNSTTSMRN
                     NNPVALNLQAPAPSKAQASRNSSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINN
                     ANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCDMEDVDDDNGTENNPRAFYDRPSFT
                     NRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQV
                     AGPSTQDSSINHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQL
                     ESKE"
     gene            complement(<301650..>303110)
                     /locus_tag="CAGL0F03069g"
                     /db_xref="GeneID:2887750"
     mRNA            complement(<301650..>303110)
                     /locus_tag="CAGL0F03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446103.1"
                     /db_xref="GeneID:2887750"
     CDS             complement(301650..303110)
                     /locus_tag="CAGL0F03069g"
                     /note="some similarities with uniprot|P24813 Saccharomyces
                     cerevisiae YDR423c CAD1 transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446103.1"
                     /db_xref="GeneID:2887750"
                     /db_xref="GOA:Q6FUJ1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:Q6FUJ1"
                     /translation="MSKVSKEGKKKAGRKIIDTEAKNKRTAQNRAAQRAFRERKEAKL
                     RALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEIKAD
                     DLKSVEVVPEQPSATNFMNSPTNITTAGSDKQADKTSSKKSSPHVKLESNTSSVSVTS
                     EERGVLSHTPTTTNTSFDTSPSVINDLQRTAANRLESTGSWMDSIFDQDSKLSNLMND
                     QSFYPFDNISFGNSPVITNNWGENDMVAKQAGLESFNFAISNSNSTFGLPAIATDISD
                     INDINDTTTRIEPQLAFPGEDIKYSRENMVMRRESSAMNNGGILDTVINSPIPMLDDN
                     SEDILGDFTCSCQNKANSCPTRQLENEAKATPVGKKIADMNLDDVELRCELLTQHIIY
                     REPLSTVLQLLKRTRHERDARSSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMN
                     KAKISDDGDGTDIVPKRHVVIKAGDLQRTLAKHISS"
     gene            complement(<303484..>303962)
                     /locus_tag="CAGL0F03091g"
                     /db_xref="GeneID:2887691"
     mRNA            complement(join(<303484..303734,303953..>303962))
                     /locus_tag="CAGL0F03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446104.1"
                     /db_xref="GeneID:2887691"
     CDS             complement(join(303484..303734,303953..303962))
                     /locus_tag="CAGL0F03091g"
                     /note="highly similar to uniprot|Q02647 Saccharomyces
                     cerevisiae YDR424c DYN2 dynein light chain 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446104.1"
                     /db_xref="GeneID:2887691"
                     /db_xref="GOA:Q6FUJ0"
                     /db_xref="InterPro:IPR001372"
                     /db_xref="InterPro:IPR019763"
                     /translation="MDQVIVKASDMGDEMQQEVFRIAEEAMREHTLEREIASVIKKEM
                     DSRYGHTWHVIVGRSFGSYVTHEKGKFVYFYVGPLALLVFKT"
     gene            <304124..>306067
                     /locus_tag="CAGL0F03113g"
                     /db_xref="GeneID:2887820"
     mRNA            <304124..>306067
                     /locus_tag="CAGL0F03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446105.1"
                     /db_xref="GeneID:2887820"
     CDS             304124..306067
                     /locus_tag="CAGL0F03113g"
                     /inference="similar to AA sequence:UniProtKB:Q04053"
                     /note="similar to uniprot|Q04053 Saccharomyces cerevisiae
                     YDR425w SNX41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446105.1"
                     /db_xref="GeneID:2887820"
                     /db_xref="GOA:Q6FUI9"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI9"
                     /translation="MKNKSRKRGGRDEDLEEEDNNPFVGTTHMFASGIASAPGGQQAV
                     LKLAQPAPGEQQGASTPDGAGVVAGTAAGATGATGAAGEGEDEDEDSNENSDIRDEDV
                     DILTQTLYKAAEEPFVSVPVRATGTDSLFKIPVDSSGPIQIKEAGDYKDPWGKHAIGY
                     VIELDGFKTVRRYSEFYSLRKNLTLLLPTVVVPPLPPKHSIMNYIFKKSIDTRIIDSR
                     KRTLCRFLNECYEVPDIANHIVFKKFLDCEIIWKDVLNSAPILILPHDNRLAPPLNPT
                     KPSPLHLLLPAPNSKVATNTSILNPLIPTNTELENKFNKLEKKFWEYKINYKNLHKTV
                     KQLENHLKLIGGLHSELGVHYNSFSIENAIISSDGNENEDRSSSMLIEKVGHAFDVSY
                     VTDEILSERHIVNLEEPLYEFIQLLEDCKRVLGFRKAKYLQYEIVEITMDKNKKRLRA
                     LLDLDDHIKTMTNVINQSTILESRKYSNQEPISDVPDSPYSKVDYTSEGEESAHDETH
                     ADHDTPQQEHHKSDDEENIEQLSSSLHASTINANKIKVRKKLSRRRDRSARELDPSLL
                     TEAERKQEIKILQRELDKLEDVQKLVLRDIEDVNESTLRSLEHVSTKLEQRWGNMLRQ
                     VTKAMIDFSRESLNAWRQVRKDK"
     gene            <306549..>307736
                     /locus_tag="CAGL0F03135g"
                     /db_xref="GeneID:2887787"
     mRNA            <306549..>307736
                     /locus_tag="CAGL0F03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446106.1"
                     /db_xref="GeneID:2887787"
     CDS             306549..307736
                     /locus_tag="CAGL0F03135g"
                     /inference="similar to AA sequence:UniProtKB:Q04062"
                     /note="similar to uniprot|Q04062 Saccharomyces cerevisiae
                     YDR427w RPN9 subunit of the regulatory particle of the
                     proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446106.1"
                     /db_xref="GeneID:2887787"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI8"
                     /translation="MVGHEVDTILSTLRIEADPELSYLFDKFEHDYENKLWHQLTQNL
                     NVFFMDERSKPLRLRIYDTFIVKFQENINELSLVQYLLVALQTISDSDEALKYLTHLK
                     QTLEDIDSKKTRNDGLNNHDNAFLFIDIEIARLYLHKKELLKARDMLDVLEKTLDFKD
                     NVPLLLTSSFYSANAEYYKLKEDFSSFYYTSLLYLSTLEDDNELTIINKEPSFELAYD
                     LCVAALLGEKIYNFGELLQHPIMNLINERKDYHWIADLLNALTVGDLEKFDKLISVQM
                     PKTLILAQNETFLRQKIRLMSLVECIFAKNIRLLSFQDVADATQIEKDQVEHLVIKAI
                     SLKLLKGSIDQVNELVTVTWVQPRIINEEQILKMKNRLVDWDEQVRALAVRLEERGKP
                     IWV"
     gene            complement(<307854..>310826)
                     /locus_tag="CAGL0F03157g"
                     /db_xref="GeneID:2887720"
     mRNA            complement(<307854..>310826)
                     /locus_tag="CAGL0F03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446107.1"
                     /db_xref="GeneID:2887720"
     CDS             complement(307854..310826)
                     /locus_tag="CAGL0F03157g"
                     /inference="similar to AA sequence:UniProtKB:P32898"
                     /note="similar to uniprot|P32898 Saccharomyces cerevisiae
                     YDR430c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446107.1"
                     /db_xref="GeneID:2887720"
                     /db_xref="GOA:Q6FUI7"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="InterPro:IPR013578"
                     /translation="MLRFQRFASTYNQRAVLRKYPVGGIIHGFQVRRAVPVPELKLTA
                     VDLIHEQTGAEHLHIDRDDKNNVFSIAFRTLPPDATGVPHILEHTTLCGSEKYPVRDP
                     FFKMLNKSLANFMNAMTGPDYTFFPFATTNARDFVNLRDVYLNSTLRPLLKEQDFYQE
                     GWRLEHSEVTNPKSDIIFKGVVFNEMKGQVSNADYHFWSQFQQNIYPSLNNSGGDPQK
                     ITDLHYQDLVDFHHANYHPSNARTFTYGSFPLEDTLKKVNEEFRAYGKRIINKKLPKP
                     LELIETKELTLEGQIDPMLPAEKQTKTSLTWKCGEPTDLYETFLLKILGNLLLDGHDS
                     IMYKGLIESGLGHDFSVNTGVESMTAANFLTVGIQGSQNVEEFKSKVFDLFKEFIEND
                     VDSNKVDAIIHQLELSKKDQKADFGLQILYSILPGWTNGIDPIEGLEFDELIGRLKSD
                     FKENGTKIFKNILDKYIIDQPYFHFTMKGSEEFSSKLAAEESTKLDKKLKELDETDRK
                     AIFERGLLLEAAQNHKEDLSCLPTLGVADISRKVDTYDLNTNANITVRNTATNGISYI
                     RGKKLINDMIPLELYPFLSLFAASLTHLGTKTTPYGAIDNEIKLHTGGISTNISVNAD
                     PTTLQPNLYFDMSGFSLNEKSDYIFNFLKTILMETDFSTHKDKLKVLINSIASSNTSH
                     IADSGHTVARSFASGHLSTVAAIQEHISGVEHYKLISRLCSIMNDDKLFQSEVIDKLV
                     MLQRIIVNSQNMEFFASVDCQAQENKIRKEVDYFVSTLPNTSSDISGAIQTACVPRYS
                     DSQVLNLIKFPFQVHYTAQAYNGVSYTHKDGAALQVLANMLTFKHLHKEIREKGGAYG
                     GGATFSALSGIFSYYSYRDPNPLASIQTFEKSASYVLNDAKWTQSDLDESKLSIFQQV
                     DAPISPKSEGSTFFNLGVTDEMRQVRREQLLDTSLLDIHRVAERYILPNKSIATVVGP
                     GIDGETVSPKWHIEDIKV"
     gene            <311261..>312862
                     /locus_tag="CAGL0F03179g"
                     /db_xref="GeneID:2887608"
     mRNA            <311261..>312862
                     /locus_tag="CAGL0F03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446108.1"
                     /db_xref="GeneID:2887608"
     CDS             311261..312862
                     /locus_tag="CAGL0F03179g"
                     /inference="similar to AA sequence:UniProtKB:Q04080"
                     /note="similar to uniprot|Q04080 Saccharomyces cerevisiae
                     YDR434w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446108.1"
                     /db_xref="GeneID:2887608"
                     /db_xref="GOA:Q6FUI6"
                     /db_xref="InterPro:IPR019540"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI6"
                     /translation="MSSTIGFRKAVGVCFVLLYLAVGVPLWYKLTNIYRAPLPSQYIE
                     SLHDNVFQDVHMVIPVYLKSDLYKFPDLHDAVQVQVNHLLNTREHDVAWSLQVLQYDE
                     KLMKGLEEAGDDVYMVDLVLDESCGFVPGFGTKHVTVLYDDESVATNDLPFFVAQTLV
                     EHVFGMEWDVFSNYWNRTQNSVAVLYKPDIHISISLLNGGSQPVSWEIDEVLKEYFTP
                     FRQFITSLVNFTVDTSIIYHNDLNLHSLNNSAEVSVSDLSHHIDLSDLSAMNDFKESS
                     SVNLAIVYPDPEFSPNGLNYIQGHERADDVLHPWNSFIVPQWGVVAINKYPLKKHSVI
                     SKEYLKPIVYQFANDMAKLLGLVDINDDFNTPYITVESFKRVMILNNIEKSVETLWSL
                     VKLSKQFQQMSIPKEVMGNVTEALDLRLEIVDLLNNPEKGTDLDWSYALSMSNQLVAL
                     TECAFFHGEMVQQNFFPQEHKVAVYLPLLGPLTIVIFLGAVSLFKEVPSTDKTDEDSD
                     EKDVNIDSETEGPELTNEKAEMKHD"
     gene            complement(<313074..>314030)
                     /locus_tag="CAGL0F03201g"
                     /db_xref="GeneID:2887677"
     mRNA            complement(<313074..>314030)
                     /locus_tag="CAGL0F03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446109.1"
                     /db_xref="GeneID:2887677"
     CDS             complement(313074..314030)
                     /locus_tag="CAGL0F03201g"
                     /inference="similar to AA sequence:UniProtKB:Q04081"
                     /note="similar to uniprot|Q04081 Saccharomyces cerevisiae
                     YDR435c PPM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446109.1"
                     /db_xref="GeneID:2887677"
                     /db_xref="GOA:Q6FUI5"
                     /db_xref="InterPro:IPR007213"
                     /db_xref="InterPro:IPR016651"
                     /db_xref="InterPro:IPR029063"
                     /translation="MELAVQRTDTDALSSKVSAIHTKYLSGGISQQFAYEEVYGEYLA
                     SLRQVSRRVFGKCRYSGASFPVMNYGTYLRTVAIDERVLEFLQCNSGSQVQIVNIGCG
                     SDLRMVSVLAKHSNVKYIDLDFKESVELKRQVLEKSSTLSSYLKNDNYVLRSCDLRDV
                     PDTLELLNEECKPELPTLIISECVLCYMPEKETQSLIDGIIRLFKNGSWVSYDPMGGS
                     DKNDRFGVIMQQNLRDSRQLEMPTLLINNSPEIYASRWTPNSDEQFERVVTDMWTYYN
                     DKVPAEEKQRIKRLQFLDELEELKVMQSHYVIFFCKWNANPN"
     gene            <314696..>316759
                     /locus_tag="CAGL0F03223g"
                     /db_xref="GeneID:2887835"
     mRNA            <314696..>316759
                     /locus_tag="CAGL0F03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446110.1"
                     /db_xref="GeneID:2887835"
     CDS             314696..316759
                     /locus_tag="CAGL0F03223g"
                     /inference="similar to AA sequence:UniProtKB:P33329"
                     /note="similar to uniprot|P33329 Saccharomyces cerevisiae
                     YDR436w PPZ2 or uniprot|P26570 Saccharomyces cerevisiae
                     YML016c PPZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446110.1"
                     /db_xref="GeneID:2887835"
                     /db_xref="GOA:Q6FUI4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI4"
                     /translation="MGNTSSKTKTSIKKKGKKLSNVAVPPALSKSDTTQSTKSVRSQS
                     SRHSDVSRPTHSRKSSIHNFGASSEALNTEEPPLASTNDTRKGTENMSANNSISNNIG
                     GLSNSGGNNTEGNNYLTAGTSMNNARRASSSRRSSYNHGELPPSMIQIEPKPPILRNS
                     KTLSSANSFAYDENALTDDDENNNSISNNNDNSIVHTFGRDRNLSATEFQRTSSMSSS
                     SRMRRKSDNSGIDRGDTPIGKSSLHRTNSMASSLLSRKSSFGSNGNTEYSTPLHSPAA
                     VLDGNRGDYFGAQPGENNNLDTIGGNRDKLAELNNDKYRKSSMSSNQSGHSKLQIDAY
                     PSISSDVAIAEAQTEIGIDTKKKKPVKPIDIDETIQKLLDAGYAAKRTKNVCLKNSEI
                     AQICQKAREIFLAQPALLELSPSVKIVGDVHGQYGDLLRLFTKCGFPPMANYLFLGDY
                     VDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKT
                     FIDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDP
                     TDSPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVF
                     SAPNYCGEFDNWGAVMSVSEGLMCSFELLDPLDSAALKQVMKKGRQERKLAAQQQHQQ
                     QLQQD"
     gene            complement(<316924..>320034)
                     /locus_tag="CAGL0F03245g"
                     /db_xref="GeneID:2887705"
     mRNA            complement(<316924..>320034)
                     /locus_tag="CAGL0F03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446111.1"
                     /db_xref="GeneID:2887705"
     CDS             complement(316924..320034)
                     /locus_tag="CAGL0F03245g"
                     /inference="similar to AA sequence:UniProtKB:P32361"
                     /note="similar to uniprot|P32361 Saccharomyces cerevisiae
                     YHR079c IRE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446111.1"
                     /db_xref="GeneID:2887705"
                     /db_xref="GOA:Q6FUI3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006567"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR010513"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR018391"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI3"
                     /translation="MGKFWFWPKHDHDNSTFANQDAKDSEQINSSNSLLEEDFSHILT
                     YEGLEIDPTGAIVDYNIDINEVRRKSQLNTVETPKDTIKEYIPEEYVTNQSKVSHSRY
                     TIAQIILVTDVDGNIHSLNKNNGELQWTLPGSIFPPLIKVEADASLENEIFIIEPFDD
                     GNIYYADVSGGIQKLPINVKQLALSSPIHLRMNSRMGADNESKIDDRIYISSRRSVMY
                     KIDLLSGKILSKFGFESQHDNQSFYSMHEDDQESDLDNSSFNVLLTRTIYEIRTYTKE
                     GASYNITYSAWDENSIQSSNPQFQMLKSDTNKVDYIPLSDKSIVARNQLNGDMKWRTE
                     IPNIAIGVFEILRDTTNGEHIPIQYPLKDVDVPKPDDIKNQVYFNRVDGSSWYALSGT
                     NYPSLVGSASLINNEQDNNNYSVLGSISGVHTLQNPDYNVFYENNRGVLGLPAMSRNT
                     LLLDPPNSVVDSGLPSDLQPPYIDGSYNDEISEQEMRMQLNRLRNVSHGYYEELMSKL
                     SQIIVLSMLGVFALSTFIFIYSRVTGMPVKHMWWNIVNIFRANNNTITAKKVTEEGGQ
                     VEKRKRKRGARGGKKNKKSAFISNNDDELSNRVLQVSDKVLGYGSSGTVVYEGKFQER
                     SVAVKRMLVDFYDIASKEIELLSESDEHPNVVRYYCSEETSKFLYIALELCDSNLEQL
                     IETNNVMRHEQRLKDYELVDILAQITQGIAYLHSLNIIHRDIKPQNILISKSKKRLQK
                     PTTGNGNNKTRIMLSDFGLCKKLDFEQSSFKTNIKNAAGTVGWMAPELLIEDENSNKI
                     SVSQEIEKIDEVYDPYLRRRLTKAIDIFSLGCVFYYVLSGGSHPFGDKYTREFQIING
                     KKDFKGLKENMKDKSLVYEAVNILNQLLNHDPSNRPSAEVVLRHPFFWSKAKKLDFLL
                     KVSDRLEIETRDPPSELLTKLENRSRRIIPHHDWCKYLDPEFFENLMKYRKYQKEKVV
                     DLLRAIRNVYHHYNDLPEHIREKMGSIPNGFYDYFSEKYPHLLMEVHFLINKTIKNEN
                     LFEEFF"
     gene            complement(<321019..>321432)
                     /locus_tag="CAGL0F03261g"
                     /db_xref="GeneID:9487987"
     mRNA            complement(join(<321019..321214,321323..>321432))
                     /locus_tag="CAGL0F03261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999493.1"
                     /db_xref="GeneID:9487987"
     CDS             complement(join(321019..321214,321323..321432))
                     /locus_tag="CAGL0F03261g"
                     /inference="similar to AA sequence:UniProtKB:P89114"
                     /note="similar to uniprot|P89114 Saccharomyces cerevisiae
                     YHR079ca SAE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999539.1"
                     /db_xref="GeneID:9487987"
                     /db_xref="GOA:B4UMZ7"
                     /db_xref="InterPro:IPR010760"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ7"
                     /translation="MMTDIEGQIRELKAHLVELQLQRKYLDEKFIQLFKSAYQNSVDK
                     EPDMESPVKIIAKHIKSLKTYNELRDVGLKLAQCVADEKNVSIGQIFEEIGISMKDE"
     gene            complement(<321809..>325801)
                     /locus_tag="CAGL0F03267g"
                     /db_xref="GeneID:2887625"
     mRNA            complement(<321809..>325801)
                     /locus_tag="CAGL0F03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446112.1"
                     /db_xref="GeneID:2887625"
     CDS             complement(321809..325801)
                     /locus_tag="CAGL0F03267g"
                     /inference="similar to AA sequence:UniProtKB:Q06681"
                     /note="similar to uniprot|Q06681 Saccharomyces cerevisiae
                     YDR326c or uniprot|P38800 Saccharomyces cerevisiae
                     YHR080c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446112.1"
                     /db_xref="GeneID:2887625"
                     /db_xref="GOA:Q6FUI2"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI2"
                     /translation="MTGLTKLLHLDKKKQKRKSSASASASASPTSKPDVSPRKIHTPE
                     PVPHAHRPTVVLPDVSSLKSTPMHKTRSNSTYNSNGNNSHGLDPAEPGFLNIPIFMDI
                     TNVSDQETHAGDKAPSAAGDAKLVRPEIVTQLTSKQGSITPGHTDNQFFDTLVKMAHE
                     ASVSAGESATSALRNVTNNVAHLALPADAKDSHSQQNSRENSQVNLQEHHQQNQQESH
                     SKSDAHSKSDAHSHLSVASHETDDASKHSKRNSREFLKSLDNMLAENGQAAGAVPGNF
                     PNESRDLQRAVNEQDQKENVDAAVAPEVTEDGHRVAKVEPLREKELNNSPLANKSRQQ
                     TTDNGKSKSCFVEAMFNTPNIDPAAKAKEEHMKSHRAQTEVNRSTGDISIDSRGALRA
                     ATTSSPRRHSSSISSEKNNGHSNHSPHYHSPLHDSGAEIEQRHSIDVPSNAGGGDHRS
                     RSLSKTILGRRSFSPNSMGMNSLPSSAIRYSISKVKNAIDITDSSSGKPRSSFADSIK
                     SSSSTGTNPDGTRVDLDTESNQGPIKLKNMKYASDRKNKEFHSMFKNSNINPEEKLIS
                     EQSCALSRDILLQGKLFIAEEHLCFYSNILGWTSTVVIAYKDIDQIEKKTTAGIFHNA
                     IAIDTPDAKYLFASFLSRDSTFDLLTDIWNQIVIGMRLREKGNKGSMSDDSDSDYDDS
                     MSESELSDGEMDSTANNDQQTEQTELDSTPSGTIDKPKKSKSKTKSGSSSFGPEQHEP
                     TTADYQPASGEKMINKTIIKAPMGKVAHILFGDDTSYLVSILKAQKNYDISAIPKILE
                     TKKRDYQYTKPISGSIGPSKTKCIISETLETYDLDSSIKMVQMTKNPDVPSGNSFVVK
                     TTFLLNWAADNSTEFRVYVGVEWTGKSWIKGAIEKGTFDGVTDTTKTMVNEINKYLPK
                     LTSSNAEEESEPSEGEEEEVEEVIEILDLPHQGPLVHEATKANVEKTKDDVVIEQNVK
                     LPAPLGTCFELVFGKDTSYIKRITENQNNFDLSEIPGFSNNKREFTYTKRLNNSIGPK
                     QTKCLITETIEHMDINNYIMVKQVTKTPDVPSGNSFAVHSCIYMSWGPGNSTLLTVVS
                     KVVWSGKSFLKGAIEKGSIDGQKGSVSILIKELKDIISSAGTTKKKIKSKKSKKSKKA
                     PKATEPAPVVESPEEEATEETQESESSLVSSIMDKLMDFDITSPFGIASVLIILVIVI
                     LFFKAIFWRSSIEPRMQFMRPGRIIIDGSEYNYVPSFKTLYEMYEDDIRKSIKNKQYY
                     KNNIILESEKTIWDWVNDRGNESTHTNNAHASTYDKKKVEELEETIKLTELQLEQMKQ
                     LLKKQAHGLL"
     gene            <326515..>326964
                     /locus_tag="CAGL0F03289g"
                     /db_xref="GeneID:2887626"
     mRNA            <326515..>326964
                     /locus_tag="CAGL0F03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446113.1"
                     /db_xref="GeneID:2887626"
     CDS             326515..326964
                     /locus_tag="CAGL0F03289g"
                     /inference="similar to AA sequence:UniProtKB:P38801"
                     /note="similar to uniprot|P38801 Saccharomyces cerevisiae
                     YHR081w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446113.1"
                     /db_xref="GeneID:2887626"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI1"
                     /translation="MSEEIKSIRPYIKQLDKRLAELTELVQDYASPLEETLVKETDEL
                     KRLKTTNNYAYILASLMFSYVKLLSGHDTQHLNEKVMVELQRVRGYIERTKKLENKLK
                     NKVSEQELKQETVKSQIRKTLGQPTISKQNFKNKHIKFEESSKVSKK"
     gene            complement(<327599..>330736)
                     /locus_tag="CAGL0F03311g"
                     /db_xref="GeneID:2887698"
     mRNA            complement(<327599..>330736)
                     /locus_tag="CAGL0F03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446114.1"
                     /db_xref="GeneID:2887698"
     CDS             complement(327599..330736)
                     /locus_tag="CAGL0F03311g"
                     /inference="similar to AA sequence:UniProtKB:P38691"
                     /note="similar to uniprot|P38691 Saccharomyces cerevisiae
                     YHR082c KSP1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446114.1"
                     /db_xref="GeneID:2887698"
                     /db_xref="GOA:Q6FUI0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FUI0"
                     /translation="MSLDYEIYKEGGTLNDRYQKIEDLSEGSYGYVSLAKDLKLKRLV
                     AVKYIFKLDEDDDNNDCNDADNSRIEELPDGDINKNNEFENNKEKENSSREKKNMMKY
                     KKSLISSKIRSRLSNNICLEAMYEVDIQTKIGFHENIVQLYDFFDSYIIMEYCSGGDL
                     YEAIKDDLVPKKTKEITHILTQILDAIEFVHNKQIYHRDIKPENILITSLIDWKIKLT
                     DWGLATTDEKSYDRNVGSERYMPPELFESNLDIDERKEPYDCSKVDLWSIGIVFLNVV
                     FYKNPFRIADQSDKSFCYFASNREALFDVFSTMTYDFFQVLRYSLTIDPTNRDIQKIR
                     AELKNLSQYTLDDNYYNEELDREEEEEEVEDIFDKPQAPPSSAPVSLPTPVSSSKPLP
                     KLQDDFTFLQSSPTDVDDGISYDPHEENERDNQFQHDEKPDVIQPKVEDSHGEVKERA
                     KSVPKFRFQKRSKKPIKNNNNNFYSVGGSKAIKIEPRRRSKIIKNSRKPLGIPTPNTH
                     INNYMSEYESKRDEFFHTRQFFTPPSVQNRYMEGIFNKGYNNSRYQNKQGNGKHWNNK
                     YFSHHNGQHQNGKSNSRRRPSSAGINYNGNVKNVFPRFVHNSNLNPNSGRRSSVHTVQ
                     HSPGTYIPPNARHDIKNNATGHKYSTSHSAVSNGLPYSSHNNHVPDISTVLDSHHETA
                     KVDLGNLTAQAYRQHIGRETDHFNMRNGFEMDDHEHDSDDILFSLDENEHDSFVDDMQ
                     HLSLSSHTDHPEPDSHTSNGFIRNDLPPLTINGIMNSISTRTSTPSSTRSRRSNGGND
                     LPDLLKSPVLAETPLSSIHNGDPRPAINVNGNPLLENIKHPQHMRTYGVKIPSLETPS
                     KQSQERQFKPGVYVPPHQRRSFNLGAGTGMNNRAHIINGTNEATLSVTPNSVQYGGAY
                     KNRRGSLPASAFGGYNRRYTTGNSAHRPNILQHDIYDRMDNDALEFEDDEPPFQNRNH
                     HRRHNSKRKEVPDMSNTSNTPEEKTMFGPYDIYSKTNGQNYPNARKSSVLQEDMVGSL
                     EQYKNYWLMLQQQQD"
     gene            complement(<331850..>333100)
                     /locus_tag="CAGL0F03333g"
                     /db_xref="GeneID:2887578"
     mRNA            complement(<331850..>333100)
                     /locus_tag="CAGL0F03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446115.1"
                     /db_xref="GeneID:2887578"
     CDS             complement(331850..333100)
                     /locus_tag="CAGL0F03333g"
                     /inference="similar to AA sequence:UniProtKB:P53437"
                     /note="similar to uniprot|P53437 Saccharomyces cerevisiae
                     YMR270c RRN9 RNA polymerase I specific transcription
                     initiation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446115.1"
                     /db_xref="GeneID:2887578"
                     /db_xref="InterPro:IPR019622"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH9"
                     /translation="MFDTSDNSFVGDHTINSDFNETHISSEQDTQNDLYLGGQGTANG
                     LGDATENGDSDPTSKDKNPKLSKELKTIISNANSLLTSLEEEHRHDLAIHLYSSYLLR
                     KLLYQAHEKKHFQEVDIFIRTQIREGWASWPNPNTTIDPQLDRVYEDNFMAERRVDVS
                     DEMRNEIDAFDKKEYRKISDYSMKHARNMLRMELNSHWQHRLQQAACKTGKTLDVNSI
                     DIPTDISNEIMNKLDHFLAGLNTKIAKINKFDVKQSDSEKKLTLIQKDIGQLKSNRHI
                     EFDYHDIISRGCEMGIDMRNIYMKSLELYNDIPSKFDKSQFKIPKQILAKYKPAAADP
                     SKDKFNEIVSRMKDDYVLFDNLISDKRLTSTSKLPWKKLYKKEKDLLLAKKVFFYVKG
                     YQEEESSEDEYSAEDCIVKIPRRH"
     gene            complement(333388..333459)
                     /locus_tag="CAGL0F03355r"
                     /db_xref="GeneID:2887847"
     tRNA            complement(333388..333459)
                     /locus_tag="CAGL0F03355r"
                     /product="tRNA-Gln"
                     /note="tRNA Gln (CTG) cove score=69.19"
                     /db_xref="GeneID:2887847"
     gene            complement(<333955..>335097)
                     /locus_tag="CAGL0F03399g"
                     /db_xref="GeneID:2887589"
     mRNA            complement(<333955..>335097)
                     /locus_tag="CAGL0F03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446117.1"
                     /db_xref="GeneID:2887589"
     CDS             complement(333955..335097)
                     /locus_tag="CAGL0F03399g"
                     /note="highly similar to uniprot|Q03529 Saccharomyces
                     cerevisiae YMR272c SCS7 required for hydroxylation of
                     ceramide"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446117.1"
                     /db_xref="GeneID:2887589"
                     /db_xref="GOA:Q6FUH7"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="InterPro:IPR014430"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH7"
                     /translation="MSVAADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYL
                     KDHPEEADAVHKALDGKHGTDISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHK
                     VEVKLNADNTFDSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFT
                     KDFYLDQIHRPRHYGKGSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNN
                     PLALFLFGLGIFVWTLIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYR
                     LVVPPALFVVLCAPIYKLVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFM
                     RKLKKYHLEHHYKNYQLGFGVTSWFWDKVFGTYLGPDAPLSKMKYE"
     gene            complement(<336157..>338610)
                     /locus_tag="CAGL0F03421g"
                     /db_xref="GeneID:2887875"
     mRNA            complement(<336157..>338610)
                     /locus_tag="CAGL0F03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446118.1"
                     /db_xref="GeneID:2887875"
     CDS             complement(336157..338610)
                     /locus_tag="CAGL0F03421g"
                     /inference="similar to AA sequence:UniProtKB:P50111"
                     /note="similar to uniprot|P50111 Saccharomyces cerevisiae
                     YMR273c ZDS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446118.1"
                     /db_xref="GeneID:2887875"
                     /db_xref="GOA:Q6FUH6"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH6"
                     /translation="MGNQNSEVYIAAQSLDKELRSVKNLKRLSIGSMDLLMDPEMDML
                     PYNNGYRNSWSTQLEQGDKPLKSTRYSDPTHYNSKIVRQERLPFKQNQPQKSDKEQTQ
                     VENTKKQPGSPKSLTRRGAVNFSSRRPVDRSNHSKNSSKINDTLPDEVAQNLLWVRAD
                     QHPNVKPENYIELVQDALHNIQIDKTEEHDKENSDTLDKVSRYYNSNNKRSPNNTGLV
                     RRPSLLRKSYTEFDEVKDSDIKEQSSTNNNVDSTPHNKKFTLKDITEELTRISNKAGL
                     TNNDAVTLARTLSMASVAEEDETDDLQERPEAEDDYARQSRNNDDNYASTMLLPTDSL
                     IKSEHSTLKRSKYTYHIRTQEDKDPTIPVSTESQHQDVIEASPGSINDIYDHYREPSG
                     DWSSLIQVAPENENKKRTDTDIDSNTKIVQHSTEHVDLGSTGHSTSDKSDINKKEPAH
                     RKKRNGWLWSSKTSEKVNVTSDKHENEDIVPESRFNHSKNRHEPLYNHKIEIANTLGT
                     LPEKKNAIDKKISNIFRRKHHTRRANQENSLAGLKISQLQWRNNDHKEKAVEATNNTE
                     ENNGSEKVLAEAVEVRTHSSYTPQGNVHVKNEYQTNNVENTNVREIPTANNGIEKEII
                     PEVSKHQNHQQQKSTARPAHSSKFRITEKQTQGQDQGQDQGQAHGSDIGGVSLQPAVN
                     VTSTKNQEIVIQNVTVTATPSQREEATDSSKTASKKPLYPPRKLTFADVKKKDKANAP
                     IEFTDSAFGFPLPELTYSTVIMFDHRLPIHVERAIYRLSHLKLSNSKRALREQVLLSN
                     FMYSYLNLVNHTLYMEQKS"
     gene            complement(<339175..>340113)
                     /locus_tag="CAGL0F03443g"
                     /db_xref="GeneID:2887873"
     mRNA            complement(<339175..>340113)
                     /locus_tag="CAGL0F03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446119.1"
                     /db_xref="GeneID:2887873"
     CDS             complement(339175..340113)
                     /locus_tag="CAGL0F03443g"
                     /inference="similar to AA sequence:UniProtKB:Q03530"
                     /note="similar to uniprot|Q03530 Saccharomyces cerevisiae
                     YMR274c RCE1 modulator of RAS2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446119.1"
                     /db_xref="GeneID:2887873"
                     /db_xref="GOA:Q6FUH5"
                     /db_xref="InterPro:IPR003675"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH5"
                     /translation="MNWLVFCINIGISLSYVAVLYITSKGIENYPARRDDPRVIKRRL
                     KNVLMVSILNTAIVPLLHSIIVPQLSYKEAFLNIGIIPGYHQHGSSQIKLYIGTILKN
                     LCLVMLLYIGPLTDMVLYYISNKESSILSAFREEFMNIWGLRNYIFAPITEELFYTSL
                     LLNTYLTLEPRKPKLTTLLWQPSLFFSIAHIHHAYEATLVGNFSTTSIIINTLFQMAY
                     TGIFGAFTNFVFLRTGGNLWSCILLHSFCNVMGFPSGSELYEYFTVIKTPKSLKLQHL
                     LSIWNKVYYILLFMGILFFKDGLWRLTSCPEHNLIH"
     gene            complement(<340640..>343438)
                     /locus_tag="CAGL0F03465g"
                     /db_xref="GeneID:2887828"
     mRNA            complement(<340640..>343438)
                     /locus_tag="CAGL0F03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446120.1"
                     /db_xref="GeneID:2887828"
     CDS             complement(340640..343438)
                     /locus_tag="CAGL0F03465g"
                     /inference="similar to AA sequence:UniProtKB:P48524"
                     /note="similar to uniprot|P48524 Saccharomyces cerevisiae
                     YMR275c BUL1 or uniprot|Q03758 Saccharomyces cerevisiae
                     YML111w BUL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446120.1"
                     /db_xref="GeneID:2887828"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH4"
                     /translation="MSHIGTPTKSGSGIMERERGRKKQQSPALSSPSSWLRSASTSSI
                     RRLRREHPASGLNVSHTPLKNLSPVRRPASSSVERRPATVQPFSLTTPNSSASLSRMA
                     ASVPPNKPNLLKRNSESRVVDVLPSFEMYNTLHRHIPQGNVDPDRHDFPPTYQEIESQ
                     SSTFGRPNPAVNGDSSQVSYDIDRNQTLLADNDPIDSRALNNLQPLRTEHHNINSTLS
                     GVHSRSSVDLINPIQDDLNDAKCVFVDKLYTLPKLSTPVEISIKITKHAPSPNQKPEE
                     ESILKEYTSGDLVHGYCTIENKSSQPLQFEMFYVTLEAYTSVIDKQKGKRTLKRFLRM
                     VDLSASWSYSSIEVSSGIEIEYGGVDYDNSIIGLNNNRILEPGKKYKKFFMFKLPTQL
                     LDVTCKQEHYAHCLLPPSFGIDKYRNNCKYSVIKVNHVLGCGHLGTKGSPILTYDMVD
                     DHLSINYTIDARIVGKDQKTQKLNIMKEKEYNLRVIPFGFSSNLIGERKSMDQLNDLI
                     RLIQERLDALKKVFKRLSKNEAILPGDILGTDISGTIDPSTKLDSEEIINRKMEQLTV
                     KNRMEGAVSLPGFTPAYNPMAPRKKEEMVETEINYKLKNKSGSHLTKGLFSGFRAPSP
                     TTPPGTNDKAEKSGLILVRAAVPRKGLSYWSPSLLRKTNKFDVKSPDDQTNWLSLLEN
                     LPEEEREPLKQLDISLTCIQSDNSAAHSPPGIQSVTTDFICVTAKSDNSIPIRFTAEM
                     LMNSEKLQNLKSTFKTFQGTIKDYEKRFNENYMKLNELYNKENTSQTPRELKFTDFIT
                     NQINNDVDSLCNINVNCLVLNDVFKKQMHTLKSNAESSSANSSSPAISHSGSSSKLTK
                     FTEQIIHQWEQTGSSQYERNVTVNLEYNPELRETIVPSFESCLCCRFYCVRVTIKFDN
                     HVGSVNLDIPVSVRKIEA"
     gene            <343997..>344335
                     /locus_tag="CAGL0F03487g"
                     /db_xref="GeneID:2887651"
     mRNA            <343997..>344335
                     /locus_tag="CAGL0F03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446121.1"
                     /db_xref="GeneID:2887651"
     CDS             343997..344335
                     /locus_tag="CAGL0F03487g"
                     /inference="similar to AA sequence:UniProtKB:P46984"
                     /note="similar to uniprot|P46984 Saccharomyces cerevisiae
                     YJL184w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446121.1"
                     /db_xref="GeneID:2887651"
                     /db_xref="GOA:Q6FUH3"
                     /db_xref="InterPro:IPR014849"
                     /translation="MELCAEYVSPDQRRSFVAGPHGTTDGVTTGPSAYVLNAGQVDRD
                     RPAEARSVAGKVTYLGQLRNQLTGLQDDINEYLTLRMEAAKSKKLKTADEQRIEKEIN
                     TLLDGGDDEE"
     gene            <345084..>346856
                     /locus_tag="CAGL0F03531g"
                     /db_xref="GeneID:2887899"
     mRNA            <345084..>346856
                     /locus_tag="CAGL0F03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446123.1"
                     /db_xref="GeneID:2887899"
     CDS             345084..346856
                     /locus_tag="CAGL0F03531g"
                     /note="highly similar to uniprot|Q99257 Saccharomyces
                     cerevisiae YPL169c MEX67 factor for nuclear mRNA export"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446123.1"
                     /db_xref="GeneID:2887899"
                     /db_xref="GOA:Q6FUH1"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH1"
                     /translation="MMMAHNVNNINTMAQQQMNDNRVRVSVRGWQKGTVQDLLNFVSK
                     NTRISIQDANVEGPLLIGYVNTRDDANRLLKWNGARFAGSSLKFEILDQGGSTSNTVV
                     FLRSCLFKRYDAQNKMLNLSALHSDPELVSKGLFSSLSTQSKLFAAMLKLASKEPQLI
                     VESVNLSDNQFKDVTAVTTLAQTFPKLKNLCLANNQISKFRSLEIWKNKFRELRELLM
                     TNNPIVNENLYRTEMIRLFPKLVILDNVVVRDTAKLDSIYNLPVKIQQFFFESNDLGP
                     SSTDFVTNFLNVWDGDRSQLLGLYTPQSQFSISVDSTIPPTTVRDADTAPSFGHYLSQ
                     SRNICKLSSDKSIKQRLAMGPEAINELFKTIPKTKHHLQDRAHDYSMEALAFPALNGF
                     VITLHGFFEETGKPESDKKGNQTNSKHRRYNHGHSAPSSFKLGTKSFDRTWIIIPMNN
                     TVIVASDMLTIRAYSCGAWIPDEQITPPVNSNVGQTPPPVNNGQPPVISSVNATPLGV
                     HHMPQQPQQPIQLAPTLQLPPDVQMNMNNIQLELLNKLHLETKLNAEYTYMLAEQSGW
                     NYENAVKSFQSSVNNIPREAFVPF"
     gene            complement(<347237..>347695)
                     /locus_tag="CAGL0F03553g"
                     /db_xref="GeneID:2887764"
     mRNA            complement(<347237..>347695)
                     /locus_tag="CAGL0F03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446124.1"
                     /db_xref="GeneID:2887764"
     CDS             complement(347237..347695)
                     /locus_tag="CAGL0F03553g"
                     /note="highly similar to uniprot|Q12091 Saccharomyces
                     cerevisiae YPL170w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446124.1"
                     /db_xref="GeneID:2887764"
                     /db_xref="GOA:Q6FUH0"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:Q6FUH0"
                     /translation="MSFLKNLLFGGVKTSEDPTGITDSGSGNAKASQDVNEPIVEGRF
                     TPRTLSKFNGHDDEKIFIAIRGKVYDCTAGRQFYGPSGPYSNFAGHDASRGLALNSFE
                     MEVVPDWDKPMDDLKDLTPQQIDSLNEWEQHFANKYPVVGTLEAEPGVNV"
     gene            complement(<348058..>350325)
                     /locus_tag="CAGL0F03575g"
                     /db_xref="GeneID:2887938"
     mRNA            complement(<348058..>350325)
                     /locus_tag="CAGL0F03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446125.1"
                     /db_xref="GeneID:2887938"
     CDS             complement(348058..350325)
                     /locus_tag="CAGL0F03575g"
                     /inference="similar to AA sequence:UniProtKB:Q08693"
                     /note="similar to uniprot|Q08693 Saccharomyces cerevisiae
                     YOR256c and similar to uniprot|Q08919 Saccharomyces
                     cerevisiae YPL176c SSP134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446125.1"
                     /db_xref="GeneID:2887938"
                     /db_xref="GOA:Q6FUG9"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG9"
                     /translation="MVGTGRRDYSRLPGDDVEVGSISDGGREAMLPSEPPEYDNISPM
                     EFKDVEPFSVSFPNKMIQWRDAINMKVIWPVQENVMDPLVEYWRLLSSKVDLCLSKVG
                     NPLILSRFIYMLLMSLVAFMIWKSGLFPNNKARGENGKFSDHRILLDYARRSVDLSKL
                     EKDWEYLSSMPHSSGTRSDMALSEFIHDTFKNNGISLLEKYQYETLVNYPGSSYLSIK
                     VGEKVLNFELTEDNFNPLSPNGEVKDARLVDGGYGTLKELEDLKNGGNLHSNFVLLLK
                     YGNVVSEQVLAAQKYGASGILFVSNSWNDNNDIVEKRSVALPQYGLGNPLKPSWDRNP
                     ADPNSPQARPSIPSIPISNKQGNELLSLINDKSVSVTASLKVDAVIKEEQPIVDIIAK
                     INGNEQADRSIIIMASRNSIDNGAAYPNSGTASLLSLVQLMQELRYKFNWEPLRSIYF
                     ISIGGSEFNSAGAAELIKEKYQSIIDGVYSIIDISEFNVWDSSKELNIETHPLLFSLF
                     NEEEVKRGYNLDVHSVHHYGDWVPYLAAGVPVTVLTSKSLRTKSAPIFTKEDTYSAFK
                     DSFEKAAKEGIIHDNLLFLVNLVLQVGDKPLIPLDITEFAKYIFSSLKELNERYDNRL
                     DLMHVMSGMSSWMAIGKQWAEGVEAWKVVVIEHDGGFEPTLIYLDRTQWNIQVSNVAR
                     YLVSWEGVPGRAHYRNLFLGPELWTQLDDDEKSWVLPGLKDLLHNGQIDEANDHLKLI
                     GKVLNDAAVMFAHSS"
     gene            <350747..>352244
                     /locus_tag="CAGL0F03597g"
                     /db_xref="GeneID:2887616"
     mRNA            join(<350747..350763,350897..>352244)
                     /locus_tag="CAGL0F03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446126.1"
                     /db_xref="GeneID:2887616"
     CDS             join(350747..350763,350897..352244)
                     /locus_tag="CAGL0F03597g"
                     /note="highly similar to uniprot|P32363 Saccharomyces
                     cerevisiae YPL175w SPT14 N-acetylglucosaminyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446126.1"
                     /db_xref="GeneID:2887616"
                     /db_xref="GOA:Q6FUG8"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG8"
                     /translation="MGYNIAMVCDFFYPQLGGVEFHIYHLAQNLLRLGHSVVIITHAY
                     KDRAGIRYLTNGLKVYHVPFFVLYRETTFPTIFSTFPVVRNILIREQIQIVHSHGSVS
                     TFAHETILHANSMGLKTLFTDHSLYGFDSMGSILVNKLLTFHLTCIDRVICVSNTCKE
                     NMVMRTDIEPDRVYVIPNAVVSKDFRPRSPQEERLKSNDRITIVVISRLFPNKGADLL
                     VRIIPIICQEHSDVDFIVAGDGPKFIEVQQMIEKYRLESRVTLLGSVPHEKVRDVMCK
                     GDIYLHASLTEAFGTVLVEAASCGLLIVTTMVGGIPEVLPEHMTVFAENTSVSSLIDA
                     TMKGIQLIKNKSVDTKQIARDVSVMYDWMDVAKRTVSVYQGIFEDSSPTDKDWVKMVH
                     RYYKRDGSWAHLLYVLCCIVSYLMVNILDFCYPREDIDLAIKWPRPQLNDDDGHVEIT
                     KKGL"
     gene            complement(<352409..>354565)
                     /locus_tag="CAGL0F03619g"
                     /db_xref="GeneID:2887880"
     mRNA            complement(<352409..>354565)
                     /locus_tag="CAGL0F03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446127.1"
                     /db_xref="GeneID:2887880"
     CDS             complement(352409..354565)
                     /locus_tag="CAGL0F03619g"
                     /note="weakly similar to uniprot|P33420 Saccharomyces
                     cerevisiae YPL174c NIP80 component of the dynactin
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446127.1"
                     /db_xref="GeneID:2887880"
                     /db_xref="GOA:Q6FUG7"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG7"
                     /translation="MASIGDNVIVNGHSATVKFIGTTDFATGTWYGLELDQPFGKNNG
                     AVQGRQYFTTSKSDGNYGLFCRAHQLQLSATQSETHRLKNIIAVLEAKLSQYIEQVRD
                     REELQAVATKRGEQCRELQDIVEKLTLREQDSLDKTSQLSHQLQLLKVENDRLTKLLS
                     YYEQKYSLNAAESEHILSVFDVKEENRRLREEVDKLEKVIKSDNASKESLTRDNLNTS
                     DNDTTEIIDQSFESVSNEHIVTRLTIENTELIDLVDQQATEMDKLKRLQTLADEIEVE
                     SQKQITELKQELFNSHKHNSEIMEERDLLRQSVLTYEMELKGLKGNAVSDFNNNIIEL
                     MNTLYGESNIFDTCLTRLYATVYINRIKENTADDDYKAIVLVLILIKELCQIILLSNN
                     VDKVLVSQISDLRVPYRVYNALSSGQVIAFESLNFLMNRMMAISGRCESINLVNAIFK
                     TLKAFSDSIEDFDLKYQIDQDFDNLDLALEGQTSLSLSWKDVGMIFKEFDAYLARKCS
                     LPTITEKFLHMLITVNNSNSSKNTPITIMHNNSDFEEESQSSLGDSKDNSLKQRLLSM
                     EERLEKEQRETKKLLIRNKLLEQKYENINRLESEIKSSKIETRKYLDNISALEDRVTR
                     LQIEKQNLLKTVTAYKTQKYQLIPEKMDNNIITKSELLSVKHLEDLNIVINQSRTKKR
                     LLCDLTWLKEHNDEPIDKCSMKGYHEALNFVNSIVS"
     gene            complement(<354791..>356059)
                     /locus_tag="CAGL0F03641g"
                     /db_xref="GeneID:2887732"
     mRNA            complement(<354791..>356059)
                     /locus_tag="CAGL0F03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446128.1"
                     /db_xref="GeneID:2887732"
     CDS             complement(354791..356059)
                     /locus_tag="CAGL0F03641g"
                     /note="some similarities with uniprot|Q03730 Saccharomyces
                     cerevisiae YML018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446128.1"
                     /db_xref="GeneID:2887732"
                     /db_xref="GOA:Q6FUG6"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG6"
                     /translation="MPCPKREMCQTEGGGRVLRVVLLCCCAVVRRCLCVFIGVSLEPQ
                     RSISPREKVWWSPHLFIYNHRQISEIAITATIITTTSIITTTTTTIITTTITTITMSG
                     LAYLGVVVVSWVMSSFVTGRVMDVYQKPFLMTYINMSSLVLYLPLYFIWTPSHSPKDC
                     DEESCLMEKHTYGTILQEPATNNNGRLILLTFLFAILWFLANFFTNSSLAYTSVASQT
                     ILSSTSSFFTMAIGALVGIELFTGRKLLGLFSSFIGVYLVTMSDFQLPSASTGRSFIG
                     DGLALAGALVYGGYTTLFKSRERLVQKYNMNLVFGLIGLFTLCTCWPLYFVYNKYIQQ
                     EPLELPPTSAIYMLILFNCALSFISNFCWAKAVMTLKSPLVVTTGLTMSIPLAMLSDV
                     LFNSQPFSWRYLVGAFYIVQGFIIIDGFSK"
     gene            <356462..>357349
                     /locus_tag="CAGL0F03663g"
                     /db_xref="GeneID:2887735"
     mRNA            <356462..>357349
                     /locus_tag="CAGL0F03663g"
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /transcript_id="XM_446129.1"
                     /db_xref="GeneID:2887735"
     CDS             356462..357349
                     /locus_tag="CAGL0F03663g"
                     /inference="similar to AA sequence:UniProtKB:P36534"
                     /note="similar to uniprot|P36534 Saccharomyces cerevisiae
                     YPL173w MRPL40"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL40"
                     /protein_id="XP_446129.1"
                     /db_xref="GeneID:2887735"
                     /db_xref="GOA:Q6FUG5"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG5"
                     /translation="MPRYDHLSKAGSRFLKHLENVPKRGQRRAEQFMNKALPEFVRPN
                     NRTVPEEQRFADETHWKFVPGDRVVITHGKYKGTVAVIKDLEVATNSFILDGNGPSRK
                     VPVAKQYWLENQSTHMLSLPVSLKRKHLKLLADIDDPANPGQTKTVAVKDVTFDAGTY
                     YDKDRKKVMPYRCVVGRPDLVVPWPTPEPKPDGVLGTEPKLARQQTFWVDTIVRNSIP
                     KNAFLTLRNPHSKYKKKLLTAKDIAKLVAPKMPLSDTKKKFLEEKEMLAKREKPQLTE
                     ADIELIGSRVKEFLETAKQ"
     gene            complement(<357731..>359086)
                     /locus_tag="CAGL0F03685g"
                     /db_xref="GeneID:2887706"
     mRNA            complement(<357731..>359086)
                     /locus_tag="CAGL0F03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446130.1"
                     /db_xref="GeneID:2887706"
     CDS             complement(357731..359086)
                     /locus_tag="CAGL0F03685g"
                     /inference="similar to AA sequence:UniProtKB:P21592"
                     /note="similar to uniprot|P21592 Saccharomyces cerevisiae
                     YPL172c COX10 farnesyl transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446130.1"
                     /db_xref="GeneID:2887706"
                     /db_xref="GOA:Q6FUG4"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006369"
                     /db_xref="InterPro:IPR016315"
                     /translation="MLVRTLYISSSVGSSNMLCNHGLKVIGKYSAIHEATRKIIVRSY
                     SKETIKKHNKQAILNTAPIEFIANNSPLVGISDVNTIKEAAKRTLRCTDDVTDDQTDE
                     IHPHLPFNVKPVDGKARAALKKEKNSMSLDIKKTMEAYVQLTKPRLTILVMLSAICSY
                     ALSPYPATVTELLCLTVGTTMCSGAANAINMGREPDYDRQMIRTQARPVVRGAVTPKQ
                     AFSFAFGMGTLGTSILYLGVNPTVAALGLSNIALYSWIYTSLKRKHIINTWVGALVGA
                     IPPLMGWAAASPLTHPGSWCLAGLLYAWQFPHFNTLSHNIRNEYKNAGYVMTAWKNPL
                     LNARVALRYSLLMFPLCFGLSYFNITDWYYQIDSGLVNAWLCLWSFKFYMQQRLNYSS
                     KIKNDRVKFNEGLATANVYARKAFFASVLHLPAVLILAILHKKNRWDWLFEDSENPKL
                     K"
     gene            complement(<359839..>361665)
                     /locus_tag="CAGL0F03707g"
                     /db_xref="GeneID:2887771"
     mRNA            complement(<359839..>361665)
                     /locus_tag="CAGL0F03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446131.1"
                     /db_xref="GeneID:2887771"
     CDS             complement(359839..361665)
                     /locus_tag="CAGL0F03707g"
                     /inference="similar to AA sequence:UniProtKB:Q08732"
                     /note="similar to uniprot|Q08732 Saccharomyces cerevisiae
                     YOR267c HRK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446131.1"
                     /db_xref="GeneID:2887771"
                     /db_xref="GOA:Q6FUG3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG3"
                     /translation="MPNILTRNPFHHHHNHNHSGSNIDNYANGVNGSTQDANDTSSMF
                     SEATGTASTIDNDNGKRRKPFLNFMNVGSSNVGQTTSNDSDTQSSVLELKRFLRPSLL
                     HNDTNRSGFFSGSKKKEIKRPMSPGSPVSPPKHDYIHNDTRNAIHTQTAIPPSTDSVL
                     SLANTSSIYQDDTILAQKYGKLGKTLGSGAGGSVKILKRPTDGATFAVKEFRPKKPTE
                     TSKQYAKKCIAEFTIGSTLHHVNVIETMDIFSDAKKQRYFEVMEYCPVDFFAVVMSGK
                     MSRGEVNCCLKQLACGVKYLHSMGLAHRDLKLDNCVMTENGILKLIDFGSAVVFRYPF
                     EQEVTLASGIVGSDPYLAPEVLGKISRADGDESEEPHQTIKIDKKTGLSLYDPQAVDV
                     WSIGIIFSCMMLKRFPWKAPKESDPNFKLYNMPEDEEHDYDESAKRHERLMRERRERR
                     AAADANDNNDKATPPERKNTDQDINANKESDVESVSKKADQNEVKQKDSHEQQPITKN
                     ESNSKKEEAGEAKHTSPSKRVIHGQYRLLRLLPHASRPIMSRMMKVNPAERATMDDIF
                     NDEWFKSIPMCTIKEGQKVLRAHGHHHTVVKDNDGRTETYKV"
     gene            complement(<362972..>364057)
                     /locus_tag="CAGL0F03729g"
                     /db_xref="GeneID:2887629"
     mRNA            complement(<362972..>364057)
                     /locus_tag="CAGL0F03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446132.1"
                     /db_xref="GeneID:2887629"
     CDS             complement(362972..364057)
                     /locus_tag="CAGL0F03729g"
                     /inference="similar to AA sequence:UniProtKB:P25303"
                     /note="similar to uniprot|P25303 Saccharomyces cerevisiae
                     YMR214w SCJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446132.1"
                     /db_xref="GeneID:2887629"
                     /db_xref="GOA:Q6FUG2"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FUG2"
                     /translation="MKLWICLVFFALIQHVLSQDYYAILGLSKDASDKEIKSAYRQLS
                     KKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTYDVHGADAFKNGGQGQRGGGFH
                     DPFDMFEQMFGRQGGGFRQTQRSQNYQVRNQVSLKEFYSGGEVEFEIPLNDICDSCHG
                     SGSADGKVKVCPACQGRGVVVQVIRMGPITQQIQQQCGQCGGKGKTIENPCKTCKGHK
                     VVRKNKPFHFEFPGGIPRNHIDKKSGESDKSPDMESGDIIIEYNESEKENLGYRRRGN
                     NLYRTEIITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMG
                     SKNFGDLYIDYVVLVPKSQTSPIDDEL"
     gene            complement(<364329..>365954)
                     /locus_tag="CAGL0F03751g"
                     /db_xref="GeneID:2887738"
     mRNA            complement(<364329..>365954)
                     /locus_tag="CAGL0F03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446133.1"
                     /db_xref="GeneID:2887738"
     CDS             complement(364329..365954)
                     /locus_tag="CAGL0F03751g"
                     /inference="similar to AA sequence:UniProtKB:Q03654"
                     /note="similar to uniprot|Q03654 Saccharomyces cerevisiae
                     YMR213w CEF1 required during G2/M transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446133.1"
                     /db_xref="GeneID:2887738"
                     /db_xref="GOA:Q6FUG1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /translation="MAPPIYVRGGLWTNIEDQILKAAVQKYGVHQWSKIASLLQKKNA
                     RQCEIRWNEYLNPTLNFEEFTKEEDKKLLELVRTLPNQWRTISELMGRPSQQCIERYN
                     ILLETELSKTDGEATTSANSAISTSFGFKPNEIHPSAETQKAKPDNDELDEDEREMLS
                     EARARLLNTQGKKATRKVRERMLEESKRIAQIQKRRELKQAGINTSLKKSKKKYENEI
                     DYNADVVYEIVPPAVLYDVTRENERTQKALQDFERNIAKKGKRKFKDDGEKESSPRKR
                     SRDKRPNKEDNKETSMSITSNDSVLLNDMKKPVLNLSAPRADGENLSVSSNNTNDAVL
                     VKKYLTECFSALPTPKNDFEILWEDSDDDDEQEIVSEEDDNSIKVQESEQLYELPMET
                     FDIVDSSMIPSIIADPKNEFEEEYNKLIKDARTRAKPTISKEHLQIWDDLNEEIQKDI
                     SGRTSLTNPEVQISTDTNLDELRAQIQKYQQRISNYDEQLHIIKPLVENNEQICNTII
                     RSLIPELKSKQLKYYTRYYMFMKEQKHIKKRTK"
     gene            <366503..>368752
                     /locus_tag="CAGL0F03773g"
                     /db_xref="GeneID:2887797"
     mRNA            <366503..>368752
                     /locus_tag="CAGL0F03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446134.1"
                     /db_xref="GeneID:2887797"
     CDS             366503..368752
                     /locus_tag="CAGL0F03773g"
                     /inference="similar to AA sequence:UniProtKB:Q03653"
                     /note="similar to uniprot|Q03653 Saccharomyces cerevisiae
                     YMR212c EFR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446134.1"
                     /db_xref="GeneID:2887797"
                     /db_xref="GOA:Q6FUG0"
                     /translation="MQLGHIFTPKHQKLVNQCYPSGRAPDKKPKSSETSYLIYYVNSR
                     SSKLEKVSNYLIKRTNTDLSRRRVGNVCVTLELMAKIVDHCKENLNVFVKEFLTLMNM
                     VLTNNSINNDVTVIELLEITFGTICRNLDGAYYGGDTEFIKMFKSFVDLLFEVVSKRL
                     NNDDLMLKVCIDISTIIGIASDPQLNYLVPKCVETAIDQLQARYPQFKENSLLEQPSL
                     TKRLSKTQTRAQEVLEIPTADNDLCVATLHNYFNTTETDKLNLSIRSLIKKLQSTPNK
                     ELLEFISNDIPVQLRYIVVLLLTRQVSNYERNQVSGSQGNPDGALNSLKLISCLLVSK
                     ISIVGLSVLDIMRKVLAVQLKSKESMPLVHQCRVTIKDLNNKIYYSEQTSDMLYDLVV
                     KIKNVQNEVEKRILVDDMKYIVDDISQPVINVDLLTELVPFMKGSVIQLLNITEEHIS
                     GGSTLSRLFQMVRDIEDRNLQSKAMSIIFDKYKKIILLPGLNYFQMNIKEPEYTYYLY
                     HFNAAKTLGVTSYYSETQQKLDNGELFTKEELMKYYKNANNTQFGEKGMQILMSYDNQ
                     ISNSDLLNDRPLSPVFSSKPLSSPMGLISPQAQTNTQLNQPMRFVSDDVHSWKVSRPS
                     IPKVSDLKKAMKNGSSTKNKPLRGSQSVKSRVTNITFLLSELRSTTAGDDSHIIDPDE
                     EEVVGIDKMEIARSLSGRGRNSVVVEDVSTNRASFVPATVNEDDEFRDAVEDVEAYST
                     SRGKIFANY"
     gene            complement(<368904..>370358)
                     /locus_tag="CAGL0F03795g"
                     /db_xref="GeneID:2887746"
     mRNA            complement(<368904..>370358)
                     /locus_tag="CAGL0F03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446135.1"
                     /db_xref="GeneID:2887746"
     CDS             complement(368904..370358)
                     /locus_tag="CAGL0F03795g"
                     /inference="similar to AA sequence:UniProtKB:Q03652"
                     /note="similar to uniprot|Q03652 Saccharomyces cerevisiae
                     YMR211w DML1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446135.1"
                     /db_xref="GeneID:2887746"
                     /db_xref="GOA:Q6FUF9"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR019605"
                     /db_xref="InterPro:IPR029209"
                     /translation="MHEVITISVSQRANHLATQFFNCRETLLYDNTKDKVNDPKIFLN
                     PTIDRISKTVSYSPRALLWDAKTGNGSLGSYQYSDGSDYYFKNDDDKPSDGDLMQTHP
                     VIPKSDYQRALDAGLPEPKLNNSNTKYWSDYARLIYQPSSFNILRDWYHDTDNPNRPD
                     FKSLKDRRFDKFIIGEEEFKSNYLVDFFDTNLHHELEQCDTLQGFNIITDIDNGWGGF
                     SSALLVELRNELPKNTYFSWAFHESDPYTVSYTRNTKVQFNKKTAEQISNKIRATTSL
                     SQESDLFIPVYSDPEYSNWEIGSLVCPLFDGLNSVLDGTDTEKRRNMQYLSELLQNGD
                     NNRKIISSANMIRKDRIIDYLYYSRFPTQSRKSSSAVSEFHVFSKCNISRSNKEMKDN
                     AEIKNVTNKQINTYGYKFADTVSDQFKEDSNYKLCLTSDERCRNVFKEYGDFVSKYIK
                     YDDDREDMKNSLENTASAYEFGWYDDSDSGDDNY"
     gene            complement(<370647..>371978)
                     /locus_tag="CAGL0F03817g"
                     /db_xref="GeneID:2887876"
     mRNA            complement(<370647..>371978)
                     /locus_tag="CAGL0F03817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446136.1"
                     /db_xref="GeneID:2887876"
     CDS             complement(370647..371978)
                     /locus_tag="CAGL0F03817g"
                     /inference="similar to AA sequence:UniProtKB:Q03649"
                     /note="similar to uniprot|Q03649 Saccharomyces cerevisiae
                     YMR210w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446136.1"
                     /db_xref="GeneID:2887876"
                     /db_xref="GOA:Q6FUF8"
                     /db_xref="InterPro:IPR000952"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF8"
                     /translation="MVGYYWLNSLEVTQVTPDHAAKINVGGSSTTIPEFIDKNIPELA
                     NGATDTLSPLLFNGHLQTAYTALASFESIDQVNYKRIMLKYPDGGVGALDFAMKEPDN
                     KTEYVPEGQTPLDALNSHMPGRFYTYMDPNDARLRSNDSKPLLIALHGLTGGSHESYV
                     RSMVRTLQNKYDFEACVLNSRGCCNSAITTAQLYNGGWTNDIRHCVKELREMYPNRKF
                     YMIGFSLGASILTNYLGEQGDKSDIELAIAFGTPFDLSHSAKCISESRIGSRVYSPKL
                     TQNLLRLVKSHEEELTKNEKFRIKYESYAANLKSVTRFDDLFTGPMFGYRDAEDYYQN
                     SSSYKRLLGIRTPYIAINSADDPIVGYQALHENMFRANPYTTLIRTSIGGHIAWFKDM
                     KGDRWYTEPACKLIADYHSKIVSQDHAINVNINDLPKESIEPVKTTYRDDL"
     gene            <372239..>373561
                     /locus_tag="CAGL0F03839g"
                     /db_xref="GeneID:2887890"
     mRNA            <372239..>373561
                     /locus_tag="CAGL0F03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446137.1"
                     /db_xref="GeneID:2887890"
     CDS             372239..373561
                     /locus_tag="CAGL0F03839g"
                     /inference="similar to AA sequence:UniProtKB:Q03648"
                     /note="similar to uniprot|Q03648 Saccharomyces cerevisiae
                     YMR209c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446137.1"
                     /db_xref="GeneID:2887890"
                     /db_xref="GOA:Q6FUF7"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR016853"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF7"
                     /translation="MGDGTATIVVTIAVICMSLLRRYKPFREWVAKAAERSLRVIKNK
                     DELYLTTPELTLHKSRPSASARPFEEYVNALESMKGYLKSSQKITSMVNNRAKELSRK
                     ELSQLKDIGYFSKLDYITSATIKNSAVIEDIIKCTLKELALKNHNNVDLKADLELACN
                     KLGYKLDSEGNISKLNTIKLLSSATSRSNSVTESLNHLCRDWSDYYKCERDPLTEYII
                     ERINSINIKGKDILIVVPGSGVGNIAYNLSQKFPEAKVDSIELSSYMFICNRYALTSS
                     NDISISPFALYYSGQTSAKNQTRELNVNLSNVSERENLYPYWADFRLYPSTLEKKYDY
                     IIVCTAYFIDTAENLFEYFNSIENLSEHCNKDLHWINIGPLKYGTRPKVQLTVEELTK
                     LRKLRNWKDLHTQTVLDYDEKLNGYLTDYEGLYQGYYGLTKFHTVCRK"
     gene            complement(<373691..>374983)
                     /locus_tag="CAGL0F03861g"
                     /db_xref="GeneID:2887740"
     mRNA            complement(<373691..>374983)
                     /locus_tag="CAGL0F03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446138.1"
                     /db_xref="GeneID:2887740"
     CDS             complement(373691..374983)
                     /locus_tag="CAGL0F03861g"
                     /inference="similar to AA sequence:UniProtKB:P07277"
                     /note="similar to uniprot|P07277 Saccharomyces cerevisiae
                     YMR208w ERG12 mevalonate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446138.1"
                     /db_xref="GeneID:2887740"
                     /db_xref="GOA:Q6FUF6"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF6"
                     /translation="MTVERDLPFLVSAPGKVILFGEHSAVYNEPAVAASVSSLRTYLL
                     VSPAGSNAEDSIELSFPDIGFDHVWKRKELEPVLRETALLQAAREDTKNLNEELVGLL
                     NVILEPLKESLHYHAAFCFLYLFCTLCPSATNIKFSVKSTLPIGAGLGSSAAISVSLA
                     MAMLRLGGKLVTGESLSGEDKALINEWAFIGEKCIHGTPSGIDNAVATYGNAVLFKRS
                     ADGTTDFEFLDKFHELKIPMVLTYTRIPRSTKVLVSSVRDLSNKYPKVIQDHVIKAMG
                     ELALESVDILNSGIGGNDSNYERLLDLVNINHGLLVAIGVSHPGLEIIRNLSITNSIG
                     ATKLTGAGGGGCAFTVLNKDVPQTEVDKFKEELSKKHGYLSFTSELGGAGSCMTPTLV
                     AEQYNLVAPLFENTENNKEELDKTLLPATATNSLFWIH"
     gene            <375906..>377477
                     /locus_tag="CAGL0F03883g"
                     /db_xref="GeneID:2887679"
     mRNA            <375906..>377477
                     /locus_tag="CAGL0F03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446139.1"
                     /db_xref="GeneID:2887679"
     CDS             375906..377477
                     /locus_tag="CAGL0F03883g"
                     /inference="similar to AA sequence:UniProtKB:Q03655"
                     /note="similar to uniprot|Q03655 Saccharomyces cerevisiae
                     YMR215w GAS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446139.1"
                     /db_xref="GeneID:2887679"
                     /db_xref="GOA:Q6FUF5"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF5"
                     /translation="MKLSAALLLLAAGQTVNALLPIHIKDYRFIKPASPNSTESENEV
                     FYVKGIDYQPGGSSGYDPDSDSDVLSDPEQCARDAFVFQQLGINTIRVYTLNPDINHD
                     KCMTILNNAGIYVILDVNGPHYGENLNRADPVGTYNAWYMSRVFRFIDAFKNYPNVLG
                     FFAGNEIINDESNYAEIDPQFIRAIQRDMKEYIAKHSNRTIPVGYSAADNVDLRLPTL
                     NYLQCNSLTGGNITKTMQESRSDFFGLNTYEWCSGSSDWKSSGFDKLNSSFSDAVIPV
                     IFSEYGCNKNKPRTFDEVSEGLYGGLKAVFSGGLVYEYSEEANEYGLVTIDPEDGSIT
                     FKEDFENLKNQLKNSSLPTIKEKDVPKSEIFKCNASLITSEFSDFGVKNFSIPEQSKD
                     TAYVIKWGANGTEGQILKNYTAPTTFKYEIKNVDGSVIPATITYPSSNLINELQTSST
                     MSVSSTSSASVTSSAKSSSVSSSTKKGKSSKSKASKSTSSGNKKARNGAEMISTPGFG
                     TGFAAAVAAAVAALL"
     gene            complement(<377962..>380088)
                     /locus_tag="CAGL0F03905g"
                     /db_xref="GeneID:2887770"
     mRNA            complement(<377962..>380088)
                     /locus_tag="CAGL0F03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446140.1"
                     /db_xref="GeneID:2887770"
     CDS             complement(377962..380088)
                     /locus_tag="CAGL0F03905g"
                     /inference="similar to AA sequence:UniProtKB:Q03656"
                     /note="similar to uniprot|Q03656 Saccharomyces cerevisiae
                     YMR216c SKY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446140.1"
                     /db_xref="GeneID:2887770"
                     /db_xref="GOA:Q6FUF4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF4"
                     /translation="MDSDKGFFHREKVTRSNGKKSNLSLAIQESESRQISGSDAEEAK
                     LVPVPGGMMDLSGSSMKSGHSGGASSGADIDLQDVINNGSLNSAINNNGNSSNSNDNG
                     VCGSTFPTVTARMYNDGGNGEDEDDDDCSSCDERNEESLKDYKPGGYHPAYKGEHYKE
                     GRYVLVRKLGWGHFSTVWLAKDVTTGSHVAMKIVRSDKVYTEAAEDEIKLLQKLTDGQ
                     DDQLGAKYTLNLLDNFVHTGPNGRHVVMTFEVLGENLLALIKKYEHRGIPLVYVKQIS
                     KQILLGLDYMHRKCGVIHTDIKPENVLMEIGDVEAIVKMVELLDEQKKNLKRLQRSGS
                     VLDHNQSFEFQRTIGHGANHSQTGMNDYTRSNEGTPLQRIPSRKPRRNTIITGSQPLP
                     SPISSSNFNDMKTQLLGTSISNTMLTTNITSTQYPISNTPQRGSSINIHQGPIASSLQ
                     SSISNRSIKNNLMSHMSESSTSIANDLNGQQQQLAHSLSSFEISNIDETQDMDGNDTN
                     IIQVKIADLGNACWYDEHYTNSIQTREYRSPEVLLGAPWGCSADIWSTGCLIFELITG
                     DFLFEPNEGHSYTKDDDHIAQIIELLGDFPSYLLNNGRYTRTFFNSRGQLRNISKLKF
                     WPLKDVLREKYKFDKEEAQEIADFLLPMLTLDPRKRCDAGGLANHPWLNDTLGMENVS
                     VPERKLYGNGSDIPGWYNEVPSHQRH"
     gene            <380625..>382202
                     /locus_tag="CAGL0F03927g"
                     /db_xref="GeneID:2887636"
     mRNA            <380625..>382202
                     /locus_tag="CAGL0F03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446141.1"
                     /db_xref="GeneID:2887636"
     CDS             380625..382202
                     /locus_tag="CAGL0F03927g"
                     /note="highly similar to uniprot|P38625 Saccharomyces
                     cerevisiae YMR217w GUA1 GMP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446141.1"
                     /db_xref="GeneID:2887636"
                     /db_xref="GOA:Q6FUF3"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /translation="MSSIEQVNEVFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCT
                     QKIADLHFKPKGVIMSGGPYSVYAEDAPHVDHAIFDLGVPILGICYGMQELAWINGKQ
                     VARGEKREYGPATLNVLDKEDALFKNVDHSTVWMSHGDKLHGLPTGFKVIATSDNSPY
                     CGIVHESKQIYGIQFHPEVTHSSNGKTLLKNFAVDLCHAKQNWTMKNFIGTEVQRIRD
                     LVGPTAEVIGAVSGGVDSTVASKLMTEAIGDRFHAILVDNGVLRLNEAATVKKTLVDG
                     LGINLTVVDAADEFLDNLKGVTDPEKKRKIIGNTFIHVFEREAEKIKPKDGKAIEFLL
                     QGTLYPDVIESISFKGPSQTIKTHHNVGGLLENMKLKLIEPLRELFKDEVRELGELLG
                     ISHELVWRHPFPGPGIAIRVLGEVTREQVEIARKADHIYIEEIRKAGLYDKISQAFAC
                     LLPVKSVGVMGDQRTYEQVIALRAIETTDFMTADWYPFEHSFLRKVASRIVNEVDGVA
                     RVTYDITSKPPATVEWE"
     gene            complement(<382447..>385737)
                     /locus_tag="CAGL0F03949g"
                     /db_xref="GeneID:2887767"
     mRNA            complement(<382447..>385737)
                     /locus_tag="CAGL0F03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446142.1"
                     /db_xref="GeneID:2887767"
     CDS             complement(382447..385737)
                     /locus_tag="CAGL0F03949g"
                     /inference="similar to AA sequence:UniProtKB:Q03660"
                     /note="similar to uniprot|Q03660 Saccharomyces cerevisiae
                     YMR218c TRS130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446142.1"
                     /db_xref="GeneID:2887767"
                     /db_xref="InterPro:IPR022233"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF2"
                     /translation="MSVESVEMEHWPVCLSYFDPFDVFGAVQSEFSSIFPLDVVRWKT
                     NDGSVRTIENLPVKLTVEDDQQQSNIKFEEPYIRLIVVTCISVDEYRTKVRPLLHQWL
                     PTVHDSSGPFTMPLILLYANSEVTDTSIFKTMSVMDKLNKDFPDVQALELKSVYKSPA
                     EKTEFWLKLSNKLKAFLIEVFQHRIRILESKLTRQFTENEELEIREQLFKIYAEFRRT
                     EDAKGQLSMIKNLMDKRIKNVETGKLEVPFEMSLSGKESTKQLLSAKNLTKFTLYRSN
                     FLRELMLLQLYDDDISKYTQIYELTKDFIRKIEKEFAADTRLLEFKFDFCKKMLDTIP
                     STSRSEWLPTINEIKADIYLIKRDAWIHGLMINHGYQLLQKNYSNKTLYSFGLDKEAA
                     ESEDAFQKSFALQTKELLALYSQCNGKRQRMADILSLEVGLLHYQRKEYTKAVQLLMS
                     CNEYYTESKWTVIGVNILEIFVDSLTNCVGIETIDFDGESVPVSTILRNSYLNLIKYY
                     NSTSEKKIFWNKFLELKNDDMTELVYPSEDLIDFSVDGNVFLHAPNVYGINVEIKGNG
                     FPDVIDVTQFKITMKNSNNEFNEFIERDFLLEMESKSYCLKSKNITFGEFGIESIELC
                     IGSTTIIKAFEDTTNKVIIEPLFHENNVWFEIRESNELKLGKYELEIADFNFGHTNDL
                     ELYLEVGKSEVTQINPVSFDSEIDQATITLDKESLSESKKIKYFFNEQQEQFTLFAKL
                     TYSLQKNPDVIYSISRVIHIDHYLPLSVSVEDIFKKDKFFFKFLLNSSVKEEPVLIFG
                     SELQCFELEHSYELSGPFIPDSPLTITGTGGESCINCFQISTKQTFNNSDIFHLMIKY
                     CTLRDFLKSYVTDAVLLEGDVEFFQKYETWKLYWLSNILSELEFDYNLYEKNMILKLN
                     GQSLDIFKVGVRLKYMKVDPVVRSKFLSCLKRLSEGIDLTEMEINEYMKVFNVKTLTV
                     PVQLPELERFYEVSFARQDCKRHQTPNKVGEPLAFHIKIKNSSDKWGIQRHDKLAYTF
                     EIINNNDWLVHGRKRMILKDDFEEMDIDLIPLRKGYLTLPQIEITSSVGNPVRVDNSN
                     TYDIVLVF"
     gene            <386224..>390591
                     /locus_tag="CAGL0F03971g"
                     /db_xref="GeneID:2887924"
     mRNA            <386224..>390591
                     /locus_tag="CAGL0F03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446143.1"
                     /db_xref="GeneID:2887924"
     CDS             386224..390591
                     /locus_tag="CAGL0F03971g"
                     /note="weakly similar to uniprot|Q03661 Saccharomyces
                     cerevisiae YMR219w ESC1 Establishes Silent Chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446143.1"
                     /db_xref="GeneID:2887924"
                     /db_xref="GOA:Q6FUF1"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF1"
                     /translation="MGDQEEERVPDAGSPSRKLELKVPSRGLGSRMRPLSGTKLRTRH
                     VSGRALFGGRYNETPVLNISTLDDHRKSLQYIKSLISKGRQILKSASEDDKKAFTEIR
                     EFQRRETIRNKIVDKILTTDYDTLTRTTNTENHVAFDSSDVVIPDENDSQNLLEDDGE
                     QGNINDGRSGSESEMEMGYHSEDCDDYEGVINDVEGDAPIKKLETQASNESIVILTDD
                     ESVVNESFEYAEDIQSTEFQSDTDQKKLPSDYEAQSNDGHQHVNNEDNDHNMYDDLFE
                     EEGPSFGSNDNRALKVNSERLLEYEDSKHLTDILHDPLSYHFHTENHTDIQNEDDHDN
                     QDISEENMSVSDNGDSDTSQNNIDFKQYMQPRNKSLLNDNVHSSSEQEFDHPSDKYSN
                     VELIIDSEDGSDQHVADKFDSDIDDNHEYGELVSDNSNSESATEDDNRIENMEYIDQN
                     RAYSDLEDGKDFPMASDHQYRTEAIDYEKMSQKEDELKQFLHEMADFQSIANDALNEI
                     QASNNGERIELTKTDEIDSDRNSSNSTNDEDSDNDQTQYHSFIHEYNINSQSASNHTK
                     ENLLNYKEAKNTSNITVNEELGEENEHKDDIEQDNSTITDNVNTESSFNSDDKKEKDK
                     KLVALLIHDSEYSSSSEDELNESENPIVYTSAFSTNPFTLETDSIRDLDFSKYIQSDS
                     GNESNAGDSTEGLKIQKPQVYTEFDRTHLFNHNSETASDQSHSQTKCISQEEGNVSHI
                     EHSSSIGNTENLLKYSPLYDNSINSGLQIKEDNHSGQDLDLNVEVGVEEESIPENSEL
                     HTTSIPEMSSKHFNMANELEILNDTELAKQNKPYMSLSPQPLEESNQQEISRSIHIED
                     FSSLKTSERGQLSANLEINIDSNSPSPVIDQKLDLEGSRSGSNSDIEDNTKFEEVPET
                     QRVENEIDSRYKNSINSDSGVEDFRSISVLSNMELPNNLEDNITSKDTLVIEEFNKSD
                     LFLEKETSNSGDNIKLDTVDEKTVSSTNSLKRKREDPDFIMSNEYHDRSPLKLRKLSS
                     TSSSFFSTVKSVFSVAKLFFKKMELEELIDITDNTTADEIMTPDQYQTESEVENYLSS
                     DKESRTTSNNDMIKSSDDSINNDLNSTDIPSSIEHTEDNKENGNNNVILKQLQILERL
                     SNGISGQYDSIDIDDTQLDDIEEEPDLIESDSSIEIPLNPSKLYNLESDTNVVLNDIS
                     ITDSGITTPFESDIEGETDISGTIANNDINSTFDNGGDQGIEPKVIDQVEGDQPAVTS
                     NITEESIGQSDSTDLNGITENIKESGENRGAAGSSEEPEKIVNGENVTNANRKTEELN
                     LKDDINNSSEPIAVRVHREVDSELKYIDHKPEPLDTTAKIEELKEMHSGENNEDTNKI
                     VISSPKQVKKKKRNTKSRTRSKSITNSPKRVNSKRNSRSSKAESNVNPSIGEGTSKSK
                     SNKRTTRSTRRMYTRSQKK"
     gene            <390873..>392219
                     /locus_tag="CAGL0F03993g"
                     /db_xref="GeneID:2887874"
     mRNA            <390873..>392219
                     /locus_tag="CAGL0F03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446144.1"
                     /db_xref="GeneID:2887874"
     CDS             390873..392219
                     /locus_tag="CAGL0F03993g"
                     /inference="similar to AA sequence:UniProtKB:P24521"
                     /note="similar to uniprot|P24521 Saccharomyces cerevisiae
                     YMR220w ERG8 phosphomevalonate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446144.1"
                     /db_xref="GeneID:2887874"
                     /db_xref="GOA:Q6FUF0"
                     /db_xref="InterPro:IPR005916"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR016005"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FUF0"
                     /translation="MKNMERAYSAPGKVLLVGGYLVLDPKYDSYVVAVSSRMHAVVSE
                     EKYNETLDGFHIQFTSPQFNNECWNYSVNSQNGYVPVEVSGNRNPFLEKTVLNVLSFI
                     GPASGKTFPNVIKIDIYSDAGYHSQNNSITRSNGLKSFQFHKTGIAQVPKTGLGSSAG
                     LVVVCTTALLSCFLNDNPLLDELDLIHNLSQLSHCQAQGKIGSGFDVAAAVYGSIKYR
                     RFQPDLISRLPTLSSDNYREYRFEMSKLIKSNWNIKHESIVLPAGLRLVLGDVRGGSE
                     TVELVKKVKLWYTNNYPRSEEIYNNINEANLSFIDAMLQLQQLQKADNDKYKGLLKAI
                     NTGNDQQFKEILHLKAAIAKIRENFRLITQESGADIEPEAQTKLLDACSQLNGVIGGV
                     VPGAGGYDAVSIISTEDTNLNENTTSSEFDSVTWLDLKQEAVGLKLENPEYYRDLN"
     gene            complement(<392293..>393825)
                     /locus_tag="CAGL0F04015g"
                     /db_xref="GeneID:2887826"
     mRNA            complement(<392293..>393825)
                     /locus_tag="CAGL0F04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446145.1"
                     /db_xref="GeneID:2887826"
     CDS             complement(392293..393825)
                     /locus_tag="CAGL0F04015g"
                     /inference="similar to AA sequence:UniProtKB:Q04991"
                     /note="similar to uniprot|Q04991 Saccharomyces cerevisiae
                     YMR221c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446145.1"
                     /db_xref="GeneID:2887826"
                     /db_xref="GOA:Q6FUE9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE9"
                     /translation="MTANKIKIAQVVCACIWCLFSAGIIFGFAALKPVLLQEGIYSDL
                     CLKQDDLEVPEPCTKQDLKLNSMFAISAAVTNMMALPIGNILDNYGPRVTGIIGAGVL
                     LSAAFCFIGSNSLQRLFDPYMTGYILLAMGGPFVFISSFQLANTFPKRSGSILALLTG
                     AFDSSSALFLFYRLFYQNITAVSLKRFFTIYLCVPVFIFLCQLTIMPSQSYKSVAAMT
                     KMAVEHLDEEGQLLSGDDGSTLITDPNDRRALLIESEHEIEQNMTDASEIRRKSVLEV
                     YVEHNLQEKSGGVFGILHHYSLREQLKSLWFLLILIFSIVTMLRINYFIATIRSQEEY
                     LLGDIEDAAKLNGIFDLLLPLGGVVSIPFIGYLLDSLDSLSTLSIVCAMSLFISMVGL
                     LKSSYWLHLIGIIVFVVFRPFYYTVVSDITSKVFGFDNFGTVYGLMICICGICNIGQK
                     WLDELTHTYFNMDPTPVNMALFIATLISCFSMLCYVYKQTENRGPEDNECQEQLLPSD
                     GQ"
     gene            <406151..>407998
                     /locus_tag="CAGL0F04081g"
                     /db_xref="GeneID:2887858"
     mRNA            <406151..>407998
                     /locus_tag="CAGL0F04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446148.1"
                     /db_xref="GeneID:2887858"
     CDS             406151..407998
                     /locus_tag="CAGL0F04081g"
                     /note="some similarities with uniprot|P18412 Saccharomyces
                     cerevisiae YBR083w TEC1 Ty transcription activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446148.1"
                     /db_xref="GeneID:2887858"
                     /db_xref="GOA:Q6FUE6"
                     /db_xref="InterPro:IPR000818"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE6"
                     /translation="MEGIRLTSYQPDNNSQLQHNSGPQIRMQQMPNTNQLLGRPEYES
                     VRVANNYNENVSFGQMGRSGAPDNYSQPGLIPAGNNRWLPSVNVAPLPAQAMYMPGQV
                     PRYSDPFGPTYFPYMYGHDKWPYRVESAFTSALRLIIKNGTSKIKIKNKNYGRNELIS
                     IYIKYHTGETRTKKQISSHIQVWKKSILNKLSTNVRLTPLDKEILELIERGPNQTEDA
                     LRLFYSVFEKIIEACPKEDIEENPNVLSTSNVVKKDQYYQSEDRNVSSGQEINSPQRS
                     VNNSNSCTPPKSNLDIKNMANSEPMSALSKNRTRSPYAHSSEYSGNDVGIEGDSKVAS
                     ISYVSPGYMKAVQDNSAWSSNNTISPPGTTSNSVFSSTPTDSTTSVSINNRVAAHTQK
                     VERDFIDAYDNHLPSSRDLRKGAEPFIAALRDDLGRGAVYTTYADNSMIQQAPAYTVI
                     SPQIGYQQQTNVAVSQPFDHQPDYNRSNTLPAYKGVPYDNLSQRVVSTSYPPVSNQYP
                     QTSAYATATQQQPQQIGQHANLTQGQFYSAPLQYTERKIQPNNGFGMNNTTENRQLNP
                     YGAGYNGASYPINSLKQEDVPANRLSISHQGSYPTSSLNAVLNKNNSGN"
     gene            <410151..>410486
                     /locus_tag="CAGL0F04103g"
                     /db_xref="GeneID:2887864"
     mRNA            <410151..>410486
                     /locus_tag="CAGL0F04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446149.1"
                     /db_xref="GeneID:2887864"
     CDS             410151..410486
                     /locus_tag="CAGL0F04103g"
                     /inference="similar to AA sequence:UniProtKB:P38202"
                     /note="similar to uniprot|P38202 Saccharomyces cerevisiae
                     YBL028c involved in mating-type regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446149.1"
                     /db_xref="GeneID:2887864"
                     /db_xref="GOA:Q6FUE5"
                     /db_xref="InterPro:IPR019434"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE5"
                     /translation="MAKSLRASSHLNAKSVKRQAVFQKIVDARESRIAEKLKNELIQQ
                     KLKELREKEGEDAIIDEDAIIAEIENKPKKDAAEKVSTSGWRDARHHLYKKAKKIKKS
                     KKKGSFTRF"
     gene            complement(<411161..>412378)
                     /locus_tag="CAGL0F04125g"
                     /db_xref="GeneID:2887925"
     mRNA            complement(<411161..>412378)
                     /locus_tag="CAGL0F04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446150.1"
                     /db_xref="GeneID:2887925"
     CDS             complement(411161..412378)
                     /locus_tag="CAGL0F04125g"
                     /note="some similarities with uniprot|P38201 Saccharomyces
                     cerevisiae YBL029w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446150.1"
                     /db_xref="GeneID:2887925"
                     /db_xref="GOA:Q6FUE4"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE4"
                     /translation="MFTSDLYSFDINLDVTSGQDNDVSITFSAPSADSNDLLAVPFFS
                     NQENAKNIESVLDEFQARDLNLKFGSAMADISSFNNNDNSISKNMLNRSTTNSSGSTK
                     VQDISPESLSGNDSPLTPLAKSNLFNFNWSDELLNGSGVIQNEINEITSNTETINCAT
                     LTSTEFLNNFLKNDLKLHGEGIFRLNTPITPPLDDAQGFVQSTENILLNDTDIFEDVT
                     ADSSSFSSLLNNAKFNNTIPTSNLDFLRNDSPMNTTSILLENLQESPEQRHERRKPVK
                     RDSVVDFSDSSSSDQGKPKKCSDARLSAVGLAKKLNLSSPQEALEREKYILSIFQNEL
                     HYPLGYKTWIRDTDKETRKQLIEQLHDIVRVKYPEYDKNILETIIRRATYSMMQSRLR
                     RERRAKTKGKTTI"
     gene            <417993..>418265
                     /locus_tag="CAGL0F04191g"
                     /db_xref="GeneID:2887931"
     mRNA            <417993..>418265
                     /locus_tag="CAGL0F04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446153.1"
                     /db_xref="GeneID:2887931"
     CDS             417993..418265
                     /locus_tag="CAGL0F04191g"
                     /note="highly similar to uniprot|Q3E756 Saccharomyces
                     cerevisiae YBL029C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446153.1"
                     /db_xref="GeneID:2887931"
                     /db_xref="GOA:Q6FUE1"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE1"
                     /translation="MFLFIPLVCGLNSWDKPYTKVQTAPLYCPHCHNYSVQPVKRRQF
                     FSVWFIPLVPLHVGKQLHCNICNWRQDFHSKEQLEKVIAEQGNIKA"
     gene            <419473..>420393
                     /locus_tag="CAGL0F04213g"
                     /db_xref="GeneID:2887686"
     mRNA            <419473..>420393
                     /locus_tag="CAGL0F04213g"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="XM_446154.1"
                     /db_xref="GeneID:2887686"
     CDS             419473..420393
                     /locus_tag="CAGL0F04213g"
                     /note="highly similar to uniprot|P18239 Saccharomyces
                     cerevisiae YBL030c AAC2 ADP/ATP carrier protein"
                     /codon_start=1
                     /product="ADP/ATP carrier protein"
                     /protein_id="XP_446154.1"
                     /db_xref="GeneID:2887686"
                     /db_xref="GOA:Q6FUE0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FUE0"
                     /translation="MSETKKPQSNFAIDFLMGGVSAAVAKTAASPIERVKLLIQNQDE
                     MIKQGSLDHRYKGIVDCFQRTARQEGIISFWRGNTANVIRYFPTQALNFAFKDQIKAM
                     FGFKKEEGYAKWFAGNLASGGIAGGLSLMFVYSLDYARTRLAADAKSSKKGGERQFNG
                     LVDVYKKTIASDGVAGLYRGFLPSVIGIVVYRGLYFGLYDSCKPLLLTGSLEGSFIAS
                     FLLGWVVTTGASTASYPLDTVRRRMMMTSGQAVKYKGAMDCLQKIVAAEGVSSLFKGC
                     GANILRGVAGAGVISLYDQLQMILFGKKFK"
     gene            complement(<421104..>421952)
                     /locus_tag="CAGL0F04235g"
                     /db_xref="GeneID:2887758"
     mRNA            complement(<421104..>421952)
                     /locus_tag="CAGL0F04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446155.1"
                     /db_xref="GeneID:2887758"
     CDS             complement(421104..421952)
                     /locus_tag="CAGL0F04235g"
                     /note="some similarities with uniprot|P38200 Saccharomyces
                     cerevisiae YBL031w SHE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446155.1"
                     /db_xref="GeneID:2887758"
                     /db_xref="GOA:Q6FUD9"
                     /translation="MNENDSNEIIEQLGISKRLGNSILDELNQRASETNPLLRKHEDT
                     DNEEERPAESTPTAHNLVFNKVHNLNFENLTDKDPDFTIHNDPLHKKKYKYSPIKRVP
                     EVNEITKKIRRLKLRSSSNLSSSGGSPEKRTTNASNVEQKTELAPLKTPNFLRPTFNS
                     MNRAKDTSHKVESSRRTYGNLLPPTSRAIPAVKEAVRQDYTKRSISIQLPRKSPAPPK
                     IPEQRSISDSSSNVFERLYKQTTMSRSNSMAFDQQNRKQLPKSRTITGLSSVVGDKHR
                     TFPSKH"
     gene            complement(<422678..>423727)
                     /locus_tag="CAGL0F04257g"
                     /db_xref="GeneID:2887647"
     mRNA            complement(<422678..>423727)
                     /locus_tag="CAGL0F04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446156.1"
                     /db_xref="GeneID:2887647"
     CDS             complement(422678..423727)
                     /locus_tag="CAGL0F04257g"
                     /inference="similar to AA sequence:UniProtKB:P38199"
                     /note="similar to uniprot|P38199 Saccharomyces cerevisiae
                     YBL032w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446156.1"
                     /db_xref="GeneID:2887647"
                     /db_xref="GOA:Q6FUD8"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /translation="MPVSHRILLSLKEAAKVIGTQGNSIQSVRDNNNNVKIGISEKVP
                     GCSDRVLTCSGEVEDVCSALGDVVTLLNKPSENEEETDNHHFYFLNHLLPVPTLDDLK
                     ATDPEASEEALHEQLQNIGYLRLLVFNSQLSSIIGKGGNQIKSLIEKHGVKLVASRAF
                     LPDSTERMLEIQGVPSAIKQVLLDICEIIAKEEEEEEKARAENNNGESTGRKRFERKY
                     YPHLQRNNTNSSSNNGSVGNSANSQEYTATVMIPESYVGALAGKKGNRLANLRKFTKT
                     KILMESRPNDLDNEHEDENDMEEDDGRLRKFTIIGSSSRSVNLAESMLQRNLATEIER
                     RKERLRNLSENNESA"
     gene            <424682..>425569
                     /locus_tag="CAGL0F04279g"
                     /db_xref="GeneID:2887883"
     mRNA            <424682..>425569
                     /locus_tag="CAGL0F04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446157.1"
                     /db_xref="GeneID:2887883"
     CDS             424682..425569
                     /locus_tag="CAGL0F04279g"
                     /note="highly similar to uniprot|P38066 Saccharomyces
                     cerevisiae YBL033c RIB1 GTP cyclohydrolase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446157.1"
                     /db_xref="GeneID:2887883"
                     /db_xref="GOA:Q6FUD7"
                     /db_xref="InterPro:IPR000926"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD7"
                     /translation="MSLPVVQCIARARIPTTHGPDIFLHLYTNDRDNKEHLAIVFGED
                     IRSRTLFRQYPGETQQDRMVRGAYVGKLYPGRTVADVDERLGFRLEFDAEGNLLTNSA
                     TTWSEENDTLVRIHSECYTGETAWSARCDCGEQFDRAGKLISLDEEPETHIKGGCGHG
                     VIVYLRQEGRGIGLSEKLKAYNLQDLGADTVQANLMLKHPADARDFGIGRAILIDLGI
                     KNVRLLTNNPDKIQQVSYKDQLRCVERVPMIPIHWTDESKGIDSKEIEGYLRTKIERM
                     GHLLQKPLNLHTPQEQETI"
     gene            <426122..>430573
                     /locus_tag="CAGL0F04301g"
                     /db_xref="GeneID:2887594"
     mRNA            <426122..>430573
                     /locus_tag="CAGL0F04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446158.1"
                     /db_xref="GeneID:2887594"
     CDS             426122..430573
                     /locus_tag="CAGL0F04301g"
                     /inference="similar to AA sequence:UniProtKB:P38198"
                     /note="similar to uniprot|P38198 Saccharomyces cerevisiae
                     YBL034c STU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446158.1"
                     /db_xref="GeneID:2887594"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD6"
                     /translation="MPLNTGINADELPTLFAKYNELSTEDKLELLTSFKGHVKKELVD
                     ASAIELYFRVLLDTDTEIPESDAVDENSSKLSQLKHSSLCYLIKRVTMQAPSIFHDSN
                     MVNRIILYLLLHAPSDTAPQSLERKKFWVPSIKAIESVYQISSSQVIKCLSGALEEIP
                     SDGSISNEKKWQNYRNIVSATIEITKDSGSSALKDFLPVIARTLHQDDANESLSKEIQ
                     ITTELVADLWITEVKKPSIPIQTVDFKDFRVRQYFQTLIDKKKSDANTPDSIKSLDSK
                     DTSFNAIFDVESELSALINESIPPNFNDSYANANRAHSSVIIYETQSHFRADFEKLLI
                     PFRDSKETEQNWKSRQTNVYQFRALIAANNNEESILKRDPDGVIETLKDIQFIEMISK
                     AVHSLRTTLSFASCLLLRDVLNAFSSSLSNYMIESIFNVFKTLLSSTKKISSQIAFHC
                     IVILLSNLTSFNNKQFQNSFVLINSKHIFSRQSSCLFLRVFIIKFANDSKFDSNTVYI
                     EEWLKKGLTDPQTSVRETMRLTFWYYYKCYEKSAKRVMSNGITPQLKKAIELAIPPHL
                     NVNYHQHTSLSSSSSTNSSRRSSLVGQRRFPSYAQPTQSSTHLRNQSTSTASNMRSAS
                     AISTRDSVLNKNSVSGYQNTTNIRKISTPLPTSNAKFVADSSTHTINLDGSFSQKVHN
                     GIDIDLSEEIRSLESHTNKKKHMGNALQDHDNNQKSAHDCDGSSTDNQILLRLRRLAD
                     KYNNNSNLTAEEMNSFLIEFLEYASKNSPKSDAIDKFIKPLRGIMIALPSQTKKLMRS
                     DWFMRNFKLTYLIELCAINETSISSLMEAKSDILSLLKCCTEILNNLEISNADEGKND
                     ENSIGGLTTLSLYYLKFRRIFYNYCFSVVKEIIAGKKLQIGSSTPIIQNLIEVFCKIN
                     GKDYDSSLYYDVLYSIYKFDRGIFIAHLKEMPLFPTVFKVCNELKERHSDFVFNEILE
                     EAESQVNGITKEISVGAQSNKEDEYKQYMEMTMVNPFAKKQDERIPSTGSVVHNPDMV
                     TAFGDNSTVENSNDKKRPYSDDTENISLGNDTMRLTEMTKIVFPSLQATKKMKTPSSE
                     EKINKSIEISDLFQDKEATEKPEKLLSDNANSSIASNNTIATVNDSPSVEVKVEELKK
                     SPTNTININYEKDGDSRDIPIVSLGSESLNSQLTEIKDDLTDSVSEIDLKPDMLQMSV
                     TCSPAILLEYYALLFKSEGAGKDCDADLSRLKKSLQRIKTKGFTIKHIDQIIKPLLFL
                     ESNEPLKVWLEDGGGYQDLLDLVAMILQSLGESDQLPLKLIGKSMALLFSLIAFIPLL
                     KDSASLRSMSLQTIWENIVTIVGNLNVQESEIYGYFAEVRNQLVKQGFFDSKSITRML
                     NILMVEIDDEKVTKKIFLIETMKEIIRSKPPWTDKTYRLMEIVQTLAYLIESKTSTVR
                     KACFECLILIFQLSNGKSKSFKQEVVELFQCIPDNVNKLIEHYCSFI"
     gene            <430854..>432839
                     /locus_tag="CAGL0F04323g"
                     /db_xref="GeneID:2887741"
     mRNA            <430854..>432839
                     /locus_tag="CAGL0F04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446159.1"
                     /db_xref="GeneID:2887741"
     CDS             430854..432839
                     /locus_tag="CAGL0F04323g"
                     /inference="similar to AA sequence:UniProtKB:P38121"
                     /note="similar to uniprot|P38121 Saccharomyces cerevisiae
                     YBL035c POL12 DNA-directed DNA polymerase alpha"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446159.1"
                     /db_xref="GeneID:2887741"
                     /db_xref="GOA:Q6FUD5"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR013627"
                     /db_xref="InterPro:IPR016722"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD5"
                     /translation="MTVDGELITQFGPEAREASIASILESLMKLHSLDVEELYIRWEQ
                     FSYQRHEKQTDLNLKNLDSFKEFLQQQIEKKALQVSSASRKTGPMKKNKVVRGSTNNS
                     AFGFSIPNTPTIKKRKLQVSSSTKKENGHENSLHFSEGTSVERTQQLGSSPLLNSDAN
                     RDVGVSTPIKLRESGKILDSLNPENIEIAGGIDPNVETATKVSIAPYFDAKKYKFRTM
                     RQKIQDAADVLDEQIEAFHELIKGHYKLSTTDFADPTVQSQSEIYAIGRVVPDSALSE
                     GFPNIDAIALETSRNQGIGRRIRLDLEHVSETSLFLGQIVAIKGKNATGEYFKVEEVL
                     SLPYPDSPVSTANEIQEVQLSMDNAPMKAVITAGPYTADDKWDFSILSDFVDRINSDI
                     KPHTIVMFGPFLDITQSCIKEANIPQFPNMKTQPKTLDEVFYKVVVPILKRIDSNIQV
                     VLLPSTRDVLSRHAAYPQDSFDRKMLQLPRNFKCFPNPSTFQLNEVFVGCSNVDIYKD
                     MKEITKGGSTSMRNRFDRVSEHVLQQRRYYPVFPGGLKKSLKFKDKTGKNIYEHISGA
                     DLDVPYLPLTEFVGGFAPDIIVIPSELQHFARVVRNVVFINPGRFVLAKGVNGTFVQL
                     TVNCPDIESGDLTRIEDDEPTFLHNVWKRSRVDILTS"
     gene            complement(<432980..>435769)
                     /locus_tag="CAGL0F04345g"
                     /db_xref="GeneID:2887896"
     mRNA            complement(<432980..>435769)
                     /locus_tag="CAGL0F04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446160.1"
                     /db_xref="GeneID:2887896"
     CDS             complement(432980..435769)
                     /locus_tag="CAGL0F04345g"
                     /inference="similar to AA sequence:UniProtKB:P38250"
                     /note="similar to uniprot|P38250 Saccharomyces cerevisiae
                     YBR086c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446160.1"
                     /db_xref="GeneID:2887896"
                     /db_xref="InterPro:IPR007632"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD4"
                     /translation="MVESLEQLDPNCVIVFQNTEQNVTQLVSELNLKGMPVVTRPGSD
                     KTSLFAFTRIDPTRYEDIHSCFHNLKATIPSIINIFPIYDNETTKRVDTLYKKNVKGQ
                     YLSLPMDADLIELFNLTGDAEQALYFSFFRHYIKWLLPMAFFGLFVRYTSGNNPWEFN
                     PYYSGALLIWSITFSAFWIFKKKPYYNKIFIKSQTFSTLFSKQSTNFETPSNLLLKKI
                     AFAPIAVVFALTLITCQLTCFAIEIFFTQLYAGPLASVTSLIPTVLLAVLTNIINMLY
                     NKFFVERFIAWENGPNPKRSKMEKNFVLLFFVNYTPLLITLFLYLPFGYKFNSTIKTS
                     VVSWANSHHLQTRNDDFKINTTRYKNQIFYFMVTNQIVAFALDNIVPTIIGKVMPIVQ
                     SKVAEKNEKRSSIANIDIVREEYPAELKRWKKVGSYSTGPWGEFDVDENYRKVIIQFG
                     FVAMFSVLWPLAPSLSVFFNVLTYKADMWRALKKCKPKYLPILSEYLEEEEDAEKELS
                     TDSWNVLLEIITWLSVIVGPTITYMYINCNIPGVGKETVLEKRDLWYASSPFSFSWTS
                     LLLFSIFIEHVSIVGYIFISSFLQSTEAPHFRGFVPPAKSPREVKTMHKGSIDLSEVI
                     EQTKTFKAMADVTPEPNESLPVPNVTDVFQSKNSDAKDKSVSPGVTDEIKDTTLNSIP
                     TPSKQSTMKRDNESPATFSGSTSTNVPAIDDDSVAGATLPDTIPTSKNYDSRTNKTPS
                     NTNKTSNMTPANGIAHDKNSMSINEKVKQSESSNSTMPQKENIDPTMVKSSNISGNLH
                     SDVPLAAAAASTALYNVPVHANNDETERQAKTSLNANGIRHISSHRSLQPPAATQQFG
                     RDYQPAAKPITPASRRYSRPDSRISNSGQNSMTSSNMSEAYSSDRAGVNRQSSTSNSS
                     HKKKKGLLHKLKKKL"
     gene            <436654..>437451
                     /locus_tag="CAGL0F04367g"
                     /db_xref="GeneID:2887600"
     mRNA            <436654..>437451
                     /locus_tag="CAGL0F04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446161.1"
                     /db_xref="GeneID:2887600"
     CDS             436654..437451
                     /locus_tag="CAGL0F04367g"
                     /note="highly similar to uniprot|P38197 Saccharomyces
                     cerevisiae YBL036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446161.1"
                     /db_xref="GeneID:2887600"
                     /db_xref="GOA:Q6FUD3"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR011078"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD3"
                     /translation="MSLRRALYTVMSGVAKREVAYDSVRQKQLVSQFLEVENRVQSEV
                     NGSKSVLLLAVSKLKPASDVQILYDHGVRDFGENYVQELIEKAELLPTDIRWHFIGGL
                     QTNKCKDLAKVPNLFSVETVDSLKKAKKLNEARGKYQPDANAISCNIQINTSQEDQKS
                     GLVDEDEVYEIVKFFLSEDAKFVKLNGLMTIGSWEVSHEEGEENKDFSKLVEWKSKID
                     SKFGTDLKLSMGMSADFKQAIRQGTSEVRIGTDIFGTRPPKNEARIL"
     gene            complement(<437622..>440642)
                     /locus_tag="CAGL0F04389g"
                     /db_xref="GeneID:2887669"
     mRNA            complement(<437622..>440642)
                     /locus_tag="CAGL0F04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446162.1"
                     /db_xref="GeneID:2887669"
     CDS             complement(437622..440642)
                     /locus_tag="CAGL0F04389g"
                     /inference="similar to AA sequence:UniProtKB:P38065"
                     /note="similar to uniprot|P38065 Saccharomyces cerevisiae
                     YBL037w APL3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446162.1"
                     /db_xref="GeneID:2887669"
                     /db_xref="GOA:Q6FUD2"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR003164"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013038"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017104"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD2"
                     /translation="MDRKKTFVGTSNNGSSSIKGLQLFIADLRSAPHLQDQERRIQSE
                     ITKIKQNFDTQHQKQSKGQDKQGGYQRKKYIAKLAYIYITSNTSKLNDIIFGLDQTME
                     LIQSSVYSEKFIAYMTIELLYEHKTVMDKINDALQYQILLDLRSNDENFVSLALNCVG
                     IVGSLSKTLSNDEDIVAEVFQILRSPTSSMNLKKKSSLAFLTLLKKNNAILTNEPQRK
                     QIWIQRILSLLDNRDNYRLTLASLPLIEYIAVHVDPAACTRLVPQLTQTLYSCLMNES
                     SSNIDNPQLDFRFANMPNPWIITKTVSLLNMLIISSNEKSSAQNDHLLHTSTMNKEIL
                     NTLRTCISQAIQLGERSFSDPMERIVQNTILFSLINFAPKLDPSDDAITDSVTALCKL
                     LSSSQINIRYLALDSLIKLCSVLGTSAMNAVRLQNLDMISQLLYDERDASIIRKLADL
                     LYIFTDSSNVKKTVDDLLQYITSSKQLADPNLKSDIAVKIAVLSEKYATDSNWFVTVS
                     LKLLSFTSLTSINDDEIWQRLCQIVVNNPALQRTACEQLLYYFKNSQTSEPLIKTGAF
                     LFGEFIDQITDLISVADLFNIFTTKYFTVTNFTKAMILTTVMKLYRCSDSIYTGAVKI
                     YQMELSSLDIELQSRSYEYLNILRIARMENNPNLINILFHPIPPFNSSTNPLLKRLGL
                     LQTSDNDLTIEALTSNPSSKDSSNPFTQPTSTDTSVTENGKNMVTQEELYNSQILAAS
                     WRDGFSRMLSFKRGILFSSSLLKILYRLDYPSPEEPYQQKISLTFINESEWDMTNFST
                     NIIPFRTDSNPEYVVQEISLLSALDIAPRRRTEQTLDIIIRRQFNAEYSPIISIFFKC
                     GASTNTINLKLGVGLNSTLRTTEAPKQQLTLAQFFSRWKALGDALGTEGECIITKLRL
                     KSIKNISHSQEESILQVSLILKRMGFDIVEQSNLPNSLFFAGIIHTKTDGNYGCLIRV
                     SCEDEEYFTLTCRATIGSGLATNIASCIKLAAFA"
     gene            complement(<441222..>441860)
                     /locus_tag="CAGL0F04411g"
                     /db_xref="GeneID:2887668"
     mRNA            complement(<441222..>441860)
                     /locus_tag="CAGL0F04411g"
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /transcript_id="XM_446163.1"
                     /db_xref="GeneID:2887668"
     CDS             complement(441222..441860)
                     /locus_tag="CAGL0F04411g"
                     /note="highly similar to uniprot|P38064 Saccharomyces
                     cerevisiae YBL038w MRPL16"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL47"
                     /protein_id="XP_446163.1"
                     /db_xref="GeneID:2887668"
                     /db_xref="GOA:Q6FUD1"
                     /db_xref="InterPro:IPR000114"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR020798"
                     /db_xref="UniProtKB/TrEMBL:Q6FUD1"
                     /translation="MLRTVSRFMPLRFGVRYSHEYAPRYKEQQKKQKGRVPVRTGGSV
                     KGSTLQFGQYGIRLKSEGVRLTAEQLKEADNAIMRYVRPLNNGQLWRRLCTNIAVCIK
                     GNETRMGKGKGAFDHWMVRVPTGKILFEMAGDNLHERVAREAFRKAGTKLPGVYEFVS
                     RKSLTRVGLHSFKNPEHDPKVDHFKEQEQKPTKKYLNVLKSQEPEYKLYRGR"
     gene            <442206..>443942
                     /locus_tag="CAGL0F04433g"
                     /db_xref="GeneID:2887710"
     mRNA            <442206..>443942
                     /locus_tag="CAGL0F04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446164.1"
                     /db_xref="GeneID:2887710"
     CDS             442206..443942
                     /locus_tag="CAGL0F04433g"
                     /note="highly similar to uniprot|P28274 Saccharomyces
                     cerevisiae YBL039c URA7 CTP synthase 1 or uniprot|P38627
                     Saccharomyces cerevisiae YJR103w URA8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446164.1"
                     /db_xref="GeneID:2887710"
                     /db_xref="GOA:Q6FUD0"
                     /db_xref="InterPro:IPR004468"
                     /db_xref="InterPro:IPR017456"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029062"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLNDGGETDLDLGNYERYLNVTLTKDHNITTGKIYSHVIAKER
                     KGDYLGKTVQIVPHLTNAIQEWIERVSRIPVDNTGMEPDVCIIELGGTVGDIESAPFV
                     EALRQFQFRVGKENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLVPDMIACRCSE
                     TLEKGVIEKIAMFCHVGADQVVNVHDVNSTYHVPLLLLEQKMINYLHQRLQLQEITLS
                     SEDIQRGENLLSKWKSMTGNFDSSMETVKIALVGKYTNLKDSYLSVIKALEHSSMKCR
                     RKLEIMWVEATDLEPETQDTEKAKFHEAWNKVSTADGILVPGGFGSRGTEGMMLASRW
                     ARENHIPFLGVCLGLQIATIEFARNVLGVKEGNSAEFFPELDESNQVVVFMPEIDKET
                     MGGSMRLGLRPTYFQQGTEWCAIKKLYGSAESVEERHRHRYEINPNFIERLEEHGLMF
                     VGRDETNKRCEIFEMKDHPFFVATQYHPEYTSKVLDPSKPFLGLVAASSGILDDVIAG
                     KYEFNGDGKSDF"
     gene            <445495..>446151
                     /locus_tag="CAGL0F04455g"
                     /db_xref="GeneID:2887839"
     mRNA            <445495..>446151
                     /locus_tag="CAGL0F04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446165.1"
                     /db_xref="GeneID:2887839"
     CDS             445495..446151
                     /locus_tag="CAGL0F04455g"
                     /inference="similar to AA sequence:UniProtKB:P18414"
                     /note="similar to uniprot|P18414 Saccharomyces cerevisiae
                     YBL040c ERD2 ER lumen protein-retaining receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446165.1"
                     /db_xref="GeneID:2887839"
                     /db_xref="GOA:Q6FUC9"
                     /db_xref="InterPro:IPR000133"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC9"
                     /translation="MNIFRLLADLTHIASILILIQTIKKTSSISGISIKTQVLYALVF
                     VCRYLDLLTFHYKSFYLTVMKIFFITSSVYTVYLLSTFKQKNPIAYQEMIMADAFKVQ
                     YLLAPCLVLAFVFNHGFDFLSLNKSFSMWLESVSIMPQLFMLSKSGKATALTTHYIFA
                     LGLYRALYIPNWIWRYFYEDRFDKLAFVTGFVQTLVYSDFFYIYYKKIVKGLGFRLPK
                     "
     gene            complement(<446420..>447148)
                     /locus_tag="CAGL0F04477g"
                     /db_xref="GeneID:2887715"
     mRNA            complement(<446420..>447148)
                     /locus_tag="CAGL0F04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446166.1"
                     /db_xref="GeneID:2887715"
     CDS             complement(446420..447148)
                     /locus_tag="CAGL0F04477g"
                     /note="highly similar to uniprot|P23724 Saccharomyces
                     cerevisiae YBL041w PRE7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446166.1"
                     /db_xref="GeneID:2887715"
                     /db_xref="GOA:Q6FUC8"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC8"
                     /translation="MATTVSSEYSTDTSNVPIEHRFNPYSDNGGTILGIAGEDFAVLA
                     GDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKRFKNSIKWYHFDHNDK
                     KLSISSAARNIQHLLYGKRFFPYYVHTIIAGLDDEGKGAVYSFDPVGSYEREQCRAGG
                     AAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLSLEEVIKLVRDAFTSATERHIHV
                     GDGLEILIVTKEGVRTEFFELKRD"
     gene            <449923..>451815
                     /locus_tag="CAGL0F04499g"
                     /db_xref="GeneID:2887940"
     mRNA            <449923..>451815
                     /locus_tag="CAGL0F04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446167.1"
                     /db_xref="GeneID:2887940"
     CDS             449923..451815
                     /locus_tag="CAGL0F04499g"
                     /note="highly similar to uniprot|P38196 Saccharomyces
                     cerevisiae YBL042c FUI1 uridine transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446167.1"
                     /db_xref="GeneID:2887940"
                     /db_xref="GOA:Q6FUC7"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC7"
                     /translation="MRDVSTSEENQYSTLTSDEILKHRSDADTSGEDEKYYKEETVNI
                     IDTNDVEPSSDEEDHDDKHEKFKRKGTFAYLWYRIVDFLEVKQIDDDGKVTESQSVLQ
                     TFLYNDDLKPVDKARRVWTWKEYIFFWISGAFNVNTWQISATGLQLGLNWWQTWICIW
                     VGYSFVAVFLVAGSRIGNIYHISFPIASRVAFGTYFSIWIVLNRVVMACVWFSTLAYL
                     GGDCVQLMLMSIFGNNLNKKMGDTIPNPNLTNFQFMCFMLFWAVSLPFLWFPPHKLRF
                     IFAIKSAITPFAAFGFLIWTLKKAHGHLALGSLNGGEKISQSVLAWSVVRSIISALDN
                     FSTLILNAPDFSRFAKTPKSSIYSQLFILPICYAVISLIGILSASAAYKLYGVNYWNP
                     LDILNRYLEHYTSGNRAGVFLISFAFAFDQLGANLSGNAIPAGTDMTALLPKFINIRR
                     GSYLCACIALVICPWNLMASSSKFTTALGAYAVFLSAIAGVISADYFVVRKGYVNVFH
                     CYTNKLDSYYMYNRYGTNWRAVCGYIVGIAPNFAGFLGSIDVHVPIGAMKVYYLNYFI
                     GYLVAGLVYLVLVYYFPVKGVPHNAKLTDRVWYEEWIEVEDFRNQREAFEKYGDASMS
                     ESKLSA"
     gene            complement(<453083..>453943)
                     /locus_tag="CAGL0F04521g"
                     /db_xref="GeneID:2887628"
     mRNA            complement(<453083..>453943)
                     /locus_tag="CAGL0F04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446168.1"
                     /db_xref="GeneID:2887628"
     CDS             complement(453083..453943)
                     /locus_tag="CAGL0F04521g"
                     /note="weakly similar to uniprot|P38195 Saccharomyces
                     cerevisiae YBL043w ECM13 involved in cell wall structure
                     of biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446168.1"
                     /db_xref="GeneID:2887628"
                     /db_xref="GOA:Q6FUC6"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC6"
                     /translation="MLAIHFNNSLSLQDQYSLASKARTKLMRCAKDAQKANKEYNLRV
                     LVGHANLLDRITENVERMNLIKRQQQNVADDLQLSKQNSNVVEGYTHAGEVSAQNKTS
                     TSDYYYYSSESESESESDSESESDYESETEAQGDFTFKVDESIDCKENTEVVDSEVSV
                     AEECNYVVGAGAHYAGHNDSSNKHFTTIWEEPSEGDNTTEEKTEICLSSSITSTGNDC
                     DEKAKDYKETTDVCSGSDSDEHSLNSPLDDNDAFESYDDICKSSNDYGVHYHKNHDNY
                     FNIPQHKTLV"
     gene            <456591..>456866
                     /locus_tag="CAGL0F04543g"
                     /db_xref="GeneID:2887970"
     mRNA            <456591..>456866
                     /locus_tag="CAGL0F04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446169.1"
                     /db_xref="GeneID:2887970"
     CDS             456591..456866
                     /locus_tag="CAGL0F04543g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446169.1"
                     /db_xref="GeneID:2887970"
                     /db_xref="GOA:Q6FUC5"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC5"
                     /translation="MHRILCRGGIQFPPTIITISEKGNFISNVARSYISMKAIFSGML
                     PCRNSLTFFFTDFLDGYNELRNVCNEKPQYRLKNFQDPYPIQQVAQT"
     gene            <459464..>460825
                     /locus_tag="CAGL0F04565g"
                     /db_xref="GeneID:2887605"
     mRNA            <459464..>460825
                     /locus_tag="CAGL0F04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446170.1"
                     /db_xref="GeneID:2887605"
     CDS             459464..460825
                     /locus_tag="CAGL0F04565g"
                     /inference="similar to AA sequence:UniProtKB:P07256"
                     /note="similar to uniprot|P07256 Saccharomyces cerevisiae
                     YBL045c COR1 ubiquinol--cytochrome-c reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446170.1"
                     /db_xref="GeneID:2887605"
                     /db_xref="GOA:Q6FUC4"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC4"
                     /translation="MLRAVASKQLRRGLATQVSGSLAPEISQLSNGVVVATEPNTSSS
                     TASVGVVFGSGSSSENPYNNGISNLLSKTYKSTENRANAATKGVEVVSKVGREYQSYL
                     VNSLPGQLSKSFDILNSTVLGNPTGSDKVFEQTKSNVLKQIEHFEETNHKGRVLEHLH
                     ATAFQNTPLSLPIRGTTESVDGLLRGDLEEFVNQHFISSNAVIVGTGNISHQELCELV
                     EKSSLKFNSTTKAKPEANKKSTFLGSEIRLRDDTLPKAWISIAAEGEALTSPDYLVSQ
                     VAAQVFGSYNAAEPNSRLQGIKLLDDIQEYQLCDDFDHFSLSYRDSGLWGFVTTTQNV
                     GSIDDLMHFVLKQWNRLTISVTETEVARGKAMLKLKLANEACKKNCHIASDLGNLVLN
                     QGVKFNQDEIFRKIDAITVKDVKAWAGKKLWDQDIAIAGTGQIEGLFDYMRLRNDMSM
                     MRW"
     gene            complement(<461459..>462667)
                     /locus_tag="CAGL0F04587g"
                     /db_xref="GeneID:2887634"
     mRNA            complement(<461459..>462667)
                     /locus_tag="CAGL0F04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446171.1"
                     /db_xref="GeneID:2887634"
     CDS             complement(461459..462667)
                     /locus_tag="CAGL0F04587g"
                     /note="some similarities with uniprot|P38193 Saccharomyces
                     cerevisiae YBL046w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446171.1"
                     /db_xref="GeneID:2887634"
                     /db_xref="GOA:Q6FUC3"
                     /db_xref="InterPro:IPR015267"
                     /translation="MDSASIDAIHMNGIKSKYLYDILKGIVREKNYDVLETINVSEFL
                     AELLDHMVNTIPNELFQTKVNNGRHTVGRKEDSEENEEAVYGTDIDDANDVHTRQLDD
                     LKRISTHLTTNFKDKSQLPFTIVRICELCFDPFHYFKTYELDKFVNALQKCCLVRGAW
                     RRYELKDVRELSNSQSDKEHIDCDQNDVALSKIPWLDEKMVSELTPFIKEIDTIMSVN
                     LSFEDDEMDDDDDDNLKNQNNDRIITHQDDNIIVEEYYENEDQDDENTGFSNQVINDN
                     NDSQEDDDEDSDYIEEDEGDEDEDDDDDEEEEEEEDGDEDEDEDKHFDIKVEEEAVKE
                     DANTTRNELMNVSNNSDDSSLQNDTGIAISSQNDTRDLSKRRLPLSDENDGNYANPAS
                     FSKRNKASES"
     gene            <463702..>467637
                     /locus_tag="CAGL0F04609g"
                     /db_xref="GeneID:2887623"
     mRNA            <463702..>467637
                     /locus_tag="CAGL0F04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446172.1"
                     /db_xref="GeneID:2887623"
     CDS             463702..467637
                     /locus_tag="CAGL0F04609g"
                     /inference="similar to AA sequence:UniProtKB:P34216"
                     /note="similar to uniprot|P34216 Saccharomyces cerevisiae
                     YBL047c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446172.1"
                     /db_xref="GeneID:2887623"
                     /db_xref="GOA:Q6FUC2"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC2"
                     /translation="MAAIVFQTPLTHEESDFYSQKFRQLDSEELGVVTGEAVKPLFAA
                     SGLSSQILSQIWALVDIDNKGFLNQNEFNAAMRLIAQMQQFPGQSVTTTLYDHPPSRL
                     PILSDPNTVQSTGNSRMGSTSNASIPHISANDISKYSQLFDRSAGASPTIPGDKAKDI
                     FLKARLPNQTLGEIWALCDRDASGTLTKQEFIMAMYLIQLVMSNHPSTQPLPDHISNE
                     IWDSLNQLPATSLPMEQPLSASSTGLSSNPPLVRQNTLSRVSSGAFTNAANNWFLTPE
                     KKAQFDAIFDALDKNHAGALGSQILVPFFLSSKLSQETLASVWDLADIHNNAEFTKLE
                     FAIAMFLIQKKNSGIDLPDVIPNELLHSPSLGLYPSQAPQTQANAQPPLPPSRNTKPQ
                     MNLPVQPQHSNNGSLNDLMALNGSFSPQPTTAKPLNHTDSGNSFENSSVANTMTAKKF
                     NPSSTFGQSIIKEEDERNVALASNTATMGTTTPATTASNLPAVPTMSNVPGTNNTQAP
                     PATQTQHMNKATSPVQRQSTLPKVPNFGGFTNAAGSGINAITGATGAVLGGAIGAVAG
                     AATGTVSGAISGANRDIFADGESSRQLSTATTDLANLSNQANSLSNQAGIASEKKSKV
                     SQELQRVNEMKANIESKLATLRAKYDQDVKATEEMETQLTQTNREVETLNQQLGVVEA
                     NYHATESKLNELKTQYEEAQQKNSKLKEDIANFNTMIASMEAQLNEKKQVAKQELSVV
                     DVNMKQLELNQITVAGIEKEISGLDEQVNVYVNKRKELDEYKKTIEDQHAQLQAKYQE
                     ISDKNNELTERQNELDERNQQIEEQEKLYHEHVAKLQSLFDDLTNRQQQFEKAEQELK
                     NRHVEYAQKVQDLTERQMNLAMGEIPSDAKEIVEKHKQSSGMGAGAAMGIAGAAGAAV
                     ATAGAAIAHAMTSNKDDDEKTESDVFDRDVPTVGSQSEPDENAETTNHRSEAEAVNMA
                     DRFEGDLNEYGIPRTQSLTSSVANNAPQSVRDDVELPETLEEKEMSKPSTAGNTITPN
                     AHMPGEWDNTGANTMTNTQEDSGQMNDSPADQSQEHSESDTSIQKSLDQEVPKKKMTI
                     DEEFPPIQELNIDESDSSSDGEFEDTRELPTQVSKNVDDQSMAMTAPPNGVTPSVPQM
                     ENTPKDDFDDAFNELEKATEEDGNTSDFENLANQGSFEGFEHIDRNEVAASMQQGNVV
                     GAPTQQGQPMAPQGHHNHGNDEWDEIFAGFGNGVKEPNASQQMQQPIPASTSATAQAP
                     INRGIATTPKSLAVEELMGMGFKEDEAVKALEKSNWDLETATNLLLDAA"
     gene            complement(<468280..>468795)
                     /locus_tag="CAGL0F04631g"
                     /db_xref="GeneID:2887590"
     mRNA            complement(<468280..>468795)
                     /locus_tag="CAGL0F04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446173.1"
                     /db_xref="GeneID:2887590"
     CDS             complement(468280..468795)
                     /locus_tag="CAGL0F04631g"
                     /inference="similar to AA sequence:UniProtKB:P38191"
                     /note="similar to uniprot|P38191 Saccharomyces cerevisiae
                     YBL049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446173.1"
                     /db_xref="GeneID:2887590"
                     /db_xref="GOA:Q6FUC1"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC1"
                     /translation="MGLRYTSYIESPLASDLNKSFKGSRNSQTDLYQYNEYGTIGNSL
                     YSGPILLRQRRRTLSGSSDSSSSSQEKIFVTYGCRRCRTHLSSSSHVISKDYRGKTGT
                     AYLMDEVLNVLEGNVETRPMLTGDYVVCDILCHWCKNVVGWKYLQSERKDQRYKEGKF
                     ILEVKTICKCD"
     gene            complement(<470517..>471395)
                     /locus_tag="CAGL0F04653g"
                     /db_xref="GeneID:2887778"
     mRNA            complement(<470517..>471395)
                     /locus_tag="CAGL0F04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446174.1"
                     /db_xref="GeneID:2887778"
     CDS             complement(470517..471395)
                     /locus_tag="CAGL0F04653g"
                     /note="highly similar to uniprot|P32602 Saccharomyces
                     cerevisiae YBL050w SEC17 transport vesicle fusion protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446174.1"
                     /db_xref="GeneID:2887778"
                     /db_xref="GOA:Q6FUC0"
                     /db_xref="InterPro:IPR000744"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6FUC0"
                     /translation="MSDPQELLKRAEKKGVPSSGFMKFFNGSDSYKFEEAAELCVQAA
                     NIYRLRKELSAAGESFLKAADYQLKAGNDDEAANTFIEAFKCFKSSGSFTDAVSSLES
                     AVNLFTKKGQFRRAANFKFDLGEIQENDLTDYKNAIESFETAGEWYEQDQSMALANKC
                     YVRCADLKALDGQYIEASDLYTKLIKNSLGNRLSQWSLKEYFLKKGLTQLAANDTVAA
                     SRTVQEGMKDDPNFHDSRECNLLQGLIESVSEGDSEKLSQLVFEFDKFSKLDKWKTTI
                     MLKIKETITEAEDDLL"
     gene            complement(471651..471723)
                     /locus_tag="CAGL0F04675r"
                     /db_xref="GeneID:2887582"
     tRNA            complement(471651..471723)
                     /locus_tag="CAGL0F04675r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (AGC) cove score=75.92"
                     /db_xref="GeneID:2887582"
     gene            <472760..>473878
                     /locus_tag="CAGL0F04697g"
                     /db_xref="GeneID:2887639"
     mRNA            <472760..>473878
                     /locus_tag="CAGL0F04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446175.1"
                     /db_xref="GeneID:2887639"
     CDS             472760..473878
                     /locus_tag="CAGL0F04697g"
                     /inference="similar to AA sequence:UniProtKB:Q06146"
                     /note="similar to uniprot|Q06146 Saccharomyces cerevisiae
                     YLR257w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446175.1"
                     /db_xref="GeneID:2887639"
                     /db_xref="GOA:Q6FUB9"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB9"
                     /translation="MSAERYPSVPSLVGDSVRSIKGTGTEPVARSDPRNDVKILNKLH
                     DTVANHNQSQQLSGSSYTSVEDLNKEGALLTDEVDLELSHVDGKVQRKDGEVDFNIAD
                     RKLGESELEKQRKRKLMLLKQKQKNRELSSTSLSRMDIQSSSSQTSLTHLDDETKEEL
                     DRVSRSQERERQRGSQMVSPTRGSDGLVRNSYGEYIKSTCNRPHLARGDSYQSSSNES
                     ENNLIDSAATPSERSGRTSFRRRLSTEYLRSLSRSLSRDPSKSTTRTNAITPSHSNNA
                     GNYTTSAPPSHHVVAIPGGDFIDNEKTRTVDQSLEDELYSTNNYSISQVELAQAANKT
                     LLNEAFDEEEEEGALLDDQGNEEHDRELERAAIKVEES"
     gene            <475180..>477294
                     /locus_tag="CAGL0F04719g"
                     /db_xref="GeneID:2887785"
     mRNA            <475180..>477294
                     /locus_tag="CAGL0F04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446176.1"
                     /db_xref="GeneID:2887785"
     CDS             475180..477294
                     /locus_tag="CAGL0F04719g"
                     /note="highly similar to uniprot|P27472 Saccharomyces
                     cerevisiae YLR258w GSY2 UDP-glucose--starch
                     glucosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446176.1"
                     /db_xref="GeneID:2887785"
                     /db_xref="GOA:Q6FUB8"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB8"
                     /translation="MSRDLKNNLLFEVATEVANRVGGIYSVLKSKAPVTVAQYKDNYH
                     LIGPLNRATYQSEVDLLDWNDPSIFSDELKPIQQTLQSMASRGVRFEYGRWLIEGAPR
                     VILFELDSVRGYLNEWKGDLWSLVGIPSPENDWETNDSILLGYTVAWFLGELAHLDSK
                     HAIIAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGDFDFYNGIEHVDV
                     DHEAGKYNIYHRYCIERAACHSADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVVKF
                     QAFHEFQNLHALKKEKINEFVRGHFHGSYDFDLDNTVYFFIAGRYEYKNKGADMFIEA
                     LARLNYRLKVSGSKKTVVAFIIMPAKNNSFTVEALRSQAVVKSLENTVDEVTRSIGKR
                     IFDHAMKFPHNGITNELPTNLDELLKPSDKVLLKKRVLALRRPWGELPPIVTHNMVDE
                     GQDLILNKIREVQLFNNASDRVKMIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYY
                     EPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIETNQAKDYGIYIVDRRFKAPDESVE
                     QLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRAYPEQFKQ
                     LVGEELSDLNMESLTGGKKFKISRPLSVPGSPKDARSNSAVYMTPGDLGTLQEANNVD
                     DYFNLSVSGDGDDDDENYAEHN"
     gene            <478256..>479584
                     /locus_tag="CAGL0F04741g"
                     /db_xref="GeneID:2887937"
     mRNA            <478256..>479584
                     /locus_tag="CAGL0F04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446177.1"
                     /db_xref="GeneID:2887937"
     CDS             478256..479584
                     /locus_tag="CAGL0F04741g"
                     /inference="similar to AA sequence:UniProtKB:P22517"
                     /note="similar to uniprot|P22517 Saccharomyces cerevisiae
                     YOL016c CMK2 Ca2+/calmodulin-dependent ser/thr protein
                     kinase type II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446177.1"
                     /db_xref="GeneID:2887937"
                     /db_xref="GOA:Q6FUB7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB7"
                     /translation="MVDNKDENKDKPAVRKPEQVEGHTVTKFFNKLNGQPESYVSKSN
                     YVFGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYDELSILQMLK
                     HPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDYM
                     HSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEV
                     LTNNGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNI
                     SDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRDA
                     IEIVKLNNRIKKLRSLYMVETDTDIEENVASVAFNTLASSLNDLRLHSQKRVGQLTAE
                     QRRLKSALTQDTFAQIVRAATKNKERIWGEKTASPTPSQSSTSSTSTNKK"
     gene            complement(<479691..>481514)
                     /locus_tag="CAGL0F04763g"
                     /db_xref="GeneID:2887780"
     mRNA            complement(<479691..>481514)
                     /locus_tag="CAGL0F04763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446178.1"
                     /db_xref="GeneID:2887780"
     CDS             complement(479691..481514)
                     /locus_tag="CAGL0F04763g"
                     /note="weakly similar to uniprot|P43596 Saccharomyces
                     cerevisiae YFR013w IOC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446178.1"
                     /db_xref="GeneID:2887780"
                     /db_xref="GOA:Q6FUB6"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB6"
                     /translation="MDGALKRKRQFTFDDFTTVKVVSRPEKLAKVIPAPSTADGDDKA
                     DPEAIEVLSEETEIEHTLRLKQFSKEDTIKSSHVSIDTGTYGEYGNADLMKLLKLNPV
                     AYAGRIVKIMAMIDKFDACFDPHLHSLTFRDFEVGLSLVDVGGNTDTDAEDKMDLLLF
                     TFLKLLNVQSVKSNFNPPTLHQLKNGNKPYSKMFSKVRTISSTSDWGYPREWRQLADE
                     ENPINTLTLSRAGLKVLEPNDRILLLECLSDWCLSYAPHINAEIFRLSHLKEEPSIGI
                     ATYMMPNYTAKTYDEIRDDYLALCKSERERYELRWKRRHSYKSANFDKKFEIYKKIRE
                     KYYAASYTERDNIDIRLYDLWSKLFELEGLDNPLNDPYTNEVYKLRKLESLVMALKDI
                     GEFYVPSLSSYKDSNKINTKNGMTIKRRMDSYKYKGFCKDHSIVTKQSGCISEFTLLF
                     FDKVKLARDITQGTDKKGDSYWYALARNDNEFEQLISNLKDLEKLSFEKSDDKMKFLL
                     QNVKEWQDIGTAISRSNLQTTSAEESTSGERLRNLRSRKALHEAFDYTESDNEDLDNT
                     SDYDDDVIDSVDEFSEADTSVVEDHSLTRAERLQRRKLRRY"
     gene            <482637..>484547
                     /locus_tag="CAGL0F04785g"
                     /db_xref="GeneID:2887772"
     mRNA            <482637..>484547
                     /locus_tag="CAGL0F04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446179.1"
                     /db_xref="GeneID:2887772"
     CDS             482637..484547
                     /locus_tag="CAGL0F04785g"
                     /note="some similarities with uniprot|P40463 Saccharomyces
                     cerevisiae YIL135c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446179.1"
                     /db_xref="GeneID:2887772"
                     /db_xref="GOA:Q6FUB5"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB5"
                     /translation="MIADLSRTATNNEQEESPMIFERDVEDPCMMNSTSTISRQTSNT
                     SLLHTTSNQRKYSTNSNTGLNLYYTHTVSSSPQVPNSSSNSNNNNQISNASEYQNNFP
                     NISKSSTNVSMDNCVEQEVIYQNPMNHRRTLENFVPPALDEGCSIVTDDATDLEDVDM
                     VFVQSRKPSTLGLDMALGRTRSMSTLKPLSNGDELSNVPSNSSEQSTSPRLFRFYSYA
                     DMLSEDNYLHNKHTTKRPSFTHHSLSSNVLQKSKTAGQPTNHSASNLIGTSPPKTQSF
                     VNPFIISRRYSSNAGPIQTATVPIPTAPGAVGSRSQSNLLRQGSYNTLSPNMTPMSNN
                     STPSAGNIGNNNNNFNNKPADRFMRTSQRPAIFKNYSASGLSEVGSPTSPTLSLSTSP
                     RIGPNSRSLTTSPPSVTSPMMIKSGRSNSANIMGTSSRSPRSTTGDKYKISTVSARRK
                     TDQLKKNLTKFHIESSGSEGYSTDEEYDGETSCTSGKDAKKKSIDSNVFDDDDNDSDN
                     EQSSGHKSADNEVDPLSEDLNGNGHTFFPSNIKINKEKLQKNLMSSFEKFQSSKIWRN
                     SIGGTNSPKQNSNSSHNTNETPTNSHPNSFLRQSNNSNSCSTITAVINEANSGTTSIP
                     KATKSVSSTLEE"
     gene            complement(<485300..>486685)
                     /locus_tag="CAGL0F04807g"
                     /db_xref="GeneID:2887877"
     mRNA            complement(<485300..>486685)
                     /locus_tag="CAGL0F04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446180.1"
                     /db_xref="GeneID:2887877"
     CDS             complement(485300..486685)
                     /locus_tag="CAGL0F04807g"
                     /inference="similar to AA sequence:UniProtKB:P16547"
                     /note="similar to uniprot|P16547 Saccharomyces cerevisiae
                     YIL136w OM45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446180.1"
                     /db_xref="GeneID:2887877"
                     /db_xref="GOA:Q6FUB4"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB4"
                     /translation="MSKAVITGAAAATAAVAAITFNQAVNEQGKRKQTALSITRDHQA
                     CSWTRIKEGLWDDAVSFKDALLLRGIYNDNTAKYIERGRDDLAQQISDSVKSSPPPQL
                     QRSVKGRNVFSSMDEDRRNERDDSQDNKSIFNWGYNDIEKAKAVAIGEFDAANKKYND
                     ILDKWKHSKTSFFSAGDAALKEQVENCKKMLEEKRQALKKASEDFNQYTKQSFNEISN
                     NIDKQDVLNGIQNKKQDLWSWLKDDTSKDGKPDVDKLAAASVVGWGERAQEFAEEELE
                     ERRRSMQIGPSEAQRRLDELKKYKENGWFTYRKGDETEEEMAKRVIKGLEGWGETAAQ
                     LAREEYEDLKWQAAKTKEEAAALVDDASQKLAEAKSDVDKTASKWWQFGKEKKDEVHE
                     KSLANYEAAKRDYENSKKALQKWTDKQRGNFWDMANDSVSSIQGQVDKAHEVVTDKLD
                     DAKSYTKEKKN"
     gene            <487684..>488292
                     /locus_tag="CAGL0F04829g"
                     /db_xref="GeneID:2887774"
     mRNA            <487684..>488292
                     /locus_tag="CAGL0F04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446181.1"
                     /db_xref="GeneID:2887774"
     CDS             487684..488292
                     /locus_tag="CAGL0F04829g"
                     /inference="similar to AA sequence:UniProtKB:Q06449"
                     /note="similar to uniprot|Q06449 Saccharomyces cerevisiae
                     YPR154w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446181.1"
                     /db_xref="GeneID:2887774"
                     /db_xref="GOA:Q6FUB3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB3"
                     /translation="MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGAS
                     PVPPPMSLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSN
                     YVRPAAAPSANLAPPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYYQAPPQQVVV
                     EQQPVQQSSAHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF"
     gene            complement(<488804..>490582)
                     /locus_tag="CAGL0F04851g"
                     /db_xref="GeneID:2887719"
     mRNA            complement(<488804..>490582)
                     /locus_tag="CAGL0F04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446182.1"
                     /db_xref="GeneID:2887719"
     CDS             complement(488804..490582)
                     /locus_tag="CAGL0F04851g"
                     /inference="similar to AA sequence:UniProtKB:Q12374"
                     /note="similar to uniprot|Q12374 Saccharomyces cerevisiae
                     YPR155c NCA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446182.1"
                     /db_xref="GeneID:2887719"
                     /db_xref="GOA:Q6FUB2"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB2"
                     /translation="MIIDSQVVLKLDAIDKQLSQALQVLLVQGIEDSQQLQSLQRSLY
                     SIKKIVDDLVNRLSRQNSTKVYIDLQKVLDTLENACIDTLGDSKVLDLFKNALVQYTI
                     VIAYYDLLSDSLVSLPQAYDALDYYNSISASRAKSWYYGLQCMVPRFIKHSYENKTEL
                     LRPRMDLIMLRNFQFVGIAKHRNELLTKPWRYLNVLVHLPLSVIRDDLSKKLAVETEL
                     VNEHTIKLGELLDDFNSSIDTNEDMDNHISRLSSHLNVEGQPVDSLTRLKLIVLNIKE
                     LQEQKPNTLVKKPNFISRNWPVLLVGLLYGPSSIIAVWQSRYKILEFLQHNVVDFVTG
                     LMYNWVYTPLKQVWATVRHDEGSAISVTSQSTLDSEMSSLSRMIVSFVVENSDHRELI
                     NENQLISQVEHGDLTQFLKIYETQLSHPIKNIVTGSLVRSLLIQVQKTKVDGSLALNG
                     IDKMLKSQQLVFGILAMSPALAIIYTSFVALKRFVKLGSVWSNIQKYKYRISVSLNNI
                     ERIINDFKDTETGAISKGKDEYLKEGLLLIEISTLHELGKKIVPKKRISEWCRDVQEL
                     MTHSKSSRQTHLNVVNRIYHVYGRYL"
     gene            <491732..>493813
                     /locus_tag="CAGL0F04873g"
                     /db_xref="GeneID:2887748"
     mRNA            <491732..>493813
                     /locus_tag="CAGL0F04873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446183.1"
                     /db_xref="GeneID:2887748"
     CDS             491732..493813
                     /locus_tag="CAGL0F04873g"
                     /inference="similar to AA sequence:UniProtKB:P32486"
                     /note="similar to uniprot|P32486 Saccharomyces cerevisiae
                     YPR159w KRE6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446183.1"
                     /db_xref="GeneID:2887748"
                     /db_xref="GOA:Q6FUB1"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB1"
                     /translation="MTVRNLTGRDYRSSRSSSFDNNTGNPFLASEEENDDDRSSSSFI
                     HYDRDASRQAALEGLDGQRHVSDYKGYYSKNNTAQNLNTGNGNTPNLDNSKRYFSQTS
                     LNTGLTRNDILSPPEFDRYPLVGSRVASSTQLHQQAYSSSPVPRMASSPDNSGSSFSS
                     TNNNTFLGEQDFSPFGGYPASSFPLLMEEKEDDDYLHNPDPEEEARLDRKRFSNDFKY
                     MDKRSAGGLAGVLFLFIGLGCLFILLPALTYTGVTEHAKPVVQEILSAYQYPQLSAIR
                     TKLVDPDTPQSALSRQARDGSYWKLVFSDEFNAEGRTFYDGEDQFWTAPDIHYDATKD
                     LEWYSPDASTTRNGTLQLRMDAFKNHNLYYRSGMLQSWNKLCFTQGAIEVSANLPNYG
                     RVSGLWPGLWTMGNLGRPGYLGSTDGVWPYSYSSCDAGITPNQSSPDGISYLPGQRLS
                     VCTCDGEEHPNQGTGRGAPEIDILEGATDTVLGVGTASQSYQVAPFDIWYIPDYDFIE
                     IHNFTTTTMNTYCGGPFQQAISAVTTLNTSWYQYGEGSGYYQKFAIEFLNDDEDGYIQ
                     WYVGDKATWTLMNTALHANGNIDNRHVSKEPMSIILNLGISNNWAYIDWQMIYFPVTM
                     SIDYVRIYQPNNSVSVTCDPPDYPTYDYIKDHPIVYNDANVTKWNLAGYSTPKNILTG
                     NCKSSKFKLSS"
     gene            <495596..>498295
                     /locus_tag="CAGL0F04895g"
                     /db_xref="GeneID:2887861"
     mRNA            <495596..>498295
                     /locus_tag="CAGL0F04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446184.1"
                     /db_xref="GeneID:2887861"
     CDS             495596..498295
                     /locus_tag="CAGL0F04895g"
                     /note="highly similar to uniprot|P06738 Saccharomyces
                     cerevisiae YPR160w GPH1 glycogen phosphorylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446184.1"
                     /db_xref="GeneID:2887861"
                     /db_xref="GOA:Q6FUB0"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="UniProtKB/TrEMBL:Q6FUB0"
                     /translation="MSPTSSSTTNDMITEEPSNHRQVPRLTRRLTGFLPQEIKSIDAT
                     IPLKSRALWNKHQVKKFEKPDDFQDRFIDHVETTLGRSLYNCDELAAYEATSMSIRDN
                     MIIDWNKTQQKLTTRDPKRVYYLSLEFLMGRALDNALINMDNGEDKANEQPRKVIKGA
                     LDELGFKLEDVLDQEPDAGLGNGGLGRLAACFVDSMATENIPAWGYGLRYQYGIFAQK
                     IINGYQVETPDYWLNFGNAWEIERNEVQIPVTFYGYVDRDGKDTTTLSPSQWIGGERV
                     LAVAYDFPVPGFKTSTVNNLRLWQARPTTEFDFAKFNNGDYKNSVGEQQRAESITAVL
                     YPNDNFAQGKELRLKQQYFWCAASLHDILRRFKKSKRPWSEFPDQVAIQLNDTHPTLA
                     VVELQRVLVDLEKLDWHEAWDIVTKTFSYTNHTVMQEALEKWPVGLFGHLLPRHLEII
                     YDINWFFLQDVAKKFPKDVDLLSRISIIEESSNERHIRMAYLAIVGSHKVNGVAELHS
                     ELIKTTIFKDFVKFFGPSKFTNVTNGITPRRWLKQANPKLAELISEILKDPSEDYLLD
                     MAKLTELNKYAEDPEFQQKWNEIKQYNKLRLADLIKRENDGVDLIDRAHISDTLFDIQ
                     VKRIHEYKRQQLNVFGVVHRYLAIKEMLRNGASLAEVEKRYPRKVSIFGGKSAPGYYM
                     AKLIIKLINSVGDVINNDKEIGDLLKIIFIAEYNVSKAEIIIPASDLSEHISTAGTEA
                     SGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNIFLFGNLAENVEDLRYNHQYNGHE
                     IPESLSKVLEYIESGELTPENPNEFKPLVDSIKQHGDYYLVSDDFESYLTTQDLVDEV
                     FHSQKKEWIKKSILSVANCGFFSSDRCIEEYADTIWNAEPVKP"
     gene            complement(<499132..>501180)
                     /locus_tag="CAGL0F04917g"
                     /db_xref="GeneID:2887862"
     mRNA            complement(<499132..>501180)
                     /locus_tag="CAGL0F04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446185.1"
                     /db_xref="GeneID:2887862"
     CDS             complement(499132..501180)
                     /locus_tag="CAGL0F04917g"
                     /note="weakly similar to uniprot|P28006 Saccharomyces
                     cerevisiae YOR178c GAC1 ser/thr phosphoprotein phosphatase
                     1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446185.1"
                     /db_xref="GeneID:2887862"
                     /db_xref="GOA:Q6FUA9"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA9"
                     /translation="MGSIMYKRKSESLKNVRFAPELTTVRKFDSDSEPISISSSNQSS
                     PELSFSNTQSNTLNIPEYNLPPILFNPVTNYSLGNDTPLGRSQKLFRLGVDDEDEDID
                     DNDADSFGDYTSTDSETDLGNLDGLDVDSFDIVDCNILDTNLVPFSQKYNLNHYRYDD
                     VKDISKIETMIFNYLNGSNIKLHNLQKKTNKLKGLIYVNNLNFEKFIEVKFSFNNWKD
                     IHYATATYNKSITDHIDEFRFTIDVMTFKYILKSKGLIYCDSYSNEDCTYCDLSMDLC
                     CRYDVNNETYYDNNNYKNYHISMVVVTAPNSVGIQELRKTTSEPIMSTMSNSNQKRHN
                     SSKHHSQQHSFQTDFLTTTTLSHNLFFHNNSYSRRFSDDTDYYNTSPLKHLYHNDTTL
                     IKPTRINEVLNANELESPQDPNYDAGFLETHSYNYTNKPITTNYNSTAAYIQNTLGDM
                     HFHDSMVEESKTGTGVDLKKVYKNNLNFQFLNSDEEESHNPLNASDLGNFNLQRNTRP
                     KTPISILKNNNNFEDVESDVHPVVDLSKVRNFTLNPNNSSETLVIHNFATSDESSNQS
                     YYSAENADDDVNCTSNNTSPSDTPSSEVASILNSGNSLDISSVSDDAELAGSEYLEAK
                     GFQNTMGKLGYTDNMNTLHKNPLDYQSILNSYCFYEPRRESYNSTCYDGDDDYNNGNE
                     "
     gene            <503890..>506208
                     /locus_tag="CAGL0F04939g"
                     /db_xref="GeneID:2887863"
     mRNA            <503890..>506208
                     /locus_tag="CAGL0F04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446186.1"
                     /db_xref="GeneID:2887863"
     CDS             503890..506208
                     /locus_tag="CAGL0F04939g"
                     /note="highly similar to uniprot|P29496 Saccharomyces
                     cerevisiae YLR274w CDC46 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446186.1"
                     /db_xref="GeneID:2887863"
                     /db_xref="GOA:Q6FUA8"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008048"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA8"
                     /translation="MSFDRPEIYSAPVLQGESANDDDNTEIIKAFKRFILEFRLDSQF
                     LYRDQLRNSLLVKNYSLSVDLEHLIGYNEDLYKRLSDEPSDVIPLFETAITQVAKRIM
                     ILNKSSNTNDGLDDIDENSNDLADDEDGITDIPVFQLILSSRANQVSLRQLNSEHVSN
                     IVRLSGIIVSASVLSQRATHLSLMCRNCRHTMSLNINNFNSITGNSVTLPHSCQSTNN
                     NSTAAYIHDTGDDPTGSGAASKNCGPDPYIIIHESSKFIDQQFLKLQEVPELVPVSEM
                     PRNITMTCDRYLTNRVNPGTRVTIEGIYSIYNSKKRSGAAGQSGSGVAIRTPYIKVLG
                     IQTDVEASSIWNSMTMFSEEEEEEFLQLSRRPDIYELLANSIAPSIFGNQDIKKAIVC
                     LLMGGSKKLLPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAG
                     LTASVQRDPITKEFFLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAK
                     AGITTVLNSRTSVLAAANPIYGRYDELKSPGENIDFQTTILSRFDMIFIVKDEHNEER
                     DISIANHVMNIHTGHTDAQLEANGSELSIEKMKRYITYCKSRCAPRLTPEAAEKLSSQ
                     FVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAEERHVDEAIRL
                     FQASTMDAAAQDPIGGMNQTNSLSDIRRVEQELKRRLPIGWSTSYQTLKREFVDTNKV
                     SQSSLDRALYALEKHETIQLRYQGQNIYRSGI"
     gene            <506566..>507027
                     /locus_tag="CAGL0F04961g"
                     /db_xref="GeneID:2887871"
     mRNA            join(<506566..506570,506700..>507027)
                     /locus_tag="CAGL0F04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446187.1"
                     /db_xref="GeneID:2887871"
     CDS             join(506566..506570,506700..507027)
                     /locus_tag="CAGL0F04961g"
                     /note="highly similar to uniprot|Q06217 Saccharomyces
                     cerevisiae YLR275w SMD2 U1 snRNP protein of the Sm class"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446187.1"
                     /db_xref="GeneID:2887871"
                     /db_xref="GOA:Q6FUA7"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027248"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA7"
                     /translation="MSEAIISRPKSELSKEELEQLEEFEFKHGPMSLINDAMITRNPV
                     IISLRNNHKLIARVKAFDRHCNLVLENVKELWTEKKNKQTINRERFISKLFLRGDSVI
                     VILKAPLQ"
     gene            complement(<507217..>509004)
                     /locus_tag="CAGL0F04983g"
                     /db_xref="GeneID:2887936"
     mRNA            complement(<507217..>509004)
                     /locus_tag="CAGL0F04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446188.1"
                     /db_xref="GeneID:2887936"
     CDS             complement(507217..509004)
                     /locus_tag="CAGL0F04983g"
                     /note="highly similar to uniprot|Q06218 Saccharomyces
                     cerevisiae YLR276c DBP9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446188.1"
                     /db_xref="GeneID:2887936"
                     /db_xref="GOA:Q6FUA6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTTIASEAYIDDSVNFESFKLDARLLQAIKGSGFTHPTLIQSHA
                     IPLALEEKRDIIAKAATGSGKTLAYLIPVIQTILDYKKSRTNGDEPGTLGIIMVPTRE
                     LTQQVTAVLEKLIHYCSKDIKVLNLAADLSTSVLNTLLSENPEIIVGTPSKILNILER
                     NTDTVGIDDLKFLVIDEVDLVLTFGYQDDLDKIAEYLPLKKNLQTFLMSATLSDDIQS
                     LKQKYCRSPAIIKFNDDEINKDKTKLVQYYVRVGEFDKFLFCYVIFKLGLIKGKTLVF
                     VNNIDRGYRLKLVLEQFGIKSCILNNELPANSRQHIVDQFNKNVYHLLIATDDADNIK
                     EFDDEQKDDIQVEEKNDETNTVVAEESTNSTTGIKSKTKNNYKQDKEYGVSRGVDFKN
                     VACVVNFDLPTTAKAYVHRVGRTARAGKSGTAISFVVPLKEFGKHKPSMLPSAKKDEK
                     ILSRIIKQQSKLGLEIQPYSFDLKQVEGFRYRMEDGFRAVTQVAVREARIKELKEELL
                     ASEKLKRHFEENPIELKSLRHDKELHPARVQNHLKRIPEYLLPENARTDKKKISFIPF
                     HKPNKVGKKSKNSKNKKRKGGKTDALKKF"
     gene            complement(<509393..>511708)
                     /locus_tag="CAGL0F05005g"
                     /db_xref="GeneID:2887906"
     mRNA            complement(<509393..>511708)
                     /locus_tag="CAGL0F05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446189.1"
                     /db_xref="GeneID:2887906"
     CDS             complement(509393..511708)
                     /locus_tag="CAGL0F05005g"
                     /note="highly similar to uniprot|Q06224 Saccharomyces
                     cerevisiae YLR277c BRR5 component of pre-mRNA
                     polyadenylation factor PF I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446189.1"
                     /db_xref="GeneID:2887906"
                     /db_xref="GOA:Q6FUA5"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011108"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="InterPro:IPR022712"
                     /translation="MDVKERSNQFRFFSLGGGNEVGRSCHIIQFKGKTIMLDAGIHPA
                     YQGMASLPFYDDFDLSIVDVLLISHFHLDHAASLPYVMQKTNFKGRVFMTHPTKAIYR
                     WLLRDFVRVTSIGSQSSNAEDDNLYSNEDLIESFDKIETIDYHSMIDVNGIKFTAFHA
                     GHVLGAAMFQIEIAGLRVLFTGDYSREIDRHLNSAEVPPLPSDILIVESTFGTATHEP
                     RLHREKKLTQLIHSTVNKGGRVLMPVFALGRAQELMLILDEYWSQHKEELGSNQIPIF
                     YASNLARKCLSVFQTYVNMMNDNIRKKFRDSQTNPFIFKNIAYIKNLDEFQDFGPSVM
                     LASPGMLQNGLSRDLLERWCPDEKNLVLITGYSVEGTMAKYLLLEPDTIPSVSNPEVT
                     IPRRCRVEELSFAAHVDFQENLEFIEQINASNIILVHGEPNPMGRLKSALLSNYASFK
                     GTEDEVHVHNPRNCYELDIECKGVKVAKAVGNIVDEIKRTEEEVVKPENDAGQSKEGI
                     EEFTGKTQDVRKDAEGEGAIISSILVSDEKNFDLNLVSLSDLREHHPELSTTVIRERQ
                     TIQVDCKKELIYWHICQMFGDVSVLIDDDNVTNTKETKLETSRGMLVLQIMGAIRLTV
                     QHNKAILEWTQGLISDTIADSIIAILMSVDSAPVSVKKSSNSCSHGHEHATPILSQPS
                     ETDKIKQVAELFKTQFGDSFTLILNKDDDNDTAEEKEDDEFVKGLITIGKNTASINFT
                     DMCVVECNSNPLKGRVESLLKIGIDMVSSLC"
     gene            complement(<512367..>512930)
                     /locus_tag="CAGL0F05027g"
                     /db_xref="GeneID:2887816"
     mRNA            complement(<512367..>512930)
                     /locus_tag="CAGL0F05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446190.1"
                     /db_xref="GeneID:2887816"
     CDS             complement(512367..512930)
                     /locus_tag="CAGL0F05027g"
                     /inference="similar to AA sequence:UniProtKB:Q05863"
                     /note="similar to uniprot|Q05863 Saccharomyces cerevisiae
                     YLR281c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446190.1"
                     /db_xref="GeneID:2887816"
                     /db_xref="GOA:Q6FUA4"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA4"
                     /translation="MLFSLIYGRKLADKILRQSNTHSIFTCSTQLIKKNKLPPRPKFD
                     ASMEADIEEKFLHGGTGPGGQKINKCNSKVQIKHVPSNIVVTCQATRSRDQNRKIARE
                     KLALELERWQLGQEKDGNSGVQVMTEREQALLEWKRQQKRSKGKKSRLKHELAKQKRE
                     EEKKKELDELMEVFGDRIGNSSTSDRN"
     gene            <513288..>514169
                     /locus_tag="CAGL0F05049g"
                     /db_xref="GeneID:2887894"
     mRNA            <513288..>514169
                     /locus_tag="CAGL0F05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446191.1"
                     /db_xref="GeneID:2887894"
     CDS             513288..514169
                     /locus_tag="CAGL0F05049g"
                     /inference="similar to AA sequence:UniProtKB:Q05867"
                     /note="similar to uniprot|Q05867 Saccharomyces cerevisiae
                     YLR283w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446191.1"
                     /db_xref="GeneID:2887894"
                     /db_xref="GOA:Q6FUA3"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA3"
                     /translation="MRSALRESTKHIRTWRYTPRPKVIRAYHSTPLLQINSTQYLKEK
                     VSNKLTNDETPLDFINKLPEQLISQGNGLSPTDAAHQVNTLEYYKRLKYEGGFNSEQS
                     NAIIALLLEIIDDEFYKTYNTKFLRDMELNKQSHLFNSAETELKYAIQNSRDTQLNSQ
                     HLQMMILQRDLAILHDEINELIINLLNKDSKMDFNNQKLENTLLLKEVNLHLSGSTNK
                     IITKLMGEVKSDIENLRWQTTRSGLVAILLLVLMVMGAVSLTKNKASEEKKEAPTRTV
                     YDQSLSVASEEPPQAAT"
     gene            complement(<514361..>515221)
                     /locus_tag="CAGL0F05071g"
                     /db_xref="GeneID:2887801"
     mRNA            complement(<514361..>515221)
                     /locus_tag="CAGL0F05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446192.1"
                     /db_xref="GeneID:2887801"
     CDS             complement(514361..515221)
                     /locus_tag="CAGL0F05071g"
                     /inference="similar to AA sequence:UniProtKB:Q05871"
                     /note="similar to uniprot|Q05871 Saccharomyces cerevisiae
                     YLR284c ECI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446192.1"
                     /db_xref="GeneID:2887801"
                     /db_xref="GOA:Q6FUA2"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA2"
                     /translation="MKYDEKITYVKDGPFFIIKFNSPSTLNSLTGDDYIYIAELLGLA
                     DEDKDIYFTVLQSTGRFFSSGADFKSIAIAEQHEAASKKPTTTPNEVARHHDELQKWL
                     AYFSSRNVNVTNAFNQHSKVLVCCLNGPVIGFSAAICCLCDLVYVMNEKVYMLFPFAN
                     LGLVTEGAVASTLPRLVGSRSSFESLLFAKPVTFPEMSRAGLVNKNYSLNDTDKFNDQ
                     VLAELKEKIDGLHLPSCLGIKKLMKLEWEDRIERINSLEVNDGVKYWVKGEPQKRFRQ
                     VGSKQRKHKL"
     gene            <516481..>517278
                     /locus_tag="CAGL0F05093g"
                     /db_xref="GeneID:2887581"
     mRNA            <516481..>517278
                     /locus_tag="CAGL0F05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446193.1"
                     /db_xref="GeneID:2887581"
     CDS             516481..517278
                     /locus_tag="CAGL0F05093g"
                     /inference="similar to AA sequence:UniProtKB:Q06688"
                     /note="similar to uniprot|Q06688 Saccharomyces cerevisiae
                     YLR412w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446193.1"
                     /db_xref="GeneID:2887581"
                     /db_xref="GOA:Q6FUA1"
                     /db_xref="InterPro:IPR012942"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA1"
                     /translation="MARGIDELNSVIDSYREVIRKSDLFGKTIQCLQSYNISKIRCLA
                     LGSFAEEFPAKYQLALLLELLDNINTIKEVSLYDPVFNEVDKLFIKEQSNWHIVEQEH
                     YKDTGNCGETLFYMPHAPLDLTEEVIKREKPKLILGNEMSQHTDRYTEKQLYDKYPLL
                     SKLVYGSKNYSKVSNPKINVSAEGDGFVRQESKKSRRRKNKWHIEPTVIDYSSVPSYF
                     ADGLIMITNYKSSSTSEDGENTTVDLIKKGQEQWNHSFSDLSLFEIA"
     gene            <519640..>521724
                     /locus_tag="CAGL0F05115g"
                     /db_xref="GeneID:2887641"
     mRNA            <519640..>521724
                     /locus_tag="CAGL0F05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446194.1"
                     /db_xref="GeneID:2887641"
     CDS             519640..521724
                     /locus_tag="CAGL0F05115g"
                     /inference="similar to AA sequence:UniProtKB:Q06689"
                     /note="similar to uniprot|Q06689 Saccharomyces cerevisiae
                     YLR413w or uniprot|P34231 Saccharomyces cerevisiae
                     YKL187c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446194.1"
                     /db_xref="GeneID:2887641"
                     /db_xref="GOA:Q6FUA0"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FUA0"
                     /translation="MKFDKLLFTVTTVFAFTTFILIIIATAGSSSNYKPITNIKIGEA
                     DISHINVTKVVPQVGPILTILGSALTANASLDQIFDALKQVADTPALVPLLNLMSNSK
                     SNVTGTIGALTNLAPLALQKSDNTTDAALNSINMVIGDATNVDLLLDGMKEVVNSAME
                     SLTSPNFKNLTIMENEVFNLLLDSENVTATTEALIDMNQIPDADKQKLIPAFTLFKDS
                     SNLNATIDSMASLMNYSSALSSIPTAELSTLFSTVSSLASSKSSLISTITALSSKLPS
                     NLAPAVSSLTTLLNSTNEDSLNSTLNALQTLILKNNITASVDSAKTSINSIKIMNEYA
                     QNKTLLLDSVEDLATQTSVPSNTTTAQLKALDDIFQGSGNASATLRTLMGLEQGLTAN
                     PSLIKYVPYIFELLDDSNNATLSFTSLLNLTSFAKSNPTTFVPIMSILGKANSITPVT
                     QDQLRELTPAILEYLHIPIKFHLSIFTLCKADINDKIISCSKSHAVQNLDFRSIIYDS
                     IAESDFKPYLEALKIGKQDLHLDGKMQNRQHEYVPAIRASLSMNLLAIIVSFFLMCYA
                     IFLLVSKNAMTHMKWCILFFLTMNSALFSGLGGTIISAMINIIKSGTHDDKYGVVFDD
                     NSSILGLLWCAFTVAFLSYVAATLSWFQFWRENKNKPVTYLSSGTSSENESVTSRVTE
                     HANNKADEKESV"
     gene            <523941..>524624
                     /locus_tag="CAGL0F05137g"
                     /db_xref="GeneID:2887831"
     mRNA            <523941..>524624
                     /locus_tag="CAGL0F05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446195.1"
                     /db_xref="GeneID:2887831"
     CDS             523941..524624
                     /locus_tag="CAGL0F05137g"
                     /inference="similar to AA sequence:UniProtKB:P47032"
                     /note="similar to uniprot|P47032 Saccharomyces cerevisiae
                     YJL079c PRY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446195.1"
                     /db_xref="GeneID:2887831"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR002413"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="UniProtKB/TrEMBL:Q6FU99"
                     /translation="MKVSTIFSVSLIAGALAAPAVVTVTKEAPPARVTVQAVVNVEDG
                     GRQSSLSTLEKKTKTKSQKKTKPTPSTDLDKRAQKKRSNLSEWQQKMLDQHNKKRELH
                     KDTDSLVWNDNLAILAQSYADRYDCSGNLAHNPEFIEAIGENLAVGYDDIDAIDAWYD
                     EIQHYDYSNPVHQGRTAHFTQLVWKDTKNVGCAYKTCGGDLYNYIVCEYDPAGNWAGE
                     FADNVKPLK"
     gene            <525230..>527617
                     /locus_tag="CAGL0F05159g"
                     /db_xref="GeneID:2887736"
     mRNA            <525230..>527617
                     /locus_tag="CAGL0F05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446196.1"
                     /db_xref="GeneID:2887736"
     CDS             525230..527617
                     /locus_tag="CAGL0F05159g"
                     /inference="similar to AA sequence:UniProtKB:Q03388"
                     /note="similar to uniprot|Q03388 Saccharomyces cerevisiae
                     YDR485c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446196.1"
                     /db_xref="GeneID:2887736"
                     /db_xref="GOA:Q6FU98"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:Q6FU98"
                     /translation="MSESEQSSDEQELLINTRQRRSNAGNRLQKLLEQEIEELQTRTQ
                     ALDEDEIDLLFKEDEEDADFEMVDDEDNESHNEEENEIDNADGKEESEVPTESKDSEL
                     QDEDVMLSDSSSEDEPDNQDDESGEKELIRQERLKKKKLQKLRKKPLVIKRTAPIIDS
                     ENKTKKRKVSSDVINAEDLLSNNRRTSSRSSVIQNKLQVYEKLSQAEKRRQIIRERMQ
                     KSRDKEQIKVLTQEDRMRIALETEQANLLSLNKYKEQEVSKKQHRLAMQQRQKMKFKP
                     GEMIITELSTTWEVTPVMEIEDYEYWKEQIEKRNKKKKKYPRKPRKKNNEGAESHRNG
                     GDVCQKEVSDTHIEISRPIIYDNGNIYLNQSYFNNKCNYQKDNATDLDGNKHMCIPLE
                     NNSEPRSILPDDLEQNRQKADYISILDSETNNLSSGIIPQASFIEVNNQDLSENSDIF
                     TGTSIKMDVDSLKVEGKNGLNISEENSSVDVPAKMGERWIKNGITVPSDGVNSSVDLN
                     ISKFVAGPTIDEEINKVTTVANDDNKASTHQRNIKIEECGEDMSLKHAQNEDLDVTAS
                     IKNSSDAKTERGELIDQSLNNDVPNENIADTMDSEEQKRIYEGPNQMVSKNFVVAYTV
                     VHDTLSKPTHDLLFGSGWKGPPNKSYDTETLFVSKNNNGAVDDITSEIKPDLTFLEKY
                     PAFGEFERKVVQEVSENTAKDLEINIKTAPPTGIFLPSGMRKKCLINNKDCHYFDPKN
                     GVPYSDVEAYKIIQELQSFDVNPETNHFFKWQGFANGGIFLDVNEKPAEGVPDNF"
     gene            complement(<527696..>529534)
                     /locus_tag="CAGL0F05181g"
                     /db_xref="GeneID:2887977"
     mRNA            complement(<527696..>529534)
                     /locus_tag="CAGL0F05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446197.1"
                     /db_xref="GeneID:2887977"
     CDS             complement(527696..529534)
                     /locus_tag="CAGL0F05181g"
                     /inference="similar to AA sequence:UniProtKB:P39904"
                     /note="similar to uniprot|P39904 Saccharomyces cerevisiae
                     YDR484w SAC2 suppressor of actin mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446197.1"
                     /db_xref="GeneID:2887977"
                     /db_xref="GOA:Q6FU97"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:Q6FU97"
                     /translation="MDVLRETLGISADFQAKAIIDQDDPYSIFCKEHNQIGTTANQKL
                     SDDRNKLEHRREVLHNTIDNIIPPLKEYLNEFKNTLNEHTRDLDNIREKSTYLKTLLE
                     YNSDKLKNISPLVNDLIIPPEVIQDILHGKIDQSWQENIDFIMDKQEIYKKYKDQGFD
                     GLKPKDFNDLCDILDVLKLVILERSKKYIVFKIKSLRSNTPVPSQKLQYELMNVNKIF
                     QFMVENNLSMALELRQAYAYTMKWYYSAYFGRYIRSLTILSFKNIDNHYVLGNGLSIS
                     PPGYANTNNSGYSFSSYLMPTSLSTATVSDDSINQYFQVERRLDLLTKEDNTVMVSQI
                     AEHNQRENYLEIGFKNLNLAILDNCAAEFKFLSTFFKTNHNSEGELNGVLEQIFQPTF
                     NQAIEYTKQLIQNTFDIFGILISIRITNLLQYSIIQKSLPSAIDDFFSVQLITLWPKF
                     QQLIDIQCQNIRKLNITVRPGKNTGVADILSSPHELTVQFGKMIFSLLTLSVNHKENV
                     DERSEPLYQSIPRLRNEFETVMTKISKTTKSPEKFLAVNYLYLYNLMQQQKLTHLTEE
                     SMLSPVVQQGTFDQQIGEQQSNNAVPLLIKETEDHFKSLVEAFNKE"
     gene            complement(<529892..>530626)
                     /locus_tag="CAGL0F05203g"
                     /db_xref="GeneID:2887749"
     mRNA            complement(<529892..>530626)
                     /locus_tag="CAGL0F05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446198.1"
                     /db_xref="GeneID:2887749"
     CDS             complement(529892..530626)
                     /locus_tag="CAGL0F05203g"
                     /inference="similar to AA sequence:UniProtKB:P33312"
                     /note="similar to uniprot|P33312 Saccharomyces cerevisiae
                     YBR153w RIB7 HTP reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446198.1"
                     /db_xref="GeneID:2887749"
                     /db_xref="GOA:Q6FU96"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR011549"
                     /db_xref="InterPro:IPR024072"
                     /translation="MLRVRDDLPPFLKNYLPDGHRNGRPFVTLTYAQSIDAKIAKQRG
                     VRTTISHIETKEMTHYLRYFHDGILIGSGTVLADDPGLNCKWIGPNNDPDESMEEKSP
                     RPIILDPKLKWKYSGSKMEELCNQGMGKPPIVITTKTPKVKEANVEYMIMEPDANDRI
                     SWKSILDTLRRNYDMKSVMIEGGSHVINQLLMCSDLIDSLIVTIGSIYLGSEGVTVSP
                     PDEVKLKDISWWKGTSDVVMCSRLQN"
     gene            complement(<530902..>531330)
                     /locus_tag="CAGL0F05225g"
                     /db_xref="GeneID:2887675"
     mRNA            complement(<530902..>531330)
                     /locus_tag="CAGL0F05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446199.1"
                     /db_xref="GeneID:2887675"
     CDS             complement(530902..531330)
                     /locus_tag="CAGL0F05225g"
                     /note="weakly similar to uniprot|P38282 Saccharomyces
                     cerevisiae YBR152w SPP381 Suppressor of Pre-mRNA
                     Processing mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446199.1"
                     /db_xref="GeneID:2887675"
                     /db_xref="GOA:Q6FU95"
                     /db_xref="InterPro:IPR009730"
                     /db_xref="UniProtKB/TrEMBL:Q6FU95"
                     /translation="MSDSSEDYSTETSSSDEEPVFHKPVLLKKSTIIPNPDTIDNNEQ
                     KAQDKLKRSIDQANQIAYERDELRRQTELSYSASDKELIRKTLEIDDDDSIDPAKELD
                     LWSQRQQNRKERQRAILVRKQLSLEQDEINRINNRDDIVN"
     gene            complement(<531690..>532601)
                     /locus_tag="CAGL0F05247g"
                     /db_xref="GeneID:2887795"
     mRNA            complement(<531690..>532601)
                     /locus_tag="CAGL0F05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446200.1"
                     /db_xref="GeneID:2887795"
     CDS             complement(531690..532601)
                     /locus_tag="CAGL0F05247g"
                     /inference="similar to AA sequence:UniProtKB:P38281"
                     /note="similar to uniprot|P38281 Saccharomyces cerevisiae
                     YBR151w APD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446200.1"
                     /db_xref="GeneID:2887795"
                     /db_xref="GOA:Q6FU94"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FU94"
                     /translation="MTLLSDNAKQEIAKNIELIDDSCLNCDCQNEEGLDEIQSGEKVF
                     DKLVIDHETELFNSSKIPKVHFIVPTSQMDWQFDACMEKPNSVQYKISTWCSENTERL
                     SAITGCGGVSMNCNVTSMPLNILDIEAMRGTKNNVLVLPFGIWIQDLRSDNVEAILDE
                     LVPAILDPKTDIKQLIASKEYLYESHKKAFIFICSHKTRDKRCGITAPILKKIFDREL
                     QNHGLFRDNSDLRGDGVNVSYINHVGGHKFAANVQIYLKDQHTLVWFGRITPKDIPHI
                     VNHLIVPDHGKLPFPEKIRCVKKYDSW"
     gene            complement(<533759..>534334)
                     /locus_tag="CAGL0F05269g"
                     /db_xref="GeneID:2887791"
     mRNA            complement(<533759..>534334)
                     /locus_tag="CAGL0F05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446201.1"
                     /db_xref="GeneID:2887791"
     CDS             complement(533759..534334)
                     /locus_tag="CAGL0F05269g"
                     /note="highly similar to uniprot|P19073 Saccharomyces
                     cerevisiae YLR229c CDC42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446201.1"
                     /db_xref="GeneID:2887791"
                     /db_xref="GOA:Q6FU93"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FU93"
                     /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLVVGTQVDLRDDKVIIEKLRRQRLRPITAEQGERLARELRAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            complement(535530..535673)
                     /gene="tRNA-Ile (TAT)"
                     /locus_tag="CAGL0F05291r"
                     /db_xref="GeneID:2887814"
     tRNA            complement(join(535530..535566,535636..535673))
                     /gene="tRNA-Ile (TAT)"
                     /locus_tag="CAGL0F05291r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2887814"
     gene            complement(<536171..>536374)
                     /locus_tag="CAGL0F05329g"
                     /db_xref="GeneID:9487989"
     mRNA            complement(<536171..>536374)
                     /locus_tag="CAGL0F05329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999494.1"
                     /db_xref="GeneID:9487989"
     CDS             complement(536171..536374)
                     /locus_tag="CAGL0F05329g"
                     /inference="similar to AA sequence:UniProtKB:Q03482"
                     /note="similar to uniprot|Q03482 Saccharomyces cerevisiae
                     YDR210w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999540.1"
                     /db_xref="GeneID:9487989"
                     /db_xref="GOA:B4UMZ8"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ8"
                     /translation="MSQQYYQQGPPPPQQGYYQQGPPPQQGYYQQQPVYVQQAPPQKE
                     SSCMDQCLKLLCCCFLLELVCGD"
     gene            complement(<537631..>540165)
                     /locus_tag="CAGL0F05335g"
                     /db_xref="GeneID:2887930"
     mRNA            complement(<537631..>540165)
                     /locus_tag="CAGL0F05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446202.1"
                     /db_xref="GeneID:2887930"
     CDS             complement(537631..540165)
                     /locus_tag="CAGL0F05335g"
                     /note="some similarities with uniprot|P38994 Saccharomyces
                     cerevisiae YDR208w MSS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446202.1"
                     /db_xref="GeneID:2887930"
                     /db_xref="GOA:Q6FU92"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR016034"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q6FU92"
                     /translation="MLVLDKGSNSQNVAHQNQAIPNRDGDHKNIGWRRKSEKEDGEEE
                     DEDLYDRVHESSTPTSIEDMGKPRDLNKDRDAIKVDPSRPAETTGQSEAANKNTGLLI
                     PRNGDSSQKINEMNARAKKIDDRPLIKEQRSVNSKDKEGTSESDKKQVILNQQMINDL
                     KAIKRKSIEIEKQYHDQEQEELLDLIADENTKLVHTDSYIQSIHEDDDEFKINQNNDT
                     LDQDHVTDLPETNHSMGSPNVNDERHSKTGKITNRVTSSGSKQHEVPTRRSSILLNTS
                     TSRRSSSRRSTLDSIHIPNLKIQSSNHSQIHPIVTSTSSHRNSKASHSLTLNDVHKYT
                     NHSIISLPTHLHKHVQQNSPAAKTGANHSPIQSNTLTSVSTTSLPPLPAVNTTRNYEN
                     NDARNSSNDGGMLKRSQSATVEIQKMRELLLQKREMKRKRRSVIVDDDRVLIGNKVSE
                     GHVNFIIAYNMLTGIRVAVSRCSGIMKPLTPKDFKFKKKLAFDYHGNELTPSSQYAFK
                     FKDYCPEVFRELRALFGLDSADYLVSLTSKYILSELNSPGKSGSFFYFSRDYKYIIKT
                     IHHSEHIHLRKHIQEYYNHVKTNPDTLICQFYGLHRVKMPISFQNKIKHRRIYFLVMN
                     NLLPPHLDMHVTFDLKGSTWGRRTNVDEKRMEEDPMYRPVLKDLNWLEANQKIMFGPL
                     KSKKFLVQLKKDVELLAKLNTMDYSLLLGIHDMERASIEAGVADPEEQLVTSAAILDK
                     LGYKQNTLVPHFFKQNDGGIRASDQFNNDLKIIYFVGIIDCLTNYSLIKKLETFWRGL
                     SHDLSVVSAIPPRDYAHRFYEFIEESIEPTPSTRYTDNPNQTRYRD"
     gene            <541830..>543635
                     /locus_tag="CAGL0F05357g"
                     /db_xref="GeneID:2887680"
     mRNA            <541830..>543635
                     /locus_tag="CAGL0F05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446203.1"
                     /db_xref="GeneID:2887680"
     CDS             541830..543635
                     /locus_tag="CAGL0F05357g"
                     /note="some similarities with uniprot|P39001 Saccharomyces
                     cerevisiae YDR207c UME6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446203.1"
                     /db_xref="GeneID:2887680"
                     /db_xref="GOA:Q6FU91"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FU91"
                     /translation="MDTQGDLVPTKCTSAPNNTPVDSYTTSPQPEMKSSSVIDIAMED
                     DDEDDDEDEEEEEANEEEDAQSNDTTPVESRDQDSTAANSDSAASPSDTADPAPVHSA
                     DHEGVSSVSHTEEEQIGAENAVADPADGTLPNAEGVQVPSNEIPPTGKAADDVPLSNH
                     VEEDKSDGNGNEAKENVDTPQVNGGEATEAPVNTEDASTTDTANTDGMKETNGGVAGD
                     ANSNTVKLEVGDEGYVPPPPPKYINSKLDGLRSRLLLDPKENKQTPRHDEDVAQVLSN
                     MRSSPFSPSSNRLTPTSASSSSSSDKHHYHFTSTLSSSSILGRPLLFRSENSSPDFGS
                     PIGTENHIDTSDEKSPNMISETKSEISQNETSSLDDGESSKEAETTVSKPSTDNITTA
                     ESASETSTGNTVAENGKDEVVKSETDEIEDKEKAEKLTRFRSKIKEAERILREQKTRN
                     ITWIKSGKRINRESSTHDSSNSSIPKRLKTEPSTTIDKQRKIKLNKAPGADNKPPISA
                     ASKVKKEGERKRKPATRSRTGCWICRLRKKKCSEEKPACFNCQRLNLDCYYDAFKPDF
                     VADPVVRKQKMDEIRMKTKEAKRQAMKKKNARPAP"
     gene            complement(<544091..>547162)
                     /locus_tag="CAGL0F05379g"
                     /db_xref="GeneID:2887681"
     mRNA            complement(<544091..>547162)
                     /locus_tag="CAGL0F05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446204.1"
                     /db_xref="GeneID:2887681"
     CDS             complement(544091..547162)
                     /locus_tag="CAGL0F05379g"
                     /inference="similar to AA sequence:UniProtKB:Q03466"
                     /note="similar to uniprot|Q03466 Saccharomyces cerevisiae
                     YDR206w EBS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446204.1"
                     /db_xref="GeneID:2887681"
                     /db_xref="GOA:Q6FU90"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="InterPro:IPR019458"
                     /db_xref="UniProtKB/TrEMBL:Q6FU90"
                     /translation="MNAGTMSESEALVWNTINDFHERLNEILRTNQITHDYALLSGFL
                     TFVHSKLLKMTENNLNKQKQLYRQYKEYPSEMTEIFDNHTTVLILDALWGKIYYPIFK
                     WFQTLRNFIVPRKAGEQPKYFEFRKMSSKISKFYKEVQAFLNSIISLILMDPEIEATD
                     GVPPQVFVFFNLKKKAAKALPKKLRLSLKYNDPLANIVRLVLHRCILYLGSAQRYKIM
                     YEKISNRHSVEDFVKSKEYFDLASLLLPSSGETYLQRGMVYIQTDNLGTAVQEFIKGS
                     LAKSPCPAALSNFKTIILENDSTLHLRLDKLILDVHSQDLKGTKIVNREIIELYFLAI
                     FGSYFAPDVWTNPKKPGFLRNGLAVKTLELTLYEKIASRYIKNIETIYNDLIIGIGGF
                     NLLQLFGNMGPDSRVKILKSNTLTRNQLSYLSFVFTYITRIITDVIKEAWNGNHEVYL
                     YLAMLRIIGCWIFANESVLEFAKSNVAFCQAYADLLNDFLASGLVSYGPDNSVKPKRS
                     YLFEEDIQLRELGFIGDELDDFNDTKIHTSEDCMTRLVGKPHMEDKLSPKEEKLARLS
                     AIIVTGKQILSYNQCDIHFDTEKTQYKIPDSGIPDMKFKNNVQKNGRNKSGKQTGAVR
                     HYQQEVKDTLKEKTLTKNYQQSSSNFSNAKGIIPTEQNSSVVYSGISVKAPSTFDIKP
                     SFQMKQPGDTLAQDLGNLNLNSPMVNSVGPSYYANTVTGSAIQNSGSEMSTGHINDRS
                     ALNAEDEHRKYLNEIFRPNMSMSSVESSRRNSSLKGYLSPNLSANMLSSVDQSITTPT
                     SIMDSHRSSYGLPSWSGSSHTKGSEVNELNSGNGIMTGNSLYYDGRHIYPSYHSRMMS
                     MNSETTIVPDAPSPFADRNRTSFADSRGSGYAEQLLNSSVFQKQSSNKINARNFPTSA
                     QQLNVSNSHQLNQSPNLAQEYGYQNSTNSPYVNSSTNINQNYMTSIGPDSMSSLHEGS
                     QGYWPDQNRKDPQASASSFQAQYPYSIRNGQQPMDNAFINTGFSNVYGPSH"
     gene            complement(<547875..>550430)
                     /locus_tag="CAGL0F05401g"
                     /db_xref="GeneID:2887892"
     mRNA            complement(<547875..>550430)
                     /locus_tag="CAGL0F05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446205.1"
                     /db_xref="GeneID:2887892"
     CDS             complement(547875..550430)
                     /locus_tag="CAGL0F05401g"
                     /inference="similar to AA sequence:UniProtKB:Q03455"
                     /note="similar to uniprot|Q03455 Saccharomyces cerevisiae
                     YDR205w MSC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446205.1"
                     /db_xref="GeneID:2887892"
                     /db_xref="GOA:Q6FU89"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q6FU89"
                     /translation="MCPIETCIMNDTLLRTNTRSSFCIQIYKPINSTVYNLISYDSKD
                     LVILYFICSISINSKVSEDYCHTFKINCILKSWFCFNKESNYDILNKWASLIGKGNSI
                     KKVLDLVKNRSHIIQILFCFMQIMSVQGLLDRIPLLISYPTIILSSNLIIPSHREVLQ
                     RGSVGIVDYEHTFFNTDHFIRLVLLPIFTASTFICLGSLFHVIESPLGRLNPNHSLKW
                     TDIIKSYGPIFLILFMLSQLNFIQGSIQSTILSLLVIREYGKMNISNKKLNFSCAIGS
                     VKIFIPLFFISLIIAYDPESYYYLFSNLLSYSIVVFIVLVLVPYTKSTAINKEKSQEL
                     KLTTDYKYQLFFLPLLSLGALLMSSHIYGMYQVQLLMLLVYVGCLSIFFLTVADIKTT
                     ELGTNGESNCPSDFYLANISLEYTLSACGFMAILLQYLSFNKIVSNIRGDIFTLVFVL
                     AAECCNSLLSEKEQEIVHNHSHSRVTVSEKSNVSLLKQIALNEDTRSIFSFLLLNTTF
                     MFVQLLYSFRSKSLGLLSDSLHMALDCTSLLLGLIAGALSKNPPSDKFPFALKSLGTL
                     AGFTNGILLLGIVCGIFIEALGRFFNPVHLHGTSELLVVAILGLLVNLVGLFAFDHAG
                     HGHAEGAGHEENMKGIFLHILADTLGSAGVIVSTILIKLTGWTVFDPLASMFIASLIL
                     VSSIPLLKSSMNGILFKLDDRNHNVVKNALNQISMTPGITGYTTPRFWPSQSSSVSMH
                     GHSHGHSHSHSSDHTHEHEHKDEHEHEHQHEDKHVHEVHKEHDETSDTSNEKLTGYIH
                     VQYIDGENSTIIKKRVEKIFENNAIRAWIQVEPQSSECWCRSAQVQQPLPMSK"
     gene            complement(<550656..>551648)
                     /locus_tag="CAGL0F05423g"
                     /db_xref="GeneID:2887684"
     mRNA            complement(<550656..>551648)
                     /locus_tag="CAGL0F05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446206.1"
                     /db_xref="GeneID:2887684"
     CDS             complement(550656..551648)
                     /locus_tag="CAGL0F05423g"
                     /note="highly similar to uniprot|O13525 Saccharomyces
                     cerevisiae YDR204w COQ4 responsible for restoring
                     ubiquinone biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446206.1"
                     /db_xref="GeneID:2887684"
                     /db_xref="GOA:Q6FU88"
                     /db_xref="InterPro:IPR007715"
                     /db_xref="InterPro:IPR027540"
                     /translation="MLQSTKVTKSVLTNVLRVEQRRGFLLSGAAVALGSTYIFGRDAK
                     LADAMDRGELHNKNEDYAKLRAERTEQRIKALSNNRPMEPRYEGHVPLYLHEKMLLFA
                     ISGIRAFFHPENGINIVQLGEATAFPIFLENLKQTMLADETGRRILRDQPNVRTDILD
                     MDKLSKLPKNTFGYTFYKWLEKEKVSPDTRAPVTYIDDPIHAFVFKRYRQCHDFYHAL
                     NDLPIIIEGEIIVKALESANMGIPMATLGWMLAPLRLKKAQRDRLYGTYLPWAIKTGL
                     TCKPLINVYWEELLEKDVEELRQELGIKMPPDLRAMRAKRKAMIKRLNEKYQKN"
     gene            <551974..>553005
                     /locus_tag="CAGL0F05445g"
                     /db_xref="GeneID:2887869"
     mRNA            <551974..>553005
                     /locus_tag="CAGL0F05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446207.1"
                     /db_xref="GeneID:2887869"
     CDS             551974..553005
                     /locus_tag="CAGL0F05445g"
                     /inference="similar to AA sequence:UniProtKB:Q03956"
                     /note="similar to uniprot|Q03956 Saccharomyces cerevisiae
                     YDR202c RAV2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446207.1"
                     /db_xref="GeneID:2887869"
                     /db_xref="GOA:Q6FU87"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:Q6FU87"
                     /translation="MTTEVYAYDYFGNKEQCGAENDWEVEVEWLIKEIIKPDLPNIID
                     NFSMCLEMLQSEQEFVMPLSNGKEESKNSGSPIVKGIMVRQGEFIIDFQVMMSFGQFK
                     KGKQIVAKMKPSQKYLLVQFSTTIMKLKDILIKLQNLQMIEDIEEFYNVLESALEELN
                     DCIDTLQNPPHGLTFPGNNNGPIKQMFDDYDNLFESTHHQIALDITIFRNELCVEFKN
                     LTKVTRPPWDQVDLRTGKCFAEKIKEELKEKRNMNLEQVLQSHGLQINQPSLLGNIVS
                     RLSSESVTLPEAQDYLRRSVSFDKRVVMEIEKASLTTSDPSLISISSKLQGLKTCINN
                     HLSNLSAHK"
     gene            complement(<553078..>553542)
                     /locus_tag="CAGL0F05467g"
                     /db_xref="GeneID:2887932"
     mRNA            complement(<553078..>553542)
                     /locus_tag="CAGL0F05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446208.1"
                     /db_xref="GeneID:2887932"
     CDS             complement(553078..553542)
                     /locus_tag="CAGL0F05467g"
                     /inference="similar to AA sequence:UniProtKB:Q03954"
                     /note="similar to uniprot|Q03954 Saccharomyces cerevisiae
                     YDR201w SPC19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446208.1"
                     /db_xref="GeneID:2887932"
                     /db_xref="GOA:Q6FU86"
                     /db_xref="InterPro:IPR013251"
                     /translation="MQSLEQCVNSLEAIVHQLDGSVSRLARNGEASNELCEGILKIKR
                     VFELVPEYDVESARLALFEEVDPMVKTLGDKIEKALIRKRRELENLRQTSELNSLRLS
                     GDLYFSETGIDNQDMDVSTDAIAIASATDAELDELRALKARRAELQELLDGR"
     gene            <553902..>555365
                     /locus_tag="CAGL0F05489g"
                     /db_xref="GeneID:2887975"
     mRNA            <553902..>555365
                     /locus_tag="CAGL0F05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446209.1"
                     /db_xref="GeneID:2887975"
     CDS             553902..555365
                     /locus_tag="CAGL0F05489g"
                     /inference="similar to AA sequence:UniProtKB:Q03944"
                     /note="similar to uniprot|Q03944 Saccharomyces cerevisiae
                     YDR200c or uniprot|Q06001 Saccharomyces cerevisiae
                     YLR238w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446209.1"
                     /db_xref="GeneID:2887975"
                     /db_xref="GOA:Q6FU85"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6FU85"
                     /translation="MTTDARNGGKRPMGRNRSNSRSSGSRSVMDIDELSVPTFIPSGN
                     RKAQTAINHHELHETVTPETLVKSPGKTHILVLKSLNETFETKFLVIPYQPDGLKLGR
                     PVASGGGKLSSAVTQIRSDNGNFDSRVLSRNHALLSCDAETGKIYIRDLKSSNGTFVN
                     GNRIDQTNVELHVGDTIDLGTDIDTKMEHRKISAIVEDISIIPLVNGYKDTNTTNVET
                     KTVATNLPKTIDHTIHNQQQPTLSNKSIGDNNFNLPPESAVSTVTAQRAAFEAAMFGN
                     VLHSDLDDNILGVQTEILSGIFVNNSAGTSPNLLNTIKTLSTELALEKQETQKLTAMQ
                     NFLVNYTSKLDEIKKVMDQNNVKYLAKLQESLRQSLSETHNRVINERLDRRKKLEEGN
                     ESFKQERDKEIKEKQELLNKLKDELSAAQLNLEQEKKRTKVLMEKKSALTSKKDLLNG
                     KTRSPSSIKSNDLSSNKVLITAAITVVVIAAVAKWKS"
     gene            <555646..>557055
                     /locus_tag="CAGL0F05511g"
                     /db_xref="GeneID:2887805"
     mRNA            <555646..>557055
                     /locus_tag="CAGL0F05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446210.1"
                     /db_xref="GeneID:2887805"
     CDS             555646..557055
                     /locus_tag="CAGL0F05511g"
                     /inference="similar to AA sequence:UniProtKB:Q03942"
                     /note="similar to uniprot|Q03942 Saccharomyces cerevisiae
                     YDR198c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446210.1"
                     /db_xref="GeneID:2887805"
                     /db_xref="GOA:Q6FU84"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR016852"
                     /db_xref="UniProtKB/TrEMBL:Q6FU84"
                     /translation="MDDKISSLLEWLRQDDEFYLNECVEIKDTVQSGRGVYLDCGELK
                     LNTPIVSIPGDYQLNKVSVLSHISHFNNAIQGSIGNTPIKDASDYYNQTNDDDPRYKA
                     YKLLTTSFLEKLSSFQLLSMYILAEWFLLPHWSNGKITSFWKPFFECWPTNEELSTIP
                     TIWALSDNPLTKELLNHLPETSKTHVNRISTLVSKDWEVLQNIFEVWSTLHACPTNDN
                     MYGMDEIFNFFLRIYFTINSRCLYAEIPGNGDDTASNFTLVPYVDFFNHTVDPDVHCY
                     PRVKYMKKGKCGIGKFEIYCGRYSYKDLDEQLYLNYGAHSNDFLLNEYGFLISNNHWN
                     NLDISKELKCILAKSPETVAFLKEWDYWDDYTISVEDISYRIIIALSHLTTRDNRKVT
                     NLINGYMSEDYFRKENYRILKNLLEQLKLNSISKITQLNKLTPYDDLTTLYVWNIANL
                     YEDEIEIINTIITSISPGY"
     gene            complement(<557208..>558329)
                     /locus_tag="CAGL0F05533g"
                     /db_xref="GeneID:2887587"
     mRNA            complement(<557208..>558329)
                     /locus_tag="CAGL0F05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446211.1"
                     /db_xref="GeneID:2887587"
     CDS             complement(557208..558329)
                     /locus_tag="CAGL0F05533g"
                     /note="weakly similar to uniprot|P14905 Saccharomyces
                     cerevisiae YDR197w CBS2 cytochrome B translational
                     activator protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446211.1"
                     /db_xref="GeneID:2887587"
                     /db_xref="UniProtKB/TrEMBL:Q6FU83"
                     /translation="MSSVPRVYFAGSPLATLVGYGIARLPGQGKIPNVVMLMVDQLKL
                     KRFMNHESQISLYRSSLMLDRLQLMAGYSVPRYANGDIAPFENLVIGGGDWRYTNSIM
                     RKYESAIVPSTELLLLNPSLFTLGLVLEKKRNKEFKIWRERPKVTIGVANKAGVEIGN
                     EEFDVRVNNNDIKIKYSHLPETLWANENDSIENSQNSINSLMNQINLHYPTATVGIQT
                     EQVSFQEMFTNYCERELVDNTIEALCLLFDCSFIKELKDIKEAIHLTNLLVWEKLKIL
                     KSQFGFIEAFENSTIIFDDQRILGLIKDKINKSHEPSEFYENYQRFANKDILENVIYM
                     SYLSHKLELKFSHVDLISRLIKGKVLAHKNRHLSTKLRS"
     gene            <558599..>559318
                     /locus_tag="CAGL0F05555g"
                     /db_xref="GeneID:2887841"
     mRNA            <558599..>559318
                     /locus_tag="CAGL0F05555g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446212.1"
                     /db_xref="GeneID:2887841"
     CDS             558599..559318
                     /locus_tag="CAGL0F05555g"
                     /note="highly similar to uniprot|Q03941 Saccharomyces
                     cerevisiae YDR196c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446212.1"
                     /db_xref="GeneID:2887841"
                     /db_xref="GOA:Q6FU82"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FU82"
                     /translation="MLILGLTGGIACGKSTVSRRLKEHYKYPIIDADQIARDVVEPGQ
                     SAYNEIIQYFNDKITGLTDEDGKLNRAALGKWVFAHKDDLQVLNNITHPAIRKRIFKD
                     ILYYYVMGYKVCVLDVPLLFESHMDNICGVSVAVTSTMAHQLERLMVRNPELTNEDAQ
                     NRIKSQMSMAERVKRADYVIENDGTLSDLYGQLDNLILRIEPTTIRTLIEYFPPLGAV
                     SATAVYLTKRWRAKNQVKSDV"
     gene            <559705..>561705
                     /locus_tag="CAGL0F05577g"
                     /db_xref="GeneID:2887713"
     mRNA            <559705..>561705
                     /locus_tag="CAGL0F05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446213.1"
                     /db_xref="GeneID:2887713"
     CDS             559705..561705
                     /locus_tag="CAGL0F05577g"
                     /inference="similar to AA sequence:UniProtKB:P15424"
                     /note="similar to uniprot|P15424 Saccharomyces cerevisiae
                     YDR194c MSS116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446213.1"
                     /db_xref="GeneID:2887713"
                     /db_xref="GOA:Q6FU81"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLRHCSLGLVTTQISAIAPLRLVGSPLFCRSYQDFAGRDRRSSR
                     SREDKPYNSRTRRFDDEGSSNYSSSRDDYRGQNTYGFRGKAPRKNFSSRDNYSSRDNF
                     RSSNGFQERGYKNKFSKNTKSYSKGGNTSGSFIPEGKMAKMTHIGKSDSDIVVTLESL
                     LEKNVISRDLYDSISRMGFEQLTPVQQKTIEPIITNSDSDIIARAKTGTGKTFAFLLP
                     IFQHLLNTKIDSQNKVKSVIVAPTRDLALQIEDEVRKIHSKNRKLKAFECVSLVGGTN
                     FDRSIRYIEKVSPSIVIGTPGRLIDVMEKFGNKFFKDVDFKVLDEADRLLEIGFKEDL
                     SYINKMLNTLNTNSTEHIRTLLFSATLDHKVQSLSNDIMNKEECLYIDTIDENEPQAH
                     EKIDQTLVVGETFADNLYAAIEHIREFGTKTPNYKSILFLPTVKFTKFMATILKRQVK
                     LPIYEFHGQIDQKKRTRIVNEFKTMKKGLLVCTDVGARGMDFPNITEVLQIGLPSEIP
                     NYIHRIGRTARSGKEGSSVTFISKEELPFFEILEDKHNVTIKNIRKFEAQPHVMADLS
                     LRLHVSEDELQEIILSVISFYRACLKDYGINYKNMLPQIAHTYGTLLQNEDKRIPLAG
                     NHILNRLGMDRDPIATKMFQIDEMPNQYNRRGPRSNYNRRRF"
     gene            <562262..>564094
                     /locus_tag="CAGL0F05599g"
                     /db_xref="GeneID:2887878"
     mRNA            <562262..>564094
                     /locus_tag="CAGL0F05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446214.1"
                     /db_xref="GeneID:2887878"
     CDS             562262..564094
                     /locus_tag="CAGL0F05599g"
                     /note="some similarities with uniprot|P49686 Saccharomyces
                     cerevisiae YDR192c NUP42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446214.1"
                     /db_xref="GeneID:2887878"
                     /db_xref="GOA:Q6FU80"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q6FU80"
                     /translation="MSYTSRTPCKFFQQGNCRRGNSCKFGHFLANDNNRTTSNDDPYK
                     SFISPTSIDKHKKQILDDMADAASYALTPLTSAYSLADPCAVNLIQARDISLEELRFK
                     YLQAQKAGQLDQYTAEVQARNSDIQVCMQEVKSHPDIAVRFLQKCTQDIKELGHRTIQ
                     QDFIKFPVGSQNQASSLNKTGNFNNTTTGMFGVSGFSGTGPAAGAGTSSGLGNGLNMT
                     SSAFGKPAFGNTATSSGGGFGSSSFGSSAFGAPAFGSGSTGSGFGSLTAGNQSNGASG
                     ASGTAFGKPAFGSVGQAAFGQTVQANTNQSPFGSISNTSGNSIPNSSPFGALGAGTNN
                     VSNPFSGKQSTAFGSPAFGSTQNNASNTQNTATGSMFGAPAFGSSPFASSQNNGQTTS
                     PFGSLKNQSSNNNNNSFGSQPNQNSIAGTSTTTFGSSPNNISNPFSSNNNKSTAFGNI
                     GTGTNTANNAFGTATPGNNVSTNQQTPFGSSAFNNANTNTNKPAFGSSGSNAQSSPFG
                     TTNSIQSNNSSGPFGNPSAVQGNSFDSPFANSATANQSIASSSQFSQNSNQNSGNFFQ
                     GSVEKEDQPPDISELAKGTVDTFKAAQFVLGQVPDIPPPMTLIN"
     gene            complement(<564202..>565296)
                     /locus_tag="CAGL0F05621g"
                     /db_xref="GeneID:2887775"
     mRNA            complement(<564202..>565296)
                     /locus_tag="CAGL0F05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446215.1"
                     /db_xref="GeneID:2887775"
     CDS             complement(564202..565296)
                     /locus_tag="CAGL0F05621g"
                     /inference="similar to AA sequence:UniProtKB:P53688"
                     /note="similar to uniprot|P53688 Saccharomyces cerevisiae
                     YDR191w HST4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446215.1"
                     /db_xref="GeneID:2887775"
                     /db_xref="GOA:Q6FU79"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6FU79"
                     /translation="MVAISKDTKMLLTPPSSTKKPVVESNVGKVTPRRLFARGKSGRK
                     PRLKSRPAPFTIFSIDDYLSGITSEKHSSDGAAEFLRYAFQYSKKIVAVVGAGISVAA
                     GIPDFRSSEGLFETLKGDSVASGKELFDFNRVYSSDEMSKKFHSMIVDLHSLSQKSEP
                     TKFHLLLDHLASQQRLVRLYTQNIDGLDTRLENLKTTVPLDKPIPTTIQLHGSVDYME
                     CNLCAKIDCFNPEAFENEGEIIPLCPQCKEFDEVRKVAGIRSKGLGKLRPRVVLYNEV
                     HPEGDLIGQVSNKDLKQKIDFLLIAGTSLKIPGVLQMCKKFIEKVVKNKGIVIYFNKE
                     MPTQSLLKSLGHIDLIVLGDCQNISDLLSL"
     gene            <565824..>567197
                     /locus_tag="CAGL0F05643g"
                     /db_xref="GeneID:2887725"
     mRNA            <565824..>567197
                     /locus_tag="CAGL0F05643g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446216.1"
                     /db_xref="GeneID:2887725"
     CDS             565824..567197
                     /locus_tag="CAGL0F05643g"
                     /note="highly similar to uniprot|Q03940 Saccharomyces
                     cerevisiae YDR190c RVB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446216.1"
                     /db_xref="GeneID:2887725"
                     /db_xref="GOA:Q6FU78"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVQITEVNESKAGTANRTAAHTHIKGLGLDDTGAARQVEGGFVG
                     QVEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGS
                     ELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHV
                     IVGLKSAKGTKTLRLDPTIYDSIQKEKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL
                     EAEEYVPLPKGEVHKKKEIVQDVTLHDLDIANARPQGGQDVISMMGQLMKPKKTEITE
                     KLRFEVNKVVAKYVDQGVAELIPGVLFIDEANMLDIEIFTYLNKALESDIAPIVVLAS
                     NRGMTTVRGTEDVISPHGIPADLIDRLLIVRTLPYNKDEIRLIIERRSAVENLALEDG
                     ALDILADMATHTSLRYALQLLSPAGILSSTAGRQKITIDDINEAKMLFIDAKRSTKIL
                     ENSDRYM"
     gene            complement(<567360..>569354)
                     /locus_tag="CAGL0F05665g"
                     /db_xref="GeneID:2887652"
     mRNA            complement(<567360..>569354)
                     /locus_tag="CAGL0F05665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446217.1"
                     /db_xref="GeneID:2887652"
     CDS             complement(567360..569354)
                     /locus_tag="CAGL0F05665g"
                     /note="highly similar to uniprot|P22213 Saccharomyces
                     cerevisiae YDR189w SLY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446217.1"
                     /db_xref="GeneID:2887652"
                     /db_xref="GOA:Q6FU77"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q6FU77"
                     /translation="MASEMDSLRDMQVDSLLKMLYLNEEHYPKANSVTEDPNATTAAI
                     ANDDAIQDIIWKVLVLDKRTTAIVSSVLRVNDLLKTGVTVHALIDSSKRSSLPDVPVV
                     YFIEPTKTNIDLIVDDLKHDKYSEFYINFVDSLSRDLLEHLAQEVVQLGKQDKVKQVY
                     DQYLDFVVTEPELFSLELPTAYSILNNPQSDEETITSLCSTIADGLFNTIITLNSIPI
                     IRAQKNGPAEIVAEKLSSKLRDYVINLKSNSSENSNSILNDSLDRFVLIILDRNIDYS
                     CMFSHSWIYQCMVFDIFKLRRNTITIPGENETSPEKQYDIEPHDFFWLQNAHLPFPEA
                     AENVESALNEYKNEANEIVKKTGVTSLNDLNIKQFDQNENEDDLGTLQIQQAVKKLPE
                     LTAKKGIIDMHMNIFASLLKELEAKNLDTFFEIEQQDPDNVKTRTKFIELLEKDGKTD
                     NLEDKLRSFIVLYLSAKNTPPQDFVKQVENYFKGQEYDITPLKYVYKLREMMKMSSSM
                     SLQTKSLDDGKQDSNKMTTSTLSGLYGLTEGTLQGGVGTLISGFKKLLPEKKTIPVTN
                     IVDAIMDPLNSSQKNLEATDTYLYLDPKITRGSHTRKPKRQTYNKSVVFIVGGGNYLE
                     YQNLQEWAHSQIHNPKKVMYGSTDILSPHQFLEQVASLST"
     gene            <570280..>572649
                     /locus_tag="CAGL0F05687g"
                     /db_xref="GeneID:2887957"
     mRNA            <570280..>572649
                     /locus_tag="CAGL0F05687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446218.1"
                     /db_xref="GeneID:2887957"
     CDS             570280..572649
                     /locus_tag="CAGL0F05687g"
                     /note="some similarities with uniprot|Q04007 Saccharomyces
                     cerevisiae YDR186c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446218.1"
                     /db_xref="GeneID:2887957"
                     /db_xref="GOA:Q6FU76"
                     /db_xref="UniProtKB/TrEMBL:Q6FU76"
                     /translation="MNRNKRVNVKPLSSLFLISYSDVRCDVEHLQKYKIHLYIDIPTI
                     DYYTDELTETKLSKLNKKLKLSKLKHDIWRAFYNGDEQFWDRLKESNHQVKVTVDISS
                     SGSLRYVQTIKFLLETIYNSLRELEYVQLQFHLDSTLTSLKWFKTFLDPELMNAGIIK
                     FNTIKHTPQQSDNTKTPFKEYYMRLNNKFMDSERYFDKKVMETIVIVTNQTGVKALLT
                     LLSDRPLNSYISEESMKALQHMSASATRNRSYSATVPNHSYETDFISHTPLKRVSSSI
                     LNFQNESLPLSHEKEARVKSPISFATSPTLTNSRSFTPIDFPGAESYNSRAMSPDDLA
                     MADALSDEFDEDEDNYDDEEFEEDDDNDDDDNDPDEGLSFFAPNILSRSGSGFNLSSR
                     AQNNINNKLKLPGTSKGRFRSLSLMDPALNRPFMQKGLQMTPANTGLTVKDNRNELRC
                     ASPLASTVTKFETNSNNNNEDTHDDDNNDLHTKFTNIYIHDGDFDEVVLDDSTQQRIL
                     HNKKKLMEIHGEDTGTRISNTPNSLIPPEFYSRLSSPSTSASSSNTSLTQLNTLVTPQ
                     FTKWLNNANLLHSQGNDKQSQIKGGANLFEQKLVKKSMEDLRNEPAKNFINGLINGDI
                     DSTEKNAYALNFRNTANYSQHHYEALDDEDRMMSGVTEDHDNTRQSSDLTFESSTTSE
                     SEDETATTASVATIKPEMPSAQLFGLSNSHNSRLSQTSKTSLDQIRPSFSFQLYDDLE
                     NIDNQVNEQIQQNPDSEPPKAYKKAVSIDLYGDEDPDNNDTWLLGWNNK"
     gene            <573128..>574174
                     /locus_tag="CAGL0F05709g"
                     /db_xref="GeneID:2887638"
     mRNA            <573128..>574174
                     /locus_tag="CAGL0F05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446219.1"
                     /db_xref="GeneID:2887638"
     CDS             573128..574174
                     /locus_tag="CAGL0F05709g"
                     /note="some similarities with uniprot|Q04005 Saccharomyces
                     cerevisiae YDR184c BAT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446219.1"
                     /db_xref="GeneID:2887638"
                     /db_xref="GOA:Q6FU75"
                     /translation="MKAQSSQEQEDGLTMLHRILKDDNVDMDSALSDMEGPSVNQNLD
                     KLEIDYRNQFEIAYRENSFENLEELSDETIGKHVTLDTLLKMDNDVIFKDENIFDDED
                     RSSRKRQRDSVSDTDTLFNEQTDSKKRKDSDMDSCKNAIDSIMTEQILSPISLSPTPS
                     SDGSIQNDKTESLEIAKDLPKEPRKPVDKPARAKLKNKYEMSNIIIHKEDIPAANLRN
                     RRSMVDNNVIKKISPHSSADHNKTVKKEPVVITNEYTVSQVAQMKRRIIDSHKLLLNF
                     NVIKDNYARACVQLKRSVTALKDSEIHRAHLILENEELKKQLQALQQHSTGKEEANST
                     NIPKQNILKNEADS"
     gene            complement(<574414..>575037)
                     /locus_tag="CAGL0F05731g"
                     /db_xref="GeneID:2887648"
     mRNA            complement(<574414..>575037)
                     /locus_tag="CAGL0F05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446220.1"
                     /db_xref="GeneID:2887648"
     CDS             complement(574414..575037)
                     /locus_tag="CAGL0F05731g"
                     /inference="similar to AA sequence:UniProtKB:Q04004"
                     /note="similar to uniprot|Q04004 Saccharomyces cerevisiae
                     YDR183w PLP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446220.1"
                     /db_xref="GeneID:2887648"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:Q6FU74"
                     /translation="MSTSDESINELLEELEQEDERNDDFIDRYRAQRMQEMHDYFGSI
                     QRKKEEGFGKVNYMDNESQVMKITTSTARVVIHFELETFKKCQYMDEKLEEIARNYLS
                     TKFISISVENAPFLVEKLGIKVLPFVICYLNGNECERIIGFNKMGNDPNGFRTSKLEG
                     VLMRAGILERRPQDADRISNLRIANKNTDLVSKLREKNDSDTSDLDI"
     gene            complement(<575499..>576965)
                     /locus_tag="CAGL0F05753g"
                     /db_xref="GeneID:2887614"
     mRNA            complement(<575499..>576965)
                     /locus_tag="CAGL0F05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446221.1"
                     /db_xref="GeneID:2887614"
     CDS             complement(575499..576965)
                     /locus_tag="CAGL0F05753g"
                     /inference="similar to AA sequence:UniProtKB:P40986"
                     /note="similar to uniprot|P40986 Saccharomyces cerevisiae
                     YDR182w CDC1 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446221.1"
                     /db_xref="GeneID:2887614"
                     /db_xref="GOA:Q6FU73"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FU73"
                     /translation="MFKRKKADTMMDRSDDEVELGSVTTGNASRMLKPQCRQWKSVRS
                     WRLVLGLWVAWVALIHYYEHTVVVRAMKKCQWNKWEQWENPVGAHHVALFADPQIMDN
                     HSYPGRPAIVNYFTRVILDHYLARNWKYVQGYLEPQTSVFLGDLFDGGRYWDDKYWFN
                     EYQRFNRIFPRKPGTTTITNVAGNHDIGFGDTVVKNSLLRFSAFFGETSDYFHIGNHT
                     FVVLDTISLSDSADPHISEKPRDFLEKFGEVDPSYPRIMLSHVPLWRDVTKQTCGSRR
                     ESSNLFPVMKGDQYQTVITEEISNDVLDTIKPILLFSGDDHDYCHIKHEYTPKDGSGT
                     KLANEYTVKSCAMNMGISKPAIQLLSLYNPQSEMGIGLTGQTYSTEMCYMPDPYKPLT
                     MYIIAAIFCLIILIKTSFFPKRYIRSKYQNFAGKIKKVDETLPMPVSISDAQLEDKKL
                     KASLQSSEEQSKFAVFFQKVGSLAALVLATFFYYYCVI"
     gene            <577895..>579424
                     /locus_tag="CAGL0F05775g"
                     /db_xref="GeneID:2887599"
     mRNA            <577895..>579424
                     /locus_tag="CAGL0F05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446222.1"
                     /db_xref="GeneID:2887599"
     CDS             577895..579424
                     /locus_tag="CAGL0F05775g"
                     /note="some similarities with uniprot|Q04003 Saccharomyces
                     cerevisiae YDR181c SAS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446222.1"
                     /db_xref="GeneID:2887599"
                     /db_xref="GOA:Q6FU72"
                     /db_xref="InterPro:IPR029184"
                     /db_xref="UniProtKB/TrEMBL:Q6FU72"
                     /translation="MKIKAEAGSQDSVRLKRQSSDAGVERFDFDAEEYEIDPRKKLKL
                     VTRGVSSGNSDAVGTQSPDGINAFEKRATISKMILDIKRNDIFGTAPILNAESALDDR
                     KYINYHRRMLRQESRMIQLDITHGENEADRLLGVYDKLNMFNWQPTLLKVTKINDPND
                     EEEMLAKREKTKEYIQTLLNNFDNMKKRTLSLNKKNAKYVKKIGSEKTMLPNSISRSD
                     SSVFHGPDRTKIYNYVDRKYYSGYVSSSDEEEECMTVEDIKAHRKASRERQCGSALTV
                     CLSNNFNAGYAIVAEPLKKPYIIKCTTQERKHWKNIRGDGDIKKFKVYHPPTTLVANL
                     TQRISCENTLKPKSVNELRNPNEDNEVIDNDQKQYKNADILLPSEDSVLSDVPSSLPR
                     SPSIAPINLLPVKKLLKSTVEETSTLPNYDGNYGELILNSQYQSNDVPHMGYSSEGAG
                     TTTNYLDRTIIQNTGNVEAMPNTRQLPPLGNFHLENNMNATEKNSVVLLSQADKYYPS
                     L"
     gene            complement(<579968..>584380)
                     /locus_tag="CAGL0F05797g"
                     /db_xref="GeneID:2887644"
     mRNA            complement(<579968..>584380)
                     /locus_tag="CAGL0F05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446223.1"
                     /db_xref="GeneID:2887644"
     CDS             complement(579968..584380)
                     /locus_tag="CAGL0F05797g"
                     /inference="similar to AA sequence:UniProtKB:Q04002"
                     /note="similar to uniprot|Q04002 Saccharomyces cerevisiae
                     YDR180w SCC2 involved in sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446223.1"
                     /db_xref="GeneID:2887644"
                     /db_xref="GOA:Q6FU71"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024986"
                     /db_xref="InterPro:IPR026003"
                     /db_xref="UniProtKB/TrEMBL:Q6FU71"
                     /translation="MGSVENYPGENSNIPKRLLEALRIQPLTFLIPKDGLSELVTDSL
                     ELNYVAERPQLDNLHKCELGEAISDKPDKQIRIKEPVNESLFFANEENKFNLLSTLSD
                     KAKVFLEQTGTPPIAKQVEGPFKNSRKHSFEESFNDPSELDLSYSSDIKRARISTSVS
                     QNLTNIGDDYVNEFNKLVNATAFENDIQNEKKNLNSEVWKLLPSGDAVTTINLIQKIH
                     RCLQNIIELPNCWPNIPADSLEQLLDITSNNIIAMKNVSIRNQEYDNILDIGLISTKV
                     IFLVYIMNSDSKDLLIDRHVLSPINFINELVLDLKSVDDDIPLTLLSMLYEAISPLPD
                     FLSLKSFIDEEIITKFVYVFVDIIFLPFENVHSDLKKVKLLNEIKIIGRSSLQNMFIT
                     FPAQRDFIIGEVLAKIEELPNKRTTKKSSSNSNDDSISDFTMTLVQFLSSINIFDHCK
                     TIDTWTPEKTDTAIRMHQESSNSIMRYCDMIANTLFDKCKDSNPQNKHLLEIYVSDLS
                     KMYAHPTWPVTEFLLQSITKRLLMVFRSNKSTNINLETTALQNLGIIFGKVFEIKIEL
                     DKSNENENSVLKLIENKSDLIKYFNFFDQLLRSSSSNEESIRYWSLNIDFLHSCYTSD
                     IKSNDIKKLIYEKITELFLQTRNSSDWRLKAAVPEKNTYNSILSIGGLYRLYDSYLRI
                     LLNLISSEKIKLRSTSIKNLSMLALKDQSILTNVLVKQTIQRRLSDSSTSVKDAILEL
                     VSVGSSYINYYEEINANFNDDSPTIRKHVLNLNEKIYNSTNDINLKVYVASRIVFKLE
                     DEEESIVDKATDILFQKWINLEEEMIQDQDNVMIVRKQNLEIISTIFSSEEKLNELIS
                     KFFKSYLLNKTIHNSAENARIINSITHIIDTLINEVVLLIGKSSDHEAKALQNYLNLL
                     VEFSEFDVITVRKEHLLTLFPYLFSEQSNELQLFLLFIFRNSIGRLTNFKSSFLRDLE
                     FSIIENISKIGSQELETSIQILWEVGNQTKDYSKLQKMCYSCLTQIRQYVVIANSNPE
                     ELRPDGKVQRLIYISSSFAKLANHNNDQNATMFRYQDEKIFEFVAKCLLVFSKIEINP
                     IIRRIAIRNLIGISGKHIQLFNSPLVIKIFDYELRENREEIKLVIYQGLHEFFLDNEK
                     ISLQEHLLNTSSKKIETVKSINKDTTKKKRSAADGLCFSLVSKFLAYILNDCLSSNYK
                     LALSCTRLVNIIIKYGFVNPTSCLPVVIGLLLADNEKIKTLSKKTLDIVTENHESLIY
                     PSLTKGIEAAMMYAERTYSENFVEQYLFLYDLQQNFIPGKKSNIKFLQHMAKILTNYT
                     RIVTTKGCTIKELNQIGFFCINMAQINFQNHYELYILMRELDAISENLKDFILNQIQY
                     KQSPKFKESHITNLIIIQTLIQELVSHILNKYGIKSDILYYDGNFEQELKSKALPFLK
                     KPNTSFLEKFEETKRFWEGKPIFRYLYSLDNRDD"
     gene            complement(<584882..>586189)
                     /locus_tag="CAGL0F05819g"
                     /db_xref="GeneID:2887939"
     mRNA            complement(<584882..>586189)
                     /locus_tag="CAGL0F05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446224.1"
                     /db_xref="GeneID:2887939"
     CDS             complement(584882..586189)
                     /locus_tag="CAGL0F05819g"
                     /note="some similarities with uniprot|Q03983 Saccharomyces
                     cerevisiae YDR179wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446224.1"
                     /db_xref="GeneID:2887939"
                     /db_xref="GOA:Q6FU70"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="UniProtKB/TrEMBL:Q6FU70"
                     /translation="MSEIAYNTNSSLVSKLQQQQQFYSAKVNDARKQGKQSPNDQVDK
                     PFRCPHDKDSPAYLKSLCKSVYPETVWAQIDATEELDAIQFHALAALLVKNFVSSWYG
                     VKVMKLDPKHDEFLAAIFEAIDTTYTGLRRKCQLMDVNSLLLNDLPYVISKHINILRQ
                     LRLKIKGQKSELYSQLSMLPSENYLIDQYKRIILESFIPNDSKLQLVFLESILRNIIF
                     GSVLDSISNPFYILELLNNILFKVNRPRQNKENISLKFRKFLQAITSCFYHHKRNSLI
                     EIDYTQILNLIILDICELHLKSPVWFAVVNIIISVSMTTLFFRDLISTIALRNLAMLR
                     QGPLSTSYLLMKTRNTLFPNDNLMGQRRVIPQGEELDKYKTNLTKLAYNFLSQHHLTT
                     VLMLSEKDVGSFIDLISQDSSCNKLFLLLLLEPIVATLISTGH"
     gene            <586441..>586881
                     /locus_tag="CAGL0F05841g"
                     /db_xref="GeneID:2887949"
     mRNA            <586441..>586881
                     /locus_tag="CAGL0F05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446225.1"
                     /db_xref="GeneID:2887949"
     CDS             586441..586881
                     /locus_tag="CAGL0F05841g"
                     /inference="similar to AA sequence:UniProtKB:Q03981"
                     /note="similar to uniprot|Q03981 Saccharomyces cerevisiae
                     YDR179c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446225.1"
                     /db_xref="GeneID:2887949"
                     /db_xref="GOA:Q6FU69"
                     /db_xref="InterPro:IPR016806"
                     /translation="MDSYKTQWLTSEGDERVRCELLAFGTVEDLERGTLNAQDRNVLV
                     KLSILNYVYGKQVVTFDALLKNYAQAGIELTDNDIEMILLELCNHGIMDVSIDSVARE
                     VKVLQLSRYRDVYCGERELLVVNPTKVITNIEIIDTLQAYSDKL"
     gene            complement(<587212..>587703)
                     /locus_tag="CAGL0F05863g"
                     /db_xref="GeneID:2887919"
     mRNA            complement(<587212..>587703)
                     /locus_tag="CAGL0F05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446226.1"
                     /db_xref="GeneID:2887919"
     CDS             complement(587212..587703)
                     /locus_tag="CAGL0F05863g"
                     /inference="similar to AA sequence:UniProtKB:P37298"
                     /note="similar to uniprot|P37298 Saccharomyces cerevisiae
                     YDR178w SDH4 and similar to uniprot|Q06236 Saccharomyces
                     cerevisiae YLR164w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446226.1"
                     /db_xref="GeneID:2887919"
                     /db_xref="GOA:Q6FU68"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:Q6FU68"
                     /translation="MLPYARVVAKRSFQTSSARQFVIPFLPLLPQKPGGVQGTPNDAF
                     IPPKPHKMEGSYHWWLEKSFSYSILPLTTVAFLTTGTLSTVTDTALCLSALGYSYMEF
                     HSCITDYVQTRQYGKYHNYALYLLGAGTLASLLGIYNLETQKGGFKGLVKSLWYGEEE
                     EKK"
     gene            <588828..>590966
                     /locus_tag="CAGL0F05885g"
                     /db_xref="GeneID:2887667"
     mRNA            <588828..>590966
                     /locus_tag="CAGL0F05885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446227.1"
                     /db_xref="GeneID:2887667"
     CDS             588828..590966
                     /locus_tag="CAGL0F05885g"
                     /inference="similar to AA sequence:UniProtKB:Q05080"
                     /note="similar to uniprot|Q05080 Saccharomyces cerevisiae
                     YMR032w HOF1 involved in cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446227.1"
                     /db_xref="GeneID:2887667"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FU67"
                     /translation="MSYSYDTCFWDPNDNGVNVLLEHVGNGIKSMDGLTTFFKLRAEL
                     EKDYARRLGAAIDLYDKSYCEEYGALFKTIQSFFPLERSRALAHSKLSELVYRQVYSE
                     LKSLQSELSARLTTLSGRIEKLRFDKYDKKKGCESLSVKLRDAEVRLSELNLNKNNII
                     GNRRKIESLEKEQKKWESNVHEFQIQLNVLKQEYKASQKFWINEWHSLSHDLQHLEIK
                     RISTIQVLLQSFAQTAIDTSIIEQTKMETLINELATFTPMDDISKFSSEFGTGRLKEK
                     RQRSSRLVNGNTSTASKPSMEILSSSHMSRGPDPYVENIRKLSSQLQKTTVTPRVLKV
                     SRTEGTDNGKSYRAESNDYQMLNSSASIEHRPSSFIPSSSEPYSNSNGRNTNETLRRR
                     VHEDKEDRRVSDHLRVGCQPKSIEREPSFVKNIEKSASESGSYSSGRHSFSPSSSSGT
                     SSNPTDFSHKIKSHRSMDSLATSVSSMASSIDDSQRFAKSWNSANRKRKSMSHLQSPE
                     INISTIDDQLENSKNTTAQRTTHPSQSTNTFNRDVSSNTILVDPRYQSSKNSMDMSRV
                     RSSRSIDSSRRKSMVLDSSVNPISDALNEMERIKSGGSSTAYSDEARRKDLPSGYGRV
                     DDNGMPVTLPTITKEGEEVIKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYR
                     GEVYGNSNTTTTHGNGLIPSNFIQILHNQL"
     gene            <591411..>592799
                     /locus_tag="CAGL0F05907g"
                     /db_xref="GeneID:2887908"
     mRNA            <591411..>592799
                     /locus_tag="CAGL0F05907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446228.1"
                     /db_xref="GeneID:2887908"
     CDS             591411..592799
                     /locus_tag="CAGL0F05907g"
                     /inference="similar to AA sequence:UniProtKB:Q05123"
                     /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
                     YMR033w ARP9 Actin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446228.1"
                     /db_xref="GeneID:2887908"
                     /db_xref="GOA:Q6FU66"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027665"
                     /db_xref="UniProtKB/TrEMBL:Q6FU66"
                     /translation="MAPFKQDSILMIYPRSGSTLVQFGLNDETFMPPTFEIPTVIYRK
                     KDNAGNFNYGPKEQFGDLETVEEVRPIQKGAIVDLEAFLHFLKLFYASILADKYSSNT
                     SAFDDDLANIPVLLVTHHTWSQLQLEMITKFVFENLEINNLLLLPLSLASTFAMVSLQ
                     NSLVIDIGTTHTDIIPVVDYTPMEHLTSTINLGGDSINTELAKKLPQLTETQIETLKR
                     STIFEVLSADAREILDTNDGEEMDEGALDVAAIVTSGRDTREVLEERERKKKQRNVKN
                     AELDTNSFYDDDGQEITVGKQRFEGTEKLIESISHRVGNVLAHIHDKAKARHIWENII
                     VVGGTSSIVGFREALIAQLYKDHIIMEPEEERQDREDAAKASLSSKKKNKFLDNTLPT
                     TEYIQVPTSIKFAKYPDYFPEWKKHGYSEIPFLGAQIVCKQVFTHPKDTFYITRERYD
                     EKGPAAIWDIVF"
     gene            complement(<593145..>594461)
                     /locus_tag="CAGL0F05929g"
                     /db_xref="GeneID:2887712"
     mRNA            complement(<593145..>594461)
                     /locus_tag="CAGL0F05929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446229.1"
                     /db_xref="GeneID:2887712"
     CDS             complement(593145..594461)
                     /locus_tag="CAGL0F05929g"
                     /inference="similar to AA sequence:UniProtKB:Q05131"
                     /note="similar to uniprot|Q05131 Saccharomyces cerevisiae
                     YMR034c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446229.1"
                     /db_xref="GeneID:2887712"
                     /db_xref="GOA:Q6FU65"
                     /db_xref="InterPro:IPR016833"
                     /db_xref="UniProtKB/TrEMBL:Q6FU65"
                     /translation="MLNCARWNRFLDEHPAILRVWNHPITEFLKSQWFFYVLAIFIVI
                     ARFAPNFARDGGLIKGEYSIGYGAVAWIFLQSGLSMKTSRLMANMTNWRAHLTILVLS
                     FLVTSSIVYGICCGIKAANDKNIDDWVLIGLLMTAACPTTVASNVLMTTEAGGNDLLC
                     VCEVFIGNLLGAFITPALSQLYTDRAPFEYGNPANGNSIGSLYGRVMKQVGLSVFVPL
                     TVGQIAQNMLPKPTKIYLDFLKKYKLKIGSYMLLLIMFSSFSTAFYQRSFTSVPHATI
                     IFVCFFNLGIYLFFTLISYAMARPFFIPILFNEVPDESSSKFYTTMYKIFRPFYYNKR
                     DTVCILFCGPAKTAALGVSLITSQYGDNKSHLGKLLLPLVLYQSIQVLTASLLVLPLR
                     KWCADEQPDITPIESTDKKAIEQYMLSSSRGSSDIEKNDCIDENAA"
     gene            <595030..>595545
                     /locus_tag="CAGL0F05951g"
                     /db_xref="GeneID:2887881"
     mRNA            <595030..>595545
                     /locus_tag="CAGL0F05951g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446230.1"
                     /db_xref="GeneID:2887881"
     CDS             595030..595545
                     /locus_tag="CAGL0F05951g"
                     /inference="similar to AA sequence:UniProtKB:P46972"
                     /note="similar to uniprot|P46972 Saccharomyces cerevisiae
                     YMR035w IMP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446230.1"
                     /db_xref="GeneID:2887881"
                     /db_xref="GOA:Q6FU64"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q6FU64"
                     /translation="MSYGRTILRTAVVVGAWLPVYITVTDSVVHVARVDGASMQPALN
                     PGLQSDWVLLWKWGVRGSMPPRRNDVILFRSPMDTSKVYCKRVKGIQYDTISTRSPYP
                     KDTVHVPRNHLWVEGDNITRSIDSNKFGPISSGLVVGKAICVIWPPSRWNADLNITTG
                     RECILRAPMED"
     gene            complement(<595752..>597353)
                     /locus_tag="CAGL0F05973g"
                     /db_xref="GeneID:2887743"
     mRNA            complement(<595752..>597353)
                     /locus_tag="CAGL0F05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446231.1"
                     /db_xref="GeneID:2887743"
     CDS             complement(595752..597353)
                     /locus_tag="CAGL0F05973g"
                     /note="weakly similar to uniprot|P23748 Saccharomyces
                     cerevisiae YMR036c MIH1 M-phase inducing protein tyrosine
                     phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446231.1"
                     /db_xref="GeneID:2887743"
                     /db_xref="GOA:Q6FU63"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6FU63"
                     /translation="MVNVFRPNDCNSSNTENGKTNHTEAKKNIFKNVQSLFSLKSKIN
                     HSKYESTHKKAQSDIYDQPQLEPASSPFQFTNDTPELYLNIQNTNEPTDDRFSVFPME
                     NNLSKSVNGPRFVQSHDDFDLALKVPDLDNHVSESNFRSSRYDSKSSIDSDTRFLKMD
                     CSQRRNSSTSNSSFSGRVSRSQTIREERRNRSESGRRIKTLYELDQNKNLDISEKVVT
                     LSNNFYQSKLTESQINIFQKEECSNPLFPRISAESLSQIILNNTHQPHYKSYHIIDCR
                     FEYEYQGGHIKNAININSKDDIEKQFLQKYIEMPALLIFHCEFSNQRGPNLASHLRNC
                     DRILNYENYPDLCFPDIVILDGGYEKFYSKFPQLCFPRAYTKMDSVENLHHYEKELDK
                     FRKDKRRVTTRNNSLMKLASISSYHSLVDEDNIPNKEHAPTKSHGKLMFEGLPRPPSV
                     KNHGPLVSRSSASSMSSLGLEAPPKLGLAKYMDVNSFNSVGSSDAESYSSRMSRNNSF
                     SGSVQSGKTCNQSIDSAGTTPWMLE"
     gene            complement(<598819..>600612)
                     /locus_tag="CAGL0F05995g"
                     /db_xref="GeneID:2887591"
     mRNA            complement(<598819..>600612)
                     /locus_tag="CAGL0F05995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446232.1"
                     /db_xref="GeneID:2887591"
     CDS             complement(598819..600612)
                     /locus_tag="CAGL0F05995g"
                     /note="some similarities with uniprot|P33748 Saccharomyces
                     cerevisiae YMR037c MSN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446232.1"
                     /db_xref="GeneID:2887591"
                     /db_xref="GOA:Q6FU62"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FU62"
                     /translation="MSVEQEPSSWSTQMENMFSLNIQDQNADVKYQSPLTPNYMSLDI
                     YQGHKADIASNRGDANNDNGDDNEIASARGESNGRDTDNGINTNTTTTTNSSTVETNM
                     TTTPATLDDFLMNFDSGATTATGKDKNPLVSDKPLGTHLQMNFVDSSSNGALPFSDQK
                     GRRATIYNGFFESMHLDTMLDDYLSTELLLNEKPNGSNNNNDDDETVANERRHSEVVT
                     GNTINLASARNSISHGVDFWNVDSHRKRGSNNGLHRDGHVNKSITRRATGGTEKHLTD
                     DSLLLDSDISSHKIDNELSQILSDYNMNFKPGTEESPLKYNTADYYNFDGNSEDVSHS
                     SAGQSHRPFMKNPHRASLPILSEATPPEYDLDIKKKQPDVSIFKDIPWESFNAEGADE
                     NDLSVANQNFYNPEIISSPKSPNDKFIKPTMILSDASLAEVEMMNNSIKSLNTSLDIS
                     IPPDVLNKDLKESWQNSQSRKSISGSSGRRRSSAALSMSNFNNNLHFNINASKSNPRR
                     KSKPSISPNSSLLSSNIDRNNDIDKPFGCHLCSKAFKRSEHLKRHVRSVHSTDRPFSC
                     HLCEKKFSRSDNLSQHIKTHKKSGSTSTTKE"
     gene            complement(<601431..>602150)
                     /locus_tag="CAGL0F06017g"
                     /db_xref="GeneID:2887621"
     mRNA            complement(<601431..>602150)
                     /locus_tag="CAGL0F06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446233.1"
                     /db_xref="GeneID:2887621"
     CDS             complement(601431..602150)
                     /locus_tag="CAGL0F06017g"
                     /note="highly similar to uniprot|P40202 Saccharomyces
                     cerevisiae YMR038c LYS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446233.1"
                     /db_xref="GeneID:2887621"
                     /db_xref="GOA:Q6FU61"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR024142"
                     /translation="MTANADFYEATYAVPMHCTDCTDDIKKCLNGITGIKDLQFDISQ
                     QMMSVNSCVAPSVIINALRDCGRDAIIRGAGKPNSSAVAILETFEDVDLKKDTAVRGL
                     ARIVQVSDQKTLFDVTVNGVPFSGKYQAKIHSNGNISEGVKSTGDVYYKFEEPIECSD
                     ASDLDKSLYSGQNFVSAPLPIWDLIGRSFVIFREGEPAYDIAGVIARSAGVWENDKQV
                     CACTGKTVWEERKDALKNNIK"
     gene            complement(<602686..>603519)
                     /locus_tag="CAGL0F06039g"
                     /db_xref="GeneID:2887726"
     mRNA            complement(<602686..>603519)
                     /locus_tag="CAGL0F06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446234.1"
                     /db_xref="GeneID:2887726"
     CDS             complement(602686..603519)
                     /locus_tag="CAGL0F06039g"
                     /inference="similar to AA sequence:UniProtKB:P54000"
                     /note="similar to uniprot|P54000 Saccharomyces cerevisiae
                     YMR039c SUB1 transcriptional coactivator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446234.1"
                     /db_xref="GeneID:2887726"
                     /db_xref="GOA:Q6FU60"
                     /db_xref="InterPro:IPR003173"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="UniProtKB/TrEMBL:Q6FU60"
                     /translation="MSYYSRYRKKNNNNGGASPGNNGGNLNLAAGLGQPDAIFDLGKN
                     KRVTVRQFRNINLIDIREYYMDNATGEMRPGKKGISLTEDLYDEFLRHRLNIDDALRR
                     LGSKRPRTKTVRLLSDDEDEEADEKPISSSSEKQEAIRENKDKDSNKNSASTNSKKHK
                     KEGEEVEEPKKKQKKPAPPTLLPHEEKIRNLELEANATIIVPSKGKVTPPPTSDAQSQ
                     PQLPPLATVSDAPAHTESTTGKADIANLVDHHDNSTDEEFAKTLEAEMNRADDDESEE
                     E"
     gene            complement(<604063..>605073)
                     /locus_tag="CAGL0F06061g"
                     /db_xref="GeneID:2887727"
     mRNA            complement(<604063..>605073)
                     /locus_tag="CAGL0F06061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446235.1"
                     /db_xref="GeneID:2887727"
     CDS             complement(604063..605073)
                     /locus_tag="CAGL0F06061g"
                     /inference="similar to AA sequence:UniProtKB:Q04212"
                     /note="similar to uniprot|Q04212 Saccharomyces cerevisiae
                     YMR041c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446235.1"
                     /db_xref="GeneID:2887727"
                     /db_xref="GOA:Q6FU59"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FU59"
                     /translation="MTVDHNDITKVSKIILGGATLNTQYNDNPEEVPIVDMLKHAFTN
                     GINAIDTSPYYGPSEIIFGQALHKLKSPDEDGLSFTRDQYYICTKVGRIKLEEFDYSP
                     KAVRASVLRSCERLDTDYLDLVYLHDVEFVEFTKSMEALKELRKLKEEGVIRHFGLSG
                     YPVKYLAFLCNECAKHPEIGPLDAVLSYCNYNIQNTTLEKYINSIRKDAKVKLLSNAS
                     ILGMSLLRSQGIHSFHPASDELKAKCRQAAEYTHKHGVEIQDLANRYAMFNWHKYGPT
                     VIGVSNVAELQDAIIDYQITEKDKLPENDIKLVKHIQEEILGTEHYNETWDSGIPHPE
                     LP"
     gene            610507..610614
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0F06083r"
                     /db_xref="GeneID:2887728"
     tRNA            join(610507..610543,610578..610614)
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0F06083r"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:2887728"
     gene            <610882..>611406
                     /locus_tag="CAGL0F06127g"
                     /db_xref="GeneID:2887676"
     mRNA            <610882..>611406
                     /locus_tag="CAGL0F06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446236.1"
                     /db_xref="GeneID:2887676"
     CDS             610882..611406
                     /locus_tag="CAGL0F06127g"
                     /note="highly similar to uniprot|P36088 Saccharomyces
                     cerevisiae YKL069w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446236.1"
                     /db_xref="GeneID:2887676"
                     /db_xref="InterPro:IPR000614"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:Q6FU58"
                     /translation="MSEKHHADYTNFNATDRSEALQLLIDSYEALAMDQRNWVCNLAN
                     AASLLWHAYKSLNVNVNWTGFYIRNGEKEQLLLGPFQGKVACQTIDFGRGVCGIAASS
                     QETQLVPDVDKFPGHIACDGETKSEIVVPIVSQSGKTLGVIDLDCLDFEGFTDVDKEY
                     LEKLALAITKSCDF"
     gene            complement(<611537..>612466)
                     /locus_tag="CAGL0F06149g"
                     /db_xref="GeneID:2887729"
     mRNA            complement(<611537..>612466)
                     /locus_tag="CAGL0F06149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446237.1"
                     /db_xref="GeneID:2887729"
     CDS             complement(611537..612466)
                     /locus_tag="CAGL0F06149g"
                     /inference="similar to AA sequence:UniProtKB:Q04659"
                     /note="similar to uniprot|Q04659 Saccharomyces cerevisiae
                     YMR048w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446237.1"
                     /db_xref="GeneID:2887729"
                     /db_xref="GOA:Q6FU57"
                     /db_xref="InterPro:IPR012923"
                     /translation="MDEDDMLMLGVGAEPTQHAEIEDPLTGGVASDPTMINDDPTAVN
                     AKVRRPQVKLTAERLLSPNGLPYVMKHAPKRVRISKSRSTYKNLEHIIQFYQLWAHEL
                     FPKAKFKDFVRLCNSLGKTDADLRNYRTELFRADMENQFGDGYRSDKQNPANNSQPVT
                     STQLPNNDANSNDENNNVENDTNQLITGGQETTRHLFARDEEDDDDSDLYRSVPPPSS
                     IAHESATSNTHAVPTSDTTLPISDNNPKGVTNSDGTVIGISEEDELLAMEEELNNYAT
                     QKIEELGDDKDTGIDPGEEEDEDALDAMKELGF"
     gene            <613189..>616296
                     /locus_tag="CAGL0F06171g"
                     /db_xref="GeneID:2887692"
     mRNA            <613189..>616296
                     /locus_tag="CAGL0F06171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446238.1"
                     /db_xref="GeneID:2887692"
     CDS             613189..616296
                     /locus_tag="CAGL0F06171g"
                     /inference="similar to AA sequence:UniProtKB:Q02630"
                     /note="similar to uniprot|Q02630 Saccharomyces cerevisiae
                     YMR047c NUP116 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446238.1"
                     /db_xref="GeneID:2887692"
                     /db_xref="GOA:Q6FU56"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="PDB:3NF5"
                     /db_xref="UniProtKB/TrEMBL:Q6FU56"
                     /translation="MFGQPRLFGANSQPFGSTNNTGSTGAFGNVQNNNVQSGFSGFGS
                     NNNASNAPQSGAFGANTSSLNSPFGSNNNAMGTPSNSTTSGGGLFGMQNPNTSGMAGG
                     NSLFGMNNNGNTGTTMMGGLPVGGMNAGAGTGTAIKPFQVVEEKDMTTNAINMYQSIT
                     FMNEYRNYSFEELRMQDYKAGRKFANSSATSTGFGTGQNQQFGAFGNTNSAQPGAQSS
                     PFGQKPASGGLFGGNGVGSTSTGLFGSNQTSTNTFGANNGSTFGNNAASSGGLFGSTN
                     NTNTNTGMFGSASNANSGGLFNQQNQTQQQQSSPFGASSGFGKPPASSGGLFGQTGAN
                     PFSSNNANTAFGQTAQQQTPNQGGLFGQSNQSQGTGLFGQSGQQQPQGGLFGQAANGN
                     SLFGSKPQPSTGFGQQTTSAGGFGSSGGLFGGQNTQQQGGLFNQTSQTQTGGLFGQNQ
                     PPNQAGGLFSQTQNTNANSPFGMKSATPAGGLFGNNQGQQGGGIFNQNQNQQQGNTTG
                     LFGGGQSQQTQSNTAGSLFGQKPTGFGSTAQPNTSSFGNTQSSGGLFGNKSTGGGLFG
                     STNTQNTTPSFGSGGTQSLLGAKPAGGLGGLGAQQPAATQTSGLFNKPATSTSFGGTS
                     SLFGNKAGPQQGSTGGLFGSNSTSNIGAGLATSQQFSNNSANQQIGNPSQNNDQEKLQ
                     QQQLLVTNPYGTNELFSKVQQAAPGSMQVSVQIQVSATKIDADNKKKSDLISAYKHTP
                     KPLFAAALSGKGLVAEKTNEIKNDLDKETSTRIMNNEIDANFQQIGSKLFEPDSLMFK
                     QLLKSKGNHRNKDLKSKEKLFIANVADSNLNEADKDKAKNEIAKLNASQVVATTLASS
                     VRETEKQEKIETDICNENAISESKLDGIDDLEFVDENYYISPSLDTLATLSKYEIQKV
                     ENLVVGNKQYGKIEFLDPVDLSDIPLGSICDDLVVFQPMSVLLYNNSTNVPEKGKGLN
                     VRARISCYNCYPLDKSTRKPIKDPNHRIMERYSEKLKKIPHTHFESYDPASGTYCFTV
                     DHALI"
     gene            complement(616444..616515)
                     /locus_tag="CAGL0F06193r"
                     /db_xref="GeneID:2887724"
     tRNA            complement(616444..616515)
                     /locus_tag="CAGL0F06193r"
                     /product="tRNA-His"
                     /note="tRNA His (GTG) cove score=66.37"
                     /db_xref="GeneID:2887724"
     gene            complement(<616975..>618324)
                     /locus_tag="CAGL0F06215g"
                     /db_xref="GeneID:2887688"
     mRNA            complement(<616975..>618324)
                     /locus_tag="CAGL0F06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446239.1"
                     /db_xref="GeneID:2887688"
     CDS             complement(616975..618324)
                     /locus_tag="CAGL0F06215g"
                     /inference="similar to AA sequence:UniProtKB:Q04213"
                     /note="similar to uniprot|Q04213 Saccharomyces cerevisiae
                     YMR044w IOC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446239.1"
                     /db_xref="GeneID:2887688"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:Q6FU55"
                     /translation="MPNIYQPTDVVLAKVKGFPAWPAMVIPKELIPENVWKIRSRISV
                     DKAETKEDQDSTPDEEFGSDYDPNDYIIYSKVLKFKKNKEQPSLYCVKFMCDDSYIWV
                     KQSDMQPLSVEECQEWLASKTKKNKKLIPAYEMAMKGSSGIDVWEFVEYGSMGKPDED
                     EYIEDDFEEPATTRRSRSKNAKIKPMRSSSRQRKKLESSVDEDDIGEAGRRTRTRAKQ
                     TNSKRDQLHALEDIIETPNKRTRKEQISKKVQTKKTKAIKPKIPEKEYYKYEDDDDWS
                     IVGLGPQETEIGKCLSAVVKKSISKKSGDRHSEMKLDLEDKILSINKLLEVSLYKMIK
                     NDQNQDDSLKNDLELIADEIAVALNIKGSMTEFLTVFNSNNQLIMNYRLLMNLGKKDL
                     EKWNLWDDFQSFFQTIYDCAFIPDSHQWEVPLEEDTNNEVQPPNEVKESIQEEILAE"
     gene            complement(<618976..>619632)
                     /locus_tag="CAGL0F06237g"
                     /db_xref="GeneID:2887697"
     mRNA            complement(<618976..>619632)
                     /locus_tag="CAGL0F06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446240.1"
                     /db_xref="GeneID:2887697"
     CDS             complement(618976..619632)
                     /locus_tag="CAGL0F06237g"
                     /inference="similar to AA sequence:UniProtKB:P11746"
                     /note="similar to uniprot|P11746 Saccharomyces cerevisiae
                     YMR043w MCM1 transcription factor of the MADS box family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446240.1"
                     /db_xref="GeneID:2887697"
                     /db_xref="GOA:Q6FU54"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:Q6FU54"
                     /translation="MSDIDEDTSTPTGGQRERRKIEIKFIENKTRRHVTFSKRKHGIM
                     KKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDDEE
                     EEEEEFDTSMQQGQQPQNQHQEQIAEQNKQPHTQKNNAPMDQQHMQVHQEQVAYSHDD
                     KGHVPEMNGQGGAPGFANGQDMHLQQQGKGPNQYNHYLNEEQNSVYQQYFQDQQAHYG
                     "
     gene            complement(<620431..>621027)
                     /locus_tag="CAGL0F06259g"
                     /db_xref="GeneID:2887755"
     mRNA            complement(<620431..>621027)
                     /locus_tag="CAGL0F06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446241.1"
                     /db_xref="GeneID:2887755"
     CDS             complement(620431..621027)
                     /locus_tag="CAGL0F06259g"
                     /note="some similarities with uniprot|P07249 Saccharomyces
                     cerevisiae YMR042w ARG80 or uniprot|P11746 Saccharomyces
                     cerevisiae YMR043w MCM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446241.1"
                     /db_xref="GeneID:2887755"
                     /db_xref="GOA:Q6FU53"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:Q6FU53"
                     /translation="MNSQSLFGISPISSSDHINLDPDLGKMPGMPGMPGIQGQRQDQR
                     PQRQVQMPAHMPGQRPTVGGGDEVRGTRDYSDKGNGNGNEHEIENEQENENENENDDE
                     DEEVSTPSSAVGKRRKAPLKYIENTTRRHVTFAKRRHGIMKKAYELAVMTGANVLLLI
                     LSPKGLVYTFATPSLQPLIRDDPGKELIRRCLNQDNST"
     gene            complement(621292..621389)
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0F06281r"
                     /db_xref="GeneID:2887730"
     tRNA            complement(join(621292..621328,621352..621389))
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0F06281r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:2887730"
     gene            complement(<621735..>624419)
                     /locus_tag="CAGL0F06325g"
                     /db_xref="GeneID:2887731"
     mRNA            complement(<621735..>624419)
                     /locus_tag="CAGL0F06325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446242.1"
                     /db_xref="GeneID:2887731"
     CDS             complement(621735..624419)
                     /locus_tag="CAGL0F06325g"
                     /inference="similar to AA sequence:UniProtKB:P46679"
                     /note="similar to uniprot|P46679 Saccharomyces cerevisiae
                     YMR053c STB2 SIN3 binding protein or uniprot|P36085
                     Saccharomyces cerevisiae YKL072w STB6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446242.1"
                     /db_xref="GeneID:2887731"
                     /db_xref="GOA:Q6FU52"
                     /db_xref="UniProtKB/TrEMBL:Q6FU52"
                     /translation="MKDSDWSGEHILRVGNDVHDVHNVHVRTTSTKTTKSNTTYNTTY
                     NTAYNTAYNTTNLSDGKSAERAEGALVMPQIEPQLTSFIFPDMRALYNIGIESYKDVY
                     YDEITVQGFEIYIVEQWIAERKLSAVISSYTGNTQDVISAVRVVLNRDPHFWPHRFKR
                     YYEELLPFTQPKFISKGCIFVTNLSAMSSKLSLLHVECGDLRSVWHDFKTNFDLKKLH
                     CTGRSALLLSAPASSAMNKFSQLFKIPIKDVVTTDQVGSQQYQDPTTEAHLLSHKRSL
                     EDPFSGRGDEEHHPLTFSKRTMQERTPPAASLWKTKKGHDLPGFYSPVVEMVTLIQIS
                     LSYFNLFKGKDKNIVDGLLSEGTKSAIEQWWLVFGRIYFGVEKPRNEGTLGPTTVASM
                     LSLVLSCFYKLILVDCMPAKDPFDEQDFRQGVSNFQKKYSTTTKENEGFLDPPTVEKL
                     FQEEARLTKNEFKKLTKTVKCKFQDIGGKGNVVQLANNVLSTDMDNFVKHIQCGSLGL
                     LWKNKGRPRRKDVRRICKKEFCGYSYKNGDPEKQLDEETERCNNLNEKLRLAHEEENK
                     KKTSEMFGNYMIDIPIIGNDLHMGDPVSSKPWRTSDAGSSEKEDDVMSKGPSAVSLSS
                     MYCNYDKHHYESGLNTNQLYHSEFYRRGSSSNLQTLREESETGVLECTEVLYRSISCS
                     DIQQQIERWTLPFDPSVVRLARDLKKIQRETKAEAQIEDMQHGYYSIMTKKTCYMEEK
                     RMQDLLKVSGDLFYKYVHAARAFQNKYDGIEIKQNFLLNDMRELNSLCSKLKYDVRIL
                     DLRVRDVEEAIQQFQRKLDTVRNTMNIGHSTIHIDTADVGTKEEFDQYIIDRYNKAHP
                     CYQSYCLKVISKDFYNNLKNDISGWVSWLFDGMFQKDK"
     gene            <625184..>627916
                     /locus_tag="CAGL0F06347g"
                     /db_xref="GeneID:2887756"
     mRNA            <625184..>627916
                     /locus_tag="CAGL0F06347g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446243.1"
                     /db_xref="GeneID:2887756"
     CDS             625184..627916
                     /locus_tag="CAGL0F06347g"
                     /inference="similar to AA sequence:UniProtKB:P37296"
                     /note="similar to uniprot|P37296 Saccharomyces cerevisiae
                     YMR054w STV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446243.1"
                     /db_xref="GeneID:2887756"
                     /db_xref="GOA:Q6FU51"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:Q6FU51"
                     /translation="MAKHEAIYRSADMTYIQLYIPQEIVREVVCLLGKLGNVMFRDLN
                     SDLSAFQRGYVARLRRLEDVGRSVDYMKRVSEKHREATARYMPQLFEDEELDDLEFNA
                     TNDNPGSNTGDDNESLLSQQNLDNLVRPSRRVNPHALFPQLLRSLEVHSMDTINDIIH
                     EITEFESRVKQLDDSLESLRDKLNVLIEKRHIVFECSRYIKFNPGILGRISNSNDANV
                     SGSQLDVTDFTALPEEANDNLSDFSFDIDEDTAEDNQNNNNDDDILMLEQGFHNKFMI
                     AGAIRRDKVMILNRILWRLLRGNLFFQNFPVEKPMMENGELVEKDCFLIFTHGDTLSA
                     KIKRVVDSLGGSMISLDQISQQTIQELNDRISDLEQVLESTERTLHTELLLINDQLSV
                     WHAVFRRETYIYATLNLFRQETQGLVAEGWIPYEELQTLKNTLKDYSESIGSEYTTVI
                     SVIITNRSPPTYHRVNKFTQAFQSIVDAYGIATYKEINPGLATVVTFPFMFAIMFGDA
                     GHGFIVLLIALYLVMNERKFDNMKREEMFDMAYTGRYVLLLMGAFSIYTGLMYNDIFS
                     RSMTLFSSGWEWPTTFKKGETLEAKQVGTYAFGLDWAWHGTENNLIFTNSYKMKLSIL
                     MGFIHMSYSYMFSYINYRHRKSRVDIIGNFIPGLIFMQSIFGYLSWAIVFKWSKDWIK
                     DGKPAPGLLNMLINMFLAPGTIDEQLYSGQAVLQTILLLAALVCVPWLLLYKPLMLRK
                     QHANGETNYSSLQHPTADDTMTSESIIDNEVVITDFDTDESESHGFNFGDVMIHQVIH
                     TIEFCLNCISHTASYLRLWALSLAHAQLSTVLWNMTIANSFSSKDPGSPLAVFMVVFL
                     FAFWFILTVAVLVLMEGTSAMLHALRLHWVEAMSKFFEGNGYAYEPFSFDLLTE"
     gene            complement(<628054..>630723)
                     /locus_tag="CAGL0F06369g"
                     /db_xref="GeneID:2887859"
     mRNA            complement(<628054..>630723)
                     /locus_tag="CAGL0F06369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446244.1"
                     /db_xref="GeneID:2887859"
     CDS             complement(628054..630723)
                     /locus_tag="CAGL0F06369g"
                     /inference="similar to AA sequence:UniProtKB:P36016"
                     /note="similar to uniprot|P36016 Saccharomyces cerevisiae
                     YKL073w LHS1 chaperone of the ER lumen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446244.1"
                     /db_xref="GeneID:2887859"
                     /db_xref="GOA:Q6FU50"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /translation="MKLSILFLFAIAVQAAFLGIDYGQQSIKAMVVSPKAMMEIVLTP
                     EAKRKDTSGICIRNVNGVLERHYGNSIGSLVTRFPQNTAMHLRSLLGKSMNDKDTIES
                     YLRENPGANLTSTTRNTIAITIDGVEYPVEQLVAMNLQEIIDRANQHIKETDTTGIDF
                     VEQVGIAIPEQFNQAQRQALLDALALTSVKDEAVLVSDGLSVAIDYALKRPDLEINVP
                     QYYIVFDVGTSAAKATLFSLTQPEDLSSPIKIEIGAFDSEATVGGSKFIAAIADIVED
                     KFLEKNTKITRKSLVENPRARAKIIQAAEKAKLVLSANNEAIISIESLVDDIDFRTTI
                     ARSEFQDIFEDNKHTVVKAIKGAIGNQLWDDNISLEDISGVILSGGSSRVPMVQEEIA
                     KLVGEEKILKNVNADETVINGATLKGLKYFGSFKTKPLDITERSLFDYSVEMSGESSS
                     KTVFEKGTKFPNESSILYKAPKKFGKELKFDLFESDTRILSNIVDTTVSSKNWTSACK
                     KGQLYLNVTFDLDSNRVFKIKDITVLCDSDGNAKEEEFEFIDVINDVTKATDVMPLSN
                     AEIRQLSNAITSWNRKDRERKRVQESLNVLEAELYDCRSFIEEFEEKLGEEEFETLKS
                     FTAFVKEKLEYLEDNSADMSKKDIEKLVRETRSQRDTLSRFYNSLDAALGSKDFQKLV
                     DTASKSIKKYKEIESKNLADLENKAEKFNVIGLNVTEKYNSILSKMSFSSIRRSSEEN
                     IKTLAGLIDEVNESIKSKAIDDESLENLIKTKLAFEELINTLDLENRQWTYQHQLVMK
                     ELKKMYNKKMKAIKKQEKQNENEENGDDEGDDEDETKTKKYLKEATSSGDSSTIKEED
                     STGSNEAGNKGDEEDEEEEEDDSSAGNVFDDEL"
     gene            complement(<631387..>632391)
                     /locus_tag="CAGL0F06391g"
                     /db_xref="GeneID:2887860"
     mRNA            complement(<631387..>632391)
                     /locus_tag="CAGL0F06391g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446245.1"
                     /db_xref="GeneID:2887860"
     CDS             complement(631387..632391)
                     /locus_tag="CAGL0F06391g"
                     /inference="similar to AA sequence:UniProtKB:P26448"
                     /note="similar to uniprot|P26448 Saccharomyces cerevisiae
                     YMR055c BUB2 cell cycle arrest protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446245.1"
                     /db_xref="GeneID:2887860"
                     /db_xref="GOA:Q6FU49"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FU49"
                     /translation="MEKFISHPPLLVHTSLSQLRYLILSEGIPVAGNDKRKRSKRGNL
                     SGGDEVDSGGSEADTHSQQSIKRLRCYVWSILSRTSMERCSQKYLALLQLGPPETHIL
                     QKIKNDTSRTLQTDPKFRAQVSEDALLRCLSCFAWEIERKKRQAGEGDTVDVSAYVQG
                     MNVLLAPLLYSCPSEAMAYQLFSTMCKRIIPAYLTRSLAGAQNGARLLDACLRIVDPK
                     LSKYLGDNLLPAEIYGMPSILTLSSCNKPLDQVCRLWDFMFAYGFHMNVLFVVAQLVS
                     IRSKIFESESPMNMLRQLPEFDADEIIRLGVGFVAKIPPDLYDLLIRHLTDPDIVIAE
                     "
     gene            <634283..>636190
                     /locus_tag="CAGL0F06413g"
                     /db_xref="GeneID:2887784"
     mRNA            <634283..>636190
                     /locus_tag="CAGL0F06413g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446246.1"
                     /db_xref="GeneID:2887784"
     CDS             634283..636190
                     /locus_tag="CAGL0F06413g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446246.1"
                     /db_xref="GeneID:2887784"
                     /db_xref="GOA:Q96WT3"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /translation="MMVPLLLSTYFITAVYGATHTFHWTTGWGNRNVDGIKERPVITC
                     NGEYPWPDVRVAKGDRIEVYLTNGFNNTNTSLHFHGMFQRGTNQMDGVPYLTQCPIGP
                     GDTMLYNFTVDENVGTYWYHSHTDGQYEDGMRGLFVIEDGENNKNFPYEYDEDVMLSI
                     GEWYDTTVDVLTRKFLNLNNPTGAEPIPQNLILNNTMNLTWEVQPDTTYLLRIVNVGG
                     FVSQYFWIEDHEMEVVEVDGVYVEKNTTNMLYITVAQRYAVLVHTKNDTSKNFAIMQK
                     FDDTMLDVIPKDLQLNATSYLVYDKSKPMPEQNYVDSIDDYLDDFYLVPMDKEELYPE
                     ADHVITIDVIMDNLINGVNYAFFNNITYTTPKVPTLLTVLSAGQDALNPFIYGTNTNT
                     FVLKKGEVVDLIVNNQDTGKHPFHLHGHVFQTILRDREFDDAKGEKPHSFNDSDHAAY
                     PSIPMKRDTVYLNPQSNMVLRFKADNPGVWFFHCHIEWHLLQGLAVVMVEDPISIQNT
                     ASQHLTANGLQVCGNVKVPTQGNAAANDSDFFNLEGQNVQHKSIPTGFTKKGIIAMTF
                     SCLAGVLGITMIAIYGFSEIPEPEIKVMRNLHLNPEDVLEKTSSSSVISASNSSSLED
                     SRNQKKKFIFF"
     gene            <637000..>637380
                     /locus_tag="CAGL0F06435g"
                     /db_xref="GeneID:2887773"
     mRNA            <637000..>637380
                     /locus_tag="CAGL0F06435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446247.1"
                     /db_xref="GeneID:2887773"
     CDS             637000..637380
                     /locus_tag="CAGL0F06435g"
                     /inference="similar to AA sequence:UniProtKB:Q04675"
                     /note="similar to uniprot|Q04675 Saccharomyces cerevisiae
                     YMR059w SEN15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446247.1"
                     /db_xref="GeneID:2887773"
                     /db_xref="GOA:Q6FU47"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR018593"
                     /db_xref="UniProtKB/TrEMBL:Q6FU47"
                     /translation="MSNLTERVRDNLLHFHLWTEVEEVPKQLNWKDDRIINILVGRPP
                     HKLSNDDDEEQEGDCKRAKKEYILPVEMSMYKEGYLTLELLDKIFDDLCAASTQRLLL
                     GIVNDDGTVLYYFAHKGIYKPKKN"
     gene            complement(<637495..>638397)
                     /locus_tag="CAGL0F06457g"
                     /db_xref="GeneID:2887865"
     mRNA            complement(<637495..>638397)
                     /locus_tag="CAGL0F06457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446248.1"
                     /db_xref="GeneID:2887865"
     CDS             complement(637495..638397)
                     /locus_tag="CAGL0F06457g"
                     /inference="similar to AA sequence:UniProtKB:P50110"
                     /note="similar to uniprot|P50110 Saccharomyces cerevisiae
                     YMR060c TOM37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446248.1"
                     /db_xref="GeneID:2887865"
                     /db_xref="GOA:Q6FU46"
                     /db_xref="InterPro:IPR019564"
                     /db_xref="UniProtKB/TrEMBL:Q6FU46"
                     /translation="MTGSVLYLWGKDRASGISGESIALEWYLKSKALREVEIVFANNT
                     DISPLGRLPVLKVCSNGDYIHGFLNIVDYLEPKRKDEFTDMEKLMELSAMSMLDSNLK
                     TLNEYQLYLDKNNYITFTRKELSQLLYFPFNFNAAYEYRNRAKEQCVDLEYLPVEEKE
                     DEDEDDGPADYELAQSKTFALRGLRKRQRAEELKSVRLNRNYMHKLLEFLDQWDSITD
                     DLPKTSPVPILFYSYMYIQLVILPNNNEICKYLKEMKSNGYVDTLKETFTKYNALDFN
                     LNVREPVFRERGDLISTLLNKISV"
     gene            <638792..>640732
                     /locus_tag="CAGL0F06479g"
                     /db_xref="GeneID:2887866"
     mRNA            <638792..>640732
                     /locus_tag="CAGL0F06479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446249.1"
                     /db_xref="GeneID:2887866"
     CDS             638792..640732
                     /locus_tag="CAGL0F06479g"
                     /inference="similar to AA sequence:UniProtKB:P25298"
                     /note="similar to uniprot|P25298 Saccharomyces cerevisiae
                     YMR061w RNA14 component of pre-mRNA 3 -end processing
                     factor CF I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446249.1"
                     /db_xref="GeneID:2887866"
                     /db_xref="GOA:Q6FU45"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /translation="MSTTNEETQANASKDYSEDALKMSYAAQPLDIMRALKLIEYYES
                     KDDYDNSRKLYAELHERFPLYSPLWTMHLQSELQRNEFDTVEKLLAQCLAGDLENNDL
                     SLWSTYLDYVRRKNNLITGGQEARAVVIKAFKLVMDKCATFEPKASSFWNDYLGFLHQ
                     WKPMNKWEEQQRLDMIREVYKKMLCVPFDKLEKMWNQYTLWEQETNTLTARKFIGELS
                     ADYMKARSIYQELLNVTANIRRTSPLNLRTANKNNIPQYVLPCKKNDHTQLEAWLKWI
                     AWEKENKLELTEDALKDRVTYVYKQAIQQLLFEPEIWYDYVMYEFDNDAARKNILKVA
                     LQANPTSPTLTFKLAECYEVENKSEEVQNCFEKTIDELLRQYKNDNGNDELSSDIIWE
                     RKTLTYIYCIYMNTMKRLSGLSAARAVFGKCRKLKKAMTHDIYVENAYLEFQNQNDHK
                     TASKVLELGLKYFGDDGEYINKYMDFLSLLNRGSQMKTLFETSIEKVEDLRQLKKIYV
                     KMIGYESKYGNLNNVYQLEKRFFEKFPDTDLIQLFSTRYKIQDDNKIKNLELTYKLPD
                     IISSDGDPSGVDKSFKKRQIENDENLPDSKRQKSQPLLPKEILDILAVLPKKQYFKNA
                     FLDPSNLVNYLNEQVKLADEEN"
     gene            complement(<640833..>642158)
                     /locus_tag="CAGL0F06501g"
                     /db_xref="GeneID:2887807"
     mRNA            complement(<640833..>642158)
                     /locus_tag="CAGL0F06501g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446250.1"
                     /db_xref="GeneID:2887807"
     CDS             complement(640833..642158)
                     /locus_tag="CAGL0F06501g"
                     /note="highly similar to uniprot|Q04728 Saccharomyces
                     cerevisiae YMR062c ECM40 acetylornithine
                     acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446250.1"
                     /db_xref="GeneID:2887807"
                     /db_xref="GOA:Q6FU44"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="InterPro:IPR016117"
                     /translation="MKISKTLLQHGRKVIDKYNLYVPTEGVFPKGYKVGSIASGVKKN
                     GNLDLGVLVNTNTSRPSSAAAVFTTNKFKAAPVLTSKKVLESTQGNGINAIVVNSGCA
                     NAVTGELGMQDAQEMIDLVNRKIGKPNSTLVMSTGVIGQRLQMDKISAGIKNIFDNNA
                     LGNDFKSWLNIAKSINTTDTFPKLVSRQFELLNGQKYTLVGMAKGAGMICPNMATLLG
                     YFVTDLPIASSALQKILRFATDRSFNCISVDGDMSTNDTICMIANGAVETDEITESSE
                     EYEQVKSQVTEFAKTLAQLVVRDGEGSTKFVTVNVQNSLTFEDAKIIAESISNSMLVK
                     TALYGQDANWGRILCAIGYAKLDNLKSLNTDSISVSFIATDNSEPRELKLVENGVPQL
                     DVDEERAAQILALDDLEVLVDLKTGNESAQFWTCDLSHEYVTINGDYRS"
     gene            complement(<642553..>644835)
                     /locus_tag="CAGL0F06523g"
                     /db_xref="GeneID:2887913"
     mRNA            complement(<642553..>644835)
                     /locus_tag="CAGL0F06523g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446251.1"
                     /db_xref="GeneID:2887913"
     CDS             complement(642553..644835)
                     /locus_tag="CAGL0F06523g"
                     /inference="similar to AA sequence:UniProtKB:P36009"
                     /note="similar to uniprot|P36009 Saccharomyces cerevisiae
                     YKL078w JA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446251.1"
                     /db_xref="GeneID:2887913"
                     /db_xref="GOA:Q6FU43"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FU43"
                     /translation="MRTFSGARDGHNKKSQRERVSPFKINNVSTKSHYKDAGMHKKNG
                     KVNGGPIKHNGKIGREVKFGDEEDEDDEDSYDDNRMMNKADLKKKAQELLRIRSTLPV
                     YSNRDEIMPYLLENQVTILIGETGSGKSTQIPQFLLEDLYKQNKRGSIAVTQPRRVAA
                     ISLATRVAQEFGSRVSDKVGYSVRFDNATSERTRLKYLTDGMLLRELMMNKDLKEYSV
                     IIIDEAHERTVLTDLILGLLKTLITTTRKDLKVIVMSATLQAEAFSNFFDKAPILFVE
                     GRKFNVTQYYLKAPSDDIIDCAINCCVQINQGEQLGDILCFLPGQEEIDKAVTIMNKI
                     APVIAKETSVPLMLAYPLYAALSPAQQASVFNPVKGFKRKVVFSTNIAETSVTISGVK
                     FVVDSGLRKVKVWRHQLGLASLLTVPISQASAMQRTGRAGRESEGKSYRLFCEDDFSK
                     LPKQTEPEIVRSDITSPVLMLKRYGVNDLVNWTWFENPGKEAIIQGLQELYHLKALDD
                     SGKITNIGRKMALLPLLPHLSCVLIKASETDCINQVIDIISCLSVENLLLNPQPEQRD
                     EVNEKRLSSCNAGKKYGDLIMAKELFDIYFYDLGNGSNATQERKEWCKDLCVSYRGFK
                     NVLKIRSQLKSYCKKIFDNTHLKPDDDDEISGEQFKLNANEDEIKTILKCFLSGFSKN
                     TAIGMPDRSYRTVTSGETISIHPSSLLFGNKQCPAIFYTEYVFTTKGYARNVSRIELS
                     WLQDIVSSNATAMGRRSLKG"
     gene            <645359..>646099
                     /locus_tag="CAGL0F06545g"
                     /db_xref="GeneID:2887915"
     mRNA            <645359..>646099
                     /locus_tag="CAGL0F06545g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446252.1"
                     /db_xref="GeneID:2887915"
     CDS             645359..646099
                     /locus_tag="CAGL0F06545g"
                     /inference="similar to AA sequence:UniProtKB:Q04734"
                     /note="similar to uniprot|Q04734 Saccharomyces cerevisiae
                     YMR063w RIM9 regulator for sporulation and invasive
                     growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446252.1"
                     /db_xref="GeneID:2887915"
                     /db_xref="GOA:Q6FU42"
                     /db_xref="InterPro:IPR009571"
                     /translation="MHLFDLRTLLAILVSICVVFQAFPLATVPLNKNLILGQYMGYHF
                     GVFGWCFVDKGVTIACHCKFRPDSIETYKYTDQLLFPSLYKVTISTLLVVHPVSFAFT
                     CILWIMALIIRLSRFGRCPIFILSAATWSLAAFLLALLSALVDLLLFVNKLKWPGWLV
                     LASVPLMAICCSWLWSLRRQVSAIFYERKAYATQTYSRFDSMELSHIDTKFSDDQSIY
                     ETYTLERVPYSKNEAIEEPALTYYTSSS"
     gene            <646495..>648012
                     /locus_tag="CAGL0F06567g"
                     /db_xref="GeneID:2887914"
     mRNA            <646495..>648012
                     /locus_tag="CAGL0F06567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446253.1"
                     /db_xref="GeneID:2887914"
     CDS             646495..648012
                     /locus_tag="CAGL0F06567g"
                     /note="weakly similar to uniprot|P32493 Saccharomyces
                     cerevisiae YMR064w AEP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446253.1"
                     /db_xref="GeneID:2887914"
                     /db_xref="GOA:Q6FU41"
                     /translation="MSTSGTTKGIPIPLNIFKRKSIPFGRISRVTPKPEQLLHPFYRP
                     GNVSSLGLCMKEGKPALLDSKSIIPSIVQNSKTGNPVLANCSLAFSSVQGVSTWLKQY
                     ENLRETRTTPFSTIPFPDLNRYLTSLPKSKVEIIEKAYTNLINNDGSHISKGIILELV
                     HELSSDFELAVFSENILIFFLNDKVSKRSELACVLEAAFDLLDTHIDQPKTIYKFLMA
                     FFAKYFEVPVQTDTDLNTLMVKLLMKLENKFHLESMYSKMVPELTEALFSFYTREGNL
                     HEANIAINDLIKKGFIPKSEDIENYLTLINTKYPGHNSQDYMWRLFHIAHFEGLIQSS
                     DHPNLLKFLVQNCRHREEIETVFTIVAKNKNSKILLEHLTAPVIDSISNMKMHRVPKS
                     SLLSDYYKMMKFAFNNELSHQLKLLLLQGYITFGNFSMSAKIIEDNHLNLTVDIANKL
                     IKIIKHNNKLFKGIDCPGFSEEALALFLECYIKPFEDELNQHSKKWLIRQQHYCK"
     gene            <648302..>649711
                     /locus_tag="CAGL0F06589g"
                     /db_xref="GeneID:2887916"
     mRNA            <648302..>649711
                     /locus_tag="CAGL0F06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446254.1"
                     /db_xref="GeneID:2887916"
     CDS             648302..649711
                     /locus_tag="CAGL0F06589g"
                     /note="weakly similar to uniprot|Q04746 Saccharomyces
                     cerevisiae YMR065w KAR5 nuclear fusion protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446254.1"
                     /db_xref="GeneID:2887916"
                     /db_xref="GOA:Q6FU40"
                     /db_xref="InterPro:IPR007292"
                     /translation="MSMSITQPIKDLLSSQFQSYNISEQVKLYDIFPLLKPSCIKEAI
                     TDVVEVCTGYGPESLDPSIRAKAAVKLSLCEFEAVGLSIIPQGCYSNSIEEMMDCMLE
                     IEHSSHWWTTYSGNYQRLSDVCSTYREYYQEKAIIETFLNITDFMADFHNQFKSSVVS
                     ETQEFQSNMKDKFAGVYNQFTHFESLLSQMIQKHSGIINDSIVAIKNKLSTEFVDELQ
                     MLKNDRYILINQILESDTEIKKTIDSMLVELTEDMKNQISAKSEFLINHMNITRLNES
                     TALHDIIEENLQERFKDIAIFLDKFMVEIQTETNKVLLEVNEKLPTLEQQYLGNFAQA
                     LSNIDKQVLSASLQWQYDYDVVFANLYAALDLLNSNLNSSVKKIEQIEHVIDTIIVDT
                     SFLNDQLANLILIPSTILRAFSFIGVKRVIIAIIVLYFKSTLLCLVHYGQSFRIAALL
                     MSATAGIFCSKLLMSYIYN"
     gene            <650449..>653040
                     /locus_tag="CAGL0F06611g"
                     /db_xref="GeneID:2887886"
     mRNA            <650449..>653040
                     /locus_tag="CAGL0F06611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446255.1"
                     /db_xref="GeneID:2887886"
     CDS             650449..653040
                     /locus_tag="CAGL0F06611g"
                     /inference="similar to AA sequence:UniProtKB:Q04748"
                     /note="similar to uniprot|Q04748 Saccharomyces cerevisiae
                     YMR066w SOV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446255.1"
                     /db_xref="GeneID:2887886"
                     /db_xref="GOA:Q6FU39"
                     /db_xref="UniProtKB/TrEMBL:Q6FU39"
                     /translation="MIRHTLRLIRYPSFSICFRVARAYRSYASSHIPQLKSDQLKSSA
                     REHHRQDLGLKFNDPLKKSGFQEVNTIKHLEETLIQYFDFISNGFKKSKKNLVKLKKD
                     LHLLHTDVSAKERFSYVFQFLLAETQMEIARYNSLGPQAIKNLADTASSYKNLKEEAI
                     ENDDQLESAIMNVIFDDNLKDTTKTVLPYTELLLNLLGNMSKSSWEKNSELLELDNVA
                     EAYEIAKLIPLEDMKKRGIFWGGKILYDSRKVRLDPVNESFYIDALVYFGKYKEAFKL
                     FNTYRDKVNQRWWLELGMMIALRSNHIKAFQTLLIEHDSNYGLNGYISSKVARLAVKR
                     YLAIRDIAKANTMTDRVLNSAKQLGIKTETANNEYNNFNSEADAYKYLNTVEPPTVHD
                     LVSIANYHIFARNTEKVYDIFAVYFSSVGNSDPGFEFCITKTRLTMLKNLNELETALK
                     DRIEQNVVPSILEVLYQSYEDLRKETNMSEIIAKEIYFDSLRKLGDKKSYTLALEKLV
                     DGADNYPIKSEVGDSDHLRNQKIIAGVIKLMLWNGQEEKASRFLTELESSSQNSKSNH
                     KESLLNSHHYALFISHYSNKSKKHRKSLRTKVNDIIDTMHVENIQPTATFWSSLIAFY
                     RRDFDLDAAFSIINGILQDNQVSIDDKEIPIERNFYERRVISKKLYNEIWMTYAFYYN
                     LRKVSSVHETFDRCHKAFFHASKDICSKMQHFPEISSRCLFRRMITQDNILPEPHLYI
                     RVIKTFLKQGDLEGLYAVLLMMTKVHGLSISESVQKYILKGLQNLKKEYISQGEQQTS
                     DKYFDNRSLKKIGLNEEEQSDALNENNNVKEHKVFNELLELMQSRNISYKESLSETCQ
                     EMGVPYE"
     gene            complement(<653273..>654562)
                     /locus_tag="CAGL0F06633g"
                     /db_xref="GeneID:2887897"
     mRNA            complement(<653273..>654562)
                     /locus_tag="CAGL0F06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446256.1"
                     /db_xref="GeneID:2887897"
     CDS             complement(653273..654562)
                     /locus_tag="CAGL0F06633g"
                     /inference="similar to AA sequence:UniProtKB:P54730"
                     /note="similar to uniprot|P54730 Saccharomyces cerevisiae
                     YMR067c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446256.1"
                     /db_xref="GeneID:2887897"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR021569"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FU38"
                     /translation="MSSVHVHHNVSSLKVPVNGSTTLKDVLNVATKHYNLDPERYTLQ
                     KDYETLDLSVPWRFLNMAQNSKFELVEMQVREDNAIAEPPKTIRIRFQIVDRGSFIKE
                     LSNNITLDKALQEIIDENQLDFAIHNAHLQCFGRQVPAELLASTTLNSLGIQSASNIK
                     VLITDRDQIAQPHLKRESEESVESPEKIQLVNEKEITEPIKVSKPHELHKPQVYLPPK
                     TSVSERVRNEIDNNIADDDYELTIEHAKLYQSMLAKQTGSLGGPLMTQRMRQMQDNVK
                     NNKHSVDECFIRFKFPDLTQIEISFSPEDTMHTVYNIVRELLISTDLNFGLYRTHPHL
                     LLDDSELRLVADLQFGAKTALLFEPNNKSNKGPYLRGSVIDSGESISNIIDPKINTTA
                     DTETEKEPSPTRKVSAAFSSSSTGPKKIPKWLRLSKK"
     gene            <654908..>656134
                     /locus_tag="CAGL0F06655g"
                     /db_xref="GeneID:2887653"
     mRNA            <654908..>656134
                     /locus_tag="CAGL0F06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446257.1"
                     /db_xref="GeneID:2887653"
     CDS             654908..656134
                     /locus_tag="CAGL0F06655g"
                     /inference="similar to AA sequence:UniProtKB:Q04749"
                     /note="similar to uniprot|Q04749 Saccharomyces cerevisiae
                     YMR068w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446257.1"
                     /db_xref="GeneID:2887653"
                     /db_xref="GOA:Q6FU37"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FU37"
                     /translation="MLEDPSLRLRKAIKEGNLLIVKRLLRRFPDLLTNIDPCNGWSSL
                     HYASYHGRYLICVLLIQLGHDKTEVLKTFKGNTCVHLALMNGHEQTTHLLLQHFPRFI
                     NKAGELGRTPTHIACIHDYYQCLSLLIGVGANLMMKDDKGNTPLHLCLEFGSTNCMKM
                     LVNEIQISDDSIRNNDNWRPSDVAKTVELAKFYKKIRKESAATDNLKKPSFQSFKTPV
                     LTSKAVFDDGPSPVLSINSSQIGNTGTNNINNSPLPRLQGIFTSRRPSVPTLNEIHNG
                     NDRSPLSGANAFGLSKSSSTRSASSPSHIVRNKSLTYLGVKDKPRMGKFEVNTESDSS
                     RSNIFGGSDNSALINRYLIPSKSINADDAATSEDSSKDLNSPTSISFNPHRRVSLLNI
                     PISKLRNDGSTNDQNN"
     gene            complement(<656199..>657539)
                     /locus_tag="CAGL0F06677g"
                     /db_xref="GeneID:2887920"
     mRNA            complement(<656199..>657539)
                     /locus_tag="CAGL0F06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446258.1"
                     /db_xref="GeneID:2887920"
     CDS             complement(656199..657539)
                     /locus_tag="CAGL0F06677g"
                     /note="highly similar to uniprot|P08539 Saccharomyces
                     cerevisiae YHR005c GPA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446258.1"
                     /db_xref="GeneID:2887920"
                     /db_xref="GOA:Q6FU36"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FU36"
                     /translation="MGCIISTSSNEDENDPFIKNKRANDIIEQSLLKERQKEKNEIKL
                     LLLGAGESGKSTVLKQLKLLHKGGFSHQERLQYAQVIWADVIQSMKILIVQARKLGIS
                     LDCDDPVNHPDLFEHKRVLLSAKALNYVDASVAGGSGFLNDYVIKYSETYALKRRSQS
                     TGKAKAFEDSFQYPYDDNEKLNLEEISKGLHENDDGSIFINSKQIKSPTVNNKTIAAA
                     ISNLWLKDRGIKQCFACANEFQLETSAAYYFDNVERFSENNYVCTDEDILKGRIKTTG
                     ITETQFNIESTKFKVYDAGGQRSERKKWIHCFEGITAVLFVLALSEYDQMLFEDSTVN
                     RMHESIMLFEKLINSRWFKDTPFILFLNKVDLFEEKVKREPIRKYFPDYPGKVGDEKA
                     GIKYFEKLFLSLNRSNKPIYVKQTCATDTETMKFVLSAVTDLVVQQQLKKSGII"
     gene            complement(<658346..>658627)
                     /locus_tag="CAGL0F06693g"
                     /db_xref="GeneID:9487988"
     mRNA            complement(<658346..>658627)
                     /locus_tag="CAGL0F06693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999495.1"
                     /db_xref="GeneID:9487988"
     CDS             complement(658346..658627)
                     /locus_tag="CAGL0F06693g"
                     /note="highly similar to uniprot|P87108 Saccharomyces
                     cerevisiae YHR005ca MRS11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999541.1"
                     /db_xref="GeneID:9487988"
                     /db_xref="GOA:B4UMZ9"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027100"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:B4UMZ9"
                     /translation="MSFLGLGGGAPQLSSQQKIQAAEAELDLVTDMFNRLVSNCYTKC
                     INNAYNEGDLNKNEANCLDRCVAKYFETNVKVGENMQKLGQTFNAAGKF"
     gene            complement(<658958..>659539)
                     /locus_tag="CAGL0F06699g"
                     /db_xref="GeneID:2887654"
     mRNA            complement(<658958..>659539)
                     /locus_tag="CAGL0F06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446259.1"
                     /db_xref="GeneID:2887654"
     CDS             complement(658958..659539)
                     /locus_tag="CAGL0F06699g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446259.1"
                     /db_xref="GeneID:2887654"
                     /db_xref="GOA:Q6FU35"
                     /db_xref="UniProtKB/TrEMBL:Q6FU35"
                     /translation="MGRINHKPLINGKRHEFKRKLNDKVEDFVRKSQKTITTRMNKVE
                     KKINDVGESENSLLSSVSLTLKTISKSSPIRNGPNPLSYCMSCPTKCREHRQPFKTPY
                     RAHQEPKVQYVRSTTQRSRFTAKKFTKSYRSDPLPRLKLRPYNHPWDSPLSKRDKSIQ
                     LNPYCSERARPITFDIKPPKFTRMPYGKATKFL"
     gene            <660254..>660766
                     /locus_tag="CAGL0F06721g"
                     /db_xref="GeneID:2887747"
     mRNA            <660254..>660766
                     /locus_tag="CAGL0F06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446260.1"
                     /db_xref="GeneID:2887747"
     CDS             660254..660766
                     /locus_tag="CAGL0F06721g"
                     /note="highly similar to uniprot|P15367 Saccharomyces
                     cerevisiae YIR022w SEC11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446260.1"
                     /db_xref="GeneID:2887747"
                     /db_xref="GOA:Q6FU34"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q6FU34"
                     /translation="MNLRLELKRFLALCFMFSSAYMTWKAMSLVANSHSPIVVVLSGS
                     MEPAFQRGDVLFLWNRNQRNKVGDIVVYEVEGKQIPIVHRVLREHSHTANPGKQFFLT
                     KGDNNAGDDIPLYSARNIYLNKEKDIVGTVVAYVPLVGYATIWLNESEKAKYAIMGLL
                     GLSALLSGEE"
     gene            <661325..>663730
                     /locus_tag="CAGL0F06743g"
                     /db_xref="GeneID:2887655"
     mRNA            <661325..>663730
                     /locus_tag="CAGL0F06743g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446261.1"
                     /db_xref="GeneID:2887655"
     CDS             661325..663730
                     /locus_tag="CAGL0F06743g"
                     /inference="similar to AA sequence:UniProtKB:P21657"
                     /note="similar to uniprot|P21657 Saccharomyces cerevisiae
                     YIR023w DAL81 transcriptional activator for allantoin and
                     GABA catabolic genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446261.1"
                     /db_xref="GeneID:2887655"
                     /db_xref="GOA:Q6FU33"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FU33"
                     /translation="MDSGSGGNVNGNSGSPNGSDRTSGDLGSRQHFIDDGQSRIEDLL
                     PEAHDNKDGGTAEGNDLLGFKENYDSFLSDLSNNGDKTKLHIDDQNPNFAELLSEYDS
                     LVNDVFSPEAENKCDGCKKENVKCTTKSDMTGCYNCQEKHIHCSLDQRSPQDLGPVIS
                     RKRSNQSERSSIDLKRGKSSNFDSPSSFFNDIKSHSPQSVGKQNLNRSSSNKSHQSSV
                     QYSPGSTKSQYNMMTQSRQSPQPPIQYPRSSFYLGSSSIYDTKLINSIKLDSIDQVQL
                     SPTVALRRVAPNVQFMLKDDYNQEVYLKQEQEVDLVESLIYPHGKALVEMFFKLVHPY
                     YPILHERVFLEKYSRSYRELTAPLLASIYSLALQWWDFHPGFIGFPKPDVIEKLNSIA
                     FETFLNRIERPKLSMVQTGLLLLLCRSECTNNWVISSCLVALAEELGLGIECQEWRLP
                     KWEKDLRKRLAWAVWAQDKWTALLESRHSHLILGRNWMVQMLSVSDLPINSPMITENE
                     AESSIDIAIGAPMFQITPTMDDFKNGALIFQYYVSLSIILGEIMDTFYTLGSIHINTS
                     IEQVLRLAKPLQLKLREWYRQLPPQLSMSKFESKKFNCNATLTLCYFTTEITLHRKII
                     ASIKPDTPEEIKKVCRTAARTRLVAAVEFIRDLKSEHTNAFWFPSATGSIMLIGSFAA
                     LLYTSSESKEESKYLSDLVRHYIWILRVGSKTFDKFGHALTNMHALFVEIPGLLNNDV
                     GDNEPEYKGKAPSYGSPPTSNKTFGGSNASSWQGSPSSFSKSHSNGPEKSFSRSDQAS
                     PSN"
     gene            complement(<664103..>664771)
                     /locus_tag="CAGL0F06765g"
                     /db_xref="GeneID:2887870"
     mRNA            complement(<664103..>664771)
                     /locus_tag="CAGL0F06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446262.1"
                     /db_xref="GeneID:2887870"
     CDS             complement(664103..664771)
                     /locus_tag="CAGL0F06765g"
                     /inference="similar to AA sequence:UniProtKB:P40576"
                     /note="similar to uniprot|P40576 Saccharomyces cerevisiae
                     YIR024c GIF1 G1 Factor needed for normal G1 phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446262.1"
                     /db_xref="GeneID:2887870"
                     /db_xref="GOA:Q6FU32"
                     /db_xref="UniProtKB/TrEMBL:Q6FU32"
                     /translation="MLRTTLRTIVRNTSYGGITSRCASSVAAPAAKKSRFDKSVVKPL
                     LVLVVFGSVLTNVMEERRKYSDMERRYQLKINKLEELIERANVGEKNLDIAAELKIID
                     ALFKVSQNQRYTGIIGNTKHHNGPSTPLKSKQDNEESLEDIWQELVSSLEEDELKLKR
                     EQELNKAKLSNELVTDKQLLKEQKKKEELEKNLVPSHATHTIVSTPGEVSEAAKDTSL
                     KRFV"
     gene            <665038..>666156
                     /locus_tag="CAGL0F06787g"
                     /db_xref="GeneID:2887918"
     mRNA            <665038..>666156
                     /locus_tag="CAGL0F06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446263.1"
                     /db_xref="GeneID:2887918"
     CDS             665038..666156
                     /locus_tag="CAGL0F06787g"
                     /note="weakly similar to uniprot|P40577 Saccharomyces
                     cerevisiae YIR025w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446263.1"
                     /db_xref="GeneID:2887918"
                     /db_xref="GOA:Q6FU31"
                     /db_xref="InterPro:IPR008402"
                     /db_xref="InterPro:IPR016807"
                     /db_xref="UniProtKB/TrEMBL:Q6FU31"
                     /translation="MDSIVPGVELLDGSESQSLLNIALFEQIKEKLNRQQGLRHKNNA
                     AHLRGQIGLREGTVNNESEDENQGDEAPYIPPLSAYSATSDEPYLPLRSIKKGCFKVS
                     IAAMKYDDFERRMYQIRKTGWHTLKPIGVAKTMAEIRREQRHKKEGSSNPESSQPETA
                     TEPDVDMLHQENINVAYTATNNRAYSNNTDVGAAIQNQERVLETSVEPQNRDNSFSVQ
                     GIGQDVNEGEEEEDEEDEISYDYDAEFARVEVEDEESDFQNRSNFFDSSNISDLNHGV
                     TAGINDNEATGGLSIQQFVETTAPNQNPYDDVYDESESNTRRVHLDPDESIDRISSDF
                     VSDNQEFTEMPTVDISDTINESDIMRSSRVSSLQNQQQ"
     gene            complement(<666263..>667348)
                     /locus_tag="CAGL0F06809g"
                     /db_xref="GeneID:2887933"
     mRNA            complement(<666263..>667348)
                     /locus_tag="CAGL0F06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446264.1"
                     /db_xref="GeneID:2887933"
     CDS             complement(666263..667348)
                     /locus_tag="CAGL0F06809g"
                     /note="highly similar to uniprot|Q02256 Saccharomyces
                     cerevisiae YIR026c YVH1 protein tyrosine phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446264.1"
                     /db_xref="GeneID:2887933"
                     /db_xref="GOA:Q6FU30"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FU30"
                     /translation="MEVTRVLGGIYMGGFTPLANHTPLKAEYNITHILSVIKLDTIPE
                     YLVRKGYTLKSIPIDDDDTTDILQYFNESNKFLDHCLYPYEQEYDPALVDFRKKKQDP
                     QNAVYVHCQAGISRSTSFVVAYLMYRFGLRLKDALHAVRRKRPQVEPNPNFMEQLQVY
                     AEMGANRVDPDNQLYKTWKLAQSIKVDPTGRDILSKDDTYKDSSNEDQELDKLTKEEL
                     SQTTVIRCKNCRKRLALSTSFIKHDPPSKQSSEGHFIRRAAGSRRIIDIQESSTTCSH
                     FFVEPLNWMKQELQGKQELEGKFSCPGCSYKVGGYNWKGSRCSCGKWVIPAIHLQSSK
                     VDHFPLAERTLPNMVNFKPSNVPLPKN"
     gene            <668173..>671451
                     /locus_tag="CAGL0F06831g"
                     /db_xref="GeneID:2887687"
     mRNA            <668173..>671451
                     /locus_tag="CAGL0F06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446265.1"
                     /db_xref="GeneID:2887687"
     CDS             668173..671451
                     /locus_tag="CAGL0F06831g"
                     /inference="similar to AA sequence:UniProtKB:P40578"
                     /note="similar to uniprot|P40578 Saccharomyces cerevisiae
                     YIR033w MGA2 or uniprot|P35210 Saccharomyces cerevisiae
                     YKL020c SPT23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446265.1"
                     /db_xref="GeneID:2887687"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002909"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FU29"
                     /translation="MNFMKDTLDLDVLNYLDRDEVPADMMDMGMMDMNMDDPVLFNQN
                     TDTNVQMSDDYLAEFLQETADTNANTNMNTNTNMNTNTNMNTNTNMNANTNTNANTNT
                     NTNTNTNANTNTNTTAKKVNYGRLAPIDTQYVNPADFVDIRSDSLPHMLSVSGLPQVS
                     RVENQLKLDFELSPQANLSDIYLSSDCIARQKFYLEKNIEEYPQEFRNSLIYLDAFLI
                     CATNRKSIDVCTKCVRREQRRAARRKSGISDNMLWCNNPNRRAVIFNNKQIVKTSVNP
                     QTGNQVFSLTTRIVCYCRHHKSLEGFKILFVLKNSNNDILAKSITSAIMITDRKLFFN
                     NTNGGMGEVGMSLSNDGMNTSRQQMGTDNEDTDTSNHNIIYSETAVESSGATSATEFQ
                     AMRKDSVVQPTPMQNVSTNGLLPPNAQKFPENMSMNIPMDNSFNLSKKKGHIPSPTSM
                     SEDGSESQGLMMSAFGTTSSRVPMVNNERKRSRIHLDNTNMTPSQNISRSMSRTSMSS
                     NYQSAASPSQFSTNQIISSMSDINIKNSPNSSTMLSEVPIIHKVIPSQGPINGGIEVT
                     LLGVRFKEGLIVKFGDNLALSTECWSDSTIITYLPPALNAGQVYVTVTDPNGTAEQQM
                     ISNQLKKAIFTYVDNTDRQLIELALQIVGLKMNGRLEDARFIAKRIVGSDGSSPGLQG
                     SNNNSPNNINSNGQYSMDNQVKYSDEILITKVVKNLNTTSNLSMCDNLGRTLLHLASL
                     KGYFKLVSTLIKKGARIDDKDSFDFTPLHFACVSGDVKIIRILLDCGADKNRKTKHGL
                     LPLELFEINHGYGEKEHSDHMTEVVKMFTEDESAESGMGRKLSTSSFNSSIFDSESLQ
                     SENANSHDNEIDNEYPVYSDGSDYEDSDYEEEEDEDSDLLPIEQAHVTNEQCDEHEPG
                     NETHKTEESAIDNTNNESLWNRVLHRINDDLPKYEDLFPRATDEGETSLTKTEQSRSG
                     AAVLQRDISHTEDSQGSSEDEEEALQRGFNKFFQNRQNFQNDKMLLFFWIPLTLVLMT
                     WFIFFNFGWRDNTIQYFSNLLTHYVRIGLAKILLGNERMKTAFREQFSNFQSTGILND
                     LIVG"
     gene            <671942..>673108
                     /locus_tag="CAGL0F06853g"
                     /db_xref="GeneID:2887811"
     mRNA            <671942..>673108
                     /locus_tag="CAGL0F06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446266.1"
                     /db_xref="GeneID:2887811"
     CDS             671942..673108
                     /locus_tag="CAGL0F06853g"
                     /note="highly similar to uniprot|P20484 Saccharomyces
                     cerevisiae YKL021c MAK11 involved in cell growth and
                     replication of M1 dsRNA virus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446266.1"
                     /db_xref="GeneID:2887811"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FU28"
                     /translation="MSRNQFRIVVGSYEHNLLCLSLDLTLETPVFTPIFHFQAHSLSV
                     KCLDISKRYLVSGSNDEHIRIYDLQKRKELGTLLAHQGSITNLKFSKVSDQEPKSTSG
                     KWLLSASEDNKIIVWRVKDWENFGTLKGHTARINDMDIHPSNRVVASVSEDHSIRLWN
                     LMTVKKAAVLKLKKYNQNGQFVRWLKAQGKYFAVSLMTKVLIYDSTTAKVYREIDTGR
                     KTIMHMETVVLADVEYIVLGMSDGKVLFYKVEEILNSKETEFTEEPEFSLLGHTNRVK
                     DLKFYVNEFGTYMVTIGSDGKVIVWDMDKRDQVAVYDCGERLNCLAVCDETIEKADTM
                     KKRTIDQIELGEQSEVESDTEELKKVMFGQKKKNQKRNKNKNKNKKKKVEVQLE"
     gene            complement(<673222..>674340)
                     /locus_tag="CAGL0F06875g"
                     /db_xref="GeneID:2887663"
     mRNA            complement(<673222..>674340)
                     /locus_tag="CAGL0F06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446267.1"
                     /db_xref="GeneID:2887663"
     CDS             complement(673222..674340)
                     /locus_tag="CAGL0F06875g"
                     /note="highly similar to uniprot|P38998 Saccharomyces
                     cerevisiae YIR034c LYS1 saccharopine dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446267.1"
                     /db_xref="GeneID:2887663"
                     /db_xref="GOA:Q6FU27"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR027281"
                     /translation="MSVTLHLRGETKPLEHRAALTPTTVKHLIGKGFKIYVEESPQSI
                     FKIDEYRRAGAIIVPFGSWISAPRDRIIIGLKEMPEEDKFPLVHEHIQFAHCYKDQAG
                     WKDVLRRFINGNGTLYDLEFLEDDNGRRVAAFGFYAGFAGAALGLADWAFKQTHKDSE
                     DLPAVSPYPNEKALIKDIGKAYKNALKTGAKKPKVLIIGALGRCGSGAIDFLKKVGLP
                     EENIIKWDIQETSRGGPFPEIAASDIFINCIYLSKPIAPFINYELLNKPDRKLRTVVD
                     VSADTTNPHNPIPIYNIATVFNKPTVKVNTSSGPKLSVISIDHLPSLLPREASEFFAH
                     DLLPSLEQLPSRHVSPVWVRAEKLFNRHSARAIRESKL"
     gene            complement(<675416..>676192)
                     /locus_tag="CAGL0F06897g"
                     /db_xref="GeneID:2887806"
     mRNA            complement(<675416..>676192)
                     /locus_tag="CAGL0F06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446268.1"
                     /db_xref="GeneID:2887806"
     CDS             complement(675416..676192)
                     /locus_tag="CAGL0F06897g"
                     /note="highly similar to uniprot|P40579 Saccharomyces
                     cerevisiae YIR035c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446268.1"
                     /db_xref="GeneID:2887806"
                     /db_xref="GOA:Q6FU26"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6FU26"
                     /translation="MSQTEQKVILVTGVSRGIGKSIVDTLFSLDKNVIVYGIARSEAP
                     LKALKDTYGDRFFYTVGDITNDDTLKKYVNSAIEGHGKINSLIANAGVLEPVQNINNI
                     DVNAWKQLYNINFFSIVSLVDIALPHLKKTHGSALFVSSDASDTYFSSWGAYGSSKAA
                     LNHFAMTLANEEKAVRALAVAPGIVDTDMQVNIRENLGPQGMSQEHLEMFRDLKKDNK
                     LLHSSIPATVYSKLALNGIPEEINGQYLSFDAEVLKEFQH"
     gene            complement(<677473..>678225)
                     /locus_tag="CAGL0F06919g"
                     /db_xref="GeneID:2887584"
     mRNA            complement(<677473..>678225)
                     /locus_tag="CAGL0F06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446269.1"
                     /db_xref="GeneID:2887584"
     CDS             complement(677473..678225)
                     /locus_tag="CAGL0F06919g"
                     /inference="similar to AA sequence:UniProtKB:P40579"
                     /note="similar to uniprot|P40579 Saccharomyces cerevisiae
                     YIR035c or uniprot|P40580 Saccharomyces cerevisiae
                     YIR036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446269.1"
                     /db_xref="GeneID:2887584"
                     /db_xref="GOA:Q6FU25"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6FU25"
                     /translation="MKKVVLVTGASRGIGEAIVKNILALDSNAVVYGIARNEDALKSL
                     KDTVGARFQYLAGDITDEDKINEIVEKVVLEQGRIDSIVANAGVLEPVAKVGSSSVAE
                     WKKLYDINFFSIIHLINKTLPHLEKSEGNAIFVSSGASTKPYYGWCAYGSSKAAVNHL
                     TMSLAAENKAIKTIAVAPGVVDTKMQDDIRDKFGPSGMTADALKRFTDLKKNGELLDA
                     DVPGKIYARLAVSGIPAELNGEYVRYNDSRLQ"
     gene            <679960..>683502
                     /locus_tag="CAGL0F06941g"
                     /db_xref="GeneID:2887723"
     mRNA            <679960..>683502
                     /locus_tag="CAGL0F06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446270.1"
                     /db_xref="GeneID:2887723"
     CDS             679960..683502
                     /locus_tag="CAGL0F06941g"
                     /note="highly similar to uniprot|P11154 Saccharomyces
                     cerevisiae YGL062w PYC1 pyruvate carboxylase or
                     uniprot|P32327 Saccharomyces cerevisiae YBR218c PYC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446270.1"
                     /db_xref="GeneID:2887723"
                     /db_xref="GOA:Q6FU24"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6FU24"
                     /translation="MPQSGQKKKLAGLRANFNILGEKDKILVANRGEIPIRIFRTAHE
                     LSMRTVAIYSHEDRLSTHRLKADEAYVIGEEGQYTPVGAYLAIDEIIDIAKKHGVDFI
                     HPGYGFLSENSEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKAKVPTVPGTPG
                     PIKTVEEAEAFVAEYGYPVIIKAAYGGGGRGMRVVREGEDIGDAFQRATSEAKTAFGN
                     GTCFVERFLDKPKHIEVQLLADNHGNVIHLFERDCSVQRRHQKVVEVAPAKTLPRDVR
                     DAILTDAVKLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVA
                     AQIQIAAGASLTELGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRIEVYGSTGGNG
                     VRLDGGNAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKIIRALIEFRIRGVKTNIPFL
                     LTLLTHPVFISGQYWTTFIDDTPQLFHMVSSQNRAQKLLHYLADLAVNGSSIKGQIGL
                     PKLSTKPNIPHLHDEKGEIISVTKVAPPDGWRQVLLEKGPEGFAKAVRAFKGTLLMDT
                     TWRDAHQSLLATRVRTHDLAAIAPTTAHALAGAFALECWGGATFDVAMRFLHEDPWER
                     LRVLRKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLE
                     QLKVGVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLEVTDKIVEMGTHVLGIKDM
                     AGTLKPTAAKLLIGSIRAKYPDLPIHVHSHDSAGTAVASMAACAFAGADVVDVAINSM
                     SGMTSQASINALLASLDGEIDTGVNVKHARELDAYWAEMRLLYSCFEADLKGPDPEVY
                     DHEIPGGQLTNLLFQAQQLGLGEKWIETKRAYKEANHLLGDIVKVTPTSKVVGDLAQF
                     MVTNQLTSEDVKRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRSDILRNKRRKLTVR
                     PGLELEPFDLESIREDLENRFGEIDECDVASYNMYPKVYEDFQKMKELYGDLSVLPTK
                     NFLAPPSIGEDIEVHLEQGKTLIIKLQAVGDLNKETGMRDVYFELNGEMRKIRVPDRS
                     QKVEKVSKPKADNHDPFQIGAPMAGVIVEVKVHKGSLVKKGQPVAILSAMKMEMVVSS
                     QADGQVKDVFVKDAENVEASDLLVLLEEEIPPQE"
     gene            complement(<683862..>684500)
                     /locus_tag="CAGL0F06963g"
                     /db_xref="GeneID:2887579"
     mRNA            complement(<683862..>684500)
                     /locus_tag="CAGL0F06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446271.1"
                     /db_xref="GeneID:2887579"
     CDS             complement(683862..684500)
                     /locus_tag="CAGL0F06963g"
                     /inference="similar to AA sequence:UniProtKB:P53168"
                     /note="similar to uniprot|P53168 Saccharomyces cerevisiae
                     YGL061c DUO1 essential mitotic spindle protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446271.1"
                     /db_xref="GeneID:2887579"
                     /db_xref="GOA:Q6FU23"
                     /db_xref="InterPro:IPR013960"
                     /translation="MSESLDNSAINQLIPEIFDQMRHNAARTRDAKKPSAMVEESGSI
                     TTQSLLRELETLDKVIATIRSIDSVVKGALPSHMNKIHHVCKSTNKMLDNWINIQSQA
                     GYAHHIMDSRTGSKTGSNSNEEVVEQYKQEIAELQKSIKMEEDKLIPAQVKGNGNGPT
                     GQRLYGNSYRQPTGRVTKATALRNARNRPSGIPQISSRLTRPTASSNLKRQR"
     gene            <684832..>686724
                     /locus_tag="CAGL0F06985g"
                     /db_xref="GeneID:2887733"
     mRNA            <684832..>686724
                     /locus_tag="CAGL0F06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446272.1"
                     /db_xref="GeneID:2887733"
     CDS             684832..686724
                     /locus_tag="CAGL0F06985g"
                     /inference="similar to AA sequence:UniProtKB:P53169"
                     /note="similar to uniprot|P53169 Saccharomyces cerevisiae
                     YGL060w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446272.1"
                     /db_xref="GeneID:2887733"
                     /db_xref="GOA:Q6FU22"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:Q6FU22"
                     /translation="MSTEAIRKLRQYAEENEKEEFDGITYLVLLEECINGLSGSEDQA
                     LFFDELYGLLDQFGTPLNDELLWGLPKALIKNISSKNVEDKALVKAICNCMKLVARVG
                     TDDYNFLFGTELLRECRAEDTNIYDDSNDTYILEAFKVRVELLLEEFILPALKTLGQT
                     NPSKFLSVIVSALVELISNNMQCGEEIEMSNILLDVIIRFYDSYELPSAKVTTPDGAM
                     ANKDEEDIVQKILESFWSFSIGRCIKNQSCFPEYILLSQIPRMDFVKQEIDVPDDFII
                     KSRNIIRITNEKLQLDLQKMMEACFEETRKIYELLPPNPTVQDGNDLTEEIYQMSYVN
                     GVTTLEEQKGKLSLDTAGVLTLSGLYYIANDNKLNVKINLYDAVLLYLRFSSASLYSP
                     IFDNTFVEGICRFWLWSYTLGENRDKNTLQSELMSVPDYVLKVFFQLLLLKTCNEAST
                     LQKRINFNLLTQLLAFSNAEVAFDFIVDTILSCPYLDAKIAIAGILKDLMAKKSDDIH
                     LKEARQVKNEPNNHNCPPKLPDRPPITVDEHRIASIHSLVKLCIEDCLKPLNNKTQGN
                     LILLQYYINILITLYKQWDGFLLKEINDEIKKLFSQRQEQEFPELEFIRLANDTLSTQ
                     LERLNL"
     gene            <687174..>688631
                     /locus_tag="CAGL0F07007g"
                     /db_xref="GeneID:2887893"
     mRNA            <687174..>688631
                     /locus_tag="CAGL0F07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446273.1"
                     /db_xref="GeneID:2887893"
     CDS             687174..688631
                     /locus_tag="CAGL0F07007g"
                     /note="highly similar to uniprot|P53170 Saccharomyces
                     cerevisiae YGL059w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446273.1"
                     /db_xref="GeneID:2887893"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q6FU21"
                     /translation="MSRLSNMRHLHSVKTPNITQIPDFTKYSPVRPINEELAPYIYET
                     MKAFPSRSHYINQQHYYHNKNVLINDYLKKNPTPVSLTQLAQYYDDSTTLTKQKVISS
                     AKFVKEEISIRMAHKIHSLQLLPFNVINNFHFVQVYESYYNIFERFRKFPAVRTLDDS
                     IRFTKFARDILKDFNTLNLPHLIMGALECTTLDLYPTDKMDKLLSDLLRARISRRLIV
                     EEHISIADNYFSGKKKNTLVLGDIFQECSAKEHILGASKICEKFIQDMYFESIPMPEL
                     KINGETDLKFYFLPSHLKYLLGEILRNTYEATIKDYIRKGLPKPEPIVITIIKNEESY
                     LFRICDRAGGLAHHHDDNNIWSFGKTKEQAAQSISNFHKLPGLQTVSLYDHLYNNTED
                     RQVNRAYINTSLEPMAHSNIASAVATGYEVPLLKLLKRSFRYKLGIGLAMCKVYAEYW
                     NGDLTLHSIHGFGTDTVLKLGNLMIHTKDKQLDRV"
     gene            <689331..>691133
                     /locus_tag="CAGL0F07029g"
                     /db_xref="GeneID:2887607"
     mRNA            <689331..>691133
                     /locus_tag="CAGL0F07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446274.1"
                     /db_xref="GeneID:2887607"
     CDS             689331..691133
                     /locus_tag="CAGL0F07029g"
                     /note="highly similar to uniprot|P53128 Saccharomyces
                     cerevisiae YGL125w MET13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446274.1"
                     /db_xref="GeneID:2887607"
                     /db_xref="GOA:Q6FU20"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q6FU20"
                     /translation="MKITQKLADRHKEKPDKATFSFEYFVPKTTQGVQNLYDRMDRMY
                     EASLPEFIDITWNAGGGRLSQLSTELVATAQSVLGLETCMHLTCTNMPISQIDEALED
                     AYNSGCQNILALRGDPPLNAPNGWQPIEGGFNYAKDLVKYIRAKYGDHFDIGVAGYPE
                     GHPEEKERHKDLVYLKEKIDAGGSFIITQMFYDVDNFIQWCHEVREMGIDVPIIPGIM
                     PITTYAAFLRRAQWGQIKIPQAFLDVLEPVKDDDQLVRDKGSELIVDMCQKILNSGYV
                     KHLHIYTMNLEKAPLIILEKLGLLPSESEVNANPLASLPWRKSLNPKRKNEEVRPIFW
                     KRRPYSYVARTSQWAMDEFPNGRFGDSSSPAFGDLDLCGSTLIRQSGKKSLELWSTPK
                     TIEDVSQLVISYLTGQIKCLPWSDTSLDEEIDPILDHLLDLNRKMIITINSQPQINGI
                     RSNHKVHGWGPKDGYVYQKQYLEFLLPNEKVEKLEKQLAGNEMLTYFAVDNKDNLKSN
                     HPDGSKANAVTWGIFPGREVLQPTIVEKVSFLAWKEEFYRILEEWKWNFQENNELKSA
                     EFIQHIIDNYMLVNIVDNDYISSTDEIYNVLINL"
     gene            complement(<691462..>693255)
                     /locus_tag="CAGL0F07051g"
                     /db_xref="GeneID:2887661"
     mRNA            complement(<691462..>693255)
                     /locus_tag="CAGL0F07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446275.1"
                     /db_xref="GeneID:2887661"
     CDS             complement(691462..693255)
                     /locus_tag="CAGL0F07051g"
                     /inference="similar to AA sequence:UniProtKB:P53129"
                     /note="similar to uniprot|P53129 Saccharomyces cerevisiae
                     YGL124c MON1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446275.1"
                     /db_xref="GeneID:2887661"
                     /db_xref="GOA:Q6FU19"
                     /db_xref="InterPro:IPR004353"
                     /translation="MLSRKSSNWLLNVPSQSEATTSVNLQSTEVGSITHTSSDDNIAT
                     PQDGIDHIDNDRSSSRAENIDMTASMVSHSRSLASLRPVMSSNFQNESDHIDDSLEFD
                     LMRSLNESIYSTDGAISKPFMINEMPQIFDKNSNEDITKNFFIFTSAGKPVYSMYEND
                     KFSASYIGLLTSIISFFQTSNEDNIKTFTSKESNITFVFCNKDPIFYVAMSRCRDESR
                     DELEAQLHFLHSFVLSTLTSKQLTKLFQKRDNFDLRSHLESTDFETLSEICSNFTDKL
                     YPEFSLNSLQCLKLKKPIRAKIHSIMSSQLNKMEDFPRGTLLYSFIIASNNRLCNVLR
                     PKSHTLHPVDLQILFLVIATQFHNLESDKELWIPICFPKFNSNGYLYCYIRTIMNPGD
                     KSSSKFLGHPPVLVAISGQKDAFFKMKSYCDELMVILTRNNEIIRELRTSILQPYSIT
                     DIPAPLVHHFIFKSSKHIQFTMPQLSTSASEPEQRALYERKLKFYYKSLQNSIAQEIA
                     SQSNKSLVNFVQWSEPAKSNSEETTDHDSFIEEPVNMLGMVWCSPRFELLLLFNNGIV
                     TRKQALSSARRIVRWCVSNESSLFINEGATF"
     gene            <694044..>694805
                     /locus_tag="CAGL0F07073g"
                     /db_xref="GeneID:2887640"
     mRNA            <694044..>694805
                     /locus_tag="CAGL0F07073g"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_446276.1"
                     /db_xref="GeneID:2887640"
     CDS             694044..694805
                     /locus_tag="CAGL0F07073g"
                     /note="highly similar to uniprot|P25443 Saccharomyces
                     cerevisiae YGL123w SUP44"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_446276.1"
                     /db_xref="GeneID:2887640"
                     /db_xref="GOA:Q6FU18"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FU18"
                     /translation="MSAPEGQQRRGGFGGRNRRGGNRRGGRNTEEKGWVPVTKLGRLV
                     KAGKISSIEEIFLHSLPVKEFQIIDTLLPNLQDEVMNIKPVQKQTRAGQRTRFKAVVV
                     VGDSNGHVGLGIKTAKEVAGAIRAGIIIAKLSVIPIRRGYWGTNLGQPHSLATKTTGK
                     CGSVTVRLIPAPRGSGIVASPAVKKLMQLAGVEDVYTQSNGKTRTLENTLKAAFVAIG
                     NTYAFLTPDLWTEHPLPLSPLDVYSDEASAQKKKY"
     gene            complement(<695417..>697012)
                     /locus_tag="CAGL0F07095g"
                     /db_xref="GeneID:2887926"
     mRNA            complement(<695417..>697012)
                     /locus_tag="CAGL0F07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446277.1"
                     /db_xref="GeneID:2887926"
     CDS             complement(695417..697012)
                     /locus_tag="CAGL0F07095g"
                     /inference="similar to AA sequence:UniProtKB:P32505"
                     /note="similar to uniprot|P32505 Saccharomyces cerevisiae
                     YGL122c NAB2 nuclear poly(A)-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446277.1"
                     /db_xref="GeneID:2887926"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:Q6FU17"
                     /translation="MSQEQYTENLKVIVAERLKGVPNFNEDITYVAEYIVLLIVNGGT
                     VESVVQELSSLFDSVSPEALQDVVQTTFFALEALQQGESLENIVDKIRMMNAQSAGGN
                     IPDQQQQQQQQQQQQEQLMQQQQQQQQQQQQPSQGSMLVSQHATSQTEQSSQPVSAFQ
                     DVINASTQNGNGDVSQPQSAFQAVNTQPKFQSRGGGVGKSRRGARGASRGGLRNTYNS
                     RENANTNNRFNPLARALGMVDGKDQNVNFVRTKKEGRCKVFPHCPLGRSCPHAHPTKV
                     CSEYPNCPKAPGTCEFLHPNEDEELMKEIEKTREEFQQRKLALLAAKKKPVQTGIVLC
                     KFGTLCSNPMCPFGHPTPANEDAKVIDLMWCPNNLTCEDPQCTKAHSSLSKIREAKPM
                     TVKKVSAPPAMARPPVEKSLEQCKYGIHCTNKRCKFRHAKSHVMCRDGANCTRIDCFF
                     GHPINEDCRFGVECKNAACLFRHPEGRVLPDKKQQPQGGDQQQNQAQFAFPAQGIQTT
                     NRVFALPDSSNIEAAPQQDMDMN"
     gene            complement(<697508..>697930)
                     /locus_tag="CAGL0F07117g"
                     /db_xref="GeneID:2887714"
     mRNA            complement(<697508..>697930)
                     /locus_tag="CAGL0F07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446278.1"
                     /db_xref="GeneID:2887714"
     CDS             complement(697508..697930)
                     /locus_tag="CAGL0F07117g"
                     /inference="similar to AA sequence:UniProtKB:P53130"
                     /note="similar to uniprot|P53130 Saccharomyces cerevisiae
                     YGL121c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446278.1"
                     /db_xref="GeneID:2887714"
                     /db_xref="GOA:Q6FU16"
                     /db_xref="UniProtKB/TrEMBL:Q6FU16"
                     /translation="MDYKTTYIQYSETTRGNETRSEGLIYQDKGDGSGLAEIMLFTKV
                     QQNLMDVTRELRDVTDQIYSYRESPGSVACTKDTLPTLMAMLMDHRERARRQYKDILA
                     TKYSEHHWDLENIVKELEAELSRTDELLSLYPHRGTLR"
     gene            complement(<698363..>700669)
                     /locus_tag="CAGL0F07139g"
                     /db_xref="GeneID:2887645"
     mRNA            complement(<698363..>700669)
                     /locus_tag="CAGL0F07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446279.1"
                     /db_xref="GeneID:2887645"
     CDS             complement(698363..700669)
                     /locus_tag="CAGL0F07139g"
                     /note="highly similar to uniprot|P53131 Saccharomyces
                     cerevisiae YGL120c PRP43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446279.1"
                     /db_xref="GeneID:2887645"
                     /db_xref="GOA:Q6FU15"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FU15"
                     /translation="MGSKRRFSGSQHEHADPVATSIPEHAAEIAEDLTKKHPIPPEEP
                     LVHHDAGEFNGLVRHKTTVEQANKLETGKINPFTGNQFSEKYFGILKVRKDLPVHAQR
                     AEFLKIYQENQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQIACTQPRRVAAMSVA
                     QRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLKRYSCIILD
                     EAHERTLATDILMGLIKQVVLRRPDLKIIVMSATLDAEKFQNYFHNAPLLAVPGRTYP
                     VELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLV
                     REEGCGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVVSTNIAETSLTIDGIV
                     YVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQK
                     ELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLD
                     DEGNLTALGRLASQFPLDPMLAVMLIGAFEFKCSQEILTIVAMLSVPNVFIRPSKDKK
                     RADDAKNIFAHPDGDHITLLNVYHAFKSDEAYEYGINKWCRDHYLNYRSLSAADNIRS
                     QLERLMIRHNLELNTTDYESPQYFDNIRKALAAGFFMQVAKKRSGGKGYITVKDNQDV
                     LIHPSTVLGHDAEWVIYNEFVLTSKNYIRTVTSVRPEWLIELAPAYYDLDNFQKGDVK
                     LSLERIQEKVERMKELKKGKDKKKSKKK"
     gene            <701085..>701381
                     /locus_tag="CAGL0F07161g"
                     /db_xref="GeneID:2887627"
     mRNA            <701085..>701381
                     /locus_tag="CAGL0F07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446280.1"
                     /db_xref="GeneID:2887627"
     CDS             701085..701381
                     /locus_tag="CAGL0F07161g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446280.1"
                     /db_xref="GeneID:2887627"
                     /db_xref="GOA:Q6FU14"
                     /db_xref="UniProtKB/TrEMBL:Q6FU14"
                     /translation="MSARKALYYAYCVGGSAKEAIKESIQFGGKSAKQYVNTSIVLRP
                     ILSQFQWYHDPAWEEAKSLSKSLRNGQTHVKHSNKAGVRHYSTSSRRSIQVCFH"
     gene            <702000..>703244
                     /locus_tag="CAGL0F07183g"
                     /db_xref="GeneID:2887665"
     mRNA            <702000..>703244
                     /locus_tag="CAGL0F07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446281.1"
                     /db_xref="GeneID:2887665"
     CDS             702000..703244
                     /locus_tag="CAGL0F07183g"
                     /note="highly similar to uniprot|P27697 Saccharomyces
                     cerevisiae YGL119w ABC1 ubiquinol--cytochrome-c reductase
                     complex assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446281.1"
                     /db_xref="GeneID:2887665"
                     /db_xref="GOA:Q6FU13"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FU13"
                     /translation="MNAAAEGLSQVSKGQSPNWKSLILSESNIDRITKKFSQMRGAAL
                     KIGQMMSFQDEKILPRELYEILSRVQNSANYMPRRQLEKVMTKELGDNWEAKFKSFDK
                     IPIAAASIGQVHNGELLDGTKIVVKVQYPGVKDSIDSDLNNLLLLLTASRLLPKGLFL
                     DKTVANARTELKWECDYIREAKALQRFELLLKDDPVFVVPHVYEEFTTENVLTMSRME
                     GTEIMNLKNESNSQEIRNFISENIMRLCLEEIAVFEFMQTDPNWANFLYNAKTNKIEL
                     LDFGASRPFPSDFIKKYRKLLTYATQENRAGAYEMSKELGYLTGLESQSMKDAHVDSV
                     MTLGEPFRGSVEDVFDFANQTVSDRIRGNIGLMVNERLCPPPEETYSLHRKFSGIFLL
                     CARMEASVHCAKLFSKYFALKE"
     gene            complement(705086..705193)
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0F07205r"
                     /db_xref="GeneID:2887808"
     tRNA            complement(join(705086..705122,705157..705193))
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0F07205r"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:2887808"
     gene            <705576..>707186
                     /locus_tag="CAGL0F07249g"
                     /db_xref="GeneID:2887818"
     mRNA            <705576..>707186
                     /locus_tag="CAGL0F07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446282.1"
                     /db_xref="GeneID:2887818"
     CDS             705576..707186
                     /locus_tag="CAGL0F07249g"
                     /note="highly similar to uniprot|P53040 Saccharomyces
                     cerevisiae YGL112c TAF60 TFIID and SAGA subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446282.1"
                     /db_xref="GeneID:2887818"
                     /db_xref="GOA:Q6FU12"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FU12"
                     /translation="MSMSQKAKTIDDQNEDASALQQSFTIWSPQDTVRDVAESLGLEN
                     VNEEVLKALAMDVEYRILEIIEQAVKFKRHSKRDTLTTDDVAKALRVLNVEPLYGYHD
                     GSHSNRELSFAKVNTAGGQSVYYLDEGEVDFDKLINEPLPQVPRVPTFTTHWLAVEGV
                     QPAIVQNPNLNDIRQSQPPIVRGAIVTALNESSSQLGGSSGSNNGTGKGSVGGESVGG
                     SGSNLASVVQPGQNVDVKPLVKHVLSKELQIYFNQIISTLTKHVESGDEEGQHMKGAA
                     LMSLKTDTGLHQLVPYFIQFIAEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIH
                     SLMPSVLTLLLAKRLGGTPEKDDEASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKS
                     LKPRVTRTLLKTFLDTNRSFGTYYGCLRGVSVLEPESIRFFLGNLHNWARLVFEEQGV
                     TVGDAGEHTPSRFSKQEVGQLVDAIVSALVVLKKDLPEVYEGQGEAVSEGDKERLVAK
                     CGVTVAHSILEREDAQEITCAIFFGENM"
     gene            complement(<707309..>709510)
                     /locus_tag="CAGL0F07271g"
                     /db_xref="GeneID:2887622"
     mRNA            complement(<707309..>709510)
                     /locus_tag="CAGL0F07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446283.1"
                     /db_xref="GeneID:2887622"
     CDS             complement(707309..709510)
                     /locus_tag="CAGL0F07271g"
                     /note="weakly similar to uniprot|P53135 Saccharomyces
                     cerevisiae YGL113w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446283.1"
                     /db_xref="GeneID:2887622"
                     /db_xref="InterPro:IPR013948"
                     /db_xref="UniProtKB/TrEMBL:Q6FU11"
                     /translation="MEQWSVVATLPVLPPDITIATDHPRVVHANILPDDVLSEVGNTP
                     IYCKHILTDADDKFYVMERYGKEYWVIWIVEMDKHSITKLIDLIEFSDEVTTKEFGST
                     NGYQSIDEINNYGTSKAEWDEIKITKIFNSFAESTKDRKIIGNSSELFMTLPSNNEQN
                     KNTRTETCLVSDPKIYFNQRYYSTLFELDNAITYFVKSHLPRVRNLFKANTSTSDYLS
                     QYIALIKSSLIPVRNFDERHTLNGLTTLLSTFDPNSEILELLTASQNLTDDSLGNDLS
                     EKMLMLSVLKYRELKIQVVLLLEMMHLLSLDEQFDSFEKQYKNKLEQRSRNVTRSSFM
                     QRRSRTRKNPSTSRELDSPKGNDINNNNDNNSNNNVNDGTFKITTQTDTIQNNIFDFY
                     ELLDIYLDKLLITDILMSSTNLDNNNTDSESDQPEENMVETKKYNFQHYMKRILDKND
                     EASVVGFVNYTLIPYYNRKAPNTIKFIIQKLKGPSMRKQPLKRITTGNTVNESTPLMD
                     NSFNDFSNINNGTDPLRASSVQYASSEKNKEELRSSSPSRKSTFLSQRANSNLTDFIE
                     KEGSVNKRLLPISRTTSDISFLEKRQFAVDNSRHLDSQNPQVSTTSDKNTQPKMSNSI
                     SRLKQQSFRRVGRNKSIFKKSTDATSSFAFSHKSIKEVNETNTIQVLSTPMGKRQSNL
                     KAQEQSPLIIESPDAGIIAKSQTNVKGNSENNNTKTSIPPNKKVKRRLFAP"
     gene            complement(<710050..>712224)
                     /locus_tag="CAGL0F07293g"
                     /db_xref="GeneID:2887718"
     mRNA            complement(<710050..>712224)
                     /locus_tag="CAGL0F07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446284.1"
                     /db_xref="GeneID:2887718"
     CDS             complement(710050..712224)
                     /locus_tag="CAGL0F07293g"
                     /note="highly similar to uniprot|P53134 Saccharomyces
                     cerevisiae YGL114w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446284.1"
                     /db_xref="GeneID:2887718"
                     /db_xref="GOA:Q6FU10"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:Q6FU10"
                     /translation="MTSTKTDQSDQQSVRWADKPSINQITVRGTIAGIFIGSLVLISN
                     FQFGLQTGWVSMMSLPSALLACAIFKQLWPVFKPDDPVFTDVENVYVQSLAVAIGTGP
                     LALGFVGVVPAIEKFLTYEESGGTREQGIPFTFIQLLLWSAALTYFGIFFAVPLRKQV
                     IVREKLPFPSGNATATLIAVLNGTEIIQEVSKKEVLQMRRRRLEQCPEVLRMDPDSDD
                     STENALSPLINAEAQRQYNSTSPSDIQPNNVYLKNITILVQTFTISSIYTVIAYFVPV
                     IKAIPFLGNELSKKYLWNLQPSPAYFGQGIIMGLPTVSYMLFGCILGWGILAPIAVHK
                     GWVSNEEDVTDWNEGVQGWVLWCSLAIMITDSIVGFLVLLINSLVKFFMLDNRRVIIS
                     NMIDDSFESMILEEEAAINHQRSLSSAQSVGTVRLVSRDLEHEVDQKHLVKYTTVLSG
                     IVVSSVICISFVIYIFGIEVIPVYSMVLALFTALFLSILAIRALGETDLNPVSGIGKI
                     SQLLFSFIIPKTHPSAVLINLVAGGIAEAGAQQAGDLMQDLKTGHLLGASPRAQFIAQ
                     LIGITWSMFLSSVMYLIYNRVYTIPSIQFRIPTATVWIDCARLVTGKELPYGTLECSL
                     VLAVIFAILSLIRNCYRERELRWMKYIPSGVAVGIGLFNSPSFTIARFIGGLAAHMWL
                     SNHKGNIDVKTTLIVCSSGLILGEGVCSILNIIFTTLNVPHF"
     gene            complement(<713250..>714221)
                     /locus_tag="CAGL0F07315g"
                     /db_xref="GeneID:2887662"
     mRNA            complement(<713250..>714221)
                     /locus_tag="CAGL0F07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446285.1"
                     /db_xref="GeneID:2887662"
     CDS             complement(713250..714221)
                     /locus_tag="CAGL0F07315g"
                     /note="highly similar to uniprot|P12904 Saccharomyces
                     cerevisiae YGL115w SNF4 nuclear regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446285.1"
                     /db_xref="GeneID:2887662"
                     /db_xref="GOA:Q6FU09"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FU09"
                     /translation="MRELTEEQRENIAIEQKLAVQSIRSFLQSKTSYDVLPVSYRLVV
                     LDTALLVKKSLNVLLQNSIVSAPLWDSKTSRFAGLLTTTDFINVIQYYFSNPDKFDIV
                     DKLQLDGLKEVEKAIGVDQLDTAYVHPSRPLYDACLKMLESRSGRIPLIDEDEETHRE
                     IVVSVLTQYRILKFVSLNCRETHLLQRPIGELGIISEQNMKFCHMSTPVIDVIQLLTQ
                     AGVSSVPITDENGVLINVYEAYDVLGLIKGGIYNDLSLSVGEALMRRSDDFEGVYTCT
                     KNDKLSSIMDNIRKSRIHRFFVVDENGRLTGVLTLSDILRYILLGNN"
     gene            complement(<714870..>716735)
                     /locus_tag="CAGL0F07337g"
                     /db_xref="GeneID:2887673"
     mRNA            complement(<714870..>716735)
                     /locus_tag="CAGL0F07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446286.1"
                     /db_xref="GeneID:2887673"
     CDS             complement(714870..716735)
                     /locus_tag="CAGL0F07337g"
                     /inference="similar to AA sequence:UniProtKB:P26309"
                     /note="similar to uniprot|P26309 Saccharomyces cerevisiae
                     YGL116w CDC20 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446286.1"
                     /db_xref="GeneID:2887673"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FU08"
                     /translation="MINKNDNSLASSAKRSALSVASPTKLNIMSSQNGNTKLHKVTKR
                     PLERSHSLNIKNGNANEPFGKFSRPKISVQAPPLLKRNSSFFKEKSTSLYSRSDFAFN
                     SPSKSQELSKSPMSSSQPLPNDDTITLTDRFLPTLQSGSQNKVQHISLDTELPPPNAS
                     PVTHLRAQTKLVFKQNVAEACGLEMDNRILQYLPAPPSYSRERPATLMRRHQYHYQNR
                     SSQTQLQKKNTELMKLRKVNTNPERILDAPGFQDDFYLNLIDWSKKNILAIALNDSLY
                     LWNGNNGEATLLKEYEECQITSVHWSDDDCHISIGKSDGNTEIWDVETSTLVRTMRSK
                     LNVRIGSQSWLETLLATGFRSGEIQINDVRIKDHIVNTWDEHTGEVCGLSYKADGLQL
                     ASGGNDNTMMIWDTRTSMPQFVKKDHSAAVKALAWSPTNAGLLASGGGQTDQQIHFWN
                     STTGAKLHTINTGSQVSSLHWGQSYDTKGNMNVEIVATGGSPDNSISIYNYETRYKVA
                     EVVHAHDARICCSKLSPDGTVLATIGGDENLKFYKIFEPKRKYKQKSKGNVVEELMTN
                     NTPYYRERLDASRKLTNNDDSDYESSSYHHESVTRTVINSKSPSSAAKATDFLIR"
     gene            complement(<717856..>718650)
                     /locus_tag="CAGL0F07359g"
                     /db_xref="GeneID:2887907"
     mRNA            complement(<717856..>718650)
                     /locus_tag="CAGL0F07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446287.1"
                     /db_xref="GeneID:2887907"
     CDS             complement(717856..718650)
                     /locus_tag="CAGL0F07359g"
                     /note="weakly similar to uniprot|P53133 Saccharomyces
                     cerevisiae YGL117w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446287.1"
                     /db_xref="GeneID:2887907"
                     /db_xref="GOA:Q6FU07"
                     /db_xref="UniProtKB/TrEMBL:Q6FU07"
                     /translation="MMQFNVRSPVVKAREETYLKKIERVFNVDKISTHDLLRLETVHL
                     CDPLQFFTNGLLESLMYPDGKFLVHHVATSKKLVQDSISIDQALQLGHPKMLELIYLR
                     DRIGSIRGKMDVENSKLNQTIIENLQEVHALVMAIYTEFKEHLKVRLYKDFYGFVLKE
                     QKENFHTVLQMIQKYINIVEKTKQAITPESLLSSMKSFNVELSIVADKLVKNSRCFKE
                     YTDVINAGSENLLFNANDQFDLADVEFQQFYKERLDRLKISARRLF"
     gene            complement(<719330..>720934)
                     /locus_tag="CAGL0F07381g"
                     /db_xref="GeneID:2887618"
     mRNA            complement(<719330..>720934)
                     /locus_tag="CAGL0F07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446288.1"
                     /db_xref="GeneID:2887618"
     CDS             complement(719330..720934)
                     /locus_tag="CAGL0F07381g"
                     /note="highly similar to uniprot|P53040 Saccharomyces
                     cerevisiae YGL112c TAF60 TFIID and SAGA subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446288.1"
                     /db_xref="GeneID:2887618"
                     /db_xref="GOA:Q6FU06"
                     /db_xref="InterPro:IPR004823"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR011442"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FU06"
                     /translation="MTIAQKTGELDQNEDASALQQSFTIWSPQDTVRDVAESLGLENV
                     NEEVLKALAMDVEYRILEIIEQAVKFKRHSKRDTLTTDDVAKALRVLNVEPLYGYHDG
                     SHSNRELSFAKVNTAGGQSVYYLDEGEVDFDKLINEPLPQVPRVPTFTTHWLAVEGVQ
                     PAIVQNPNLNDIRQSQPPIVRGAIVTALNESSSQLGGSSGSNNGTGKGSVGGESVGGS
                     GSNLASVVQPGQNVDVKPLVKHVLSKELQIYFNQIISTLTKHVESGDEEGQHMKGAAL
                     MSLKTDTGLHQLVPYFIQFIAEQITHNLSDLELLGTILEMMYSLLSNTSIFLDPYIHS
                     LMPSVLTLLLTKRLGGTPEKDDEASAVEFLEKTNAVRDFAASLLDHILRKFPQVYKSL
                     KPRVTRTLLKTFLDTNRSFGTYYGCLRGVSVLEPESIRFFLGNLHNWARLVFEEQGVM
                     VGDAGEHTPSRFSKQEVGQLVDAIVSALIVLKKDLPEVYEGKGEAVSEGDKERLVAKC
                     GVTVAHSILEREDAQEITCAIFFGEG"
     gene            <721308..>722618
                     /locus_tag="CAGL0F07403g"
                     /db_xref="GeneID:2887812"
     mRNA            <721308..>722618
                     /locus_tag="CAGL0F07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446289.1"
                     /db_xref="GeneID:2887812"
     CDS             721308..722618
                     /locus_tag="CAGL0F07403g"
                     /inference="similar to AA sequence:UniProtKB:P53136"
                     /note="similar to uniprot|P53136 Saccharomyces cerevisiae
                     YGL111w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446289.1"
                     /db_xref="GeneID:2887812"
                     /db_xref="GOA:Q6FU05"
                     /db_xref="InterPro:IPR017986"
                     /translation="MRVLASCVDNGSLKEAVFGFGTDTSVQTAPQPQLIETHLCEGLD
                     AHVEQIHKIDDGKWLLARHNGTVQYVESELVDHSEIEGMKVSHFDVVGSITGLLDVSR
                     LDHLNAQSKRRTKLKDGFVSLAPVSKKDCYLACTKSGLVHILALNFKDKLLTKLQTFE
                     VKAPLEFAQVYDVEKTKKTVFACGGEENLVKLFELSESCDKISMIWESKNVKNDRLDM
                     RVPVWPVALKFLQPVPTSSAGYDKNKLNFQFLVVTGWSHFGIYNTQHGKRPMKYLDLL
                     PEREPLRQLELLDPSHNTKAITQLGNLKCKETESLEFITTDKKTQVLKYNGQGQLIGK
                     YGKGDITGLATYIGIHDQKYLLEGGLDRYLRVFDIESRAQKAKIYLGTNINRILVLDE
                     ELEALQEIEMAKNNKRKQTASDEEDDAEELWSKLETKKEKKRKL"
     gene            complement(<722699..>724543)
                     /locus_tag="CAGL0F07425g"
                     /db_xref="GeneID:2887976"
     mRNA            complement(<722699..>724543)
                     /locus_tag="CAGL0F07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446290.1"
                     /db_xref="GeneID:2887976"
     CDS             complement(722699..724543)
                     /locus_tag="CAGL0F07425g"
                     /inference="similar to AA sequence:UniProtKB:P53137"
                     /note="similar to uniprot|P53137 Saccharomyces cerevisiae
                     YGL110c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446290.1"
                     /db_xref="GeneID:2887976"
                     /db_xref="GOA:Q6FU04"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:Q6FU04"
                     /translation="MAVQKILEITGERPKLELPIVNFPPFKLRAWLIEKDPVVWAHLL
                     ETYVQYFKFLNHGNNIEDLNESTHDHLCIFLRTYLKEMAEEEGKLLSLGANSDVTKQL
                     QLLRTWVFELIKKCGLMHFQLHGETIWNLVKYYANRNPNSVRALLDGSLKPQINTTRT
                     QLNWAKQIQTHLKMLLETGKFDRIDLKCFESLLGEGDHTKSNFNSSFLTTNWVETLEQ
                     LWNKGQGRSSEIVRQLMLICLITSPDKVISKLLKDLEISNIENLVMYPLLGSIILNKS
                     YEKYNKSLKKDFPFLNVNMSVPTSQYEDIEENYQIDQNNIDSIKEIFPDLTDYQVELL
                     LVKFENNVETLTDALFEDPTIVESIPKEKPKSINTIKKPLSGPRYRRERRKSHEESEI
                     ISDRHVPDELRNKTLTRALELLYEKDEDEHDDTYDESEVNHANLAEKISLEDEVDKTK
                     STNETNTNKIQSQFEANEKYLWELLKKDKEIFSRSRRGTKERKNIKKETNWSDEQIEG
                     WARMLERSPQRARILEEKYMFRGNVKRGKTSYVKNRDENSDNEAHTRPPKSNNNRDRK
                     NPQSTKEDNQQTQQKSKKQFARNEKNKASRANHNRKAGNMKKQAKAGL"
     gene            complement(<724949..>725320)
                     /locus_tag="CAGL0F07447g"
                     /db_xref="GeneID:2887789"
     mRNA            complement(<724949..>725320)
                     /locus_tag="CAGL0F07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446291.1"
                     /db_xref="GeneID:2887789"
     CDS             complement(724949..725320)
                     /locus_tag="CAGL0F07447g"
                     /inference="similar to AA sequence:UniProtKB:P53139"
                     /note="similar to uniprot|P53139 Saccharomyces cerevisiae
                     YGL108c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446291.1"
                     /db_xref="GeneID:2887789"
                     /db_xref="GOA:Q6FU03"
                     /db_xref="UniProtKB/TrEMBL:Q6FU03"
                     /translation="MGLCASKESPSQPTSSSSDARPVQRTGHQKKSDTAAKVSGTTQR
                     NKSKKKLGGDEVLGEETQKISAKEAARLAAEKRYQDAHQKNTKGELGKKLEQERAKSH
                     KSKMMEEAEMRQAERERLEWD"
     gene            complement(<725722..>727572)
                     /locus_tag="CAGL0F07469g"
                     /db_xref="GeneID:2887885"
     mRNA            complement(<725722..>727572)
                     /locus_tag="CAGL0F07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446292.1"
                     /db_xref="GeneID:2887885"
     CDS             complement(725722..727572)
                     /locus_tag="CAGL0F07469g"
                     /inference="similar to AA sequence:UniProtKB:P38330"
                     /note="similar to uniprot|P38330 Saccharomyces cerevisiae
                     YBR238c or uniprot|P53140 Saccharomyces cerevisiae
                     YGL107c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446292.1"
                     /db_xref="GeneID:2887885"
                     /db_xref="GOA:Q6FU02"
                     /translation="MFRYLSRTSTIYKGVIATSKTASTANVVAAQESRRNYANKRNNN
                     RNGPADALDEKLNSILSGKTSSKRKPYGGRKSPVDETSPWYAQLCALDDCLTTTLKQS
                     ATPMRKLLSDRVNHPDMRSNPTFWHSVSRAMTLYNELKQCPEMTDQRVTSLVHLLHNG
                     LRTDRQLVSSLNKKPDYDSQSFHKEMVNFIYTSLNEISDDILNNNVPINANGLMHLFT
                     SYQEMGFTDLVVQIWKKIETIAEQNPQSNIGKISKHPNVVGIVLPILYEKEIVNFSEA
                     EKLFKECEQYHNRMFPNLYVGMILTSLKANENMKALELFETLCTNSKGVHYGYISETH
                     IAFISQCKDISVAESFLDKAVNNEMPYRVEIQVSAVNSLMYNIWSENQDFNKIKEIWQ
                     KMVTFYGENNLRLAIFSSLNNEFFSYFFEKYKENKTEGLEQLQKLITQYNNLKGIDEP
                     FLNIILAKCTVWKEPEVIKYIEKNFELFNVPKSLITSRILLKSLGSIDNITKEQIVER
                     WQEIVLKADSLGSKYIANADWAALRDATVKWAQENKDNQESLDRIEWYLQIVNVYQKY
                     CRDGSQRYRILKGCSKSFPILAENLQRLDLVDTSSIPVCEVKSLKEALQN"
     gene            <728029..>728454
                     /locus_tag="CAGL0F07491g"
                     /db_xref="GeneID:2887837"
     mRNA            <728029..>728454
                     /locus_tag="CAGL0F07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446293.1"
                     /db_xref="GeneID:2887837"
     CDS             728029..728454
                     /locus_tag="CAGL0F07491g"
                     /note="highly similar to uniprot|P53141 Saccharomyces
                     cerevisiae YGL106w MLC1 MYO2P light chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446293.1"
                     /db_xref="GeneID:2887837"
                     /db_xref="GOA:Q6FU01"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FU01"
                     /translation="MSQNKDIFTLFDKKGQGSIPKDVVGDYLRAIGYNPTNKQVTEIL
                     SGSGEALTLPEVEELVKKNEAMLDATTKGKLEDFVKAFQVFDKDNTGKVSVGDLRYML
                     TGLGEKLTDEEVDELLKGIEVDSEGQIDYKKFIEDVLRQ"
     gene            complement(<729306..>730505)
                     /locus_tag="CAGL0F07513g"
                     /db_xref="GeneID:2887838"
     mRNA            complement(<729306..>730505)
                     /locus_tag="CAGL0F07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446294.1"
                     /db_xref="GeneID:2887838"
     CDS             complement(729306..730505)
                     /locus_tag="CAGL0F07513g"
                     /note="some similarities with uniprot|P23493 Saccharomyces
                     cerevisiae YKL093w MBR1 or uniprot|P32488 Saccharomyces
                     cerevisiae YMR081c ISF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446294.1"
                     /db_xref="GeneID:2887838"
                     /db_xref="GOA:Q6FU00"
                     /db_xref="UniProtKB/TrEMBL:Q6FU00"
                     /translation="MDELVLPLGRSASVLDVFERAVQDPCSLDIDEQDETDMLDRDYQ
                     GYDAYTGAPEPAADNSALVKDNSFVASICPSTGLDPLQEEEDALCEKECAQECAQECA
                     SDEQGKRKLARRASAASSTSCSYVSDTSSCQSVNDRVNVLNLDEPNKVKEQEYEFRNP
                     FKEKNERQSAEGQDCTARPPMTPSARASVEEFKLRRTQTEPEFPIRPSVLSRRNTCNM
                     LHQINTRSQSIQVGRSRAPSLRRISTNGNSITYGRSGVSIPMRSNSTIPARSNSTTFM
                     SNNIIRERSNSATPVGDSPSRTYSRGSFGIPTHLYSLEKYVSSQLDALATKEYDSEAA
                     KQVENQRELRNKRSNTVSYIGSSPFNRTRSNTESSFGANQNPPIRCGNARKKSFIELS
                     LENSFAS"
     gene            complement(<731456..>732397)
                     /locus_tag="CAGL0F07535g"
                     /db_xref="GeneID:2887650"
     mRNA            complement(<731456..>732397)
                     /locus_tag="CAGL0F07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446295.1"
                     /db_xref="GeneID:2887650"
     CDS             complement(731456..732397)
                     /locus_tag="CAGL0F07535g"
                     /inference="similar to AA sequence:UniProtKB:P28321"
                     /note="similar to uniprot|P28321 Saccharomyces cerevisiae
                     YKL094w YJU3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446295.1"
                     /db_xref="GeneID:2887650"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ9"
                     /translation="MAEYPYKLRTKEPELKYEEFNGAKFAYVLWPSEGAPKARVLLVH
                     GFGEYTKINHRLMDHLALAGYESFTFDQRGAGLTSPGKQKGITNEYHTFNDLDHFVAK
                     NLLECKEKDIPLFLWGHSMGGGIILNYASKGKHRDQVSGYIASGPLIILHPHSSPNKI
                     TQWLSPVLAKCLTKTRIDTGLDLEGITSDPRYRKFLENDKPMSVPLYGSFGQIYDFLE
                     RGKRLYNDQDGFVSRKYPRDKPLFIQHGKDDTINDPQGSQKYYDMCPAQDKTLRIYDH
                     ARHSILSLEKDELFAPIFNDLQAWLDEHSQARIKSKL"
     gene            complement(<733271..>734158)
                     /locus_tag="CAGL0F07557g"
                     /db_xref="GeneID:2887969"
     mRNA            complement(<733271..>734158)
                     /locus_tag="CAGL0F07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446296.1"
                     /db_xref="GeneID:2887969"
     CDS             complement(733271..734158)
                     /locus_tag="CAGL0F07557g"
                     /inference="similar to AA sequence:UniProtKB:P28320"
                     /note="similar to uniprot|P28320 Saccharomyces cerevisiae
                     YKL095w YJU2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446296.1"
                     /db_xref="GeneID:2887969"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ8"
                     /translation="MSERKAINKYYPPDYDPVEAERIARSMSKKLKNANKSESTIRLM
                     TPFSMRCTKCDEYISKSRKFNGKKKTLDEKYLDSIKIYRFTIRCPQCANPISFRTDPK
                     SADYVMESGGVRNYVKRQEEEKKAQDETLEETLKRLAKEKEEEEELKQNKGKSEDKSK
                     DKMALLEEKLAKLQQQQKDVKDLEQMIQNNKAKYETSNMLGKISKPKNNAKLEQQNLD
                     AIAESAFAKFRSHNSISTNDDKSETTAVQNTDTFSQLQSRSNLPELKNTSMEAKQKPT
                     KIKLKVKRNTLGIVKRQRK"
     gene            complement(<734937..>735575)
                     /locus_tag="CAGL0F07579g"
                     /db_xref="GeneID:2887779"
     mRNA            complement(<734937..>735575)
                     /locus_tag="CAGL0F07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446297.1"
                     /db_xref="GeneID:2887779"
     CDS             complement(734937..735575)
                     /locus_tag="CAGL0F07579g"
                     /inference="similar to AA sequence:UniProtKB:P28319"
                     /note="similar to uniprot|P28319 Saccharomyces cerevisiae
                     YKL096w CWP1 cell wall mannoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446297.1"
                     /db_xref="GeneID:2887779"
                     /db_xref="GOA:Q6FTZ7"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ7"
                     /translation="MQFTTAFSVALIAMAKLALADSQAFGLLAIHSGSPVQNTPVNSE
                     NGALVLKSGGSFAGTVTDAGKLKFSDNTYAVVNSDGSIKTGSESEGTSGFALSGSHLT
                     YKGNSGFFAIPSGSEYKFSTAQGTGAIDIVISPRSTKDGSVVADFTPAGSASSAASSA
                     KPSSAAASSAAPTKAAISQINDGQIQAQTTNGAAKAAAGMGAGAIAAIAMLL"
     gene            complement(<738412..>739068)
                     /locus_tag="CAGL0F07601g"
                     /db_xref="GeneID:2887617"
     mRNA            complement(<738412..>739068)
                     /locus_tag="CAGL0F07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446298.1"
                     /db_xref="GeneID:2887617"
     CDS             complement(738412..739068)
                     /locus_tag="CAGL0F07601g"
                     /inference="similar to AA sequence:UniProtKB:P28319"
                     /note="similar to uniprot|P28319 Saccharomyces cerevisiae
                     YKL096w CWP1 cell wall mannoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446298.1"
                     /db_xref="GeneID:2887617"
                     /db_xref="GOA:Q6FTZ6"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ6"
                     /translation="MQFTTAFSVALIAMAKLALADSQAFGLLAIHSGSPVQNTPVDSQ
                     NGALVLKTGGSFAGTVTDAGKLKFSDNTYAVVNSDGSIKTGSESEGTSGFALSGSHLT
                     YKGNSGFFAIPSGSEYKFSTAQGTGAIDIVISPRSTKDGSVVADFTPAGSASSAASSA
                     KPSSAAASSAAPTKAAISQIGDGQIQATSTIHQQTTNGAAKAAAGMGAGAIAAIAMLL
                     "
     gene            complement(<741200..>742456)
                     /locus_tag="CAGL0F07623g"
                     /db_xref="GeneID:2887678"
     mRNA            complement(<741200..>742456)
                     /locus_tag="CAGL0F07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446299.1"
                     /db_xref="GeneID:2887678"
     CDS             complement(741200..742456)
                     /locus_tag="CAGL0F07623g"
                     /inference="similar to AA sequence:UniProtKB:P34246"
                     /note="similar to uniprot|P34246 Saccharomyces cerevisiae
                     YKL098w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446299.1"
                     /db_xref="GeneID:2887678"
                     /db_xref="GOA:Q6FTZ5"
                     /translation="MTEMDFDLEQIQKYELPDFETALLFSIVAKKNFLVLFDAEQRKL
                     NDEISNEELIQKSVGDVMQKRTDFKINFKYQCINHVTDEMISEIQKCELDDYKNLETM
                     EHVDEKGDRSANIAGVDQNVTIEFYLVEDIDRQSLADYYQLGRLMREGYIFNVQHNGI
                     ANNKKYWKLFIGTVAWKRDEYIIPDDILQLGAADKKYSHKHGQSFKLKSFSTGFEDWI
                     RHKFWLVTTLAMPNIKPTIEVQAADDTASFSSVVITKDEAKEEEAITGSSDGAEKIIS
                     GDYKNYDNIHIQASLRRYILDIMVHIRTHRLTFNARGGGIHKNCYSNMITLSKIICIK
                     DHKSFVVPQHVRLAAMWFLPLQLSVIDDSLKDNSILYGSKPELVRELMKRVVYVRNKQ
                     IIDMDNPLFMEALIVKSALKKIVPPV"
     gene            <742923..>743678
                     /locus_tag="CAGL0F07645g"
                     /db_xref="GeneID:2887658"
     mRNA            <742923..>743678
                     /locus_tag="CAGL0F07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446300.1"
                     /db_xref="GeneID:2887658"
     CDS             742923..743678
                     /locus_tag="CAGL0F07645g"
                     /inference="similar to AA sequence:UniProtKB:P34247"
                     /note="similar to uniprot|P34247 Saccharomyces cerevisiae
                     YKL099c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446300.1"
                     /db_xref="GeneID:2887658"
                     /db_xref="GOA:Q6FTZ4"
                     /db_xref="InterPro:IPR007144"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ4"
                     /translation="MAKLVHDIQKKQHRERSQLTGRARLGMLEKHKDYVKRAQDYHKK
                     QNTLKALREKAKERNPDEYYHAMNTRKVDDKGLLIKSRYEDGEDPSLDMDQVKLLKTQ
                     DSNYIRTLRQVELKKLQRDKQLIGYKSQSKHTVFVDDQDSMRDFKAENYFKTTKEFLD
                     RPENRLTVDQLTSQNLNVGDSESLLMPKESLDKKRLKKIKQVKLHMEREKQLNQIQQR
                     MDSQRERMKKGSKKKIISDTGNVTFKWKKQRKR"
     gene            complement(<744275..>746653)
                     /locus_tag="CAGL0F07667g"
                     /db_xref="GeneID:2887601"
     mRNA            complement(<744275..>746653)
                     /locus_tag="CAGL0F07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446301.1"
                     /db_xref="GeneID:2887601"
     CDS             complement(744275..746653)
                     /locus_tag="CAGL0F07667g"
                     /note="some similarities with uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164c MSS11 activator of STA1 STA2 and STA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446301.1"
                     /db_xref="GeneID:2887601"
                     /db_xref="GOA:Q6FTZ3"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /translation="MSSSSIHTTEGSTPNTAGGMGKEPYSNVSGSQRSSDTLKQQKFI
                     VSDAMAKNSRQLLFAHIYNYLVHNKFYSTASQFLKEVEVPLTTIENIGKIKENTVRDD
                     SSQMRYDDIPENLLRPDMLLNASDTFLVEWWEIFRTLFDHVDGIPNESLDSNGNQEVF
                     KQRIMAILPHNNPTVPPPFINGAENLVDPERHMNIARGSSVSQPSGVLRSPTQNELLN
                     NSQDQRPPQFRSKSMMNGMPPGLSSMSTPNGVEGMQGNFERPTFQQSKSAALPTQRKS
                     SIEEQANRNSSNFSGFGSQSPKNVNEDNEIDSKSAKGKLRSKSSKRGKVGKAAGTPKY
                     NEVDEKHSTMQGSPFSPELLGSNNPVLQNQSKPSAQSQMNGSQWDPNFLMQQQRNPQQ
                     WQKLNGNNMQQDIPNSSHPSIGSNNPSNTSHRFNSRRKEQYDSKPEAIGNGSHRSSTS
                     PSAGSVGNMSADYGDQNEYGSNKSSNFSGAFTNNNAMFQEMAKTMNLMMNQKSEEMNQ
                     WNKSNPYNMRPDNMPMSTMNWNNFPMPKGTSNSFNKDMLQAMQNKMMQSQSSSGMDPN
                     LQQQYLMMMNMLMNFQSGNGFQSNPTNVYKSRGNDLDFAQPFSSENNLANDQSNIRSS
                     YEAYQEDSKTPSTENGGRKMNMTPSLQSTNMISNGQMKHSTSRFSPTHGAPNQSELNK
                     MESTQRGNDISHNYNPPNNRFVGNNLKSQNFSLASQDESVIAAAKKGRRKLTKLNKRN
                     LATPESTSNTNYPESNKNGISTPNGSVGNKGKQTDINGHSNYPDNPFELFNI"
     gene            complement(<748281..>750740)
                     /locus_tag="CAGL0F07689g"
                     /db_xref="GeneID:2887912"
     mRNA            complement(<748281..>750740)
                     /locus_tag="CAGL0F07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446302.1"
                     /db_xref="GeneID:2887912"
     CDS             complement(748281..750740)
                     /locus_tag="CAGL0F07689g"
                     /inference="similar to AA sequence:UniProtKB:P32567"
                     /note="similar to uniprot|P32567 Saccharomyces cerevisiae
                     YMR165c SMP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446302.1"
                     /db_xref="GeneID:2887912"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ2"
                     /translation="MQYVGRAFGSVSKTWSSINPATLSGAIDVIVVEHPDGTLACSPF
                     HVRFGKFQILKPSQKKVEVLVNGKSTNVPMKLGESGEAYFVFETSANADDIPKELLDS
                     PVISASSSPNQSPVSTSLDLNNGMEDDATQRIDSHKSTFLDSGSPVIDKLEEPDFLDI
                     NESTENFDKEDRTLNKKKTKTFQENLNRKLTEIHIPSKLENDGSLLLDIEGYKPNKEK
                     VHDTDEQLKSILKEELGSEADISNFIQEDGKGNIKIVNPFENNKSPLMSPPQSPTMSG
                     NTSELVMSPPSPASADSTFHASSDELDSSSQISQDDEEKNRRFIKTIRLSSDQLKCLN
                     LVYGENDLAFSIDHGRSVITSKLFVWKWDVPIVISDIDGTITKSDALGHVLAMIGKDW
                     THQGVAKLFSEIARNGYNIMYLTARSAGQADSTRNYLRSIIQSGHRLPAGPVILSPDR
                     TMAALRREVILKKPEIFKIACLNDIRSLYFDNIDFHTARESQKLEDAGGTNEKISDAI
                     DKGHTLTFSATNTDDEKPTPFFAGFGNRITDALSYRTVGIPSSRIFTINTEGEVHMEL
                     LELAGYKSSYIHINELVDHFFPPVLLNADDDMRSISSFTPGSPVSGTVDGKMGNISFQ
                     SNGPDDASKPYFRSTQEEKFTDVNYWRDTLLSTDDLPDLSSDDNLDDVNDTKAATTST
                     ENETPNKGKKNNADQKLMSQQGDKIATTTNGTNISKKGPVDTEKSGHSNKTHVSPESK
                     EIGKRIYLHLGSPLTSPVKTYPGESILEEMSALTKRASSPSSSVTKLNVLDDAHDEYN
                     HDSELSDDNNEEDEFDEDDFE"
     gene            complement(<751794..>752900)
                     /locus_tag="CAGL0F07711g"
                     /db_xref="GeneID:2887928"
     mRNA            complement(<751794..>752900)
                     /locus_tag="CAGL0F07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446303.1"
                     /db_xref="GeneID:2887928"
     CDS             complement(751794..752900)
                     /locus_tag="CAGL0F07711g"
                     /inference="similar to AA sequence:UniProtKB:Q03829"
                     /note="similar to uniprot|Q03829 Saccharomyces cerevisiae
                     YMR166c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446303.1"
                     /db_xref="GeneID:2887928"
                     /db_xref="GOA:Q6FTZ1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ1"
                     /translation="MWSFTSSIPVFGTVHDTDGHGHDIPTTSGGSGPSSSRSGDDQNL
                     FDDYEHSPIWHCFLAGGVGGIIGDSAMHSLDTVKTRQQGAPNVHKYKHMLQAYRTMFI
                     EEGFRRGLYGGYCAAMLGSFPSAAIFFSTYEFTKRTMINDYHLNDTFSHLTAGFLGDF
                     FSSFVYVPSEVLKTRLQLQGCYNNPHFNSGYNYKSLRNAIATIYRTEGVAALFFGYKA
                     TLARDLPFSALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTP
                     LDVVKTRVQTQLPSQIDISTDTKIKNVSKPVTLTNSIFKSLRTVYTSEGFFGFFSGVG
                     PRFVWTSVQSSIMLLLYQMALRVLSNRESEKLDL"
     gene            <753761..>755932
                     /locus_tag="CAGL0F07733g"
                     /db_xref="GeneID:2887615"
     mRNA            <753761..>755932
                     /locus_tag="CAGL0F07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446304.1"
                     /db_xref="GeneID:2887615"
     CDS             753761..755932
                     /locus_tag="CAGL0F07733g"
                     /inference="similar to AA sequence:UniProtKB:Q2I041"
                     /note="similar to uniprot|Q2I041 Saccharomyces cerevisiae
                     YMR167w MLH1 DNA mismatch repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446304.1"
                     /db_xref="GeneID:2887615"
                     /db_xref="GOA:Q6FTZ0"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FTZ0"
                     /translation="MGKIRALDPSVVNKIAAGEIIISPVNALKEILENSIDAGATMLE
                     ILVRDGGIKLLQVSDNGCGIQLDDLPLLCERFATSKLTNFQDLENIATYGFRGEALAS
                     ISHIARLSVTTKTNDEQCAYKVSYNEGKMVDKPKPVAGKNGTSIHVEDLFYNIPSRLR
                     ALKTPNEEFTRILDVVGRYGIHSKGIGFSCKKFGDSSYSITLKPDFTTIDRIRSIYGN
                     NVATSIIGFEMDSNENLGLTKVSGYISTSNLNNKKSVQPIFFINDRLVTCDPLRRAIY
                     NTYTNYLPKGTRPFIYLSINISPPSVDVNVHPTKREVRFLHQDEIIDEITTSINDQLS
                     KLDTTRTFNRGVMMSKPLTDNSSTKYSQAATPTTTHPMNSSQTSQRRYENKLVRVDSS
                     QAKITSFLKSSQYNSAEYISASQHIGKQSNTASDNNKDKATPIDLNDDVNITRAQSLQ
                     DESQSNTYSMLSKERVTVNLTSIESLRNQVDMSAHKELTEIFAGSNYIGIVDYYKRLL
                     TIQFDLKLFLVDYGAICNELFYQIGLTDFANFGTIQLQTQDTEQLSIRNILKTLNLAE
                     TKIDEISSQLVEMKEMLWEYFSIEIIENESHVAFLKTIPLLLKGYTPSLSKLPLFIYR
                     LGTIVNWNSEQECLDGILKQIALFYIPEIIMEVSSSSESPKGEKHSNTENAHKKEELS
                     EKIEHVIYPCLKRRFLAPSSIVDDVIEIANLPGLYKVFERC"
     gene            complement(<755947..>757782)
                     /locus_tag="CAGL0F07755g"
                     /db_xref="GeneID:2887796"
     mRNA            complement(<755947..>757782)
                     /locus_tag="CAGL0F07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446305.1"
                     /db_xref="GeneID:2887796"
     CDS             complement(755947..757782)
                     /locus_tag="CAGL0F07755g"
                     /inference="similar to AA sequence:UniProtKB:P40969"
                     /note="similar to uniprot|P40969 Saccharomyces cerevisiae
                     YMR168c CEP3 kinetochore protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446305.1"
                     /db_xref="GeneID:2887796"
                     /db_xref="GOA:Q6FTY9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY9"
                     /translation="MFQRPLPTKSNRPCSVCSKRKVKCDRLVPCGHCRKRGTESECVQ
                     SAISANKGNHESEKGYLSGLLRFWQSYEYWIPNIGLFKSQKLKYENNEVLDYLNVEAQ
                     FWESSITETGSYKLLNYTIENLGTLYFGCIGDVTELYKILEQYWDIKEDQSSKLPFSD
                     SDKCYSRALLWSIFTMGVYYCPKELLDGIISIDKVRDFTKKQTLTEEQIRCKIYEGFI
                     TTTIDSLYRCNFMAQPDIRFIQTYIILSTTLYSFQFPIQANMILTNAMYVTKLLSATV
                     ISASNSEDIIGSIANESLNRLWYRICACDYIQEGPNKSIDFNRELGSLLKHAAYLEDL
                     PSTDVYKEEDNYEILFWKLLSLDRDIDQYLNNGLKPPPKTLDAVQREVDIYTQKVSNL
                     EEDQKSINSKFEKFLGHFILYTVSWKIQKLQIIFYDNKVSLNKLIRITKNIIKLLVKN
                     FEHGHDTFNKHPLVIYYLSRVATFTNFYHIFENSVEIHEIVLDINELIVNLPPIFGNH
                     LENLKYIIFRFTLLRKEFGKTDVVDTGGEFQHPVFKVLQNDVATISKSNNKLNYLLKG
                     LGSLIPGKSIGEGIYEEDEDSMLDPTILEIVSEFEEKYPIDRVID"
     gene            complement(<758205..>759719)
                     /locus_tag="CAGL0F07777g"
                     /db_xref="GeneID:2887829"
     mRNA            complement(<758205..>759719)
                     /locus_tag="CAGL0F07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446306.1"
                     /db_xref="GeneID:2887829"
     CDS             complement(758205..759719)
                     /locus_tag="CAGL0F07777g"
                     /inference="similar to AA sequence:UniProtKB:P47771"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170c ALD5 or uniprot|P54114 Saccharomyces cerevisiae
                     YMR169c ALD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446306.1"
                     /db_xref="GeneID:2887829"
                     /db_xref="GOA:Q6FTY8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY8"
                     /translation="MPEVFEEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPA
                     TEEVITSFYAATEDDVDKAVKSARESYENVWFKISPAEKRDMLLKLADLIEEEKPLLA
                     ALETLDAGKPYHTNAMDDIDQIIHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYG
                     VCGMIIPWNYPLAMASWKMQGCLAAGNTLVIKPAENTSLSLLYLAQLFKKAGFPKGVV
                     NVVPGKGSVVGNSLGLHMDVDKISFTGSTKVGSSILELAGKSNMKDVTLECGGKSPAV
                     VFQDADIDNAIEYIANGIFYNSGQNCTANSRVYVQEDIYDDFIKRFTEHTKENWKFGS
                     KCDPFDKDCTVGPVVSEKQFETVNDYIRHGKEEENLQIHQTVEKCDCKGYFISPTIFT
                     DVPQGSKLMKEEIFGPVVVVAKFKDYKEAIKLANDTNYGLASMVFTKNISVANWFARD
                     IKSGTVWINSSNEEDPTVPFGGFKQSGIGRELGETGVESYMQIKTVHLNMSEKI"
     gene            complement(<760681..>762423)
                     /locus_tag="CAGL0F07799g"
                     /db_xref="GeneID:2887830"
     mRNA            complement(<760681..>762423)
                     /locus_tag="CAGL0F07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446307.1"
                     /db_xref="GeneID:2887830"
     CDS             complement(760681..762423)
                     /locus_tag="CAGL0F07799g"
                     /inference="similar to AA sequence:UniProtKB:Q03212"
                     /note="similar to uniprot|Q03212 Saccharomyces cerevisiae
                     YMR171c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446307.1"
                     /db_xref="GeneID:2887830"
                     /db_xref="GOA:Q6FTY7"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY7"
                     /translation="MLLFLGLLAQASGFVIPDAYRDAQSTGLKRRDDVPTPPEVLPYP
                     GPAEDVPYPGTPDGYTNQDDQLDINVMFIYFGSMLVMYLCICIIYFTTKIVVTRLLTR
                     HARISLLNEEGMATGLSARSRRLAESAESRWPSALDDENEVKSKLQKLSPEEQFYYKQ
                     GEEYIKQNPPLIISTGSRSGDQNTVNDPIINDQTRQFIEEEGALAWEFQPNPNLPNDT
                     IIVENKTEISFLNYNYDASVTTNLPIPCINRVYYCEFKIFELSITDDQTTLKDNEIIS
                     FGLSTSPYPYFRLPGRHHHSIAYDSNGARRFNDSFKLEPELADLFPKCQKGDIIGIGY
                     RTRSGTVFFTRNGKKISEKSVGGHIKGWKFKYLYPVVGANVPCKIHVNFGSYGFVFIE
                     ANVKKWGYAKPNGIKLPPPSYDDYVQDTLLESGYEDNDNSDNDSDDESDTDNRRQHRS
                     IKNTIIDIDGNLLPPPPGFEFSTSPHSHGTNEEINLDSLPMNPPSYSDEESKNQVKSK
                     ITPRDSVGRSDGLTQDEQGSREGKSMMLNDLENDGLDDDEDDYMESDDGYEHDIDELQ
                     AMIEMEDDDRNDSS"
     gene            complement(<762977..>765742)
                     /locus_tag="CAGL0F07821g"
                     /db_xref="GeneID:2887921"
     mRNA            complement(<762977..>765742)
                     /locus_tag="CAGL0F07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446308.1"
                     /db_xref="GeneID:2887921"
     CDS             complement(762977..765742)
                     /locus_tag="CAGL0F07821g"
                     /inference="similar to AA sequence:UniProtKB:P53119"
                     /note="similar to uniprot|P53119 Saccharomyces cerevisiae
                     YGL141w HUL5 ubiquitin-protein ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446308.1"
                     /db_xref="GeneID:2887921"
                     /db_xref="GOA:Q6FTY6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY6"
                     /translation="MLNFTGQTRKRNVNLGRKQQTTKKEILQRAKLERDRRAEEKKQE
                     ASAAYIQRQIRKFLSCKKTALLNLTSPKVVHLVPLLGSKLLIYLGTHELLHILNVSKH
                     FLTQFGTALGNWKLLNIYSDCHDVNIANMCINCLNIGIPLIDGIIDANIKFISSNEVL
                     RGTSGLHIDVIAPVLSAWKVQFSQNYRRVFEITESQCVQFEEVLHFYEGLVLNDLLPM
                     VELNGSSVLLENMSYLYSKLKHANQHLYNIIRQCVTNVRYEPVNIRMRGYVTEIYQKD
                     FIYSYLDSINIHTNFSSDLLNFIENAPSEAERDSVYVSLLSRENFVENLLNIFSRFQD
                     PEQTYWDDITHYPAFKLLCQLIKVHLWLSTDHELLYNRNRIKLEQLVLFTDGIKDMVF
                     NDMWTKPTNDSFLYTNEALPLLKIIYLRDSRMKFCKSSNGDKEYWTVYNTDFLKTAIY
                     KQIQDYEDYYRSYKDNYDDLYDSDDEDNNDKEINDIMNLKANYLVNMEVKPNNIKQFR
                     KLKILLEAPFYVPFEQRVEMFYTLIELDKRRLNLDDDSSLMMDVLNALGPSLSRRQAV
                     NISRDNVLEDAYSSFNPAGERFKGKLSVTFTNEFGPEAGIDGGGITKEFLTSVTEEGF
                     KNDKYKLFDTNQNYELYPSSEVNATKMKYYYFLGKVLGKCIYDRVLIDIHFTDFLLKK
                     LLNSSNHYISYFDDLQSLDESLYQNLVKLLAMSASDLESLELHFEVDDLSTGKNRVTE
                     LIPNGSKTVVTKNNVLQYLVLIADFKLNRSLNKQVAALHRGLSVMIAPHWFEMFNSSE
                     LQKLISGEGKDINLEDLKSNTIYGGFSDTSLTIQYFWQILEEFEPQQRLDLLKFVTSV
                     PQAPLQGFGALEPKFGIRNSGPERDRLPTAATCVNLLKLPDYADKELLRQKLLYAINA
                     GAGFDLS"
     gene            <766285..>768123
                     /locus_tag="CAGL0F07843g"
                     /db_xref="GeneID:2887751"
     mRNA            <766285..>768123
                     /locus_tag="CAGL0F07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446309.1"
                     /db_xref="GeneID:2887751"
     CDS             766285..768123
                     /locus_tag="CAGL0F07843g"
                     /inference="similar to AA sequence:UniProtKB:P30777"
                     /note="similar to uniprot|P30777 Saccharomyces cerevisiae
                     YGL142c GPI10 required for Glycosyl Phosphatdyl Inositol
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446309.1"
                     /db_xref="GeneID:2887751"
                     /db_xref="GOA:Q6FTY5"
                     /db_xref="InterPro:IPR005599"
                     /translation="MVTNKKDTDENRDVQGSIVTKTSAIFPVLVGFRVINSLLTRTYF
                     QADEFWQSLEPAHYKAFGYGELTWEWKVGLRSYAFPMLFEIIYRLVKLLAIASKEALS
                     IICSIGAGLMLLCFPQSKLATEVARDLLTIPNEYSETVEYYGVIYAPKLFMALLAATG
                     EYFTIKLIQKVYLKTVSKNDDQLPKLSNITKIALLLTLTNFFNCFFITRTFINSFEMI
                     LTSIALYNWDWSGGIEINTRSFTKSLFFAMFACIQRPSNAIIWIVLGFFLTINLLLRR
                     DYTLIGRLYAKILVVFTITMLVNVVIDFYFYNQIIFPVFKFINFNFTSILSEFYGVAP
                     WHFHLLQSLPIMLGYSLPLFIYGLFSNDSTTKNNIRFGALRQIKFVLILNIIFYSYLK
                     HKEFRFIYPLQPLFCLLSALGALKLAGKVQNYRYLKEYVWIIPLMSMIVSIFITTFQE
                     SGVIQVMKDLHNEKDIDSVGFVMPCHSTPWQSYLHRNDIRQLWAISCEPPLHLLGKNN
                     ASIELQTYMDESDYLYENISGFIKKNFPKFTNSMDMENVNNNASMPQFPHEWPQFLII
                     FEQLDNEFMSRYLLDSGYVKYNKIFNSYSHWDSRRNGDLIIYYKNN"
     gene            complement(<768270..>770804)
                     /locus_tag="CAGL0F07865g"
                     /db_xref="GeneID:2887701"
     mRNA            complement(<768270..>770804)
                     /locus_tag="CAGL0F07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446310.1"
                     /db_xref="GeneID:2887701"
     CDS             complement(768270..770804)
                     /locus_tag="CAGL0F07865g"
                     /inference="similar to AA sequence:UniProtKB:Q12151"
                     /note="similar to uniprot|Q12151 Saccharomyces cerevisiae
                     YDR213w UPC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446310.1"
                     /db_xref="GeneID:2887701"
                     /db_xref="GOA:Q6FTY4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY4"
                     /translation="MTTLAVQNAVTNDVSKPQSRKREKIIELVDIGGKKVSTTSTGKR
                     KFHNKSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLECVYTPVQPPKRRTRTRVKYITR
                     DANGEIIETEKPQVEGKDVNGDLPPKAVSEIPGRKFMLSDPKDSGLPASISNLLSKGT
                     SLDPKTTNEGNAQDYHNASNRNQPNDISLKSLAGIEKSLLSHMSGNNLLNNTSNILGI
                     PNQSLLSGNQIQQHLQLLQQMNDSKPDGKTSSSFADTSLPHLNMKENEEKSNISQHKV
                     LVQLQQQLQLERHQKQQLAQYQKLQMEQQQEFIKRSQEHENSSSSKSSLAAESVSSYD
                     EQKGKIDNNNNSATAVQADTLAQLSKLGISMKGLSSLLTAGFGGVQYDFQALLGLKNL
                     GQSKQDKANYAHDALTSMQEDHEYARDEKIKMETTANNDINRMLGSSNNVSTPKLADT
                     PGTTSILNMTPLIREALVGSMSSPSMFDRSRENNILNVPTPTMSQNMVPADNLLGNNV
                     KNLEQLSKSSNLNLLDLKTFHHYCTNVWQTIVAANISDPQVWKNEIPAMAFEYPFLMH
                     CILSFSATHLSRTEAGLEDYITNHRLEALSLLRSAVLNITEENTDALVASALLLLMDS
                     LANAWNNHDPHMQLPKDTSNATDILKKNGMLLNAMSPSAWIFHVKGAATILTAVWPLS
                     PKSIFFNIISVDLSEFANSINHENNTITELICFDESISDLYPVEIDSPYLITLAYLHK
                     LQGERKKKDFLLKIFAFPALLDKTFLSLLMTGDIGAMRIMRSYYKILMNFTNDVKDSV
                     WFLEGLSQVLPQEVDDYSGGGGMHMMLDFLGGGLPSLVAANINEYL"
     gene            complement(<773115..>774794)
                     /locus_tag="CAGL0F07887g"
                     /db_xref="GeneID:2887635"
     mRNA            complement(<773115..>774794)
                     /locus_tag="CAGL0F07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446311.1"
                     /db_xref="GeneID:2887635"
     CDS             complement(773115..774794)
                     /locus_tag="CAGL0F07887g"
                     /note="highly similar to uniprot|P12612 Saccharomyces
                     cerevisiae YDR212w CCT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446311.1"
                     /db_xref="GeneID:2887635"
                     /db_xref="GOA:Q6FTY3"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY3"
                     /translation="MAQLFNNSRSDTLFLGGEKVSGDDIRNQNVLAALAVANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVV
                     IIASELLKKAYELVKNKIHPTTIITGYRLALKEAIRFINEVLSMSVDSLGKETLINIA
                     KTSMSSKIIGADSEFFSNMVVDALLAVKTQNPKGETKYPVKAVNILKAHGKSSTESVL
                     VNGYALNCTVASQAMPKQIGGGNVKIACLDLNLQKARMAMGVQINIEDPEQLEEIRKR
                     EAGIVLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATG
                     ATLISSMSNLEGDETFESSYLGTCQEVVQTRYSDDECILIKGTSKHSSSSIIVRGPSD
                     YSLDEIERSLHDSLSVVKRTLESGHVVPGGGCVETALNIYLDNFATTVGSREQLAIAG
                     FASALLVIPKTLAVNAAKDSSELITKLRSYHAASQLAQPDDQKKRNYRNYGLDLVRGK
                     IVNEVTAGVLEPTISKVKSLKSALEACVAILRIDTMITVDPEPPKEDPHAH"
     gene            <776659..>779808
                     /locus_tag="CAGL0F07909g"
                     /db_xref="GeneID:2887763"
     mRNA            <776659..>779808
                     /locus_tag="CAGL0F07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446312.1"
                     /db_xref="GeneID:2887763"
     CDS             776659..779808
                     /locus_tag="CAGL0F07909g"
                     /note="some similarities with uniprot|Q12180 Saccharomyces
                     cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
                     cerevisiae YBR150c TBS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446312.1"
                     /db_xref="GeneID:2887763"
                     /db_xref="GOA:Q6FTY2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY2"
                     /translation="MSTETPSRENSQLPGTTPMIDYGMAMELLQQHYKRRSTKACDHC
                     RKRKIRCDEVNPVTNKCSNCVKFKVECTFKFHEELQTKKKRMYELKAIEKANKKAKKR
                     PYRKRNRDAKQDSNTTDEASQTSANTKTVSPIYSDAQQHTEITNHFLAEENGKPVITN
                     DEQHFIHQYNYQQPTAFHNYSHSMPSFQNMSPQHNQYNAKNDFNMHQPAVSYANGEHQ
                     LPNLENNNIPNAIHNPSLVVDEDTLAAVNDQITKIDRKLKGIVNANVYIQKCMDSLQS
                     EDNSKERANDQPTMPVTKQYTTLLFTTQNMLYIKKKFFGQSNPSSNFDIDGNFLTKDE
                     LNQYSNDTSESGNNGNYSNILAEKDFMPALKDIFAVYLKYYVVQMTKVMEFSSMPTLK
                     PGNKLCNIISREQASALISSFQTLLISSSIFPTDGKECSNLVDRYFRNNGNGLTKPEY
                     LLVNICICLGAQKMRSQILRGKKEARQLEKDLLLKVKNLTLLNSVYFFHKMTISNICI
                     TSLQGLLLLCHYIQIYINTETAAGVLVEAVNMAISLELHLHKSYEGLSPLELIKRRVL
                     WSYCFSVDKYYSLILSRPPLVRNENTDVLSPEVFFETVTVNILPTITYNPDLLKNDTP
                     ENRTEALNILLSHYEFMPAVLAYFKVKLVKVELSLYETCFSVRSTLDNTFDQIIDKVL
                     KIKAELDSWRESLPSMLKLESYIQYISLLHSQIPEDNTLPNPVNMQCSVLNLHFRYYY
                     LITNLSLFIDTFLSDNKNLWNGSKHNISQVSQIFHNKAKDKSIKVLTLFLSLDYEPDL
                     YSELSYYFLTCLFVVLLYVIKNLNKTSNNCEMVYLINLLNDCHKFIIGNVENLLVSED
                     MKWNMSIFFFTYLMHAITKNFKNDETSKQNFQLDFVFLGPLLARLVRTKTTIKQDILK
                     QLESFVNIMGLYKEDGNDIFGTQNFGESSATVLPNGNYLEELDIFSKFNSEALKILRT
                     PIFGTGNVINCHGNELSVRDEELTKERDIEGRSILPLDLDESESFGTSPYDSIDEFQD
                     FLLQGVFFYDRDMLFSNHG"
     gene            complement(<780118..>780825)
                     /locus_tag="CAGL0F07931g"
                     /db_xref="GeneID:2887646"
     mRNA            complement(<780118..>780825)
                     /locus_tag="CAGL0F07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446313.1"
                     /db_xref="GeneID:2887646"
     CDS             complement(780118..780825)
                     /locus_tag="CAGL0F07931g"
                     /inference="similar to AA sequence:UniProtKB:P50087"
                     /note="similar to uniprot|P50087 Saccharomyces cerevisiae
                     YGR235c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446313.1"
                     /db_xref="GeneID:2887646"
                     /db_xref="GOA:Q6FTY1"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY1"
                     /translation="MAVDYYREVDLVQERVVPPEGVVVPSSGAKEAVYTPEKSNKDVI
                     AKASSKFVKLIGNNELVDGISVRYPPYMVDFFRRRRTNLAERLDRTSEKLEKASNRYY
                     RSERKITSTIAGLKAERKEEFIPGLTYTAVSFMTGSVLTRNRNFVYRFFTPIILGTTC
                     LAFVLPGTFNNVKSLCYDIEKHNFPSFVENQDKIVFKINVGIGKTISVLEHTFSTIGK
                     GVSRTQAALQEWTGLNV"
     gene            complement(<781219..>781509)
                     /locus_tag="CAGL0F07953g"
                     /db_xref="GeneID:2887609"
     mRNA            complement(<781219..>781509)
                     /locus_tag="CAGL0F07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446314.1"
                     /db_xref="GeneID:2887609"
     CDS             complement(781219..781509)
                     /locus_tag="CAGL0F07953g"
                     /inference="similar to AA sequence:UniProtKB:P50088"
                     /note="similar to uniprot|P50088 Saccharomyces cerevisiae
                     YGR236c SPG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446314.1"
                     /db_xref="GeneID:2887609"
                     /db_xref="GOA:Q6FTY0"
                     /db_xref="UniProtKB/TrEMBL:Q6FTY0"
                     /translation="MQINPRIYSEAQKVAKQPQFKYLVAAMLCAAMVPTAYRRGVTLP
                     HYSQSVLEEVNENIAHKPIEKEKNPSMWGMLKDANKYDLNEEYTYELFSSIM"
     gene            complement(<782229..>784541)
                     /locus_tag="CAGL0F07975g"
                     /db_xref="GeneID:2887606"
     mRNA            complement(<782229..>784541)
                     /locus_tag="CAGL0F07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446315.1"
                     /db_xref="GeneID:2887606"
     CDS             complement(782229..784541)
                     /locus_tag="CAGL0F07975g"
                     /inference="similar to AA sequence:UniProtKB:P50089"
                     /note="similar to uniprot|P50089 Saccharomyces cerevisiae
                     YGR237c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446315.1"
                     /db_xref="GeneID:2887606"
                     /db_xref="GOA:Q6FTX9"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX9"
                     /translation="MSTSTSYARHISFDDLAPSLIDDQAKIIRETSQHIGFYNHFIKV
                     PPQYNPAYRNAVGSGDASPLRQQNHELDSRKLTSKLDGMHLAPRGRSALGTSNRSRSV
                     SPFIHSPKVTNAPRLPPPPEQKILKMKEIKVDEPVEIEDIDISDVDPNLEKHIKKVTE
                     SNTQTNSGSNHGYTQNAFSNLNELEDRIDVKNNKTSQPPVGEEKKRSKSFAGMTDAEL
                     AQLEDFYTSQARSTSVSNQMNNFDFGKQIPVFFDDSKKNNNVNANLALESLAAIYPTR
                     PTITYKSMSLNSQHPEYTAFMKKMRKHVPCREKEHTIDYRTIMCYISGRRYTWSSVDW
                     YIENVAADGDHLVIVSRVPEFEKELETLCNQEKRKSKLQQRNSDRSDRISVYSESHTL
                     SSTPSSDPDAVTPSTIGFRAEAIRDRAREVCRELLDYYAYRLKDKITKITVEIVKSDS
                     TKDAITGAAGVYAPNFQIISTVSTNTQIKFRNGNVKLPFFVLKHYPMPTFLIPFEFID
                     PSLLDKDYLSPESHGSVKVSYVDDYERVDLDSRLTWLDQVIKKTTKNPYAQNSDKPID
                     PICDSDSEAESVASFTGDLPIQDKKRYEEFEHLGYVMPAPMRQLLAKRSKLVYDIDGK
                     RLAPDNTSRGSGRSSRLYLNDGGMYRVKSMVDSVQTSETDGENDRSKMNQNTLNNTGI
                     RKVKSSGGPIFLTPPMPGSTNRPPKGRKHSDTSLKKAKSHDPTSKSSTPLSLPRASSN
                     GKSKKTDSSKNSSSSSSKKSIGSMFKKVFW"
     gene            complement(<785803..>788613)
                     /locus_tag="CAGL0F07997g"
                     /db_xref="GeneID:2887843"
     mRNA            complement(<785803..>788613)
                     /locus_tag="CAGL0F07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446316.1"
                     /db_xref="GeneID:2887843"
     CDS             complement(785803..788613)
                     /locus_tag="CAGL0F07997g"
                     /note="weakly similar to uniprot|P50090 Saccharomyces
                     cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
                     cerevisiae YHR158c KEL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446316.1"
                     /db_xref="GeneID:2887843"
                     /db_xref="GOA:Q6FTX8"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX8"
                     /translation="MTSFLFRRLTRRKKNKDPKEKNKEKSNRGNLRISKVPPPAEKYP
                     TPPRAKNQYVIPTITDDPAVLNSPSTSVRIPRAPMFADIDYDNITERKAKRLSRTDRS
                     VRYSHRHSSRRISMLISKLEEDKKKTVSLDSSDINVRYSFRDSALSRLQEVLDEANES
                     PWGRTRLMSSPLPRYRHIASTYATPDNRIFVMGGLHGELVYGDTWMLTANSDSTNFTT
                     QVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLDDDLYLFNVDSHRWTIP
                     TPIGTRPLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFNDLAMYDLSDFRNPHSRWQ
                     FLKSKAFTPPPLTNHTMVAYDYKLWVFGGSSRGELQNQLYVYIPDLNEWRCLETEGDK
                     PQPIQEHSATIYKNLMCVFGGKNKDDEYQNTMYFLNLQTLKWYRLDTSHCNEPLPRSG
                     QSMSLMQNDKILIMGGDKNDYCVNGANLNDIDEYDRGYGVASYTLDLKNLNDYCPGVF
                     SIERPANLTHVAKNPEARYSMASPGPNILTPYLQQVRQLNRLLSTASMSPKTPSPMIS
                     KALPESSEKEDISKDQAENTSGSTQSPPAGLLGTSEAPQSGRSENESVFEDAFPASHL
                     SESSSPQQSEISIVENKKQNNPFITNPLGTINSSIIELNKANTSQLPIEGTRSVILSQ
                     DTVEQLQQDLEELRIMEESNETVSDNKLKQLKMEIDNLRNKDVVEDTTKSTLDDLNEK
                     FKRLEQGKDALRSKMSKLDSMFENNEHHKATEHTGYALLNLNSKASRNKDTDLDDSNQ
                     HLVSIDAEKVADELLLIGDKREDSSASDKSESFTLTESNQPETSNGDFIYNDANKNGK
                     TSLERKTVPRKMPVDKKRVKRRTILFHSQKHKEMMEELTKQLDMLTYDSQEMASSEID
                     SNSSYKLENQMPVMPGNFPQTM"
     gene            complement(<790810..>791508)
                     /locus_tag="CAGL0F08019g"
                     /db_xref="GeneID:2887900"
     mRNA            complement(<790810..>791508)
                     /locus_tag="CAGL0F08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446317.1"
                     /db_xref="GeneID:2887900"
     CDS             complement(790810..791508)
                     /locus_tag="CAGL0F08019g"
                     /note="weakly similar to uniprot|P50091 Saccharomyces
                     cerevisiae YGR239c PEX21 peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446317.1"
                     /db_xref="GeneID:2887900"
                     /db_xref="GOA:Q6FTX7"
                     /translation="MSQYCAADPIQRMVSRKGPYLDTQQQRVYKHRSGTGHGTNIRQP
                     TTGIVEATFLQNNSGMNAVHPTTLNVQTHNAHATGRTIAKSVDTNSWVNDFSSMKVQD
                     PLEFADSYKNLYKQYEQKQFHNTVPAQCPRNLYIPTVTRPQTTLNIVDHHEDKSSAVD
                     QLIDDEFEKIEEEVKDQNQKLEFQESAQSFIEICERSQMKEKLQRSKFFQVMQKVSDG
                     EATIRQDGENYVIR"
     gene            complement(<792575..>795550)
                     /locus_tag="CAGL0F08041g"
                     /db_xref="GeneID:2887882"
     mRNA            complement(<792575..>795550)
                     /locus_tag="CAGL0F08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446318.1"
                     /db_xref="GeneID:2887882"
     CDS             complement(792575..795550)
                     /locus_tag="CAGL0F08041g"
                     /note="highly similar to uniprot|P16861 Saccharomyces
                     cerevisiae YGR240c PFK1 6-phosphofructokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446318.1"
                     /db_xref="GeneID:2887882"
                     /db_xref="GOA:Q6FTX6"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX6"
                     /translation="MLHQDNCYGVAFRAIATADEELFKQTVRFYHSLGFSTIKDFNKF
                     KHGENVVLASGTSDDSLREVWLESFKLSETDSLGFRVPQQEASNKAQSQGAFVKVRLV
                     MHEPLKDVYSTAQTSHITYFSADLPAIAKEFGDKVTKVSDSVLQMNDPMGNQLSFTSF
                     ASPLDEKPTNMDAFLKPLEKEDDITASQSTDAVNQLKESLQSGSNLQKKKKIAVMTSG
                     GDSPGMNAAVRAVVRTGIHYGCDVFAVYEGYEGLLRGGKYLKKMHWEDVRGWLSEGGT
                     LIGTARSMEFKKREGRKRAAGNLISQGIDALVVCGGDGSLTGADLFRSEWPSLVEELV
                     KDGTFTSEQVAPYRNLTIVGLVGSIDNDMAGTDSTIGAFSALERICEMVDYIDATAKS
                     HSRAFVVEVMGRHCGWLALMAGIATGADYIFIPERAVPHGQWQDELKEVCQRHRNKGR
                     RNNTIIVAEGALDDQLNPVTAEDVKDVLVDLGLDTKVTILGHVQRGGTAVAHDRWLAT
                     LQGVDAVKAVLEMTPETPSPLIGILENKIIRMPLVESVKLTKSVATAIENKDFDKAIS
                     MRDTEFIELYENFLSTTVKDDGSEMLPVTERLNIGIVHVGAPSAALNAATRAATLYCL
                     SHGHKPYAIMNGFSGLIQTGEVQELSWIDVENWHNMGGSEIGTNRSVAAEDMGTIAYY
                     FQKNKLDGLIILGGFEGFKSLKQLRDSREQYPIFNIPMVLLPCTISNNVPGTEYSLGV
                     DTCLNALVNYTDDIKQSASATRRRVFVVEVQGGHSGYIASFTGLVTGAVSVYTPEDPI
                     SLKSIREDLSLLKENFRHDKGENRNGKLLVRNEQASSIYSTELIADIISESSKGRFGV
                     RTAMPGHAQQGGAPSSKDRVIASRYAVKCIKFIEQWNKKNKATALDKDAKVLRFKFDK
                     HGAKIPTVEHEDDSAAIICVNGSHISFKPIASLWENETNIELRKGHEVHWTEFNEISN
                     ILSGRLRLRAEVEASNNRV"
     gene            complement(<796793..>798397)
                     /locus_tag="CAGL0F08063g"
                     /db_xref="GeneID:2887752"
     mRNA            complement(<796793..>798397)
                     /locus_tag="CAGL0F08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446319.1"
                     /db_xref="GeneID:2887752"
     CDS             complement(796793..798397)
                     /locus_tag="CAGL0F08063g"
                     /inference="similar to AA sequence:UniProtKB:P53309"
                     /note="similar to uniprot|P53309 Saccharomyces cerevisiae
                     YGR241c YAP1802 adaptor protein andsimilar to
                     uniprot|P38856 Saccharomyces cerevisiae YHR161c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446319.1"
                     /db_xref="GeneID:2887752"
                     /db_xref="GOA:Q6FTX5"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX5"
                     /translation="MALNKLVKGATKIKMAPPKDKYVGPILQDTSTSRHSMQEAVQLL
                     GQRIAGSNEWTIVFKSLIMLHLMIQYSEQSEARGFDDDDDYYGGNRRKGDGSPILDYM
                     SRNLDFFNSTRKILSSSKWSRDDIKVIERYNQYLKIRCKEYDLCNGTDYVKVGFNIAM
                     KYRRERSQQNLGNKNISISTELDHVESLENTITALIKNRFSQIDLQNDLILYTFKMLV
                     TDLLPLYNSLNGGVIALLESFFELDRAEAKRTLELYKSFVDLTDHVVNYLKIGKSVGL
                     KIPVIKHITTKLISSLEDHIRNEERGGAKLNSQRKVSSNTTAYGDESNRNANQPGTLQ
                     RSETTSSMAQQKLEQIREQKKILEQQLQNQQVLITPTVPQEPYVNNPFTPSAADTFSF
                     EPTGSNPFAPQMTSPQMMMQQQQPQAQPQQPMQTSPMPMVQQGTSMYVGNQMSGFTGG
                     NVNGIQQQSPQQPLAQQPLRTGSNNPFALENMAQYETVENPFGTAHMPTIQEVDMQQM
                     QMQQPVTYAMIPVQITNPFQQQQQQM"
     gene            <799495..>799902
                     /locus_tag="CAGL0F08085g"
                     /db_xref="GeneID:2887753"
     mRNA            <799495..>799902
                     /locus_tag="CAGL0F08085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446320.1"
                     /db_xref="GeneID:2887753"
     CDS             799495..799902
                     /locus_tag="CAGL0F08085g"
                     /note="highly similar to uniprot|P53311 Saccharomyces
                     cerevisiae YGR243w or uniprot|P38857 Saccharomyces
                     cerevisiae YHR162w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446320.1"
                     /db_xref="GeneID:2887753"
                     /db_xref="GOA:Q6FTX4"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX4"
                     /translation="MSTIGFAFKRFWQSETGPRTVHFWAPTLKWGLVFAGLSDLNRPV
                     DKLSGTQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGVQIGRLMNYRLTNG
                     DTMSQAIGYLFHGKPANTIASSGNGKKPEQLIA"
     gene            complement(<800627..>801886)
                     /locus_tag="CAGL0F08107g"
                     /db_xref="GeneID:2887790"
     mRNA            complement(<800627..>801886)
                     /locus_tag="CAGL0F08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446321.1"
                     /db_xref="GeneID:2887790"
     CDS             complement(800627..801886)
                     /locus_tag="CAGL0F08107g"
                     /note="highly similar to uniprot|P53312 Saccharomyces
                     cerevisiae YGR244c LSC2 succinate-CoA ligase beta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446321.1"
                     /db_xref="GeneID:2887790"
                     /db_xref="GOA:Q6FTX3"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX3"
                     /translation="MFRGTVLNKNLAQLARVQGKRHLSIHEYRSAELLRKYGVGTPRG
                     LPAMTPEEAAKAAEQLGTDKLVIKAQALTGGRGKGHFDTGFKSGVHMISSPQEASKLA
                     KEMLQHKLITKQTGEKGKLVSAVYIAERVETKHEAYLSILMDRATGKPMIICSSEGGM
                     NIEEVAEKNPDAIKKFSITVSEGLKPETAREIAESLGFSADAIDDAQDAVSKLYKIFS
                     ETDATQVEINPLSEIANNKDHKVMCTDAKFGFDDNAFFKQEEIFSWRDLTQEDPDEVS
                     AKKYELNFVKLFGNIGCLVNGAGLAMATMDVIKLNGGEPANFLDCGGGATPETIKEGF
                     RLIMSNDKVDAIFVNIFGGIVRCDFVALGLVEAAKELGLRIPIVARLQGTNLDEGRQI
                     IKDSGLKIYSFDELDPAAKKVVELAHH"
     gene            complement(<803610..>805847)
                     /locus_tag="CAGL0F08129g"
                     /db_xref="GeneID:2887946"
     mRNA            complement(<803610..>805847)
                     /locus_tag="CAGL0F08129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446322.1"
                     /db_xref="GeneID:2887946"
     CDS             complement(803610..805847)
                     /locus_tag="CAGL0F08129g"
                     /note="highly similar to uniprot|P53313 Saccharomyces
                     cerevisiae YGR245c SDA1 required for normal organization
                     of the actin cytoskeleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446322.1"
                     /db_xref="GeneID:2887946"
                     /db_xref="GOA:Q6FTX2"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX2"
                     /translation="MVKRSRAAILPTNIILLQNLVKRDPESYYEEFLQQYAHYESLRD
                     IFMLGNMAGEGDATTSGVESTTGSSEGNTSTSQLIELIGFVSQVCSCFPKETQNFPDE
                     LRELLLEHHKSLPFELKEKILTSLTMLRNKGVITAEQLVQTFFPLLVAYSSQGNTLGI
                     NSHAKELRTLVYKNLISLLKSCNTGSKNQKLNKSTQAICFNLLDQPDSQGIWAAKLTR
                     ELWRRGIWDDSRAVEIMTQAALHNDAKIAISGVMFFLDADREREETFEEKSDDEDAID
                     INALKHKMQVNKKTGRRGKKLENAVKTIKKKNKNGTNQAFLNFSAIHLLRDPQGFAEK
                     LFKEHLSGKNSNKFSLEQKISLMQLLSRMIGTHKLIVLGIYTFFLKYLTPKTRDVTKI
                     MAASAQACHDLVPPETLNVLVRKITDEFVSDGVASEVAAAGLNTIREICTRAPLAIEE
                     TLLQDLVEYKGSKAKGVSMAAKGLVSLYREVAPEMLKRKDRGKVASMELQEAKRSGTE
                     RDNRKLQFGVENTVQGIQGIELLAKWKKEQEANGEAVDDDDDKNWEVEDMEEEDDVDG
                     EWVTMDSDKEYDVDMEDSDDEKKSEEKSEENPEEKPEDKIDPESAFREIASSRILTPA
                     DFAKLQELRTEEGVAKLMGMRNEKNEEVVDAGLLTGPVKYKQTREERLQKIMEGREGR
                     EKFGSRRGKRDNARSTTNREKERRKNFVMSIHKRSVRGKQKMSLRDKQKVLRAHITKQ
                     KKKGH"
     gene            complement(<806209..>808005)
                     /locus_tag="CAGL0F08151g"
                     /db_xref="GeneID:2887768"
     mRNA            complement(<806209..>808005)
                     /locus_tag="CAGL0F08151g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446323.1"
                     /db_xref="GeneID:2887768"
     CDS             complement(806209..808005)
                     /locus_tag="CAGL0F08151g"
                     /note="highly similar to uniprot|P29056 Saccharomyces
                     cerevisiae YGR246c BRF1 TFIIIB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446323.1"
                     /db_xref="GeneID:2887768"
                     /db_xref="GOA:Q6FTX1"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:Q6FTX1"
                     /translation="MVLRCKNCGNTELVVDSSTPNNDLVCVACGVVSEENPIVSEVTF
                     AETSSGAATVTGSFLSAGQSHTSGGLGSNAMESREATLNNAKKKLRAVGHALNIPDYI
                     VEASHQWYKLALAYNFVQGRRSQNVIAACLYIACRKEMTHHMLIDFSSRLQVSVYSIG
                     ATFLKMVKRLQITKLPLADPSLFIQHFAEKLELGEKKIKVVRDAVKLAQRMSNDWMFE
                     GRRPAGIAGACILLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKGTKAASLSVKE
                     FRNDDPKKEDSGAAPPSFTKNRKQEVALKKKLEKKELYETSEEALARNPILTQVLGEQ
                     ELSSKEVLYYLKEFTQKREKVIQRLKTTHGIDDSDVLQSQGTDEEEVVTNGGETNETN
                     EHNNKKRVREDSQEVEESVASDAKSLNVTLSSGRKINDLIDGYSLEKDPYRPRNLNKL
                     PTTESLLSKVPDDPENLDDVDDEDLDALILDEEASKLKERIWIGINSEYLLEQESKRL
                     KQEADIAAGNTSGKKKRQKKRKNKNDGEVVSAVNTMADLKDKSGFIAALRHAEEIGDT
                     TAAESVKKMLQKSTFSKKINYDAVEGLFNHAA"
     gene            <808506..>809087
                     /locus_tag="CAGL0F08173g"
                     /db_xref="GeneID:2887610"
     mRNA            <808506..>809087
                     /locus_tag="CAGL0F08173g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446324.1"
                     /db_xref="GeneID:2887610"
     CDS             808506..809087
                     /locus_tag="CAGL0F08173g"
                     /inference="similar to AA sequence:UniProtKB:P53314"
                     /note="similar to uniprot|P53314 Saccharomyces cerevisiae
                     YGR247w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446324.1"
                     /db_xref="GeneID:2887610"
                     /db_xref="GOA:Q6FTX0"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR012386"
                     /translation="MSIALWYCPAPGTLDYEVLKTLINSLQLLVPGSPSFEPHLTVVT
                     HLQVQNRGDVSKVLQSCSSCLKTIPKGHSLIKYSNWSINKQYFKKIVLECEKDKYLLS
                     LAQLMRELYVEIEDQKRRAEHWVIEEFQPHVSLMYNDSQITKATEMVVRQRIHDAMQL
                     FSNNPSSKSWRTFKVVSCEGPVEEWQVLGSVTL"
     gene            <813050..>814027
                     /locus_tag="CAGL0F08195g"
                     /db_xref="GeneID:2887941"
     mRNA            <813050..>814027
                     /locus_tag="CAGL0F08195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446325.1"
                     /db_xref="GeneID:2887941"
     CDS             813050..814027
                     /locus_tag="CAGL0F08195g"
                     /note="some similarities with uniprot|P53050 Saccharomyces
                     cerevisiae YGR249w MGA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446325.1"
                     /db_xref="GeneID:2887941"
                     /db_xref="GOA:Q6FTW9"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW9"
                     /translation="MQHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFC
                     DNVLKRYFKHGNVSSFVRQLHMYGFHKVGNNSVNSHINNIEGNKIVSKKEPHFIIWKF
                     SHPSGNFHRESSYETLCKITRKPTGFGKDGKRKNILSPIAISYLNPGIKTELSYLPFS
                     RAATGIDNFDLQKENMSYIESATDEALTTSTDTLIDNSLFSGITSANSINTIKTSGTG
                     SNGITTGSSNIQTLINNNIALLKKTTLLIIEILDKFNNPELSQKSEEMFSNLQKLQEL
                     KNQLVSKQCELVNMVQPELNSGKSNQVIQSNQYPTPSQFPNFQNYFPSM"
     gene            complement(<814508..>816544)
                     /locus_tag="CAGL0F08217g"
                     /db_xref="GeneID:2887802"
     mRNA            complement(<814508..>816544)
                     /locus_tag="CAGL0F08217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446326.1"
                     /db_xref="GeneID:2887802"
     CDS             complement(814508..816544)
                     /locus_tag="CAGL0F08217g"
                     /inference="similar to AA sequence:UniProtKB:P53316"
                     /note="similar to uniprot|P53316 Saccharomyces cerevisiae
                     YGR250c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446326.1"
                     /db_xref="GeneID:2887802"
                     /db_xref="GOA:Q6FTW8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW8"
                     /translation="MAGNPHIENIANTNQLTIRLKPTNEELNAALNNCATDHKGLIVP
                     QERIEPYESLNETKRAEYLSLKNINNEQNKLVASGNADTEEIESYERVIQFQFKHMPN
                     LKNCLKKVKAILKEEFEKGALAYWSISLNTHALTHPGNLFIGGIPKNMSLNTLMETFD
                     KFGTISSLKILFDNKNVGIGFLSFMLGSEAAECIRCMNGTKIRSDNGDEGTLFINYHI
                     ERKERERLFLSHESSDSSASSLSVRNMRVNTHHRGKHNSPELNSWSTNNSSDDLTINN
                     CVFIGNLPTDIQNEGEFIDDLTEAFPSVTVISYYFPYDHSLNQYKGYGFIKLQNNDQA
                     RRIIHEISTDCFEFCGNHIIANKASNKDNKTTSHFTLYTKTTETNPKTRNNYLEQTSP
                     YAGGINTFPPSMNNYTFGYDLYPPIKRGSHNLPYIYGLPVPLEGQQESNIYVKHVPLD
                     WSDKDLFNFYRPFGNIISCKIITVGGSSREEKSTNSSDEDLPFGISRGYGFVYFANPL
                     DAAYAILSTDGYYLEGAIQKLSVSYAQKKKKDGQSLLDESLSNESSDQIDNSEKTNEK
                     EKRNHSSAKFGQQQYNKKFMNALMSNFYHRNYVGKPSYNLVPSQAMGSPGMSSGMISS
                     SRGNMGLMTPQLIPAAPIDMYSTNSQPRILPNANWFAYPIYPQCPVPLPMDNLV"
     gene            <821107..>822540
                     /locus_tag="CAGL0F08239g"
                     /db_xref="GeneID:2887765"
     mRNA            <821107..>822540
                     /locus_tag="CAGL0F08239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446327.1"
                     /db_xref="GeneID:2887765"
     CDS             821107..822540
                     /locus_tag="CAGL0F08239g"
                     /inference="similar to AA sequence:UniProtKB:P53318"
                     /note="similar to uniprot|P53318 Saccharomyces cerevisiae
                     YGR255c COQ6 monooxygenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446327.1"
                     /db_xref="GeneID:2887765"
                     /db_xref="GOA:Q6FTW7"
                     /db_xref="InterPro:IPR000689"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR010971"
                     /db_xref="InterPro:IPR018168"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW7"
                     /translation="MLKMQLSSVRYLATIAKNSTPKLTDVLIVGGGPAGLTLAAAIKN
                     SPTLAGLSTTLVDAGDLKKVGEFHDQPPEHFTNRVVSITPKSLHFIAERAGAGDFLLR
                     DRIQPYDGLYVTDGVTKSLLDLEKPSMLEMIEILNIQSSLLKKLSQYDEVLDGFKLVE
                     KSKVTKIENTDPKDPTSWPLVTLDNGDVYKTRLLVGADGFQSPVRKFANIETRGWFYG
                     TFGVVATMKLQYDTYKLRGWQRFLPDGPIAHLPLPGENATLVWTTTERISKLLLTLDP
                     KAFASLVNAAFVLDNTDLQYYFDELEAGKISTNELIEDVKFRMDQEFSKLSDETMIDE
                     LYPPQVIDIKGDTRARFPLKMTHADNYCSHRVALVGDAAHTTHPLAGQGLNMGQGDVE
                     ALVDALEKATQRGQDIGALLSLEPFWAERYATNHVLLNMADKLYKLYHTDSAPVVALR
                     SLGLDLTNNFPPVKNWIVKTLTADTEF"
     gene            complement(<823014..>824330)
                     /locus_tag="CAGL0F08261g"
                     /db_xref="GeneID:2887972"
     mRNA            complement(<823014..>824330)
                     /locus_tag="CAGL0F08261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446328.1"
                     /db_xref="GeneID:2887972"
     CDS             complement(823014..824330)
                     /locus_tag="CAGL0F08261g"
                     /note="highly similar to uniprot|P00924 Saccharomyces
                     cerevisiae YGR254w ENO1 enolase I or uniprot|P00925
                     Saccharomyces cerevisiae YHR174w ENO2 enolase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446328.1"
                     /db_xref="GeneID:2887972"
                     /db_xref="GOA:Q6FTW6"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /translation="MSVTKVHARTVYDSRGNPTVEVEVYTKDGMFRAIVPSGASTGSH
                     EALELRDGDKSKWEGKGVTKAVSNVNDIIGPKLIESKLDVKDQKAIDEFMIKLDGTKN
                     KSKLGANAILGVSLAVARAGAAAKGVPLYQHIAELADMKKEPYVIPCPFFNVLNGGVH
                     AGGNLALQEFLIAPVGAESFHEALRLGSEVYHKLKALAKKRIGSSAGNVGDEGGIAPS
                     LSTPFEALDLIYDAIKEAGHEGKVKIAMDPASSEFFQGDKYDLDFKNPHPDAKNKLSG
                     AQLGDYYKTILEKYPIVSLEDPFAEDDWEAWTNFFPKAGVQIIADDLTVTNPERIQTA
                     IDKKTADCLLLKVNQIGSLTESINSAKLAYGAGWGVQVSHRSGETEDTFIADLVVGLR
                     TGQIKSGSLARSERLAKWNQILRIEEELGASNTIFAGAKFHKGQLL"
     gene            <825860..>827500
                     /locus_tag="CAGL0F08283g"
                     /db_xref="GeneID:2887572"
     mRNA            <825860..>827500
                     /locus_tag="CAGL0F08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446329.1"
                     /db_xref="GeneID:2887572"
     CDS             825860..827500
                     /locus_tag="CAGL0F08283g"
                     /inference="similar to AA sequence:UniProtKB:Q03330"
                     /note="similar to uniprot|Q03330 Saccharomyces cerevisiae
                     YGR252w GCN5 histone acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446329.1"
                     /db_xref="GeneID:2887572"
                     /db_xref="GOA:Q6FTW5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /translation="MVTRRRLHHPEVEQVSKRQKVDKAESKNKKHADVAAERGEQSTE
                     DHEDESQDKKDKKVVGDNRDEDEEVSPNGQEAAEDNDDRKDKDAKEKDTETNDEGTEK
                     SHTDVNDDDDDVDESKEEDAAAAVDITKEKKDEQESDNKTEEKKVQENEEEEEEDENK
                     NDEDVEELGSTEPVDDEKKGLVKFEFDGVEYKFKERASVIEENEGKIEFRVVSNDNTR
                     ENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVIRKPLTVVGGITYKPFNKR
                     QFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTSDIRYFLTYADNYAIGYFKKQGFT
                     KDITLDKKVWMGYIKDYEGGTLMQCSMLPRIRYLDAAKILLLQEAALRRKIRTISKSH
                     VVHPGLECFNDIENIKPIDPMSIPGLKEAGWTPEMDELAQRPKRGPHYAAIQNILVEL
                     QNHAAAWPFLRPVNKEEVPDYYEFIKEPMDLSTMELKLENNKYEKMEEFIYDARLVCN
                     NCRLYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID"
     gene            complement(<827705..>828829)
                     /locus_tag="CAGL0F08305g"
                     /db_xref="GeneID:2887588"
     mRNA            complement(<827705..>828829)
                     /locus_tag="CAGL0F08305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446330.1"
                     /db_xref="GeneID:2887588"
     CDS             complement(827705..828829)
                     /locus_tag="CAGL0F08305g"
                     /inference="similar to AA sequence:UniProtKB:P53320"
                     /note="similar to uniprot|P53320 Saccharomyces cerevisiae
                     YGR257c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446330.1"
                     /db_xref="GeneID:2887588"
                     /db_xref="GOA:Q6FTW4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW4"
                     /translation="MTDRPPATLTIQERMMSATVGSLLTSVILTPMDVVRIRLQQQQM
                     LADCGCADISELDDSKVRKRISEGGVRRNTLEQLRQSKVVNRIDTVPKIFWESTCFQN
                     LNCRNQKFNGTLEAFEKIAKFEGVTTLWRGISITLLMAIPANVVYFTGYEYVRDRSPL
                     NGLYPTINPLICGAFARTLAATSVAPLELIKTKLQSIPSSSMKNGSVIMYRDLFNEIK
                     SEIAMRGVAQTMFKGLEITLWRDVPFSAIYWASYEFYKTKVAYLSPSTFDKNSSNWFH
                     FTNSFLGGFISGSLAAICTHPFDVGKTRQQISLVTDKKLANSNLKYGSSNTMFGFLNY
                     IRKTEGIGALYTGLAPRVAKIAPSCAIMISSYELTKRLFM"
     gene            complement(<829426..>832404)
                     /locus_tag="CAGL0F08327g"
                     /db_xref="GeneID:2887604"
     mRNA            complement(<829426..>832404)
                     /locus_tag="CAGL0F08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446331.1"
                     /db_xref="GeneID:2887604"
     CDS             complement(829426..832404)
                     /locus_tag="CAGL0F08327g"
                     /inference="similar to AA sequence:UniProtKB:P07276"
                     /note="similar to uniprot|P07276 Saccharomyces cerevisiae
                     YGR258c RAD2 structure-specific nuclease of the nucleotide
                     excision repairosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446331.1"
                     /db_xref="GeneID:2887604"
                     /db_xref="GOA:Q6FTW3"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW3"
                     /translation="MGVHSFWDIVGPTAKPVRLESLHDRRMAVDASIWIYQFLKAVRD
                     KEGNAIKSAHITGFFRRVCKLLYFGIKPVFVFDGGVPVLKRKTIQKRKERREGKRDNA
                     TNTAKKILAKQLQTLKDNGAANEQLQSNASNGTANGNTSKVFTPFDEWDLPDIPGFRY
                     SRSDERVNAADDFEKLINSIDTDVIDDIDLDSINPASKEFEELPKTTQFMILSTLRLR
                     SRLRMGYSKEQLENIFPNSMDFSKFQIDMLKRRNFFTQKLINVTGMNDGGASKLEDED
                     SNGGSRLSSTKDKEYKLVKTENGWSLGFGDVDGSEANKAILLDDPEHSVAIKMEKDMG
                     NNLGSSFGAEDEDGEEEFDWEDVDLKPAPQRKVEDYSLKAARKLTTGAGSEIKRAAVQ
                     SFLDTRPSDISPRKRKAQEQIMKPIHIEEDTTPDLQNENVAEVLSTDDSEGEYEQQMK
                     EIELMENFKKKRNLKEQLNDSATNESIMRVDNNYKVNEQPIIRGDRTNQPVLTESEQN
                     LRFIVNKIPTLDGGGSLLFGPNVEKPVIDDIDGVQKVLPAEEGEKRDREVPEIPSWFT
                     NDSFIEKSNPYTANQFVNDIDLKPNADEISKSPRKEEYQLLSGLAATDAINELSSTRA
                     PNDVVEVGAFQSFKTPSQKAETAQKSSSDEEDYDDEQVRKPEVFDYNFSEEEEEELAE
                     NLRREEEDFREFRVTALNNKDVSQNAFIEDEIYAQQVKDKRDADEVTMDMIKDVQELL
                     ARFGIPYITAPMEAEAQCAELVNLKLVDGIITDDSDVFLFGGKKVYKNMFQEKNYVEY
                     YDSEDIYQGLGLTRETMIELAQLLGSDYTTGIKGMGPVSSMEILAEFGDLKNFKRWYN
                     EGQFDKKKQEGEDKFRRDLRKKLVKNDIILDDDFPSVFVADSYLNPEVDHDKTPFTWA
                     NPDLDMLRQFLYSYLGWPQEKSDEVLIPLIRDINARKKAPKQSTLTDFFPREYLDHKK
                     LNLGKRITTATGKLKQRRLK"
     gene            complement(832602..832674)
                     /locus_tag="CAGL0F08349r"
                     /db_xref="GeneID:2887903"
     tRNA            complement(832602..832674)
                     /locus_tag="CAGL0F08349r"
                     /product="tRNA-Val"
                     /note="tRNA Val (CAC) cove score=79.05"
                     /db_xref="GeneID:2887903"
     gene            <835733..>837322
                     /locus_tag="CAGL0F08371g"
                     /db_xref="GeneID:2887904"
     mRNA            <835733..>837322
                     /locus_tag="CAGL0F08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446332.1"
                     /db_xref="GeneID:2887904"
     CDS             835733..837322
                     /locus_tag="CAGL0F08371g"
                     /note="highly similar to uniprot|P53322 Saccharomyces
                     cerevisiae YGR260w TNA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446332.1"
                     /db_xref="GeneID:2887904"
                     /db_xref="GOA:Q6FTW2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW2"
                     /translation="MTLRMRGHDNIEEEVSSGHDFDDGRKVVKVESPLRETDESESDE
                     KKVLESANEREVLGTTTDDDGYMLPSLDHPMEKKILKKMDLFIIPLLGLMYFLSNLDK
                     SNIGNAEVAGLSKSIGLKGKEYNIAVTVFFGTYIVFDPVGANLLKIMGPNRMMSSCLL
                     CFGAISLATAFIKNYGQLLAVRLLLGMFEGMIYPAINMYLSVCYRREQYAVRFAFVFT
                     AAALSSAFGGLIAYGCSKIHGSLEAWQYIYIVEGAISIGFVPVYIWGLGRKLEDSWFF
                     TEEEREYVIERYNTMNTFNPDEKFEWFQVWLAVKDIKTWVSAIALFGIDLTTFGLTVF
                     LPIIVTSLGFSHVRAQLMTVPVYFLTAVVFFVCAIWSDKLKLRSPFIIGACLTTSIGL
                     AIVLGSTVHGVRYFGVFILCMGIYVNAACNCLWLSGNNGNYFKRATALGINLFIGSGS
                     GLVSGQIFLAKDKPRYIMGLSLCLGFQVLSIVMTALQFYLYYRSNQQKQKIIDHCHEI
                     GEPIPYDERLSDLNPEFKYMY"
     gene            complement(<837596..>840016)
                     /locus_tag="CAGL0F08393g"
                     /db_xref="GeneID:2887817"
     mRNA            complement(<837596..>840016)
                     /locus_tag="CAGL0F08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446333.1"
                     /db_xref="GeneID:2887817"
     CDS             complement(837596..840016)
                     /locus_tag="CAGL0F08393g"
                     /inference="similar to AA sequence:UniProtKB:P46682"
                     /note="similar to uniprot|P46682 Saccharomyces cerevisiae
                     YGR261c YKS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446333.1"
                     /db_xref="GeneID:2887817"
                     /db_xref="GOA:Q6FTW1"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:Q6FTW1"
                     /translation="MSQFASALESARTLTLEAAAVASSKLGESSYKQYSKTISPRQLK
                     TLLNSRNTREVKDGLKCLISAMALGDNTIDAKSYLPDVVKTVHTDDMRIRRLVALYLV
                     RYAEIDQDVALLVVNSLQKLVNDTLSETRAFSIKSLVDMRLKSLEPIIIHGMRKSVSD
                     PSAIVRSEVAYTIAKIYTSAYEDFQDELEITLKELLADSDPTVISSVIVVFYRHFLDH
                     LDWLHGHFRRYCNILHELDSNAQIYMITSLTLYSKRYIPKPLLRNSENEKESMPLPDD
                     IQEIIYTAFTIENDPDLDLLLSGIRKLIYSDNFAVLLTCCQAILQLSTPGSLRRTKFP
                     EVIANLINNSRTNGSIKSLILQNILLMSTVDPQIFTPYFRQFFLYPTDNIVTAEFKLK
                     VLSSLVTEETIDSVATEIRRYVYDDLAQNIKKEAMIALGICGQLSELWESKILKWLLR
                     FLTYQKLDKNLMDTAVDVIRVLLHSNPRSHIKTVLELSTLLESQDTLHDKARSGIIWL
                     FGEIARVEFSVCPDVLRKLTLNFAQEGRYSRHQILLLAAKLLSYDISANTTGDGAYDY
                     SKSRLYQIFNTLIYLAKYDDDFDIRDRARMLGSLFHEDKLQIGTLLLQGTKPEPQLFP
                     SNYRNRDGSEDQNVKSLISYGVSSSLINAYLFRKWEYSPDPVSENQDIREPTPTKDYR
                     KYYTSISSDSFKGRDTISNNAFSSSIDRNKDFEAKPSKDSTYVSKRGQKYKLQSLEEF
                     FSDIPEQPNKKSLNQSIDNSTGDKKPHISSEEEDTEEESDEGSNSESETGEDDLDSSE
                     EYTDDSSD"
     gene            complement(<840334..>841134)
                     /locus_tag="CAGL0F08415g"
                     /db_xref="GeneID:2887568"
     mRNA            complement(<840334..>841134)
                     /locus_tag="CAGL0F08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446334.1"
                     /db_xref="GeneID:2887568"
     CDS             complement(840334..841134)
                     /locus_tag="CAGL0F08415g"
                     /note="highly similar to uniprot|P53323 Saccharomyces
                     cerevisiae YGR262c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446334.1"
                     /db_xref="GeneID:2887568"
                     /db_xref="GOA:Q6FTW0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /translation="MSQEIVDRVRNYLSPNIPVTPISQGAEAVVFTTSVHPYLPENCN
                     SNEKYIIKYRSPKRYRHPVIDKSLTKHRTLGEARLLSKLYTIEGLHVPKLIACDAYNG
                     YLWLEFLGEDLPENFGYSNLKNFLWMYDAKNDPYCEVVKRALIEVGEQIGKLHWNDYC
                     HGDLTSSNIVMVHSDTDSHHWVPHLIDFGLGSTTTMVEDKGVDIYVLERAILSTHSQH
                     AEQYIEWMLDGFKSVYEKNGKLGKKKLDELLKRFAEVRLRGRKRSMIG"
     gene            complement(<841456..>842718)
                     /locus_tag="CAGL0F08437g"
                     /db_xref="GeneID:2887630"
     mRNA            complement(<841456..>842718)
                     /locus_tag="CAGL0F08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446335.1"
                     /db_xref="GeneID:2887630"
     CDS             complement(841456..842718)
                     /locus_tag="CAGL0F08437g"
                     /inference="similar to AA sequence:UniProtKB:P53324"
                     /note="similar to uniprot|P53324 Saccharomyces cerevisiae
                     YGR263c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446335.1"
                     /db_xref="GeneID:2887630"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV9"
                     /translation="MDTKSNVSVNTTEIPTNITVTTDLSTLRNEEDSITMSIWHTLRF
                     LSKFIGILPFKMTYYLIKVVMESERGVNIDIVSRIFMRESTKLIDENICQYVLNPIFE
                     FIYKFEGNGISLINYSVPNDDLEQISGGIFDKPFVKSTRTQSKFFWKRQINPHTFNPE
                     IDPILIYYHGGGYALQLTPTTLSFLTNTGKYFPDMPILISDYATTASKLDSNKYPRQL
                     LDILAVYDYVTQSLGCKNVIVMGDSAGGNAVLVLLLYLHKHNRPLLPRKAIPISPWLN
                     TTYIGEQERTYMKQSEKWDGICTKGSEMFGDLYIPKILRESGYNPDNDEYINIEHNFD
                     AETWNLITEKCDLLVTYGDDEILSYQIKLFVDKLIECNPKRYNNVENVLAHFQGCHTG
                     PILAWDGNVESWSKQTMIKPILDFIDKA"
     gene            complement(<843128..>845380)
                     /locus_tag="CAGL0F08459g"
                     /db_xref="GeneID:2887794"
     mRNA            complement(<843128..>845380)
                     /locus_tag="CAGL0F08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446336.1"
                     /db_xref="GeneID:2887794"
     CDS             complement(843128..845380)
                     /locus_tag="CAGL0F08459g"
                     /note="highly similar to uniprot|P00958 Saccharomyces
                     cerevisiae YGR264c MES1 methionyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446336.1"
                     /db_xref="GeneID:2887794"
                     /db_xref="GOA:Q6FTV8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV8"
                     /translation="MASQVSFDKVKGRDAKVVLANNLKIALAIELAKGLKLSINEDRS
                     EPLLTAGELVLRDANAILRYALDDFEGIHSEQYHYALSSVEAYLYHQQSSEEHATELV
                     NKMIDNYLKLDKDSKLDAVTLISFANAYALRPTQINDAFKDDLPEALKKAIQTATKYT
                     PRSSSEFKNTGEKHIAEGYLVSKQGSEILPKEGERNILITSALPYVNNVPHLGNIVGS
                     VLSADIFARYCKSRNYNTLFICGTDEYGTATETKAIEEGVSPRELCDKYHKIHSDVYK
                     WFQIGFDYFGRTTTEQQTEIAQDIFLKLDKNGYLGEESMKQLYCPVHNSFLADRYVEG
                     ECPKCHYEDARGDQCDKCGGLLDPFELINPRCKLDNAIPEPKTSDHIFLALDKLEPEI
                     KKWVEKASTEGEWSKNSKTITNSWLKDGLKPRCITRDLVWGTPVPLEKYKDKVLYVWF
                     DATIGYVSITANYTKNWEQWWKKPEDVKLYQFMGKDNVPFHTVVFPGSQLGTNDEWTM
                     LHHLNTTEYLQYEGGKFSKSRGVGVFGNNAQDSGISPSVWRYYLASVRPESSDSHFSW
                     DDFVARNNSELLANLGNFVNRIIKFVNAKYNGVIPKFDTKNLPNYDSLVSDINEILRN
                     YVKEMETAHERRGLEIAMSLSARGNQFLQENKLDNSLFSQHPEKSDAVVGVGLNIVYA
                     VASLIYPFMPETAETINRMLNAPALKIDEEFHIALLGGHNINKAEYLFQRIDEKKIDE
                     WRAKYGGQDK"
     gene            <846289..>848394
                     /locus_tag="CAGL0F08481g"
                     /db_xref="GeneID:2887703"
     mRNA            <846289..>848394
                     /locus_tag="CAGL0F08481g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446337.1"
                     /db_xref="GeneID:2887703"
     CDS             846289..848394
                     /locus_tag="CAGL0F08481g"
                     /inference="similar to AA sequence:UniProtKB:P53326"
                     /note="similar to uniprot|P53326 Saccharomyces cerevisiae
                     YGR266w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446337.1"
                     /db_xref="GeneID:2887703"
                     /db_xref="GOA:Q6FTV7"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV7"
                     /translation="MTSEDGVSGDWDATQYHKLVEGVDSCSDTSPIKQDGVVCGPTLR
                     LKSIDYERDVWLGSMLIVVRDAFDPSSPRAPKVTYELGGGSHSGEFQGKLFHTDYFGD
                     DNSNKSVFQFYRYDIELPLADNEAECKYTVADKAEEHYRFFIPGRNQNCNSISYSCNG
                     FSLSVDTTKFKGSLWYDILQKHANVHYHVMLGGGDQIYSDSVKIYSERVKKWLETHDP
                     VKKYTMKADEFFVKEVANFYLKEYLEWYGYGHWKGATEKSKTTQRCFPIATATIPSVN
                     MWDDHDIIDGFGSYPDRFMSTNVFSSLGNIAYKYYMLFQHHVSIEEKQAYLEDKHWVL
                     SKGKGAFIQQQSHSVFTRLGPSIGLLGLDCRTERKLKAILPKSTYDIAFERITKELQA
                     KRFDHLYLMLGVPIAYPRLVLLEYIFSSKLLAPIKYLSKKGIFAKGLVNEFNGDVELL
                     DDLNDHWCAHYHKKERNNFIAALQDWGAKYGVRITILSGDVHLAAVGRFRSKLHRHHL
                     ITSEETKKENEEILDSAQEDNRLMFNVISSAVVNTPPPDGMAKLLQTKNRIHKFDYET
                     DEDSVPLFKMNPDQKSKRDEDCFLNGRNWSDLIPVENLMKNKYLANTFKVENGDKVLP
                     GMVKEGLGFEVKNKKPKSDENPLYPVTPNGIMVTIHVEKDRKSNASESTMYSFPIPEL
                     TVKGEKLSHKGAKHLVGFH"
     gene            complement(<848954..>849691)
                     /locus_tag="CAGL0F08503g"
                     /db_xref="GeneID:2887571"
     mRNA            complement(<848954..>849691)
                     /locus_tag="CAGL0F08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446338.1"
                     /db_xref="GeneID:2887571"
     CDS             complement(848954..849691)
                     /locus_tag="CAGL0F08503g"
                     /note="highly similar to uniprot|P51601 Saccharomyces
                     cerevisiae YGR267c FOL2 GTP cyclohydrolase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446338.1"
                     /db_xref="GeneID:2887571"
                     /db_xref="GOA:Q6FTV6"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV6"
                     /translation="MQQALNHRLSSMERTGTPLNTRPASPYTSIPTVASDGLSWPSKG
                     ARTRAHETEEEEKQRTGRIADAVKVILEELGEDVTREGLLDTPQRYAKAMLFFTKGYQ
                     TNIMDDVINNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVIGLSK
                     LARLAEMYARRLQVQERLTKQIAMALSEILKPLGVAVVIEASHMCMVSRGVQKTGSST
                     MTSCMMGCFRSHKTREEFLTLLGRRSI"
     gene            complement(<850744..>851325)
                     /locus_tag="CAGL0F08525g"
                     /db_xref="GeneID:2887704"
     mRNA            complement(<850744..>851325)
                     /locus_tag="CAGL0F08525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446339.1"
                     /db_xref="GeneID:2887704"
     CDS             complement(850744..851325)
                     /locus_tag="CAGL0F08525g"
                     /note="highly similar to uniprot|P53200 Saccharomyces
                     cerevisiae YGR001c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446339.1"
                     /db_xref="GeneID:2887704"
                     /db_xref="GOA:Q6FTV5"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV5"
                     /translation="MNLFKEDWQLSQFWYSDSTADKLADALLEGADATTVIAIVSAPS
                     VYAAIQKRDDSEIPTKHIYLFEYDTRFELLAGKDHFFFYDYNKPLDFDDKLKGKVDRL
                     LIDPPFLNEDCQSKSAQTAKSLLAPKDGSKTSDGLLKHRLISCTGERMAQVIKKAYPD
                     TEITDFYPEHGNGLSNEFRCYANFEWSGWKFSK"
     gene            complement(<852168..>853206)
                     /locus_tag="CAGL0F08547g"
                     /db_xref="GeneID:2887849"
     mRNA            complement(join(<852168..852711,853127..>853206))
                     /locus_tag="CAGL0F08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446340.1"
                     /db_xref="GeneID:2887849"
     CDS             complement(join(852168..852711,853127..853206))
                     /locus_tag="CAGL0F08547g"
                     /note="highly similar to uniprot|P32471 Saccharomyces
                     cerevisiae YAL003w EFB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446340.1"
                     /db_xref="GeneID:2887849"
                     /db_xref="GOA:Q6FTV4"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR018940"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV4"
                     /translation="MAFTDFSKIDTVKELNTVLGEKSYVEGTSATQADVEAYKAFRTA
                     YPNFSRWFNHIAAKADEFDSFPAASGASAAAEEEDDDDVDLFGSDDEVDEEAEKLKAQ
                     RLEEYNKRKAAKGPKPAAKSIVTLDVKPWDDETDLEEMLANTKAVQMDGLNWGAHQFI
                     PIGFGIKKLQINCVVEDAKVSLDDLQQAIEDDEDHVQSTDIAAMQKL"
     gene            <853613..>854824
                     /locus_tag="CAGL0F08569g"
                     /db_xref="GeneID:2887854"
     mRNA            <853613..>854824
                     /locus_tag="CAGL0F08569g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446341.1"
                     /db_xref="GeneID:2887854"
     CDS             853613..854824
                     /locus_tag="CAGL0F08569g"
                     /inference="similar to AA sequence:UniProtKB:Q06168"
                     /note="similar to uniprot|Q06168 Saccharomyces cerevisiae
                     YLR321c SFH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446341.1"
                     /db_xref="GeneID:2887854"
                     /db_xref="GOA:Q6FTV3"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="InterPro:IPR017393"
                     /translation="MSNRAVPQGYLANLQFRIRSDNLPLLSTVQPSRGHKRGGRAVNY
                     AEFDNELLEDFSNFPTFDIDSDSNDEEQSSASAGNDDPQANANGGEAAGVNGQGSGDG
                     GSANTGAGRHGKSQLTAEMEKNYKTGVPDLNEQKDSLNVLRYQKIRESFQHGKIAVPY
                     RLYVPPELSTGQQEAILIPITLNVEHGNNTISDAFVWNVNDTSISVEDFVTTYCNDLG
                     LYGNVSLHSQIVSSINEQIQELENVASLVIPDLEVVVNLTCTIQGKFFEDYFQWNLSD
                     KSLSPEKFALIIVADLGLAREFAPGIAHSLHEYLLHVKKEWAEGSLHQDTVPNEAAFG
                     YLAGVRLNIDDLGAKWAPKVEYLTQEEIQKREIEKERNMRRLKRESDRMGGGARRGRR
                     RLDDLELTMKM"
     gene            <855132..>855620
                     /locus_tag="CAGL0F08591g"
                     /db_xref="GeneID:2887792"
     mRNA            <855132..>855620
                     /locus_tag="CAGL0F08591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446342.1"
                     /db_xref="GeneID:2887792"
     CDS             855132..855620
                     /locus_tag="CAGL0F08591g"
                     /inference="similar to AA sequence:UniProtKB:Q06162"
                     /note="similar to uniprot|Q06162 Saccharomyces cerevisiae
                     YLR315w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446342.1"
                     /db_xref="GeneID:2887792"
                     /db_xref="GOA:Q6FTV2"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV2"
                     /translation="MSSTDLIIAHFNELRFSDVLSIEDFKEIIIQSKTVEVHDEDVNK
                     WYQSYLRAEQKKLKLFRERLRIFLASIRQRELQKLEKEQLSESYNLEEIISSLYKLNE
                     VFEGIVMNQNDELRQKQAELANFKDHLAASLDSSDRSILDSINSSIEAIEKYRKALDE
                     GS"
     gene            complement(<855805..>857403)
                     /locus_tag="CAGL0F08613g"
                     /db_xref="GeneID:2887793"
     mRNA            complement(<855805..>857403)
                     /locus_tag="CAGL0F08613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446343.1"
                     /db_xref="GeneID:2887793"
     CDS             complement(855805..857403)
                     /locus_tag="CAGL0F08613g"
                     /inference="similar to AA sequence:UniProtKB:P53201"
                     /note="similar to uniprot|P53201 Saccharomyces cerevisiae
                     YGR002c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446343.1"
                     /db_xref="GeneID:2887793"
                     /db_xref="GOA:Q6FTV1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR027109"
                     /translation="MSSSDIFDVLNIKQKSSSPNAASPSVPASGKSSKPQLTGMQREL
                     YNLLGENEAPVVVQSMNRFKEKLASNAKPTPWSLANFKANEYLTLQHWVKGSRELIGE
                     EPQESEFKKYDVHLTIPEFTEDEYNSFIPTSNAEENEKQNIGEKVEANGDSTDVNMTE
                     EDTNDKVKESVPQDENKSTSDNKKNNEKWEYNEVKYLFDLCKKYDLRWFVIQDRYDYE
                     NSNRTLEDLKSKFYEVSKCYFKAKKPDDPMLQSLNYSKDKETQRKKYLERLLARSAAE
                     IAEEEALIIESRKFEMAAKKTLAERETLLRLLDSPQSDISVAQYLTSNGMSQLYNSLL
                     ADKSRKRKIDSAVPENPWMKQQHQFAQQRQQMQQLQQKKLEKHDASATPGPATTVTAT
                     ETSTNVTSAGSIPSGLQSPKKTKRQKLELQTALKRKSESEYAEQLLKIFNMDERKSLG
                     VIAHGEKLSPGVFLRSAKITTFKPAIQNKIISTAQELGIPARPVMPTFEVVTEYEALL
                     KKIATLLDIKKQIDKIEAGKQITK"
     gene            <857724..>859997
                     /locus_tag="CAGL0F08635g"
                     /db_xref="GeneID:2887574"
     mRNA            <857724..>859997
                     /locus_tag="CAGL0F08635g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446344.1"
                     /db_xref="GeneID:2887574"
     CDS             857724..859997
                     /locus_tag="CAGL0F08635g"
                     /inference="similar to AA sequence:UniProtKB:P53202"
                     /note="similar to uniprot|P53202 Saccharomyces cerevisiae
                     YGR003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446344.1"
                     /db_xref="GeneID:2887574"
                     /db_xref="GOA:Q6FTV0"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q6FTV0"
                     /translation="MINRRVGIRIPTKLSIPKQDFSQSWEILESALNHIYAEDTEKLS
                     FGDLYRTIYTQVLNRNGEKLYSAFEAYMAKKLDEIRELTFTEHVLSDNDSFLLEMGEL
                     WKKQSDILKTISDLTIYMDKVYSKPNRVPEIHELGLQIFKKHILMKIKDQLLNSILAD
                     INSVRDCQELDLQKAHLWKLLVSMMETITDTKDTFYLNYFEPKFLNDTGLYYKKSFTP
                     TDKSATECLEKIRVLQSFEIEMCEDYLNKDTILKLNHVLEEVLYNQKLNIHVPELIKI
                     SFEQDNYELLDQIYTVSLSDDYRLQIVNAIKSYMLKHCNNSEPKEIPKKRYLYAIQWT
                     ARVLATYKKCHEFLSNVNFGSVVVRKSEADNETETKAYNSAVISNEVFSEYLNQDGKR
                     SSEFVTIYLDSCLKLSIEKQKYKQVKQDLDAAVKLFKLLQEKDIFSQYYQQQLSKRLL
                     QQKSSLDLERWLITQIKSEMGSLFTSKLEGMLRDVNSSIELYKTFQNTTKEAVAGFMF
                     KPQILTPTSWPFQAPDRVDPNFKLPETLQGIQDSFETFYTNKYNQRILKWSHHLSSIE
                     VGYQFAKTYHEIHLPIYAASIFFLFENHDSLTKDEIQDMTGLPDVELDKLLLSMTTAP
                     RSKILVKSPPSKIINSTDTFAINEDFTAPTTKVKLQMIIGVVQPNNGTGEPNKASIMD
                     NVERERQEVTNAAIVRLMKSERHLQFSELQEKTAVQLAQRFTLSLATFKACIETLIEK
                     EYIQRDVDDHEFLHYIT"
     gene            <860500..>862011
                     /locus_tag="CAGL0F08657g"
                     /db_xref="GeneID:2887855"
     mRNA            <860500..>862011
                     /locus_tag="CAGL0F08657g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446345.1"
                     /db_xref="GeneID:2887855"
     CDS             860500..862011
                     /locus_tag="CAGL0F08657g"
                     /inference="similar to AA sequence:UniProtKB:Q06169"
                     /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
                     YLR324w or uniprot|P53203 Saccharomyces cerevisiae
                     YGR004w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446345.1"
                     /db_xref="GeneID:2887855"
                     /db_xref="GOA:Q6FTU9"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU9"
                     /translation="MDQPSTKSKVLSEEEKERIKTNKVIKSVLKKRGKWKSNAYSNNE
                     VEEDYNIVSSPLLNSTPPTVSKALVKLYPYLIVTDKFLSIVTWTNDNLWLNFLSVLSY
                     FVFVLYFQFLVKYFGHLLIIGIIWCYSLVDSAVEDTMMSCPSLDDIVHIMVRVSTKAD
                     IVLSPLTILNSQDIQRLLFTSAFLSPIYILVTKLIFYPRTLVLFAGVYVLTYHSSWSK
                     AFRRSLWNFRLIRLLMFYITGLDMGGINKHYTIFTSVNDQIKKLTGPKKADGSSNEPI
                     RFTYVLYENQRRWIGIGWTSSMLSYERSAWTDEFLNAAPPITEFTLPEGDSGLEWKWI
                     DKEWRLDLTNDGSIQLPSSKMKTTANPSSDDGFIYSDNTWKNPSTEDSFSKYTRRRRW
                     IRTAELIGAKINSRSNSVTTVQEINSTTSTGIDNHDIQSPADDAESTTMKRKVSFSDV
                     RKIRIINDQNEEVKDVTEKENINIQLTSPTLEKKVSTDQDPREILIESNKKIE"
     gene            complement(<862179..>863366)
                     /locus_tag="CAGL0F08679g"
                     /db_xref="GeneID:2887744"
     mRNA            complement(<862179..>863366)
                     /locus_tag="CAGL0F08679g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446346.1"
                     /db_xref="GeneID:2887744"
     CDS             complement(862179..863366)
                     /locus_tag="CAGL0F08679g"
                     /note="highly similar to uniprot|P41896 Saccharomyces
                     cerevisiae YGR005c TFG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446346.1"
                     /db_xref="GeneID:2887744"
                     /db_xref="GOA:Q6FTU8"
                     /db_xref="InterPro:IPR003196"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU8"
                     /translation="MSQRATPAAGPTLATAASNNDSGDEYLSQEEEVFDGNDIENNET
                     KVYEESLDLDLSKSKRQVWLVRLPMFLAERWRDRNNLHGQQLGKIKINQDGSKIKLML
                     DENDNDAIPHEYDLELTKKIVENEYVFTEQNLKKYQQREKELAADPEKQRQAYLKKQE
                     REEELKKKQQQQKRRNQRKRFNHRVMTDRDGRDRYIPYVKTIPKKTSIVGTVCHECQV
                     MPSMNDPNYHKIVEQRRNIVKNSNKEKIVTLDETVGVTMSHTGMSMRSDNSNFLKVGR
                     EKAKNNIKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLV
                     KKGPYAFKYTLRPEYKKLKEEERKATLGELADDDQPTEGKEGNSENENEMGEEEIEME
                     DIV"
     gene            <863663..>864220
                     /locus_tag="CAGL0F08701g"
                     /db_xref="GeneID:2887891"
     mRNA            <863663..>864220
                     /locus_tag="CAGL0F08701g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446347.1"
                     /db_xref="GeneID:2887891"
     CDS             863663..864220
                     /locus_tag="CAGL0F08701g"
                     /note="some similarities with uniprot|P33411 Saccharomyces
                     cerevisiae YGR006w PRP18 U5 snRNA-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446347.1"
                     /db_xref="GeneID:2887891"
                     /db_xref="GOA:Q6FTU7"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU7"
                     /translation="MATEKPRDERIQAVIEEEQKVDTTIDPQEIGKPNGAQLLSLKCN
                     LYLHKLLDTWALEQEEGGNDILKDTKRGIYPLLVSLRKARLPSDQLVSLATVLYHLQQ
                     YESTRDKVHMQRSLESYMKLSLGNVAWPIGVTQVGIHERKIQRQDARNNTATAGIVAN
                     VMTDEQTRLWITNVKRLLTHMEQRK"
     gene            <864757..>865707
                     /locus_tag="CAGL0F08723g"
                     /db_xref="GeneID:2887575"
     mRNA            <864757..>865707
                     /locus_tag="CAGL0F08723g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446348.1"
                     /db_xref="GeneID:2887575"
     CDS             864757..865707
                     /locus_tag="CAGL0F08723g"
                     /inference="similar to AA sequence:UniProtKB:P33412"
                     /note="similar to uniprot|P33412 Saccharomyces cerevisiae
                     YGR007w MUQ1 choline phosphate cytidylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446348.1"
                     /db_xref="GeneID:2887575"
                     /db_xref="GOA:Q6FTU6"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU6"
                     /translation="MTVHLWEEKVWIDGCFDFTHHGHAGVFLQARQTIDPEVSGGNDA
                     LICGIHSDEDIRVNKGCLPVMQERERYEHARANRWCDQVIEGAPYVTHPDVMNKYGCM
                     YVVHGDDITLDKDGNDCYQEMKDCGRYKCVKRTAGVSTSDIIQRILTGSRDHHSRPDE
                     VVTLEELTKYSYDRDGYGPGCTVYRETLDNIVVRGKTVPERLVIVEGNFDLFHIGHIS
                     KFKKIRADHPDRHVIVSVRTNEDDIMTLKEKALSILSCKYIDGVVLDLDMGTLATDIV
                     TIQIDDIDGGEFDYLTKETIVNRIISQRDEYVSRNKRKGF"
     gene            complement(<866073..>866333)
                     /locus_tag="CAGL0F08745g"
                     /db_xref="GeneID:2887776"
     mRNA            complement(<866073..>866333)
                     /locus_tag="CAGL0F08745g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446349.1"
                     /db_xref="GeneID:2887776"
     CDS             complement(866073..866333)
                     /locus_tag="CAGL0F08745g"
                     /note="highly similar to uniprot|Q06177 Saccharomyces
                     cerevisiae YLR327c or uniprot|P16965 Saccharomyces
                     cerevisiae YGR008c STF2 ATPase stabilizing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446349.1"
                     /db_xref="GeneID:2887776"
                     /db_xref="GOA:Q6FTU5"
                     /db_xref="InterPro:IPR006861"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU5"
                     /translation="MTRTNKWTVHEAKANARYFTRNGNFGESPNSVKREGSGKGNWGK
                     PGDEINDLIDAGEIPPIFNKQRRGSNNQQNEHKLGKVQNREL"
     gene            <867394..>867789
                     /locus_tag="CAGL0F08767g"
                     /db_xref="GeneID:2887825"
     mRNA            <867394..>867789
                     /locus_tag="CAGL0F08767g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446350.1"
                     /db_xref="GeneID:2887825"
     CDS             867394..867789
                     /locus_tag="CAGL0F08767g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446350.1"
                     /db_xref="GeneID:2887825"
                     /db_xref="GOA:Q6FTU4"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU4"
                     /translation="MNQDDVEFPVNSRGDGDHLVLPSSQGGNDVEENSIPPIPQSADN
                     QSRNLNGGGGLTMLDENNRIFVFFQNQNRENSLRQVSFETTISYTLDSYRRGIVTCVE
                     IGGGRSVVWFHETRVSRIDKSAIIRNHVS"
     gene            <868002..>869171
                     /locus_tag="CAGL0F08789g"
                     /db_xref="GeneID:2887777"
     mRNA            <868002..>869171
                     /locus_tag="CAGL0F08789g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446351.1"
                     /db_xref="GeneID:2887777"
     CDS             868002..869171
                     /locus_tag="CAGL0F08789g"
                     /inference="similar to AA sequence:UniProtKB:P53206"
                     /note="similar to uniprot|P53206 Saccharomyces cerevisiae
                     YGR012w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446351.1"
                     /db_xref="GeneID:2887777"
                     /db_xref="GOA:Q6FTU3"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU3"
                     /translation="MDSKWGRVIGGVVLSCGALYTAYTVIQRRYETEAKVYDGMQELI
                     GNTPMVKLKSLCDTDRNINVYAKLEMNNPGGSAKDRIALNIIQVAEAEGRLVRGEPGM
                     VFEGTSGSTGISLAMICNALGYKAHISLPDDTSLEKLNLLKSLGAIINPVKPASIVDP
                     DQYVNAAKKACDDYLESGKTKYAIFSDQFENEHNWEIHYRTTGPEIYKQLKGKVNCFI
                     SGCGTGGTISGVSKYLKERIRPYVVLADPQGSGFYNRINYGVMYDSVEKEGTRRRHQV
                     DTIVEGIGLNRLTFNFLKGEKYIDESIRVTDPQAIKMAKFLSINEGLFIGSSTAINAV
                     AALELIRRNDQAILPNDSNIVIIACDSGSRHLSKFWKEALQVPDTVTLNEILASK"
     gene            <869467..>871308
                     /locus_tag="CAGL0F08811g"
                     /db_xref="GeneID:2887569"
     mRNA            <869467..>871308
                     /locus_tag="CAGL0F08811g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446352.1"
                     /db_xref="GeneID:2887569"
     CDS             869467..871308
                     /locus_tag="CAGL0F08811g"
                     /inference="similar to AA sequence:UniProtKB:P53207"
                     /note="similar to uniprot|P53207 Saccharomyces cerevisiae
                     YGR013w SNU71 associated with U1 snRNP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446352.1"
                     /db_xref="GeneID:2887569"
                     /db_xref="GOA:Q6FTU2"
                     /db_xref="InterPro:IPR002483"
                     /translation="MLEDALVPDDKLIYVSPENLYYCYANDTIDQDDKWTSIQPQQGY
                     IPILSANLRAYKIELLKKLRFSGQNNVSPSIKKEKKNLEPNKKITTKPTESTGSKKYL
                     IPEQFIPDSLEKQLRTLTVILKDALYLGKNNRFIKENEVVSDDTRLLILDEFLKLIIP
                     NYIDSLANWTLVDLNKGTDDESLLYLRFNESGTQSMISFYKKHSKMAKYMEIHYDTNT
                     EKYINDNFKDDGDEDNVEAEQSHSVGEILKSMETAFEKARSQVGTFKGDINDDQDDKI
                     NYKIDYNTLLDIPSDSLEQLTKEILNFRTKVIDIEKQKQLRQQYEDNERRQKHMTQLF
                     EKLRKGTKSNDSNRNMDIESTDTINDSDSEEDDDEEDEDDLAIEKRKEEKRKEEEARK
                     YRALLKDYETTIEPHLHLLSQQYKQNLEYEKELAANREANVKDLLRQANDIYYDKDRS
                     FKDREEQEDKLDREKYGDIIIEDIVIDDDRKGQKKLLEKDKKVKKAGEPAIKINLAFK
                     KAMDNSIQDKRDKAEDIEPVSQPIEARSTNRYAALKEKRVVDELVKELLGVYEDDVVA
                     YVFEILEKPEMSDEKKQSELVTEMEDLFDKEGAVQFAEQVFKALDEA"
     gene            <873849..>876659
                     /locus_tag="CAGL0F08833g"
                     /db_xref="GeneID:2887570"
     mRNA            <873849..>876659
                     /locus_tag="CAGL0F08833g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446353.1"
                     /db_xref="GeneID:2887570"
     CDS             873849..876659
                     /locus_tag="CAGL0F08833g"
                     /note="weakly similar to uniprot|P32334 Saccharomyces
                     cerevisiae YGR014w MSB2 multicopy suppressor of a CDC24
                     bud emergence defect"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446353.1"
                     /db_xref="GeneID:2887570"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU1"
                     /translation="MKTAVLLSLLSAALAAPVANRFDDAINNYQNNADLGLASNSTNS
                     DNANANANANANSGNIDVDANKVSSYLNSIASKAFVTTKSSKSNDYDDTYNSKFSTID
                     LSSSKSSDKNDFDWLSSSVVQSTPSISSIYSSNAYDTQIPSQVVSSNDFQLNSEIVSS
                     VPSAEQISSDTISSVPSAEQISSDTISSVPSAEQIPSNVISVPSSIDSSFSVTPLSSS
                     SSSSEEPTQYPISSSISSQIEQSSVIPSPVESVSSQIESDSSSSISDYLSSSTPTPIP
                     SPPAESTERSELESSISISIPPIVPPTTSSEIVSSLEPSSVPFQSSSEDNTSTYISSQ
                     AQVVPSSVESIEPSSVPSEVPISTTTTSSPSQISSEYLSPTPSIFESPISQESTISSG
                     SSFVESVISSELPKPPQPIISSDTSTESSILPQPSPSSVESNTISFPSSAVVTTTPQP
                     PPVVESSESPLASSSSSSQIIVSSVDVPPSASVPVASSIPSVSVSSDPVAPSSVIPVD
                     IPSSSSSSPPYVTPSPSTIISVPSPLPIDSSDTITSSQIIPSPEVPSPSSAIPSSSVS
                     QPPIEIPSSSSESSSSSTSSNSNAWIPTSLIIAPTETESESTPTESNDGTQLSSLPKV
                     IYGSAYSESVPEGYSVITIGFKKPLNYPFVVSESKSSAQIMYYLPKLLNANFESIFSD
                     IKTVQLMPLEIQDSGYLSTVALLFFPTSEIQSLSNMVKNTSSSLYSTQYETITQSLSA
                     LIDPRIPVTGLTDTKTNNAGSSSSSSSNSNGRSSNSNQDTEHSSSFGNINSGSLDYIP
                     SSKSASSDGTQSKTKKRIIPIIVGTIAGGMAVIIMLFLFFRYHAMKRREQLNQERLAR
                     LNFERASSCSDDSIERYNNEKQQYSDDVSSLSPSMKINKWMNDNHNVEHSTTTTDVNG
                     SKKIIKISMPIATQNSLGWNDI"
     gene            complement(<876783..>877760)
                     /locus_tag="CAGL0F08855g"
                     /db_xref="GeneID:2887884"
     mRNA            complement(<876783..>877760)
                     /locus_tag="CAGL0F08855g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446354.1"
                     /db_xref="GeneID:2887884"
     CDS             complement(876783..877760)
                     /locus_tag="CAGL0F08855g"
                     /inference="similar to AA sequence:UniProtKB:P53208"
                     /note="similar to uniprot|P53208 Saccharomyces cerevisiae
                     YGR015c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446354.1"
                     /db_xref="GeneID:2887884"
                     /db_xref="GOA:Q6FTU0"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FTU0"
                     /translation="MHKSLHKKGLELRDVVPLAFHHTKPRIRRATPAPWKEKPAIINL
                     HGLFGSHIMFHSLNRPLMKTFETDIYNVDLRNHGNSPRAQPYDYLTLSKDIIQMIRDN
                     IYREQPGRPIYLIGFSLGGKVALLSSLSRQINVKKCISIDLPPYELDKVDDMFMQNFE
                     LLEKIVKREIKVRRSCPSWKTDILTMFRELPVNKCNPNGNNVALYFANGFLTYKPNNE
                     SSSGLENDYLQYAVPLEYMPDIIAEIKKWPSATSLNPMMYHTKSQLPTLFMKGLHSSF
                     IKNDYSLLKTQYPQSSVLEFDCGHTILMDYPKESTEAIIKFLSNNKRVQ"
     gene            <878120..>878704
                     /locus_tag="CAGL0F08877g"
                     /db_xref="GeneID:2887856"
     mRNA            <878120..>878704
                     /locus_tag="CAGL0F08877g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446355.1"
                     /db_xref="GeneID:2887856"
     CDS             878120..878704
                     /locus_tag="CAGL0F08877g"
                     /inference="similar to AA sequence:UniProtKB:P53209"
                     /note="similar to uniprot|P53209 Saccharomyces cerevisiae
                     YGR016w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446355.1"
                     /db_xref="GeneID:2887856"
                     /db_xref="GOA:Q6FTT9"
                     /db_xref="InterPro:IPR016564"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT9"
                     /translation="MSRIRRFNRKVLGYETDLMTEFDSLGGSDGIIIPEGPIDIIEQE
                     ELIEKFEVNLLVKNRWYINAVSLAYIICAGVYLMLLTKRTKMSSIPLILGFNSIILSF
                     LALRYHLVNDYVLLRSLKLKLTNRTIDILNITQLIMIEWIVIDDYRSDTLILVFLHLP
                     VLLFLVQALIKLLLSEIDSDLSQLRDLKYNYKNA"
     gene            complement(878909..879028)
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0F08899r"
                     /db_xref="GeneID:2887840"
     tRNA            complement(join(878909..878953,878990..879028))
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0F08899r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2887840"
     gene            <879436..>880137
                     /locus_tag="CAGL0F08943g"
                     /db_xref="GeneID:2887851"
     mRNA            <879436..>880137
                     /locus_tag="CAGL0F08943g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446356.1"
                     /db_xref="GeneID:2887851"
     CDS             879436..880137
                     /locus_tag="CAGL0F08943g"
                     /inference="similar to AA sequence:UniProtKB:P38771"
                     /note="similar to uniprot|P38771 Saccharomyces cerevisiae
                     YHR038w FIL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446356.1"
                     /db_xref="GeneID:2887851"
                     /db_xref="GOA:Q6FTT8"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /translation="MLALRTSVGLTKNLFTRRLHISPVLLKKKPSHKGKGGPVEDEEI
                     DIVNPSIYVDELVSKFDKSLELYSKELTDKRKGSVNANIFDNLSLKNGALFKEMASTT
                     LKGKGSLLVTVFDPNEVKNIVSAILASGQNLNPERVPTNNQQLKIPLPPPTAESRQNL
                     CKELKTVFEKYKQSPSKNSLGHIRNEVMKKLKSLQKKDESVKKIIQNVEKVHKDYVTK
                     LSEQLKQAEKSVMGQ"
     gene            complement(<880296..>882215)
                     /locus_tag="CAGL0F08965g"
                     /db_xref="GeneID:2887853"
     mRNA            complement(<880296..>882215)
                     /locus_tag="CAGL0F08965g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446357.1"
                     /db_xref="GeneID:2887853"
     CDS             complement(880296..882215)
                     /locus_tag="CAGL0F08965g"
                     /note="highly similar to uniprot|P38694 Saccharomyces
                     cerevisiae YHR039c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446357.1"
                     /db_xref="GeneID:2887853"
                     /db_xref="GOA:Q6FTT7"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT7"
                     /translation="MQDNIYLNSDMVQKLNHTIQEYVRDILRNQSIINEDVVADPRIV
                     MGTSMVATIFTLYVGYKLLLCSSGYKYKARKFNVSTPEEVQPNWKGKRLNPPKLVDDS
                     KPRHIQSYCPATGQYLGEFKSMTADEIDELVGNANAAQMKWAESSIAKRLEVLATLQK
                     FILENQDLIAKVACRDSGKTMLDASMGEILVTLEKIQWILKHGPSTLEPSRRPGPTNF
                     FMKFYKGAEVRYEPLGVISSIVSWNYPFHNLMGPIIASIFTGNAIIVKCSEQVVWSSE
                     FFIEMVRKCLDVCDVDSNIVQLCYCLPPTKDDDAANHFTSHPGIKHITFIGSQSVASH
                     ILNCASKSLTPVVVELGGKDAFIVLDSVKDLDALSSIILRGTFQSSGQNCIGIERVIV
                     SEKNYDQLVNILEKRMKETPLRQGSDIDHLEVVDMGAMISDNRFKTLEALIQDAVSKG
                     ARLLYGGSQYNHPKYPQGHYFQPTLLVDVTPDMDIAQNEVFGPVLVMMKAKDTSNCIE
                     LANAAPFGLGGSVFGSDYSECNFVANKLKTGNVAINDFATFYVCQLPFGGINGSGYGK
                     FGGEEGLLGLCNAKSVCFDTLPFISTQIPKPLDYPIQSNDKAWRFVKSFITGSYAMTT
                     WQRIKALVSLAKNAN"
     gene            complement(<882851..>883596)
                     /locus_tag="CAGL0F08987g"
                     /db_xref="GeneID:2887901"
     mRNA            complement(join(<882851..883192,883594..>883596))
                     /locus_tag="CAGL0F08987g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446358.1"
                     /db_xref="GeneID:2887901"
     CDS             complement(join(882851..883192,883594..883596))
                     /locus_tag="CAGL0F08987g"
                     /inference="similar to AA sequence:UniProtKB:P48836"
                     /note="similar to uniprot|P48836 Saccharomyces cerevisiae
                     YHR039ca VMA10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446358.1"
                     /db_xref="GeneID:2887901"
                     /db_xref="GOA:Q6FTT6"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT6"
                     /translation="MSQKNGIATLLKAEKEAHEIVTEARKYRQEKIKQAKLDASKEIE
                     NYKAKKEQELKDFESNNAGGVQELEKKADAEVQSELDEIKKTVESKKKQVVDLLLEAV
                     TKPTTEVHINAN"
     gene            <883964..>885076
                     /locus_tag="CAGL0F09009g"
                     /db_xref="GeneID:2887603"
     mRNA            <883964..>885076
                     /locus_tag="CAGL0F09009g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446359.1"
                     /db_xref="GeneID:2887603"
     CDS             883964..885076
                     /locus_tag="CAGL0F09009g"
                     /inference="similar to AA sequence:UniProtKB:P38772"
                     /note="similar to uniprot|P38772 Saccharomyces cerevisiae
                     YHR040w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446359.1"
                     /db_xref="GeneID:2887603"
                     /db_xref="GOA:Q6FTT5"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT5"
                     /translation="MGLCEVCNVEEFKYKCPRCFKKTCSLACSKQHKADESCSGKSHD
                     PTAYIPRTDIKEADDENHESNILVQRDYNYLINMRREVEVQIDDSKRKNKRILREIYD
                     PYMANKRQRGNSDNSSRLIRRGVSCLMLPKGMQRSLQNKSKWDNSLNQFTWTIEWVLC
                     GDGDTVTHLTHRAKENESVVEGISKIVFNKIQTFYKIENGDGDETQAVLSREDRIALI
                     KDYNLEFYIKWFPYNSTEMSDSRNLIRIDAVNSTLGDVFKNRTVIEFPTIYITKSAQE
                     LPKGFKVMIEEKGSAPGAEENSRVNVAGSGSSSDTETDDSDAEPEEESSKQDNTQNKN
                     VVVENVSEATATVDKDTSDEEDDDYNPGVSLDFLMS"
     gene            complement(<885518..>886855)
                     /locus_tag="CAGL0F09031g"
                     /db_xref="GeneID:2887760"
     mRNA            complement(join(<885518..886289,886842..>886855))
                     /locus_tag="CAGL0F09031g"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_446360.1"
                     /db_xref="GeneID:2887760"
     CDS             complement(join(885518..886289,886842..886855))
                     /locus_tag="CAGL0F09031g"
                     /note="highly similar to uniprot|P05753 Saccharomyces
                     cerevisiae YJR145c RPS7B or uniprot|P05753 Saccharomyces
                     cerevisiae YHR203c RPS7A"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_446360.1"
                     /db_xref="GeneID:2887760"
                     /db_xref="GOA:Q6FTT4"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT4"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAIMMQRHVKVDGKVRTDATYPAGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTDDGRTIRYPDPNIKVNDTV
                     KVDLASGKITDYIKFDIGKLVYITGGRNLGRIGTIVHKERHDGGFDLVHVKDSLDNTF
                     VTRLNNVFVIGEQGKPYISLPKGKGIKLTIAEERDRRRAQQGL"
     gene            <888804..>891233
                     /locus_tag="CAGL0F09053g"
                     /db_xref="GeneID:2887848"
     mRNA            <888804..>891233
                     /locus_tag="CAGL0F09053g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446361.1"
                     /db_xref="GeneID:2887848"
     CDS             888804..891233
                     /locus_tag="CAGL0F09053g"
                     /inference="similar to AA sequence:UniProtKB:P38888"
                     /note="similar to uniprot|P38888 Saccharomyces cerevisiae
                     YHR204w HTM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446361.1"
                     /db_xref="GeneID:2887848"
                     /db_xref="GOA:Q6FTT3"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT3"
                     /translation="MLITVLWLCTLCVVLARPELNYKERTFTKWELDEYKAEVKELIY
                     FGLDEYLGKGFPYDEIRPISCKPKTRNFKDLYDTGTNDVLGNFTTTLIDSLTTVAVLG
                     DRDRFKSLVDLVDSTYPNGFDMDSTVQVFETTIRIIGGLLSSHLYATDPSKKVYLGKK
                     DYNGCLLKLAKDMGDRLLPSYLTKTGLPVPRINLKYKFHGITPDLVNENNAAALSCPM
                     FEFTLLSYLTHDAKYEEITKYAFKKTWDLRSEIGLVPMSFNPQYSYSFGGVTGIGASI
                     DSFYEYALKGSILFDDNYLLDVWHSSYDAIRTHAKEDWYFNTIGTRDGHKATNWVDSL
                     SAFFPGLQVLAGNIEDSVYQHMLFLKLWDTFGGIPERWMMDGIYSFRPLELPWYPLRP
                     EFVESTYFLYRATKDPFYLNVGYRILQDFKFRFKKECGFGGMQDLISGEPQDRMETFV
                     LSETLKYLYLLFDEENEIHADRGNIIFSTEAHPMWITYEMKRDYNEKKFFTDKTYLEH
                     LEEVQLFDWDKKLRDNNEKNKELLNKYADVLKRINKFRNKTKEELSGLMKEKKEELEE
                     NGIVESHNAEIGHSQFKDVCKVSKYRQNDAGFSFSNIMSSFKRISEPERIFNTTLIKP
                     NYLDDYAPFEFDKQFYDRWCPRNASSSLAATTLPFDIVLELPGQYELYQYPNGTVNAM
                     KLGNKRKLRLERITRGDIDVYGEFVSDADFSGVNWDLVRQGNAKYENGTALKNNKSLY
                     RVVKIDGVVIPRKQMLFVNSTLFKEVVSFEELYEDPEILHKRDILRAFGVNKDGYLIF
                     NDTVVSNCKII"
     gene            <894761..>897001
                     /locus_tag="CAGL0F09075g"
                     /db_xref="GeneID:2887850"
     mRNA            <894761..>897001
                     /locus_tag="CAGL0F09075g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446362.1"
                     /db_xref="GeneID:2887850"
     CDS             894761..897001
                     /locus_tag="CAGL0F09075g"
                     /inference="similar to AA sequence:UniProtKB:P11792"
                     /note="similar to uniprot|P11792 Saccharomyces cerevisiae
                     YHR205w SCH9 serine/threonine protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446362.1"
                     /db_xref="GeneID:2887850"
                     /db_xref="GOA:Q6FTT2"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT2"
                     /translation="MNFFGSKSHHPSSQGSSNSNSSSNGNKHALGSAGNGFFPSFTSQ
                     TATPTTAVSSSSYAMGTTGVASEDVISRMKAMNEPAKTSTQGNNVNQKIVIGVNDKPA
                     IITTGPEEQSTRDEQKHGSEPQFRTDTHLTPSPVQLEQSSSSRTDSSSSGENDIPRGK
                     LEVTIIEARGLSTISENSLPYVVCTFESSEFISDGPESVENNGSYVNNHGGLSSIREQ
                     LRKRPLYTHRSSSQLNKLTSRQNNFDSEVVSSGLNPIWHHKATFDVLGSHSELDISVY
                     DSNHEDMFLGQVRLRPNIHTTSNMSHEQWYPLQSRVMDEKITGEILVKWHYTLTKKRH
                     YGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLSKKVIVKKNEIAHTIGERNIL
                     VTTSSKASPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQREGRFTEDRAKFYIAEL
                     VLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSKADLKDRTNTFCGTTEYLAP
                     ELLLDESGYTKMVDFWSLGVLIFEMCCGWSPFYAEDNQKMYQKIAFGKVKFPRDILSP
                     EGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWELLKQKKIPPPFKPHLVSET
                     DTSNFDPEFTQTSTSYMNKHHQMAATPLSPGMQAKFAGFTFVDESAIDERFNANNSNR
                     RFLQSSSFMEPGSFIPGNPNLPPDEDVIEDQDDDDFENVKNPRDLDFDGDQHMDDEFV
                     SGRFEI"
     gene            <898706..>900598
                     /locus_tag="CAGL0F09097g"
                     /db_xref="GeneID:2887693"
     mRNA            <898706..>900598
                     /locus_tag="CAGL0F09097g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446363.1"
                     /db_xref="GeneID:2887693"
     CDS             898706..900598
                     /locus_tag="CAGL0F09097g"
                     /inference="similar to AA sequence:UniProtKB:P38889"
                     /note="similar to uniprot|P38889 Saccharomyces cerevisiae
                     YHR206w SKN7 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446363.1"
                     /db_xref="GeneID:2887693"
                     /db_xref="GOA:Q6FTT1"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6FTT1"
                     /translation="MDYEVNANQIPVLGIEQGLIPDNLDGSVKADTATSTAMNMNDKS
                     EISNDGSHSIHTSNPNNNGENGKNGGKPASNDFVRKLFNILESNQYSNIVRWSNTGDS
                     FVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYDFHKIKRTNEERQKSIYGEQSWEFE
                     NPNFKINDEKSLDLIKRKTPAQRKVMLEDASAPSQKTPELLSVQSENKLKSALLSNTV
                     KKDIFNNLRKRVDKMQKDMDTVMMDNYNLKSDYQKLATKYNTLLDSLITFRTVNENLI
                     NNFNALCNVLSSKGVELPSSVYENMNINIPVPSGQSPVNISPSPSLGIPIKNSTMSPS
                     LPSMKSLQNTPSLTGKLSTNQRLDLPPNSQGILSDTNVGQTESPEIQMPISSNSSSTT
                     KEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGCTVQVVTDGLSAISNLEKFRYD
                     LVLMDIVMPNLDGATATSIVRSFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFT
                     RNDLHSILIRHLKDRIPLCDQNRGSGITSESPNLPPTQHIISSQQNNEQNSSLPQSLP
                     PIHPPNHQSPLFNNRASNITPLAPLNSAMSPQSPSHLERPLTNRSPLGMTPLNDGQPA
                     FKKQHT"
     gene            complement(<900830..>902377)
                     /locus_tag="CAGL0F09119g"
                     /db_xref="GeneID:2887694"
     mRNA            complement(<900830..>902377)
                     /locus_tag="CAGL0F09119g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446364.1"
                     /db_xref="GeneID:2887694"
     CDS             complement(900830..902377)
                     /locus_tag="CAGL0F09119g"
                     /inference="similar to AA sequence:UniProtKB:P38890"
                     /note="similar to uniprot|P38890 Saccharomyces cerevisiae
                     YHR207c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446364.1"
                     /db_xref="GeneID:2887694"
                     /db_xref="GOA:Q6FTT0"
                     /db_xref="InterPro:IPR001214"
                     /translation="MSVSQLKIQTLTLNDSEPSLPGKPITPSKEQIRDDVVLLWKEEP
                     AAEDLDLPHLYDKMKIRNTDWQFDINTLEDVLVSNNLYSVDDSQMDSYNDKIEFPDIS
                     EVMHLVNDKLPSKVEIRECEELRKGRGLYATRDIQQGELLFHEKVPIAMVPPMDKLKL
                     IRSGKSCSMCGVSLSNSSHFTMLHGLDCNGCNSIWCSTNCKQKDITHPYLKHFGSKNK
                     NIRPMDWNMFERHCQENIFVAAYSIGVIHAASLIDKAQSDEINQQFEALAKISQRVRY
                     ESSDSNNIGGTFDAEIGSLKEENPEPLWKKAFDLFIRTFPDTAEMGYEVFLEYLGRFH
                     INQLSGQLYFLYSFLNHNCEPNVRYDINNKLELKVYARKFIKKDEELVTTYVNPLHGV
                     SLRRRELRVNWGFICNCDRCAKEIELRKKNAVSIRETVLNSNSSSEVSLRSGLNVTSP
                     IALQRSNGGSSSDLRRKSSIRNRKPDLKEMLKNSKEFELEAPAALGRNRSTSVRFDDI
                     VSMAVEE"
     gene            complement(<904239..>904448)
                     /locus_tag="CAGL0F09141g"
                     /db_xref="GeneID:2887852"
     mRNA            complement(<904239..>904448)
                     /locus_tag="CAGL0F09141g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446365.1"
                     /db_xref="GeneID:2887852"
     CDS             complement(904239..904448)
                     /locus_tag="CAGL0F09141g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446365.1"
                     /db_xref="GeneID:2887852"
                     /db_xref="GOA:Q6FTS9"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS9"
                     /translation="MKNADCRLFTFYCLNPTPFLTHYFRYQFKNSPNSRTLLLTQECL
                     GTLFKDSPKNLLSHVTLVKGSNTKS"
     gene            <904652..>905410
                     /locus_tag="CAGL0F09163g"
                     /db_xref="GeneID:2887823"
     mRNA            <904652..>905410
                     /locus_tag="CAGL0F09163g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446366.1"
                     /db_xref="GeneID:2887823"
     CDS             904652..905410
                     /locus_tag="CAGL0F09163g"
                     /inference="similar to AA sequence:UniProtKB:P40098"
                     /note="similar to uniprot|P40098 Saccharomyces cerevisiae
                     YER182w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446366.1"
                     /db_xref="GeneID:2887823"
                     /db_xref="GOA:Q6FTS8"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS8"
                     /translation="MILSSIRATGRALPRNLSIKHITRGRLSSSMPEFTINKTRKSPK
                     WVPITIFGATFGMGWFFTQHMTFTDLMAYWRYDSLPEDAQEVKDYKLQLYNKCEKLPV
                     VKQLGKAGYVEIFPPRRKEDLLIDRALSTPGGIAIPPRFFFNPTTKETVGIYHLGMKL
                     TGYPFIVHGGILATIMEDLMRESVKLITQKTDEKINDLSISYKFPTLANQFVIVRTTQ
                     HETFGKNIKLTAEVMDQTGNRTLIKGRGSFSASK"
     gene            complement(<905569..>906258)
                     /locus_tag="CAGL0F09185g"
                     /db_xref="GeneID:2887631"
     mRNA            complement(<905569..>906258)
                     /locus_tag="CAGL0F09185g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446367.1"
                     /db_xref="GeneID:2887631"
     CDS             complement(905569..906258)
                     /locus_tag="CAGL0F09185g"
                     /inference="similar to AA sequence:UniProtKB:P40099"
                     /note="similar to uniprot|P40099 Saccharomyces cerevisiae
                     YER183c FAU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446367.1"
                     /db_xref="GeneID:2887631"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS7"
                     /translation="MNEMLAVKQQLRKHMGQTLGKISREEIISQSECIRDNLMPILEG
                     KQNVACYMSMDTGELDTGNIIESLFEAGKKVYLPRCTHTKLTGHVQLRNDSKNPGNMK
                     DHPHLTFHEMDSHDHVLSLSPKGKYNLKEPDIEDEKLSPLPPMLDAILVPGVAFTSGC
                     SRLGHGAGYYDDFFSRYKLQHSNQLPLLIGIALKQQIVEDIPMDAHDYFLDCILVGDG
                     SIHWRNKPITM"
     gene            <906883..>908070
                     /locus_tag="CAGL0F09207g"
                     /db_xref="GeneID:2887857"
     mRNA            <906883..>908070
                     /locus_tag="CAGL0F09207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446368.1"
                     /db_xref="GeneID:2887857"
     CDS             906883..908070
                     /locus_tag="CAGL0F09207g"
                     /note="highly similar to uniprot|P38891 Saccharomyces
                     cerevisiae YHR208w TWT1 or uniprot|P47176 Saccharomyces
                     cerevisiae YJR148w TWT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446368.1"
                     /db_xref="GeneID:2887857"
                     /db_xref="GOA:Q6FTS6"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS6"
                     /translation="MMLNSRLAFASISRNFGLARRSIASLDASKLKVTKKTPPSQPRP
                     NDELVFGQTFTDHMLTIEWTKEKGWDIPEIKPYGNLTLDPSSCVFHYAFELFEGLKAY
                     RTPDNKITMFRPDMNMIRMNKSAARICLPTFDSEELIKLMGKLIEQDKHLVPTGTGYS
                     LYIRPTLIGTTNGLGVGTPDRALLFVITSPVGPYYKTGFKAVRLEATDYATRAWPGGV
                     GDKKLGANYAPCILPQLQAAERGYQQNLWLFGPEKHVTEVGTMNVFFAFKNSVTGKKE
                     LVTAPLDGTILEGVTRDSILTLTRQNLDPNEWEINERYYSINEVAERAAKGELLEAFG
                     AGTAAVVSPIKAIGWQGKDIDVPLIPGEQSGPITKQVAQWIADIQYGRVKHGNWSRVV
                     AQL"
     gene            complement(<908186..>910693)
                     /locus_tag="CAGL0F09229g"
                     /db_xref="GeneID:2887909"
     mRNA            complement(<908186..>910693)
                     /locus_tag="CAGL0F09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446369.1"
                     /db_xref="GeneID:2887909"
     CDS             complement(908186..910693)
                     /locus_tag="CAGL0F09229g"
                     /note="weakly similar to uniprot|P39961 Saccharomyces
                     cerevisiae YER184c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446369.1"
                     /db_xref="GeneID:2887909"
                     /db_xref="GOA:Q6FTS5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS5"
                     /translation="MAPPLAKKAKLAGKDRVIRACDVCRKRKVKCDGDQPCSSCMTAS
                     TVCIYNGVAFPHVKSFYHRDNDLYRELRLLYKSAKALSRNEKIKASGQLCKTLTEIEN
                     SISNLQSQVDLDINDETIADYDGEGSLERQFIETSTVRLNRFSNVDMTKNNVPNITPY
                     FGIYSTLAIFSKYGFSWMFKKLMSYSNNTSTRETMYIYMKFLDMAQLHYEEDINQKTT
                     PIEWCFDKYAVNCDCKTLDGLFAILNIQVNPTKNDDILTKDVYEELARRPIEFFSKLI
                     EYAWETCYLYYTGVGQSFQMSSKIFELEDIMTCLALEFSSKILYADMHHEIIIPATLR
                     WVRICHWHEELYTVGKFLACAIRRALDLGLNSWEYYISLPEVAAEKNRLIWWECYWWD
                     KWFSLSAGKSPLIDDAKITCLLPRRLMESGLDESMTCLEMMERCNFRHMSESEIRIFG
                     YIMLGKYIEYINSEILFKKEYTDYRLFASVKKPIDVTINKFYDEYRSAIDLLNKMENF
                     FVSLTGVDVDTDELTEFMTYFIETKMKCLIAMGSLIYRLKGVEVSGSELLDKCLKISL
                     TNIYQCSLTGLRRVSNFNSFLIERYLLHINLMILNLMLSIIESPENEPVENILLMCNV
                     VHLLGNANALKNCSNSKNMPLSELICRQSLSLSYICCRVYVQLAVKRNSSISEEEILR
                     VLQRSNPHFATIYNQLNDISSDIFKSLLELNVAGSYQAHLIDHFREMMGDKILQKMKQ
                     LESEVQSSATPSSIEATSTVSSTVHQDHIDTNYKMNGGPAQELQDVTFEALLNSDSFA
                     SVYTDFLESLDLRKPSGNDTMPSLSLDHHADMNNPSL"
     gene            <925942..>926406
                     /locus_tag="CAGL0F09273g"
                     /db_xref="GeneID:2887803"
     mRNA            <925942..>926406
                     /locus_tag="CAGL0F09273g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999496.1"
                     /db_xref="GeneID:2887803"
     CDS             925942..926406
                     /locus_tag="CAGL0F09273g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999542.1"
                     /db_xref="GeneID:2887803"
                     /db_xref="GOA:W0TYL6"
                     /db_xref="UniProtKB/TrEMBL:W0TYL6"
                     /translation="MKSTHQKGQKFCVNNVCASKMRKKQLSSTWIFYIIQLCYHLSLA
                     TSQAVVQSNTIVYGNNPPEYDNGYIVLGGAYLAFQDMTTVAMYDTVKVQKGGALYYLN
                     NGLDGFNIISENHILGFFNFENNGTVVVDDRNSTTAGTWKIDNHLFSYQFLY"
CONTIG      join(CR380952.1:1..927101)
//
DBGET integrated database retrieval system