GenomeNet

Database: RefSeq
Entry: NC_006030
LinkDB: NC_006030
Original site: NC_006030 
LOCUS       NC_006030             992211 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome G complete sequence.
ACCESSION   NC_006030
VERSION     NC_006030.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 992211)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 992211)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380953.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..992211
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="G"
     gene            <14591..>15892
                     /locus_tag="CAGL0G00154g"
                     /db_xref="GeneID:2888412"
     mRNA            <14591..>15892
                     /locus_tag="CAGL0G00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446371.1"
                     /db_xref="GeneID:2888412"
     CDS             14591..15892
                     /locus_tag="CAGL0G00154g"
                     /note="highly similar to uniprot|P32527 Saccharomyces
                     cerevisiae YGR285c ZUO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446371.1"
                     /db_xref="GeneID:2888412"
                     /db_xref="GOA:Q6FTS3"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS3"
                     /translation="MFTLPALTRDITVEVNTSAQKSSAVRRPIEPVGKYFMHHAQRTL
                     RNHTWSEFEKLQAEQNVKKVDESNVDPDEALFDQEIADVSLLTHDPRDWKTADLYAAM
                     GLSKLRFRATENQIIKSHRKQVVKYHPDKQSAHGAGLDQDGFFKIIQKSFETLTDVTK
                     RRQYDSCDFNADVLPPKKGTDYDFYEAWGPVFEAEARFSKKTPVPSLGDAKSTKKEVE
                     AFYSFWHRFDSWRTFEFLDEDVPDDSSNRDHKRYIERKNKAARDKKKTADNARLVKLV
                     ERALSEDPRIKQFKEEEKKEKERKKWEKEAGSRAEAEAKAKAEAEAKAKAEAEAQEAA
                     LAKADKKKAKEAAKAAKKKNKRAIRNLPKESDYFGDSDKASAIDEQVGLIVDSIVDEE
                     LVEIAGKIKASPADGKVVLQEAAKKLSDSGKLPASLLSYFI"
     gene            <16581..>17540
                     /locus_tag="CAGL0G00176g"
                     /db_xref="GeneID:2888426"
     mRNA            <16581..>17540
                     /locus_tag="CAGL0G00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446372.1"
                     /db_xref="GeneID:2888426"
     CDS             16581..17540
                     /locus_tag="CAGL0G00176g"
                     /note="highly similar to uniprot|P53337 Saccharomyces
                     cerevisiae YGR284c ERV29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446372.1"
                     /db_xref="GeneID:2888426"
                     /db_xref="GOA:Q6FTS2"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS2"
                     /translation="MSSYMSHRRAGDAGIPTSRNPQASNFTPMNTTPSYPNIRKFPGQ
                     SSNGFEDLKQKAEKFAEKVEDLTTHPIVHQISPYVPSISRFFIVATFYEDSFRILTQW
                     SDQVFYLHKWKHYPYILVVLFLLIVTICMLGGATLLVLRKHTNYATGVLCGCIIMQAL
                     VYGLFSGSAFVLRNISVIGGLLIAFSDSIVRNKTTFAMLPELNSKDDQTKGYLLLAGR
                     MLIVIMFIAFTFSKSIITILITVVCTVCFAIGYKTKFASIMLGFILTFYNVTLNNYWF
                     YDNSKRDFLKYEFYQNLSIIGGLLLVTNTGAGELSVDSKKRIY"
     gene            <18798..>19724
                     /locus_tag="CAGL0G00220g"
                     /db_xref="GeneID:2888394"
     mRNA            <18798..>19724
                     /locus_tag="CAGL0G00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446374.1"
                     /db_xref="GeneID:2888394"
     CDS             18798..19724
                     /locus_tag="CAGL0G00220g"
                     /note="highly similar to uniprot|P15703 Saccharomyces
                     cerevisiae YGR282c BGL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446374.1"
                     /db_xref="GeneID:2888394"
                     /db_xref="GOA:Q6FTS0"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FTS0"
                     /translation="MRFSTVAALAFGASQVAAIGELAFNLGVKNNDGTCKTTNDYEND
                     LKVLKSYTSTVKVYAASDCNTLENLGPAAEAEGFNIFLGIWPNDEAHFQAEKNALSSF
                     LPNLKSSTIAGFLVGSEALYRDDLTASQLADKINDIRNYVSNIKDSQGNSYSGKQVGT
                     VDSWNVLVAGYNAPVITASDFVMANAFSYWQGQTMQNASYSFFDDIMQALQTIQGVKG
                     STDITFWVGETGWPTDGTNFEASYPSVDNAKQFWKEGICAMRAWGVNVIVFEAFDEDW
                     KPNTSGTSDVEKHWGVWTSGDNLKYSLDCSFN"
     gene            complement(<20428..>24861)
                     /locus_tag="CAGL0G00242g"
                     /db_xref="GeneID:2888393"
     mRNA            complement(<20428..>24861)
                     /locus_tag="CAGL0G00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446375.1"
                     /db_xref="GeneID:2888393"
     CDS             complement(20428..24861)
                     /locus_tag="CAGL0G00242g"
                     /note="highly similar to uniprot|P53049 Saccharomyces
                     cerevisiae YGR281w YOR1 ATP-binding cassette transporter
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446375.1"
                     /db_xref="GeneID:2888393"
                     /db_xref="GOA:Q6FTR9"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR9"
                     /translation="MLRKDSAAAGSGGDSDSYDQEHKRVSTSSESPQGSTAGKAKTAS
                     PVQDYDLDADSDEISILTSGEYRVCRNKPQTYLNSNDIEKVTQSDIYPQKRLFSFLHS
                     KKIPEVPQRDEERKIYPLFHANILSNIFLWWVIPIVKIGYKRTIQPNDLFKMDKRMSI
                     EVMFKDFEDNMDYYFEKARKQYKEKNPDTTPEEVLENATLKKFTVLRALFFTFKKQYS
                     WAVLLAILANCASGFNPMLTKRLIRFVEEKAFYPPLHVNKGVGYAIGACVMLLFNGIL
                     FNHFFHASQVTGIQARSVLIKAAMKKMFKASGYAKHKFPNGKVTSFVTTDLSRLEFAL
                     SFQPFLAGFPAILAICIVQLIVNLGTISLAGVGVFVGGFCISLFAFKWILGLRIAANI
                     FTDQRVTMMREVLSNMKMVKFYAWEDAYEKNIQDIRTKEISRVRRMQMLRNFLIAMAM
                     SLPNIASLITFLSMYKVNNEARENPAKVFSSLSLFQVLSLQMFFLPIAIATGIDMVLG
                     LNRFQELLEAPESSDPFNPDSLINQIHKNEKQLDAESEIALAMKDASFEWEDYELNDA
                     DEEKKKEQLGNKNKKDTNKDNKNQVIVDAIGEEDNERSTSNGEGTKTFTKFSNLNFEI
                     KKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGHMLLCGYPWIQNATVRDNII
                     FGSPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERGITLSGGQKARINLARSVYKN
                     KDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILATHQLSLIEKADRVIVLSTNG
                     SVDIGTVEELKTRNQTLINLLQFSSEKKDDEEEVEGDEYEVTEDPLKLEMSELEKEIT
                     RKSMAKEGLTMTKEERAVNSIGWKVYKEYIDSAVGKWGIIIIPLYGVMIMFTTFCNLF
                     SSVWLSYWTENKFKNRSTSFYMGLYSFFVFGGYLFMNIQFTMLCMMGIMASKWLNLKA
                     VKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTENIRLMMSQFANIIGVCVLCIV
                     YLPWFAIAIPFLLLVFVLIADHYQSAGREIKRLEAIQRSFVYNNLIEVLGGMDTIKAY
                     KSQDRYMTKMDFLINKMNEVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHIS
                     PSAVGVLLTYVLQLPGLLNTVLRALTQTENDMNSAERLVTYATELPQEAAYRKSDYSP
                     PDNWPTNGEVIFEDVSFAYRPGLPTVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALY
                     RLNELTSGRIFIDGIDTFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSL
                     WNSLIRGGAIEKDDLEDIKHQKPDKNGSYNNMHKFHLDQIVEEDGANFSLGERQVLAL
                     TRALVRQSKILILDEATSSVDYETDGKIQTRIATEFQDCTILCIAHRLKTILNYDRIL
                     VLEKGEVAEFDKPEILFNNEKSIFRSMCDRSGITVDDFPKK"
     gene            <26046..>26912
                     /locus_tag="CAGL0G00264g"
                     /db_xref="GeneID:2888416"
     mRNA            <26046..>26912
                     /locus_tag="CAGL0G00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446376.1"
                     /db_xref="GeneID:2888416"
     CDS             26046..26912
                     /locus_tag="CAGL0G00264g"
                     /inference="similar to AA sequence:UniProtKB:P53335"
                     /note="similar to uniprot|P53335 Saccharomyces cerevisiae
                     YGR280c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446376.1"
                     /db_xref="GeneID:2888416"
                     /db_xref="GOA:Q6FTR8"
                     /db_xref="InterPro:IPR000467"
                     /translation="MGLAAVKTRQKFGLDPRNTAWSNDQSRFGHKHLMRFGWQPGQGL
                     GTQPVQSMKTHIKVSIKDDNLGLGAKLKKNKGDKIDEFDNGECAGLDVFQRILGRLNG
                     KETEVNKELEIQRKDKILNGKWGVHFVKGDTLASTWDPKTKKLLSYSQMEKDSSSDEE
                     SDDDEDEKKKHKIEKKEAKKSKKRKRDSESDSESKKKKKSKKDKKEKKSKKDKKNKKE
                     KESKKDKKSKHKKDKKQEIRTASIESSTSATSIPESVSTRLSVRSKWIKQKRAAVMDS
                     KALNEIFMVTGN"
     gene            complement(<27239..>28918)
                     /locus_tag="CAGL0G00286g"
                     /db_xref="GeneID:2888417"
     mRNA            complement(<27239..>28918)
                     /locus_tag="CAGL0G00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446377.1"
                     /db_xref="GeneID:2888417"
     CDS             complement(27239..28918)
                     /locus_tag="CAGL0G00286g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446377.1"
                     /db_xref="GeneID:2888417"
                     /db_xref="GOA:Q6FTR7"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR7"
                     /translation="MQYSLVSFIIAATLLLSSVMADDLPAIEIKGNKFFFSNNGSQFY
                     MKGIAYQADTANVTGGATINDPLADWDTCSRDIPYLQQLATNVIRVYAVNTSLDHSRC
                     MNALNDAGIYVIADLSSPKVSVNRKSPSWDLEIFDRYKSVVDMFANYSNVLGFFAGNE
                     VTNDATNTDASAFVKAAIRDTKSYIKEKGYRGIPVGYSSNDDADTRVDIADYFACGDD
                     AERADFYGINMYEWCGNSTFQKSGYADRTKEFANLSIPLFFSEYGCNEVQPREFTEVQ
                     ALYGPDMTDVWSGGIVYMYFQEANNYGLVSIDGSSVKTLEDFNYYSKEIHSISPSSVN
                     SKTYTPTATSLACPSTNQYWKAATNLPPTPQLDLCECMDAANSCIVQDDVDEDDYQDL
                     FSYLCGKIDCGGITGNGTTGKYGSYSFCSPKEKLNFVLNLYYNAQGGSKSNCDFSGSA
                     TLRSGTTQAGCASALKEIGSVGTNSATDSVTFSGGSTGTSKASATGSNSSKSGSSKSG
                     SSTSSSAKSSSSGKSNKKSNSSSSVQVGLYQLLFSAFITLGAVAGAGFALI"
     gene            <32751..>33875
                     /locus_tag="CAGL0G00308g"
                     /db_xref="GeneID:2888414"
     mRNA            <32751..>33875
                     /locus_tag="CAGL0G00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446378.1"
                     /db_xref="GeneID:2888414"
     CDS             32751..33875
                     /locus_tag="CAGL0G00308g"
                     /inference="similar to AA sequence:UniProtKB:P53334"
                     /note="similar to uniprot|P53334 Saccharomyces cerevisiae
                     YGR279c SCW4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446378.1"
                     /db_xref="GeneID:2888414"
                     /db_xref="GOA:Q6FTR6"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR6"
                     /translation="MKFSTLITSALLGTAIAAPHAAHTHKEKRDVVTKTMHAVQTVVV
                     GPDGTPVQKAEAINEQVVENAPQPTTQQQQQQQQQASPAPAKSTTELAPASSPASSSS
                     SSSSSNTKKPDTQVGGAGVKGITYTPYNADGTCKDASAVASDLAALSQYPTIRLYGTD
                     CNQVENVFKAKASGQKLFLGVFDVSNIQGSVDAIKSAVNTYGSWDDVTTVSIGNELVN
                     GGQASPAQVGQYVAAGRAALQAAGFNGPVVSVDTFIAVINNPELCQYSEYMAVNAHAY
                     FDQYTKAQDAGSWLLQQIQRVWTACDGKKEVVITESGWPSKGQTLGVAVPSKQNQKDA
                     VNSITAACGADTFLYNAFNDYWKADGPYGCEKYWGVLSDE"
     gene            complement(<34662..>35606)
                     /locus_tag="CAGL0G00330g"
                     /db_xref="GeneID:2888218"
     mRNA            complement(<34662..>35606)
                     /locus_tag="CAGL0G00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446379.1"
                     /db_xref="GeneID:2888218"
     CDS             complement(34662..35606)
                     /locus_tag="CAGL0G00330g"
                     /note="some similarities with uniprot|P53333 Saccharomyces
                     cerevisiae YGR278w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446379.1"
                     /db_xref="GeneID:2888218"
                     /db_xref="GOA:Q6FTR5"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR5"
                     /translation="MNTETKVEDLTASDDIEFKKKFYLILKSSLSGDEAAHKVLAERV
                     SDDAKSKVVDIIVRSSIQEPTYSKFYGLLSERLCATHSSWVEGYKHVLLDNYTNMNTF
                     EPAQLRIIGKLWGHIFAADYLGFELFENFRMNEEDSSPATRIFLKFLFQELVAELGIN
                     ELQARLNEDYIKPFLKNLFPEEDLDDMRYSINYFTSIGLGVLTKRMRDDVSSIEEQEK
                     KVREAERLKEEESRPEGPSDTWRSRKPLPSQENKYSKTSAKDRRFSRRDGGNSRKSVG
                     KRSRTPPRSRYNSNTKSDRKPRSRTPPRRRNRSRSPRR"
     gene            <35994..>36869
                     /locus_tag="CAGL0G00352g"
                     /db_xref="GeneID:2888135"
     mRNA            <35994..>36869
                     /locus_tag="CAGL0G00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446380.1"
                     /db_xref="GeneID:2888135"
     CDS             35994..36869
                     /locus_tag="CAGL0G00352g"
                     /inference="similar to AA sequence:UniProtKB:P53332"
                     /note="similar to uniprot|P53332 Saccharomyces cerevisiae
                     YGR277c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446380.1"
                     /db_xref="GeneID:2888135"
                     /db_xref="GOA:Q6FTR4"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR4"
                     /translation="MTKIALVLKDLEEIDYSELQEQVLRKVILPIVNKSSVLDIILLD
                     AFEDSVHLDDVLGRLYSASRDVLVSKGLELQPINVLFGSEWSESEHRKDYIWSYLVTE
                     EGAEITGYKYENHIQYQKLKISHNTIPHGSQPDGNRYKVSALGGTFDHLHDGHKILLS
                     VASYLTSQRLIVGVTDEELLVNKKYQEFLEDFEERCNGVNKFLQLLKPSLKMEVVAIR
                     DVCGPTGTVPEIECLIVSRETIGGGEVVNKTRASKGMSQLDIYVVNVLGGQEDDGWKE
                     KISSTDIRKRLASST"
     gene            <37404..>39386
                     /locus_tag="CAGL0G00374g"
                     /db_xref="GeneID:2888091"
     mRNA            <37404..>39386
                     /locus_tag="CAGL0G00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446381.1"
                     /db_xref="GeneID:2888091"
     CDS             37404..39386
                     /locus_tag="CAGL0G00374g"
                     /note="weakly similar to uniprot|P53331 Saccharomyces
                     cerevisiae YGR276c RNH70 ribonuclease H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446381.1"
                     /db_xref="GeneID:2888091"
                     /db_xref="GOA:Q6FTR3"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR3"
                     /translation="MRDSVMDKQPTERAMEADLSPTKSANTPITNCEDIPIKMINPFL
                     SNDSTTNYTVPKLQVDDNATVNRSVARLSISEVPVVEVENFKAKRMTNTGKRRRSSAA
                     ISAPGSTLRLSSHSDELIADRIKNKGKKKKKRAQKHDGPLSIKVGTEKLASINVMTGL
                     IKYLYDITDEHRWWEEITGKNSLKKNVLLFIPGLEPQDFGLPQDQRFADNVDELATKG
                     LTGLNPFDNQITFPMSAPGSNTAIFSAYNAFINPPLLPKQRRELLSDLSKKTITIYDL
                     LASVDQLLERDYPIHEGTKSLTDIFKSQVIDINNEVNSKATWKNTKEFEHDGSHIFAL
                     DCEMCKCETGFIVARVSLVNFENEVIYDELVIPEAPIVDYVTKYSGMTKEKLDGATKT
                     VEQVQDDLLNIISANDILIGHSLSNDLSVLRIRHPNIVDTAIIYDHQGGPPFKPSLKY
                     LASEYLNKDIQAENGDDGHDSIEDARTCMELTKLKIQRGMAFGSHLRTENIFDLLDAR
                     GIKSLVLNNTVPKSHFKTDSNIGTIFCDNDDEVFNSIINNIEQYDFFVGRLRALEFAR
                     GYAIPKNGVVLNQEDVLKNICEQINNIYEKVPSGSLITILSGSGNTKQWMALMNKINT
                     CNSKEERKQLRKDLNEELKDTIKIARDAVVEIIIKS"
     gene            complement(<39655..>40467)
                     /locus_tag="CAGL0G00396g"
                     /db_xref="GeneID:2888284"
     mRNA            complement(<39655..>40467)
                     /locus_tag="CAGL0G00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446382.1"
                     /db_xref="GeneID:2888284"
     CDS             complement(39655..40467)
                     /locus_tag="CAGL0G00396g"
                     /note="some similarities with uniprot|P53330 Saccharomyces
                     cerevisiae YGR275w RTT102 Regulator of Ty1 Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446382.1"
                     /db_xref="GeneID:2888284"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR2"
                     /translation="MTAESMIHRANKGGYGSSQDENIHYEYDWVRPVKVTENSQGGDG
                     SDPLIGIGSESKESSFYGFKFKTWQKRNGGHPIEKDPVTLLNMDDFDRTKVSEKKKKL
                     GKKLDGDDLSEDAIRGAVGGSDTVFSSSHAKPDTSGGMKRNETETEKQSDSNTQEQST
                     TSVKEEESKNETNDTEVTPESNAIEKDELASKLGDVQTPESGNLSEGQKPSDTQLLEN
                     DIKDETKSEIVEEDGNEVGDPVSEPVNEPVSNTVTPEGENNKEDNDIEMTDA"
     gene            <40916..>44035
                     /locus_tag="CAGL0G00418g"
                     /db_xref="GeneID:2888166"
     mRNA            <40916..>44035
                     /locus_tag="CAGL0G00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446383.1"
                     /db_xref="GeneID:2888166"
     CDS             40916..44035
                     /locus_tag="CAGL0G00418g"
                     /inference="similar to AA sequence:UniProtKB:P46677"
                     /note="similar to uniprot|P46677 Saccharomyces cerevisiae
                     YGR274c TAF145 TFIID subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446383.1"
                     /db_xref="GeneID:2888166"
                     /db_xref="GOA:Q6FTR1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR1"
                     /translation="MKGNSKGKNKDLSNEDDAYNAIFAGDFGSMEIGSYIGKDDEGAT
                     EHLPDAVDFEDEDELADEELPEEEDVVGEFGVTSHNNKDDGYISGYDGGEQDLFEVGP
                     SANGDADVRNHFMSTIPNENSSMVGSDLSNEEYQGQNALFMGIEQNNDSMYMDNTHAF
                     PAPDSGNAERVQQRQQQRLAELVKKEQKTILEKKLLKKYFPTFSKGKILKWNKLIYRK
                     TMDYNWYYKILAQEDLLKPLFPLKLKLHVQPDQRKLFELPENRWNMMSKAKSKEGQRK
                     GIVSVEIEDADLDNLREKNVQAKDNGISDELIIATTDWNEDQIINGHLNDESKSRMSF
                     ETKSYDTPSDWNWNEDDLVNGKLKQANMAELSMNDPNLLLIEDKKRITNINQENKEKQ
                     TYDIQAIMKRFNISNDDKYNILRQAHQTKIRAIISNLNIEHSKPAARLQSPFYKVTAP
                     KSQLRHFHRPNFNSTIRAGTNIVFSKLKLRKRKRDKGKDIKESFATTPDLTVGDTAPI
                     YLMEFSEENPLALSKFGMGNKLINYYRKISEEDTLRPKLPVGETHVLGVQDKSPFWNF
                     GLVEPGHIVPTLYNNMLRAPVFKHEVSGTDFLLVRSTGNGISNRFYLRNINHLFTVGQ
                     TFPVDEIPGPNSRRVTSMKAIRLRMIVYRLLNKASTRSISIDPIAVHFPEAEYGQNRQ
                     KIKEFMKYQREGPDKGLWRLKEGEPLLDGENIKKLLTPEQVAEVEVMGHGIQNQDDNE
                     VFNFDNDLVKLEESLTPWNISKNFINATQMRAMVQIHGAGDPTGCGEGFSFLKTSMKG
                     GFLKSTTSLANLAASSPAPATKKGSSSSGYSYNVAQQQKVYEDEITRTWYTHTKSLSI
                     SNPFEEINDPDEVNETNRYIRNKRKDGRVLRIVRKKRDENGIIQRQTVIIKDPRIIQG
                     YLKRKEKQRKDNLNVDKLLEETDTDIHNIEDIEMQKKILETELANLEKSQQRRARLNL
                     KKSEGKVGKGAKNTSRRCATCGQVGHIRTNKSCPMYYSDNGPGGRNAPGDTPSAATPD
                     VTATPPANI"
     gene            <44599..>46275
                     /locus_tag="CAGL0G00440g"
                     /db_xref="GeneID:2888406"
     mRNA            <44599..>46275
                     /locus_tag="CAGL0G00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446384.1"
                     /db_xref="GeneID:2888406"
     CDS             44599..46275
                     /locus_tag="CAGL0G00440g"
                     /inference="similar to AA sequence:UniProtKB:P25045"
                     /note="similar to uniprot|P25045 Saccharomyces cerevisiae
                     YMR296c LCB1 serine C-palmitoyltransferase subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446384.1"
                     /db_xref="GeneID:2888406"
                     /db_xref="GOA:Q6FTR0"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FTR0"
                     /translation="MDAPRVSISSVLPQYVPVPVFLSTSFAYICFFVNDVSAKIPGGA
                     YVISYIKKSHRDDPYRTAIELGLLIYALVYYFSKPQHKKGLQASKPNLSAQEVEAMIE
                     EWEPEPMVDDSLTEFQNWRLDKIPVMKDSGVETRVTFTRSNGKETFENVLNMSTNNFL
                     QLSKTERVVNTAKTTIKNYGVGACGPAGFYGNQDVHYHLEYELAKFFGTDSAVLYGQD
                     FCVAASVIPAFTKRGDILVADNDVSLAVQNALQLSRSTVYYYEHNNMESLENLLAELT
                     EAEKKDKPPAIPRKFIVTEAIFTNTGDIAPLPELTKLKRKYKFRLFVDETLSLGVLGA
                     SGRGLPEHFNMDRARSIDITVGSLANALGSSGGFVLGDHVMSQHQHIGSNAYCFSASL
                     PAYTTTTATETLKMLAEDNSAVQKVHGLSRQLFDFFNNDKDLMAYVQVKSSVHSPILH
                     LELLDDFRMDKFGYNKDQLFQIVSSLQKKCITNKYIEPYENEEKFLQEIVDFVLEKYN
                     ILITRNTIVLKSESVPIVPSLKISCTANMSSSEVEQACHAVKEALLNYCN"
     gene            <46734..>47276
                     /locus_tag="CAGL0G00462g"
                     /db_xref="GeneID:2888265"
     mRNA            <46734..>47276
                     /locus_tag="CAGL0G00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446385.1"
                     /db_xref="GeneID:2888265"
     CDS             46734..47276
                     /locus_tag="CAGL0G00462g"
                     /note="some similarities with uniprot|Q03559 Saccharomyces
                     cerevisiae YMR295c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446385.1"
                     /db_xref="GeneID:2888265"
                     /db_xref="GOA:Q6FTQ9"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ9"
                     /translation="MSKEATIYKGNQTQKDQSKRDKKGKKKLRLKVNDSVLGAVQEAQ
                     PFEEAADQFKKPGAYYGITKNEVINDVFGCQIQDPDRSNPTRKTDERPLDTIRGFQYS
                     ITGDSRILTQLETPIYGFQMRPDFNFNDIATAQKYNQEVHSSEIRKPEIIEYISDEES
                     LESPSKWSWLFLKKPERIHK"
     gene            <47727..>48416
                     /locus_tag="CAGL0G00484g"
                     /db_xref="GeneID:2888404"
     mRNA            <47727..>48416
                     /locus_tag="CAGL0G00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446386.1"
                     /db_xref="GeneID:2888404"
     CDS             47727..48416
                     /locus_tag="CAGL0G00484g"
                     /note="some similarities with uniprot|P53328 Saccharomyces
                     cerevisiae YGR272c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446386.1"
                     /db_xref="GeneID:2888404"
                     /db_xref="GOA:Q6FTQ8"
                     /db_xref="InterPro:IPR019310"
                     /translation="MSGVRMQKKNRRALGQSLEMAQFLDSGSNKIKRRIRDLERLLKK
                     KKDILPSNIIVEKERTLEALRLELHNHEVKENIRKNAKKYHMVRFFERKKALRRYKKA
                     LKTYKADENEANKEALENAEVDLCYVVNFPKSEKYISIFTEDDTEASAETNLRRKAFR
                     QLVRGKIADKSLPVSLSNILAGKKLSEEAIGVTLDDALSRSNQTDASHQESDEDSDSN
                     ENEKEEDDFFE"
     gene            complement(<48535..>54405)
                     /locus_tag="CAGL0G00506g"
                     /db_xref="GeneID:2888244"
     mRNA            complement(<48535..>54405)
                     /locus_tag="CAGL0G00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446387.1"
                     /db_xref="GeneID:2888244"
     CDS             complement(48535..54405)
                     /locus_tag="CAGL0G00506g"
                     /note="highly similar to uniprot|P53327 Saccharomyces
                     cerevisiae YGR271w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446387.1"
                     /db_xref="GeneID:2888244"
                     /db_xref="GOA:Q6FTQ7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ7"
                     /translation="MTTTYSVNSSGSFMNAMQTMNDACVQLKMEDITQMVPAIDNELN
                     KDIKSAGKCKLAVLSQDRNEWDDIFDEFIDPNFDINFLISDKNKSSTKAVYKRLWRLI
                     NSASFSVSYEEFTRSILGITNEYDNGDLEKELLDFLGMENMELISFLVENRSFITSQP
                     TEFVIHELDQTENPNDYLDDGLIAEQIKANEEITKNEKLDPLRKIIKYPHVFRKYEAG
                     SSSLSFGNQKFTLPEGTTRQSYQTYEEICIPAADPIKAKSSLYTKLIQVSSLDKYCRT
                     VFSYETLNQIQSLVYPVAYQTNENMLICAPTGAGKTDIALLTILNTIKQYSEMGPSGD
                     IDIQYDDFKIIYVAPLKALAAEIVDKFSRKLAPFDVMVRELTGDMQLTKAEILSTQVI
                     VTTPEKWDVVTRKSNGDNDLVSKVRLLIIDEVHLLHEERGSVIETLVARTLRQVESSQ
                     SMIRIVGLSATLPNFMDVADFLGVNRQIGMFYFDQSFRPKPLEQQLIGCRGKAGSKQA
                     RENIDRVAYDKLTEMIEKGHQVMVFVHSRKDTVKSARTFISMAQKNNEISLYAPEPSV
                     KDIYSRQLAKNRDKDLKEIFQFGFGVHHAGMSRSDRNLTEKLFKEGAIKVLCCTATLA
                     WGVNLPADCVIIKGTQVYDAKRGGFVDLGISDVIQIFGRAGRPGFGSANGTGILCTSA
                     DRLDSYVSLITQQHPIESRFGAKLVDNLNAEISLGTVTNVEEAIQWLGYTYMFVRMKK
                     NPFTYAIEWDELMSDPQLYDRRRNMIIAAARRLHSLQMIVFDEVSMYFISKDLGKIAS
                     DFYLLNESVEIFNQVSNPRATEADVLSMISMSSEFDGLKFREEEASELTRLAESAAPC
                     QIAGDLESNHGKTNILLQAFISQSKIFDSALSSDSNYVAQNAARICRALFLIGLNRRW
                     GVFTNIMLNVCKSIEKRLWSFDHALCQFDLPENILSQIRNKNPTMDRLLDMDPEELGE
                     LVHNKKMGHKIFSLLSYFPQVEIDSEIFPITSNVMRVHVNLTPTFIWNLRIHGEAQFF
                     WVTVEESNKSQILYFEKFILNRRSMKNDHELDFMIPLSNPLPPQVVVKVVSDTWLGCE
                     STSAISFQHLIRPYNENVLTKLQKLRPLPVSALHNPLLESMYSFKYFNPMQTMTFHTL
                     YNTNDNVFVGSPTGSGKTVVAELAMWHAFKEFPGKKVVYIAPMKALVRERVDDWKKKI
                     TPVTGDKVVELTGDSLPDPRDVRDATIVITTPEKFDGISRNWQTRKFVQEVSLIIMDE
                     IHLLASDRGPILEMIVSRMNYVSTQTKQPVRLLGMSTAVSNAHDMAGWLRVKENGLFN
                     FPSSVRPVPLKMYIDGFTDNLAFCPLMKTMNKPSFMAIKQHSPDKPTLIFVASRRQTR
                     LTALDLIHLCGMESNPRRFLNISDEQELEYYISQVTDDTLKLSLQFGIGLHHAGLVEK
                     DRTISHQLFQQSKIQILIATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDIL
                     QMMGRAGRPAFDTSGTAIVYTKNSKKMFYKHFLNIGFPVESSLHKVLDDHIGAEITSG
                     TITNRQEALNFLSWTFLYRRAHHNPTYYGIEGDLSVENVSKYLSKQIDETLYNLEESG
                     CVELNGEDIIPTPFLSISSYYYISHKTVRTVLRNIHGNASFQDILKWLSLAEEYNELP
                     VRGGEAIMNIEMSAQSRYKVEDTFEGDIEVSMIDPHVKAFLLLQAHLSRVDLPIADYI
                     QDTVSVLDQSLRILQAFIDIASEMGYLATVMTLIKVMQCIKQGCWYEDNPVTLLPGCD
                     IQRFKDIEFRNNGYPTKPIKTKLTLQKLASSKSNEYKPIIRELNVSRDFESKFLNVVK
                     RIPALTNIRVLEQTNPSHLQITAQHVSGVSSRNMEVYCDRFPKTQKELWFCIGYQNEE
                     LLIIKRCQPRKTGKIIELECDLLIPEELYGENLTFTIVNDAMDLQYTVNVQLQEEL"
     gene            complement(<54617..>58570)
                     /locus_tag="CAGL0G00528g"
                     /db_xref="GeneID:2888190"
     mRNA            complement(<54617..>58570)
                     /locus_tag="CAGL0G00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446388.1"
                     /db_xref="GeneID:2888190"
     CDS             complement(54617..58570)
                     /locus_tag="CAGL0G00528g"
                     /inference="similar to AA sequence:UniProtKB:P40340"
                     /note="similar to uniprot|P40340 Saccharomyces cerevisiae
                     YGR270w YTA7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446388.1"
                     /db_xref="GeneID:2888190"
                     /db_xref="GOA:Q6FTQ6"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ6"
                     /translation="MTRNLRHSARVSDANNEILDENGVTHTTGRSLKKINYAEVESGL
                     DFLDEETNSEAPNGDNHDLQEETAKESQLPNEAPNGTKDIFPEDEDVPHTSRRSGRSR
                     RRKVHDPEEEDESFHEEDLSDDLLDDDASDLDDDEDNVYNSSKLRQKRNRRADDQFVV
                     PDPEDEAFTEDGENDEDYGQQTGRRTRGRLTGRSTNSPSKTTNSGRRLRSRTRSTLYN
                     SKENLTENNSEEALSLADEIRELQEDSPIREKRSLRERTKQVDYRIPPPLTNFPVEEY
                     PTATASNIPPYATASPRRGRGGWNASQNAGPNRRLFPTGGPFGGNDVVTIFGQNTNFF
                     GQNNANNPKLILDSDSSEDEILPIGGKSKRKPKNPLRDPKRKKKPEIADLDPLGVDMN
                     IKFDDVGGLDNYIEQLKEMVSLPLLYPEVYQKFNITPPRGVLFHGPPGTGKTLMARAL
                     AASCSSESRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEIDGLAP
                     VRSSKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYF
                     PLPDTNARKTILKIHTKKWSPPLSDELIHRLASLTKGYGGADLRALCTEAALSSIQRT
                     YPQIYRSSGKLLIDTDLIRVNSSDFTRALEKIVPSSNRSVGESSQPLPEPVDQLLDVQ
                     FEGLKSTINDILPDAHMKVSQSKSLIDEYMEYEDFTDDTGSDGFSKVELIKQITNLRT
                     FRPKLLVTSSPGNGLSYIGSAILNFLEKFNVQRLDIPSLVADSTRTIEAAIVQAFIEA
                     RKRQPSIIFIPNFDIWMKTIPSNAIMTLSSLMKSLVSDDKVFLLCLSESLSEQDCYTN
                     DLLASFEFATNIFEIEKPNVKQRTTYLKKTIENIKLPPSAYMLKRKRTEPLAKLPLAI
                     SGDSSNVDAEGKPLSKEELLRRKLKEFQHQDMKLKNVLKIKLSGLMDLFKNRYKRFRK
                     PPIDDAFLVHLFEPQMQNIPNWQPAYVKDESMILEVATGKRFFNMDLDIIEERLWNGF
                     YSEPKQFLKDIECIYRDANTTGDRERIIKASEMYANAQMGIEDISTPEFIAECKATRQ
                     RDIERQELYLEDERKQLVNVSNSTDKSSDTVDVGVAAGSQLQVEKKEIIENEFLPSSG
                     PDLATNSNNEMKQISVAGNECQENSSNEQQPSDLKVDQLASTKDDEYSTLYPASLDNV
                     DEVSTKEDKPSQPLKEDVVSNDAESQSNSISSTQELIETNIRTDRPTNVHVKLSIDED
                     RLNNLYDILIGKTDGFSVSQMEALCSRVTNIIWNHRENIEKNDVFNQIEHIVNML"
     gene            <59768..>60460
                     /locus_tag="CAGL0G00550g"
                     /db_xref="GeneID:2888074"
     mRNA            <59768..>60460
                     /locus_tag="CAGL0G00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446389.1"
                     /db_xref="GeneID:2888074"
     CDS             59768..60460
                     /locus_tag="CAGL0G00550g"
                     /inference="similar to AA sequence:UniProtKB:P40325"
                     /note="similar to uniprot|P40325 Saccharomyces cerevisiae
                     YGR268c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446389.1"
                     /db_xref="GeneID:2888074"
                     /db_xref="GOA:Q6FTQ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ5"
                     /translation="MSGPGEDGLPSYEDVLKEEERLQQNQRPQHGQDLPPSYSRPPQR
                     PPSDTKQRPTEPPRPSSKPSKLPSRPGVKPANTKPAKPAKPASKPTPSVQPKPSNIPW
                     VYPKGYYCEKCRNTGYKIKNGKSCKRCWRQFATRNSATPMGGPTVVTTPNTYYSGLPF
                     GDYLHPFSQPTYQYGAPPMQIGGQAPIYVRPGDPRLGGVVCGECRGTGRVRFFLDEDL
                     CPLCNGVGRIVR"
     misc_feature    60727..60839
                     /note="Centromere Cen0G"
     gene            <61223..>62272
                     /locus_tag="CAGL0G00594g"
                     /db_xref="GeneID:2888099"
     mRNA            <61223..>62272
                     /locus_tag="CAGL0G00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446390.1"
                     /db_xref="GeneID:2888099"
     CDS             61223..62272
                     /locus_tag="CAGL0G00594g"
                     /note="highly similar to uniprot|P53199 Saccharomyces
                     cerevisiae YGL001c ERG26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446390.1"
                     /db_xref="GeneID:2888099"
                     /db_xref="GOA:Q6FTQ4"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ4"
                     /translation="MSEIKSVLLIGGAGFLGLHLIQQFYDVSPRPDIHIFDIRPLPEK
                     ISKQFTFDVNDIKFHKGDLTSSEDIKKAILASKCNVVVHSASPVHGGAAEVYHKVNVT
                     GTRNIIDTSKKCGVKALVYTSSAGVIFNGQDIHNADETWPIPEVPMDAYNETKAIAED
                     MVLKANDPDNDFLTIALRPAGIFGPGDRQLVPGLRTVAKLGQSKFQIGDNNNLFDWTY
                     AGNVADSHVLAAKKLLDPSTAAKVSGETFFITNDTPAYFWALARTVWKADGHVDKRVI
                     VLKRPLAIVAGYLSEWVSKLVGKEPGLTPFRVKIVCAYRYHNIAKAKELLGYYPKVDI
                     EEGIKKTLAWMDEGL"
     gene            62853..62961
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0G00616r"
                     /db_xref="GeneID:2888017"
     tRNA            join(62853..62889,62925..62961)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0G00616r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2888017"
     gene            <63258..>64787
                     /locus_tag="CAGL0G00660g"
                     /db_xref="GeneID:2888018"
     mRNA            <63258..>64787
                     /locus_tag="CAGL0G00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446391.1"
                     /db_xref="GeneID:2888018"
     CDS             63258..64787
                     /locus_tag="CAGL0G00660g"
                     /inference="similar to AA sequence:UniProtKB:P39705"
                     /note="similar to uniprot|P39705 Saccharomyces cerevisiae
                     YAR002w peroxisomal matrix protein import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446391.1"
                     /db_xref="GeneID:2888018"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ3"
                     /translation="MVSHYDRMKRSSIAPYRRSNDSSNRIDKKTGKKGHGLMSKLKDL
                     VSFGWAQEHHKDNDFSARDTGRERTNVSKGSYAAVPGGFFSSDQSSFILRERSRIMNE
                     STMHSEADTSNAKLADFFAKKGNEPLSEIEMEGVLALMQKSRGVADESSFLGNSSRLL
                     GDISNANASQVLRTGNISTSSALNVPNFKPSTDESRNINAKEVENSTIVSTPLKRKNF
                     DYSSIRSPYRTVIYRFDDSNKKKISSVFDKPESSSQEVDETPKPSNSKPLSNTASALV
                     SLLSDKDAAKESIKPMANPYTSHLTALRKSREDLPSINDKITVPKRRQRSETEDKEEA
                     KITSSNGEAQEDTNIPEGIASRKNEEAQDSFTKYKPMRSSSLRDSVSLAHTESNNEKQ
                     MNSPKFVPAPLDKNETKETAKSDLTLTSSDKQSESKPSFSFPVNSTTKSTFMGTKKES
                     TSPAVNSQAVKNVSNNETKEIKPQVHECIYDFGNPTSSGFKKTDIDDTLVSKYRGQFV
                     F"
     gene            complement(<64911..>65561)
                     /locus_tag="CAGL0G00682g"
                     /db_xref="GeneID:2888023"
     mRNA            complement(<64911..>65561)
                     /locus_tag="CAGL0G00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446392.1"
                     /db_xref="GeneID:2888023"
     CDS             complement(64911..65561)
                     /locus_tag="CAGL0G00682g"
                     /inference="similar to AA sequence:UniProtKB:Q05359"
                     /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
                     YAR002ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446392.1"
                     /db_xref="GeneID:2888023"
                     /db_xref="GOA:Q6FTQ2"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ2"
                     /translation="MKLFQLIVGLVFGVHVAHGFYYYSTAGERKCFQKELSKGTVLKG
                     THELQVYIDEIGKYGVPEKDTISVMIDVEEIFDDNHRVVHQKALPSSEFTFVALDSGE
                     HNICLQSQSKGWSYKPKVKIDVNFEVGFASELDSKATTKVKLLHQKVIQLIAQIESIK
                     REQKLMREREVLFRDLSEIVNSRATWWGIITLIVLGATCAWQMKHLGSFFVKQKVL"
     gene            <65805..>67127
                     /locus_tag="CAGL0G00704g"
                     /db_xref="GeneID:2888283"
     mRNA            <65805..>67127
                     /locus_tag="CAGL0G00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446393.1"
                     /db_xref="GeneID:2888283"
     CDS             65805..67127
                     /locus_tag="CAGL0G00704g"
                     /inference="similar to AA sequence:UniProtKB:P39706"
                     /note="similar to uniprot|P39706 Saccharomyces cerevisiae
                     YAR003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446393.1"
                     /db_xref="GeneID:2888283"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ1"
                     /translation="MNLLLQDPFSVLKDYPEKLVHTLENPLNTECLEFSPGGDYLALG
                     CSNGAVIIYDMDTLKPITMLGSKLGGHVQAVNSVSWSGCGRYLITTSRDWFIKLWDLA
                     KPGEPLKEVLMSSSVWSCCWVDESKFTAVATVFEEKDAFYIDFHTELSSPSVLPVVTQ
                     NNEDSSGNKGYVLVALPHPKHRDIIVVGSSKGWLTFYQVKCTSVVEFNIIKEERVAAS
                     NVKHIIISNNGDRLATSSADRTIRQFSMKIGYSEDNENLSIELEQECKYQDVINKLQW
                     NCIFFSNNSAEYLVASAHGSSAHELYIWETGAGTLVRVLEGAEEELMNISWNFNNMCI
                     ACNGFETGSIYIWSIVIPPKWSALAPDFEEVEENVEYDEKEDEFDQVDLDEQRQEMTE
                     AEEVPIDLVTPEQFDVRCNDLSKRYFTIPMDYQHILLLKSSNMMTDDI"
     gene            complement(<67419..>69302)
                     /locus_tag="CAGL0G00726g"
                     /db_xref="GeneID:2888281"
     mRNA            complement(<67419..>69302)
                     /locus_tag="CAGL0G00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446394.1"
                     /db_xref="GeneID:2888281"
     CDS             complement(67419..69302)
                     /locus_tag="CAGL0G00726g"
                     /note="highly similar to uniprot|P22336 Saccharomyces
                     cerevisiae YAR007c RFA1 DNA replication factor A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446394.1"
                     /db_xref="GeneID:2888281"
                     /db_xref="GOA:Q6FTQ0"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:Q6FTQ0"
                     /translation="MSAELTKGDFVAIFTNQQRYQDPANGVYQVINIRKADPSKPNKK
                     FLIMISDGVYHMKALFKADAIPKLHSMNIDRGDIIKTLRVEPLLIKEKKLVLVIEDFD
                     MVQSGAEVVDSNTQFLDSVLANRLNEVIAARKDPNSPFPQQQQQVDSSSNVNGNGTLG
                     MPSSTTAIGNATTSHNNKFNDSASQKSRAIFAIEQLSPYQNVWTIKARVSYKGDIKTW
                     HNQRGEGKLLNVNFLDTSGEIRATAFNDNATAFNEILQEGKVYYVSKARLQPAKPQFT
                     NLSHPYELNLDRETVIEESFDENNVPKTHFNFIKLDNIQSQENNSNVDVLGIIQTVNP
                     HFELTSRAGKKFDRRDIQIVDDSGFAISVGLWNQQALDFNLPEGSVVAIKGVRVSDFG
                     GKSLSMGFNSTLIANPEIPEAYKLKGWYDQQGKDQDFTSLKQDAGAGTTSAANLAKFI
                     SQRITIARAEAENLGKNERGDFFSVKAAISFMKVDNFAYPACSNENCNKKVIEQPDGT
                     WRCEKCDINNPSPRWRYILTISIIDETGNLWLTLFDDQAKQLLGVDANTLMSLKENDP
                     DEFTRTTQNVQMNQYDFRIRAREDNYNDQTRIRYTVANLHKLNFKAEADYLADELTKV
                     FLT"
     gene            <69713..>70570
                     /locus_tag="CAGL0G00748g"
                     /db_xref="GeneID:2888214"
     mRNA            <69713..>70570
                     /locus_tag="CAGL0G00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446395.1"
                     /db_xref="GeneID:2888214"
     CDS             69713..70570
                     /locus_tag="CAGL0G00748g"
                     /inference="similar to AA sequence:UniProtKB:P39707"
                     /note="similar to uniprot|P39707 Saccharomyces cerevisiae
                     YAR008w SE34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446395.1"
                     /db_xref="GeneID:2888214"
                     /db_xref="GOA:Q6FTP9"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="InterPro:IPR016690"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP9"
                     /translation="MENEGTVDGKVKVVISVVLDEDGVPGSGLVFDLESIRYLRELGI
                     AGVLSGTLPSATQQNLFLTVPLRLMIEEVLWLLINNLCEVKIIPANSGDHMASIIKQR
                     KLELADMNKKNMEKMFALQRDYKRALHKQKLEKLGIKEKNTDANEELINSSLFVETPN
                     TSLITPEAIKSHQRDHILDLLKSAFSKYNTYLLYQQLRNQNYVLAPGARFGGKYIAYP
                     GDPLRYHSHLTIQDAIDYYEEPIDLLQLLSGARLGTTVKKLWVFGGVKDKEKNKPVSF
                     YSVEWAGFG"
     gene            70780..70852
                     /locus_tag="CAGL0G00770r"
                     /db_xref="GeneID:2888105"
     tRNA            70780..70852
                     /locus_tag="CAGL0G00770r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (TGC) cove score=76.57"
                     /db_xref="GeneID:2888105"
     gene            <71625..>72122
                     /locus_tag="CAGL0G00792g"
                     /db_xref="GeneID:2887983"
     mRNA            <71625..>72122
                     /locus_tag="CAGL0G00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446396.1"
                     /db_xref="GeneID:2887983"
     CDS             71625..72122
                     /locus_tag="CAGL0G00792g"
                     /inference="similar to AA sequence:UniProtKB:Q02721"
                     /note="similar to uniprot|Q02721 Saccharomyces cerevisiae
                     YLR329w REC102 meiotic recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446396.1"
                     /db_xref="GeneID:2887983"
                     /db_xref="GOA:Q6FTP8"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP8"
                     /translation="MYYNVVASRTSDNCGVEWALKCQIWTPNRAGTLTETSREHSIGA
                     NIFPSVRCLEELNISVQLHTNIRKLSDIKSHFCSHFNEYFISILVSQLEFRFPLVFSY
                     PARTRLRVQEPNIAPISYALSNSSALMLDLVSIMEKQPTNTTIYQLITYRKDNEVYKL
                     YPLDI"
     gene            <72451..>74199
                     /locus_tag="CAGL0G00814g"
                     /db_xref="GeneID:2888154"
     mRNA            <72451..>74199
                     /locus_tag="CAGL0G00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446397.1"
                     /db_xref="GeneID:2888154"
     CDS             72451..74199
                     /locus_tag="CAGL0G00814g"
                     /inference="similar to AA sequence:UniProtKB:Q12114"
                     /note="similar to uniprot|Q12114 Saccharomyces cerevisiae
                     YLR330w CHS5 chitin synthesis protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446397.1"
                     /db_xref="GeneID:2888154"
                     /db_xref="GOA:Q6FTP7"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP7"
                     /translation="MSAVEVLLTVGKMDASLALLTTKDHHVIELPTMLLPENVKAGSI
                     VKMQVVQDVNEEEKERSNFKNVQAAILEKYGSSRPSAPILKVINVTQTGCILAWDHLQ
                     LGSAKLKSLVLYRQGVRSMVIPNPFKVTTTKISGLSIDSVYEFQLKLSTTSGQFWSEK
                     VKIHTHKMTDMSGITVCLGPLDPLQKVTPRQIAHSLKTLGARPLQDHVAIDTTHFVCN
                     DIENDDDPELLKAKNNNIPIVRPEWIRACEVEKRIVGVRGFYLDADPSILSNYGFPEL
                     TDEQLQEKEVPALPNEESEAQFVKDKLDQVADESVKDASTEAVSENNDDETKKEQVKE
                     LETDSQDNIEEPIQEESKDVPEGEPHDEFKNEGTEELSEVKDSIEQEIMADEKLVEEQ
                     PKLAEGVQVTEDVAPEEVSYVTEDVAKPAEEVTAVEEVNQPAEEVNAATEEVAEPEEE
                     VAEPVEEAGPGREVTTEEAELAEEATEPAEETEPAKEVITEEAEPAKEVTAEEAEPAE
                     ETEPAEEGNASAEEVTVSETKADEDEEPEEVGSTNEDKTQVPVIEVQDETPSPSPSPA
                     PAGKKKNKKKKKGKRK"
     gene            <74216..>74605
                     /locus_tag="CAGL0G00836g"
                     /db_xref="GeneID:2888243"
     mRNA            <74216..>74605
                     /locus_tag="CAGL0G00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446398.1"
                     /db_xref="GeneID:2888243"
     CDS             74216..74605
                     /locus_tag="CAGL0G00836g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446398.1"
                     /db_xref="GeneID:2888243"
                     /db_xref="GOA:Q6FTP6"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP6"
                     /translation="MKYNININLTHSKAASRPTHVYLYNTYIYLCCAIPWIRSLRSST
                     CDLISYRPVTKVSNAKRDSAKEKREKRFQLSGLRIELIRAKLLRNECTMGGGSWYQKS
                     QFQLRKPSFTCFGYWFVGLQERTWHSV"
     gene            <75218..>76279
                     /locus_tag="CAGL0G00858g"
                     /db_xref="GeneID:2888169"
     mRNA            <75218..>76279
                     /locus_tag="CAGL0G00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446399.1"
                     /db_xref="GeneID:2888169"
     CDS             75218..76279
                     /locus_tag="CAGL0G00858g"
                     /inference="similar to AA sequence:UniProtKB:P36027"
                     /note="similar to uniprot|P36027 Saccharomyces cerevisiae
                     YLR332w MID2 mating process protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446399.1"
                     /db_xref="GeneID:2888169"
                     /db_xref="GOA:Q6FTP5"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP5"
                     /translation="MKLLLVLMAVATAQIVPNTIPTNTNTNTNAINTNAINTNINNNG
                     SYSISSSISSVSSVQSISSFSSFSSLSSSSSSSIASVPTLSVLPTSSNSSTISSTSLS
                     SSSSSSASSSLSSSSSSISSSSSSSSSSTTSSTSSSSSSSSSSSSSSSSSSSSSSTIT
                     TPTTTENPTITSIIEGKTILSDLYTTITYTPTATHGANNKKVHHGLSKKNRNIVIGCV
                     VGIGVPLIVLTLFLLYVFCIRSPKTDFINSDGKVITAYRPNKITKWWNALMGREITEE
                     YQSKSPLGGEASDFEDSELAYADDDDESLSYGASNMDSRQPNRNNSGASHPTRSNNLI
                     MEEDRFYDEHGNELTTTNY"
     gene            77743..77814
                     /locus_tag="CAGL0G00880r"
                     /db_xref="GeneID:2888211"
     tRNA            77743..77814
                     /locus_tag="CAGL0G00880r"
                     /product="tRNA-Glu"
                     /note="tRNA Glu (TTC) cove score=62.99"
                     /db_xref="GeneID:2888211"
     gene            <78457..>80625
                     /locus_tag="CAGL0G00902g"
                     /db_xref="GeneID:2888212"
     mRNA            <78457..>80625
                     /locus_tag="CAGL0G00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446400.1"
                     /db_xref="GeneID:2888212"
     CDS             78457..80625
                     /locus_tag="CAGL0G00902g"
                     /inference="similar to AA sequence:UniProtKB:P32499"
                     /note="similar to uniprot|P32499 Saccharomyces cerevisiae
                     YLR335w NUP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446400.1"
                     /db_xref="GeneID:2888212"
                     /db_xref="GOA:Q6FTP4"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015007"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP4"
                     /translation="MSKRGADNQLTREELDRDDISDEETPHQATMASSDVISRRKIAM
                     PKRKMAFPSTLRGNTDESKTANAFSFLKKPQTEKTAANADDKPAKLKALNLQFKDKLE
                     EFLNSDPACDLRPVFMKYGKYIDEINSSTSKTSVPEPKAFSFTPQSITETVAPGFGKV
                     SAPRATTTPDVHTPKQTTFPFAPQAPKPEAASSQEPPKSSFTFTKPTTTVSDSKANAD
                     SSESDSEDEKEIKITGPTFSISTKPITSDSVFAFGAAKKEQKKDDSDSESDVEIKGPE
                     FKFAGEVKSDVFKLHKKADENKNETKTDNSKVTENKAPTFSFGSTPNPFNTSGSKDEN
                     NSGSNEPAKQANTVPKPAFSFTNNLISKESESSQEKKPLSFNFTAPKTDNNEVQEASE
                     SEKTKSSESSTFSFGNNTTTKTNPFSGNTSGFSFGKPASTSNTTESKPSISFSKPQNN
                     DTVPKSAFSFGTSANTVTETNEEKDSNTNGGNEDSKPALNFNFSSNTSSQKPSFSFGS
                     TSEKKEETTEHSTTSGGFSFGQSKAPAFSFGTPATNTTTNNPPSSGFKFSLPFNQENK
                     SNEADSSKISEKKEDGNSATVETTEEQSTSSSIQLQNGEEDETPLFTCRSKLMTINTK
                     TNGYDSRGVGELKLLQKKDDKSKIRLLCRSDGMGNILLNTAVVKSFKYSPLTPENENL
                     VKIPTIDKDGALVTYVARFKQKADGRLFVKSIEDAKNDMN"
     gene            complement(<80770..>84360)
                     /locus_tag="CAGL0G00924g"
                     /db_xref="GeneID:2888033"
     mRNA            complement(<80770..>84360)
                     /locus_tag="CAGL0G00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446401.1"
                     /db_xref="GeneID:2888033"
     CDS             complement(80770..84360)
                     /locus_tag="CAGL0G00924g"
                     /inference="similar to AA sequence:UniProtKB:Q06132"
                     /note="similar to uniprot|Q06132 Saccharomyces cerevisiae
                     YLR336c SGD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446401.1"
                     /db_xref="GeneID:2888033"
                     /db_xref="GOA:Q6FTP3"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP3"
                     /translation="MSSKRSGINIPGVILDELKERDYSNDERFKLGKRKPKGQLNRKD
                     RRKLQRAQKKQKGKKEVDLDKVLKKKPQQQNSATRASANKKDNRKSKEDALPFSSDDE
                     LSSGDFDEFEEGDLNEEEWEQLRELEGSEQEEDSGFEESSSDASENHFEDPDEDEIIS
                     EVSDESEESELTVDETYAQLKALKDKKSGNVKHNKRANIKQEPSSESESDDSVSKLEE
                     EETFSGSDLSGEEVDSGMSVEETYAKLKALKEAKKWNNHKLETVVGIEGDEDENSEEE
                     YSDLPDSEFDDEEEQEDDQEMTVEETMNKLKELKKMKDQSKRTENQSKKSVRFSSENQ
                     VKVFESYRSDDSISDEIISESDDFMSDELISDSDEVISNDDDDDDDDDDEEEEEEEAE
                     MTPEETWAALRKLKESKNSTNHKDKADTTSKKLKTKSKSKSDEVVEFPLSPMDRAAIQ
                     RDEWDMEHYAKKLGLKGKRKKLKARDEYDAIGGLLEGLDYFENYGEDEETDSSESVSS
                     VEDSSEYDEEDKREDVKRMAGNSKGELPFPSDDELSSGDFDEFDENDLNEEEWAQLRE
                     LEASDEEESDGEDTKSSKKKKNKRENPYVAPAAADTEAYVPPSLRKNKLNEDSDNSMI
                     IEIRKKVKSSLNKLSDSNLVIMVSTLNELYDTYPRQYVSDSVTKEMMQIIAQNNKLLD
                     SFIMNYAAIVYSLWRLRGIEVGASFLQQIVEHFLKHLEKQLDENESMTEISEDSPQII
                     GKQSSNIISLISYCYNFGLMSSSLVFDMIKQLITKPNEFTIELLLRIVSISGPLIRSD
                     DPSALKDIIADLLSNVKVLKTVSPRMQFLLDTMADLKNNRLKPSIMAADFHPTKKNVL
                     SAIRGSNTEEPLQVSLDDIKNIETKGKWWLIGASWKGNMNSAFEEGISSGAAKNIVSE
                     MDIKDDFLDDIPDWAEIARSQRMNTELRRAIFVSIMSAQDYVDASSKIEKLNLKNKQL
                     VEVPKVIMHCLLSESGKSGYNPYYYLVANKLCELNGHLQKPFQFLFWDILKRFEDNSS
                     YDSDEDDLIDDSEDVDENTALKRTISQGKFFGSMIAEQILKLDVLKHAPIIGGLKPNG
                     YIFMEVMIYQLLILVAKKSEKKSKSKTEEGVAYTTSLLKDIIVRGIKDDNKSFILKGL
                     NWFLGKKRKFHNYISGRKGDKKYEKDSRRLDWGLSATKHIINEELSINAF"
     gene            <85007..>85603
                     /locus_tag="CAGL0G00946g"
                     /db_xref="GeneID:2888304"
     mRNA            join(<85007..85065,85138..>85603)
                     /locus_tag="CAGL0G00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446402.1"
                     /db_xref="GeneID:2888304"
     CDS             join(85007..85065,85138..85603)
                     /locus_tag="CAGL0G00946g"
                     /note="highly similar to uniprot|P27882 Saccharomyces
                     cerevisiae YGR029w ERV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446402.1"
                     /db_xref="GeneID:2888304"
                     /db_xref="GOA:Q6FTP2"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP2"
                     /translation="MSPEEGLTGRKIIYDEDGKPCRSCNTLLDFKFATGTISKAGSVI
                     PAMAATDNSAEELIPGSKTYKKIDPPDVQQLGASSWSLLHSIAAKYPKTPSETQQKEM
                     SQFLNIFSHIYPCNWCAADFEKYIRENAPKVSSREELGRWMCDAHNKVNVKLGKPKFN
                     CDFWEKRWKDGWDE"
     gene            complement(<85791..>88130)
                     /locus_tag="CAGL0G00968g"
                     /db_xref="GeneID:2888253"
     mRNA            complement(<85791..>88130)
                     /locus_tag="CAGL0G00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446403.1"
                     /db_xref="GeneID:2888253"
     CDS             complement(85791..88130)
                     /locus_tag="CAGL0G00968g"
                     /inference="similar to AA sequence:UniProtKB:P37370"
                     /note="similar to uniprot|P37370 Saccharomyces cerevisiae
                     YLR337c VRP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446403.1"
                     /db_xref="GeneID:2888253"
                     /db_xref="GOA:Q6FTP1"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR028293"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP1"
                     /translation="MSAPPPPPPPPMAPAASVPKSAMQGRDALLGDIRKGAKLKKAVT
                     NDRSAPILSSGGVSSAPSSAPSGSSAPPVPVSIPGGAPQLGDILAGGIPKLRSVSGSN
                     APPGGAPPIPGAPPPQQAPKMPSGRPNMPSGRPTNRSHQKKSSISSIASSAPAPPSAP
                     PPPSAPAPPSAPSMPSMRPPKHESKTQNQNSIPSAPAPPVPGAPPAPPTSAPSIPSAP
                     APPAPPAPPAPPMAAAPPAPPMAAAPPAPPAPPAPPMNSAPSAPPAPPAPPAPPMSSA
                     PSIPALNSQSDNSPASNPPPSIPGGLPFLAEINARRSEKGVVDDKTVSHASNNASTST
                     NRAPSPPSAPPAPPVASAPSIPSAPAPPAPPISSAPSIPSAPAPPAPPAPPAPPAPPV
                     AAAPPAPPAPPAPPMVSAPPAPPAPPAPPAPSMTSAPPAPPAPPAPALQAAKSMKSSS
                     PPPVSSGPLPFLAEIQKKRDDRFVVGGDSNYSTKVEQTDIQGAAGSAPTTSAPPPPPA
                     GGAGMSFMSEIESKLKHSHHEPAPSSAAPPLPPSAPQIPTSTAPPVPSVKASGDSHGA
                     APSNSFMSDIAASLAARNSHGADAPDVPSVPPPPSAPPAPSAPAPPSAPAPPSTSAPA
                     APPAPPPPPSAPMTPAAPPPPSAPSMPAAPPPPSAPAPLTHSAPPPPPASTSSQQTQS
                     TDSAGNIKHRLFSSGTAERKVNQYTNAPEIDVGLVTINGSSSTTGTKIQSGKVTVDDS
                     RFKWTNANQLPKPRPFQGKTKLYPSGKGTSVPLDISSYA"
     gene            <88989..>89924
                     /locus_tag="CAGL0G00990g"
                     /db_xref="GeneID:2888316"
     mRNA            <88989..>89924
                     /locus_tag="CAGL0G00990g"
                     /product="60S acidic ribosomal protein P0"
                     /transcript_id="XM_446404.1"
                     /db_xref="GeneID:2888316"
     CDS             88989..89924
                     /locus_tag="CAGL0G00990g"
                     /note="highly similar to uniprot|P05317 Saccharomyces
                     cerevisiae YLR340w RPLA0"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P0"
                     /protein_id="XP_446404.1"
                     /db_xref="GeneID:2888316"
                     /db_xref="GOA:Q6FTP0"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="UniProtKB/TrEMBL:Q6FTP0"
                     /translation="MGGIREKKAEYFAKLREYLEEYKSIFVVGVDNVSSQQMHQVRKA
                     LRGRGVVLMGKNTMVRRAIRGFISDLPDYEKLLPFIKGNVGFIFTNESLKDIKEVIVA
                     NKVAAPARSGAVAPEDIWVKAMNTGMEPGKTSFFQALGVPTKIARGTIEIVSDVKVVE
                     AGNRVGPSEASLLNLLNISPFTYGLTVVQVYDQGQVFPSTILDITDEELVSHFVSAVT
                     TVAAISLAAGYPTLPSVGHTLINNYKNLLAVAIASSYHYPEIEELIDRIENPENYASA
                     APAAAAASGDAAPAEEAAAEEEDESDDDMGFGLFD"
     gene            <90335..>91672
                     /locus_tag="CAGL0G01012g"
                     /db_xref="GeneID:2888317"
     mRNA            <90335..>91672
                     /locus_tag="CAGL0G01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446405.1"
                     /db_xref="GeneID:2888317"
     CDS             90335..91672
                     /locus_tag="CAGL0G01012g"
                     /note="some similarities with uniprot|Q06134 Saccharomyces
                     cerevisiae YLR341w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446405.1"
                     /db_xref="GeneID:2888317"
                     /db_xref="GOA:Q6FTN9"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN9"
                     /translation="MNVLSVQHENIPSIKYHKRPIKDGQKRCAFYLSTETESVVNYSL
                     RFDSKSLSRRKFDALLKVPTHVSNSKIDTHTLPHLIEIIQEQIISVTEQRKCVTLHDN
                     LYMIALCIVPMTVELTRTLEQVNNASQSKFTVNSYYSNKFLFLIEILIEFIWVDHIRA
                     LCREEIHKDHTHSNYKTRYNMTMLVEDPDSVLSRIYYRWSKLNYFPITLLSSLKFTVI
                     GEGKNVEIGYRNETRKIVLSTLLLVSKKCFVQFMKIVMAQQALYQNLDEACFLLMCEW
                     LLKGTVQSNSGESVVGIRQVILDLVNAKDGSLLSEHLGFRCRCNTWAKQLSTRLIENK
                     TKEDVIQGTEIEDTDLKFNKYEVALLFLDDLIRSTATVHSVGTSQEDSNIQDEHTQEL
                     THRPLEWMSVFNSCSYHSGNAIKHRKRSQLQNWFKKHTLMRRIIKVFKNLRSS"
     gene            <93468..>99059
                     /locus_tag="CAGL0G01034g"
                     /db_xref="GeneID:2888318"
     mRNA            <93468..>99059
                     /locus_tag="CAGL0G01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446406.1"
                     /db_xref="GeneID:2888318"
     CDS             93468..99059
                     /locus_tag="CAGL0G01034g"
                     /note="highly similar to uniprot|P40989 Saccharomyces
                     cerevisiae YGR032w GSC2 or uniprot|P38631 Saccharomyces
                     cerevisiae YLR342w FKS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446406.1"
                     /db_xref="GeneID:2888318"
                     /db_xref="GOA:Q6FTN8"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN8"
                     /translation="MSYNNNGQQMSDQGYYDNNQGYYQPEDQQNGQAMYGDEGYYDPN
                     ISGGDYYNQPPPPPNMMGQDMENFSDFSSYGPPGVQGYDYQNMNQSGQYTPSQMSYNG
                     DPNSGSSTPIYGNGMSAYDPNAIAMALPNDPYPAWTADSQSPVPIEQIEDVFIDLTNK
                     FGFQRDSMRNMFDHFMTLLDSRTSRMAPDQALLSLHADYIGGDTANYKKWYFAAQLDM
                     DDEVGFRNMSLGKLSRKARKAKKKNKKAMEEANPEDAEDILNKLEGDNSLEAADFRWK
                     TKMNALTPIERVRQIALYLLIWGEANQVRFTSECLCFIYKCATDYLNSPLCQQRTEPM
                     PEGDYLNRVITPLYRFIRNQVYEIVDGRYVKREKDHHKVIGYDDVNQLFWYPEGIAKI
                     VFEDSTKLIEIPAEERYLRLGEVSWDDVFFKTYKETRSWFHMITNFNRIWIMHVTIFW
                     MYVAYNSPTFYTHNYQQLVNNQPPAAYKWASAALGGTVASFIQLLATICEWSFVPRKW
                     AGAQHLSRRFWFLCLIFAVNLGPIIFVFAYEKDTVQSKAGHAVAAVMFFVAVATLLFF
                     SVMPLGGLFTSYMQKSTRRYVASQTFTASFAPLHGLDRWLSYLVWVTVFAAKYAESYY
                     FLILSLRDPIRILSTTTMRCTGEYWWGSKLCRHQSKIVLGLMIATDFILFFLDTYLWY
                     IVVNTVFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQVW
                     NAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRN
                     SEAERRISFFAQSLATPMPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRV
                     TLLEYLKQLHPVEWECFVKDTKILAEETAAYEGMDDQDPEKEDALKNQIDDLPFYCIG
                     FKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLYRVENPEIVQMFGGNAEG
                     LERELEKMARRKFKFLVSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLNEGE
                     EPRIYSALIDGHCEILENGRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLI
                     DANQDNYLEECLKIRSVLAEFEELNAEQVYPYSPGVKYEDQNTNHPVAIVGAREYIFS
                     ENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFINATFMTTRGGISKAQKGL
                     HLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREY
                     YYLGTQLPIDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLHALAHESIICIYDKN
                     KPKTDVLYPIGCYNFSPAIDWVRRYTLSIFIVFWIAFVPIVVQELIERGLWKATQRFF
                     RHILSLSPMFEVFAGQIYSSALLSDLTVGGARYISTGRGFATSRIPFSILYSRFAGSA
                     IYMGARSMLMLLFGTVAHWQAPLLWFWASLSALLFSPFIFNPHQFSWEDFFLDYRDYI
                     RWLSRGNSKYHRNSWIGYVRMARSRITGFKRKLVGDESEKAAGDASRAHRTNLILAEI
                     IPNAIYAAGCFVGFTFINAQTGVKTTDDDRVNSVLRIIICTLAPIVIDIGVLFFVLGM
                     SCCSGPLFGMCCKRTGSVMAGFAHGIAVIVHIGFFIVMWVLEGFNFTRMLLGVVTMIQ
                     CQRLIFQCMTVLMLTREFKNDHANTAFWTGKWYGSGFGYMAWTQPTRELTAKVIELSE
                     FAADFVLGHVILFAQFPVLCIPAIDKFHSIMLFWLKPSRQIRPPIYSLKQSRLRKRMV
                     KRYLTLYIIVFLVFAGCIVGPAVASSHVAKDLGHQLTGTFHNLVQPRNVSNNDTGFGI
                     STYSNHYYTHTPSLKTWSTIK"
     gene            <99661..>101289
                     /locus_tag="CAGL0G01056g"
                     /db_xref="GeneID:2888270"
     mRNA            <99661..>101289
                     /locus_tag="CAGL0G01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446407.1"
                     /db_xref="GeneID:2888270"
     CDS             99661..101289
                     /locus_tag="CAGL0G01056g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446407.1"
                     /db_xref="GeneID:2888270"
                     /db_xref="GOA:Q6FTN7"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN7"
                     /translation="MKKLLYFALSVVATSAQLADEVLLRKWSLQLPTIEIEGNKFFNS
                     ETGEQFFMKGIAYQQQVDQDSELYDGTPYVDPLADPHICLRDLPYLVELGINTIRVYH
                     IDPSSSHDTCMKAFSDAGIYVLIDLAEPEISIVRNNPSWDVKVWSRYRDVVDAMHFYN
                     NVLGFFAGNEVTNDKYNTDASPFVKAAIRDVKTYMQQKGYRNIPVGYSTNDDAETRIN
                     LSKYFVCGENSADFYGINMYEWCGYSTYGTSGYKERTEEFTDFPVPVFFSEFGCNLVR
                     PRPFTEVAALFSKKMSSVWSGGLVYMYFEEENQYGVVKINKNNEVEKLPDFDNLKKAY
                     RKATPKGVNLSDQAVSRKSINVRKLDCPEKSHNNNWLASDILPPTPNDEKCSCLDEIL
                     PCLALPSNDDQDHYKTLFNYVCGEVDCTDIKTDGTLGKYGKFSDCSVNQKLSLQLSKL
                     YYKLKLEDHICPTNPKYVRFNSATITRKDTCESILKEISQGTAKTKKEPINEIVTSVP
                     AEDGMISSTANTLSGTIILVIIVLNTLVVLLIAY"
     gene            <102146..>102944
                     /locus_tag="CAGL0G01078g"
                     /db_xref="GeneID:2888247"
     mRNA            join(<102146..102164,102580..>102944)
                     /locus_tag="CAGL0G01078g"
                     /product="60S ribosomal protein L26"
                     /transcript_id="XM_446408.1"
                     /db_xref="GeneID:2888247"
     CDS             join(102146..102164,102580..102944)
                     /locus_tag="CAGL0G01078g"
                     /note="highly similar to uniprot|P53221 Saccharomyces
                     cerevisiae YGR034w RPL33B or uniprot|P05743 Saccharomyces
                     cerevisiae YLR344w RPL33A"
                     /codon_start=1
                     /product="60S ribosomal protein L26"
                     /protein_id="XP_446408.1"
                     /db_xref="GeneID:2888247"
                     /db_xref="GOA:Q6FTN6"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN6"
                     /translation="MAKQSLDVSSDRRKARKAYFTASSSERRVLLSAPLSKELRAQYG
                     VKALPIRRDDEVLVTRGSKKGQEGKVSSVYRLKFSILVDKVTKEKSNGASVPIALHPS
                     KVVITKLHLDKDRKNLIQRRGGKLE"
     gene            <104031..>105599
                     /locus_tag="CAGL0G01100g"
                     /db_xref="GeneID:2888128"
     mRNA            <104031..>105599
                     /locus_tag="CAGL0G01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446409.1"
                     /db_xref="GeneID:2888128"
     CDS             104031..105599
                     /locus_tag="CAGL0G01100g"
                     /inference="similar to AA sequence:UniProtKB:Q06137"
                     /note="similar to uniprot|Q06137 Saccharomyces cerevisiae
                     YLR345w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446409.1"
                     /db_xref="GeneID:2888128"
                     /db_xref="GOA:Q6FTN5"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN5"
                     /translation="MADIRSDDEELENGLGSEILISGNHMARVSKRWGGLDPEKRRLQ
                     ASLDAELERKKPAGDAVHQNVDIEDDYLSPGQLYSTDSGRLFHAGKILVVLVGLPATS
                     KTLLSVAITRYTRWLGVRTKSFHLSQYRKASGFLPVDFLSAVPRTEDGKEFRKQLLAD
                     IYGDIYNFFTKTKGQLAVYDALNIRKYDRKFIHDKFAEIGVKVLYIESIMTDKRLVNH
                     NIDVALQSFDYQGFTKEEATKDYMERYMINENLYETMSADENLSFVKYINLGDRITVH
                     NNDYGYLVHKIVFFLMNMKEKSGCLYFARCGRSDKDRYVDDEQLNEEGIEYSNRLTTL
                     ILNRIAEIRKYREREEDISEIHHGDYSKQLPEHHVIDNIRKELLVWTAPRKRTYDTAK
                     PFQDLGFNVRQRSQLKQLNPGVIADMSEDEIAKEYPEEYKEYCRDRYHFRFPRAESYH
                     DLAVRMEPLLLEMEHTSHDIVVIAHESTLRILYGYFMALSCVDLPKLDFTRNELVEIS
                     FSPFCNQVRKIPIL"
     gene            complement(<105880..>106218)
                     /locus_tag="CAGL0G01122g"
                     /db_xref="GeneID:2888320"
     mRNA            complement(<105880..>106218)
                     /locus_tag="CAGL0G01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446410.1"
                     /db_xref="GeneID:2888320"
     CDS             complement(105880..106218)
                     /locus_tag="CAGL0G01122g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446410.1"
                     /db_xref="GeneID:2888320"
                     /db_xref="GOA:Q6FTN4"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN4"
                     /translation="MQVLNDIYNGTLNTISITGYNSVKSVVIVSSWMLSPVKSLCYMI
                     GGNGADETASNGSSNSSSSYQLKGGMPATVEPRSNHTVITRYDLIDAAERRERERLER
                     RRRRKSRSDN"
     gene            complement(<108004..>110589)
                     /locus_tag="CAGL0G01144g"
                     /db_xref="GeneID:2888385"
     mRNA            complement(<108004..>110589)
                     /locus_tag="CAGL0G01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446411.1"
                     /db_xref="GeneID:2888385"
     CDS             complement(108004..110589)
                     /locus_tag="CAGL0G01144g"
                     /note="highly similar to uniprot|Q06142 Saccharomyces
                     cerevisiae YLR347c KAP95 karyopherin-beta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446411.1"
                     /db_xref="GeneID:2888385"
                     /db_xref="GOA:Q6FTN3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027140"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN3"
                     /translation="MSVQEFAQILENTILSPDQNVRLTSETQLKKLSNENFLQYAGLL
                     AQVLVLPEAKVEARILAALSLKNELVSKDSIKNQQFAQRWATTIDPESKQQIKSNALA
                     VLMDNEPRVANASAQLIAAIADIELPRGEWPDLMQIMVDNTNTNQPENVKRASLLALG
                     YICESADPQSQVLMASSNSILIAIVQGAQSSEPSKLVRLAALNALADSLVFIKNNMER
                     EGERNYLMQVVCEATQANDTDIQAAAFGCLCKIMSLFYAFMKPYMEQALYALTIATMK
                     SEDDKVASMAVEFWSTICEEEIDIAYELSQFPQSPLQSYNFSLSSIKDVLPNLLNLLM
                     RQNEDPEDDDWNVSMSAGACLQLFAQNCGNYVLQPVLEFVEQNITNDNWRNREAAVMA
                     FGSIMDGPDKTQRTYFVHQALPAILNLINDPSLQVKETAAWCIGRIADLVAESIDPQE
                     HLPGVIQSCLVGLQDHPKVATNAAWTIINLVEQLSDMQPSPIYNYYPALVDGLIKSAN
                     RPDNEFNARASAFSAMTTLIEYAIDTVSDTSASISSFVMDKLGQTMTVDEAQLSMEDA
                     QSLQELQSNILTVLAAYIRKSPNSVVNVSDMLMDLFVKLLSRKSSAFIEDDVFYAVSA
                     LASSLGKGFENYLESFSPYLIGALNQVDSPVAITAVGFIADISNSLEDDFKRYAGAFM
                     NVLGQLITNPAAKKELKPAVLSVFGDIASNIGEDFIPYVNEVMGLCVAAQNSKPENGT
                     LEALDYNIKVLESVLDAYVGIVAGLHNHPAELFNYIGTIFQFLNIVAEDPQLYSEDST
                     SRSAVGLIGDIAAMYPDGSIKQFYTQQWIADFIKKTRKNQEFSQSTKDTARWAREQQK
                     HQLSL"
     gene            complement(<111298..>112185)
                     /locus_tag="CAGL0G01166g"
                     /db_xref="GeneID:2888386"
     mRNA            complement(<111298..>112185)
                     /locus_tag="CAGL0G01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446412.1"
                     /db_xref="GeneID:2888386"
     CDS             complement(111298..112185)
                     /locus_tag="CAGL0G01166g"
                     /note="highly similar to uniprot|Q06143 Saccharomyces
                     cerevisiae YLR348c DIC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446412.1"
                     /db_xref="GeneID:2888386"
                     /db_xref="GOA:Q6FTN2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /translation="MSEKQVKYPWWYGGAAGIFAVMNTHPLDLTKVRLQAAPIPKPTI
                     VQMLRSILKNEGIVGLYAGLSASLLRQCTYTTARFGMYDALKEHVIPRDKLTNMWYLL
                     GASMVSGALGGLAGNFADLINIRMQNDSALPLDKRRNYKNAIDGMVKIYKAEGAKSLF
                     LTGWKPNMVRGVLMTASQVVTYDMFKNFLVTKYNMDPKKNSTHLTSSLLAGFVATTVC
                     SPADVIKTIVMNAHKKPGHNHDSSFKILMEAINKEGPSFMFRGWVPSFTRLAPFTMLI
                     FFAMEQLKKYRVGMPKEEA"
     gene            <112898..>113554
                     /locus_tag="CAGL0G01188g"
                     /db_xref="GeneID:2888162"
     mRNA            <112898..>113554
                     /locus_tag="CAGL0G01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446413.1"
                     /db_xref="GeneID:2888162"
     CDS             112898..113554
                     /locus_tag="CAGL0G01188g"
                     /note="highly similar to uniprot|P53224 Saccharomyces
                     cerevisiae YGR038w ORM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446413.1"
                     /db_xref="GeneID:2888162"
                     /db_xref="GOA:Q6FTN1"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN1"
                     /translation="MSVPPLTKTISQSSFAESLRDLSSDEDLINKRIGSPNRDHRRRR
                     SSSILSHVEPETFEDENDQHILTNMNATWMDQPGAWIIHVVIILLLAGMYKVMPGMST
                     KNAWSLTNTTYVIGSYVMFHWIKGTPFEFNGGAYDNLTMWEQIDGETLFTPTRKYLIS
                     VPIVLFLIVTHYSRGSHFFSKDFIWNCCVTFFGAILPKLPITHRLRLSIPGFTPAQIS
                     "
     gene            complement(<113748..>114614)
                     /locus_tag="CAGL0G01210g"
                     /db_xref="GeneID:2888114"
     mRNA            complement(<113748..>114614)
                     /locus_tag="CAGL0G01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446414.1"
                     /db_xref="GeneID:2888114"
     CDS             complement(113748..114614)
                     /locus_tag="CAGL0G01210g"
                     /inference="similar to AA sequence:UniProtKB:P49954"
                     /note="similar to uniprot|P49954 Saccharomyces cerevisiae
                     YLR351c NIT3 nitrilase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446414.1"
                     /db_xref="GeneID:2888114"
                     /db_xref="GOA:Q6FTN0"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:Q6FTN0"
                     /translation="MSYILKSKVKVALIQLVGSTPDKLANLKHAKALIDNAMQREPET
                     KIVVLPECFNSPYDVTQFAKYSEVIEDPEAPSVNILKEIAKTHAITLIGGSIPERDPA
                     NDNIYNTCLIINEEGSIIAKHRKLHLFDIDIPNKITFKESITLTGGDKVTMVDTKYGK
                     IGVGICYDLRFPEMAMIAARKGAFAMIYPGAFNTVTGPLHWQLLARARSVDNQIYTLL
                     CSPARVPGSPYQAWGHSLCSDPSGKILCEADINEETLFIDLDPEVIETTRGGIPITTQ
                     RRFDVYPDVSSK"
     gene            complement(<114924..>117116)
                     /locus_tag="CAGL0G01232g"
                     /db_xref="GeneID:2888423"
     mRNA            complement(<114924..>117116)
                     /locus_tag="CAGL0G01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446415.1"
                     /db_xref="GeneID:2888423"
     CDS             complement(114924..117116)
                     /locus_tag="CAGL0G01232g"
                     /inference="similar to AA sequence:UniProtKB:P09620"
                     /note="similar to uniprot|P09620 Saccharomyces cerevisiae
                     YGL203c KEX1 carboxypeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446415.1"
                     /db_xref="GeneID:2888423"
                     /db_xref="GOA:Q6FTM9"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /translation="MLHATVLPILLWLATLAYGFDRKEFLVDGNELPGFTKLKNTKHW
                     TVPKMYAGHLPATRDNDTQYFFWKFENKKTKKNDETPLIIWLNGGPGCSSMAGALMEI
                     GPFRLNKKAEVIKNDGSWHMRGSVLFLDQPVGTGFSYSKEDNEVSELDEVADNFMVFL
                     QNYYATFPDDKDRELILAGESYAGQFIPYFTKAIIKFNEQQRDENSKINIKVMFIGNG
                     WLDPKRQYLSYVPFSLEKGIIKKEDPAFKDILKQHETCQNYINSDHTGHSELSYPPCE
                     AVLGKIISQDKTQCINVYKFDEYDSYPSCGLEWPVDTKFTKQFLTDKKVLAALHANDE
                     RSWIECRPDVKLENIKAKPAIELIPSLLESGIELILFNGNKDLICNTLGIDNVLKHLQ
                     WEGETGFTDEVQIFDWVYRDDLKSDKEKVAGTVKYERQLTLITIEDGSHMVSYDKALI
                     SRGILDMYYDDVLLVHRDGKDTLISSKDGDIDGYLEDDKSQDENKDNESEDESEDEND
                     SDDESDGKEGDKQENKPDDSDDESDEEDDDEDEDDEDDDDDDDDDDGDDEDKKGDQNS
                     HPSHGDMNGGLDNDLETGGEYYQDEDEEGSNFKAFFLILSLVSAFIIVAAFYISDYIK
                     SRRHPILVDGDGRSRLNKSVTWASDIENGSFDIEDDDPEFGTEGMEDNMELEDVFSID
                     EEDEEQLEGVVPESTRKSKKGSKKKGKYFSVPNDDSAEDIELQDIERH"
     gene            <119281..>120795
                     /locus_tag="CAGL0G01254g"
                     /db_xref="GeneID:2888210"
     mRNA            <119281..>120795
                     /locus_tag="CAGL0G01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446416.1"
                     /db_xref="GeneID:2888210"
     CDS             119281..120795
                     /locus_tag="CAGL0G01254g"
                     /note="highly similar to uniprot|P53090 Saccharomyces
                     cerevisiae YGL202w ARO8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446416.1"
                     /db_xref="GeneID:2888210"
                     /db_xref="GOA:Q6FTM8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM8"
                     /translation="MTLPESKDFTYFFSEETKARKPSPLKTCIQYFSDPNMIFLGGGL
                     PMSAYFPWDNLAADTPLPPFTNGIGATITGSQEDTSKFSVKKESKVHEGDIPLARSLQ
                     YGKSMGQPELTDFLKEHTKMIHDMKYSDWDVVATTGNTNAWESTLRVFCNRGDVILAE
                     AHSFSSSLASAEAQGIITFPVPIDAHGIIPEKLEALLDNWTEGAPKPKLLYTIPTGQN
                     PTGSSLNAERKKEIYRIAQKHDFLIIEDEPYYFLQVGEYISDLSKRAEVAQKNANISH
                     EDFLKSLALTFLSVDTDGRVIRMDSFSKVLAPGTRLGWITGSSKLLQAYLSLHEMTIQ
                     SPSGFSQSLVSGTLNRWGQKGYIDWLIGLRHEYTAKRDHCIDSLYKFIPKDNNKEGKP
                     IFTINPPIAGMFFTVDMDASAHPEFATTYESDPTKVEEALYQKVIKSGVLVVPGIWFK
                     ADGETTPAQPASSKENPNPNQIFFRGTYAAVEPSKLDEGLKRLGQCLREEFQLA"
     gene            <121156..>121967
                     /locus_tag="CAGL0G01276g"
                     /db_xref="GeneID:2888251"
     mRNA            join(<121156..121169,121310..>121967)
                     /locus_tag="CAGL0G01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446417.1"
                     /db_xref="GeneID:2888251"
     CDS             join(121156..121169,121310..121967)
                     /locus_tag="CAGL0G01276g"
                     /inference="similar to AA sequence:UniProtKB:P53952"
                     /note="similar to uniprot|P53952 Saccharomyces cerevisiae
                     YNL050c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446417.1"
                     /db_xref="GeneID:2888251"
                     /db_xref="GOA:Q6FTM7"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM7"
                     /translation="MSTKVVSRDELFNSEPSGDELPYEEGVHDDFDIVQVEQQEEANN
                     KGAEDNGNDPEEYAFPLFSFGAGEEATKEDKPLMKVSLKVEEEELVQERPKSYYYQHL
                     SEECKDALSSSALTYDDIFTEKNMRPYQGWKKFRGKVIDVADYNRIIDANKKMEIKNK
                     KRRPGKKQRIAKALGSKRVKEREEKDKELKKQRKKMFHKRGGKKNKKKASTSAIPSKP
                     KFRTE"
     gene            complement(<122088..>123227)
                     /locus_tag="CAGL0G01298g"
                     /db_xref="GeneID:2888056"
     mRNA            complement(<122088..>123227)
                     /locus_tag="CAGL0G01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446418.1"
                     /db_xref="GeneID:2888056"
     CDS             complement(122088..123227)
                     /locus_tag="CAGL0G01298g"
                     /inference="similar to AA sequence:UniProtKB:P53951"
                     /note="similar to uniprot|P53951 Saccharomyces cerevisiae
                     YNL051w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446418.1"
                     /db_xref="GeneID:2888056"
                     /db_xref="GOA:Q6FTM6"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM6"
                     /translation="MDSNFTEFEELIDPEFDSKSYSNSMLKAMNTTSNELDIDAPKKK
                     AQYDADELKSRYESFLKSHASGLMDEFDRERKLNGSISAELKPSLEYMSISYNRLLEQ
                     VLVPYERAQKLQAALNSVHQTSTLLRDVLMFVHLSQQITSFVPLQGEDKLSAVSISKL
                     ASLHYQIQLNQSQHPNLKSLKFVKEMESQTLAPRRKSLLSHITLTISRECLNSIKLRS
                     NENDLKSLLLSLYTLSEQEFYVTLQKIILTNATNTSRILSKSVNAIKTLPSLFEEAVK
                     KGHDVYVIETLLQNVKVENSNLLVQFTRLSRNKASTPRQLYWGKVSSAFKIDLNTAIE
                     RGGPVGKQIVNSKTFILDTIKDVFQRMSEEEPDFEHNLQIMIGVL"
     gene            complement(<123910..>125226)
                     /locus_tag="CAGL0G01320g"
                     /db_xref="GeneID:2888054"
     mRNA            complement(<123910..>125226)
                     /locus_tag="CAGL0G01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446419.1"
                     /db_xref="GeneID:2888054"
     CDS             complement(123910..125226)
                     /locus_tag="CAGL0G01320g"
                     /inference="similar to AA sequence:UniProtKB:P38590"
                     /note="similar to uniprot|P38590 Saccharomyces cerevisiae
                     YNL053w MSG5 dual-specifity protein phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446419.1"
                     /db_xref="GeneID:2888054"
                     /db_xref="GOA:Q6FTM5"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM5"
                     /translation="MSELTSSGGPRSLQNRNTKNLSIAIEHQKPELTSLQEIPEVRPQ
                     MQSNFSSGTIYRRSTLDSDKSVRKPGNTIYSVTPKLDRVQSASPIYASSMEIDNKKKL
                     GRVHSLSLSIKTKNLPTRNSNSLKSGHIRNRSFTMSGAETSTPLITDESESRNLKKEF
                     MNKVGSRVQQQDFDMDAMYSEIYQNTAYTEGPLLVVEPSIYLYSEPNLSVILNYDVVI
                     NVAKEIDNLKQHIPAGMAIDYYHVPWTHASQISKDLAWLTEVMHTAVTKGKKILVHCQ
                     CGVSRSASLIVGYMMRYENLALNDAYAKLKEIAKDISPNMGLIFQLMEWNDMLPSLRN
                     NEASSKTTVQSMDMSQNIPLETTKNVSTSKFDNSSYGMSSSITISDTTSGNSPSSANS
                     ISLQNESFPVLNSKELTLTDLSNNNILNGSYKNAADVVADSSQLWH"
     gene            complement(<126180..>129410)
                     /locus_tag="CAGL0G01342g"
                     /db_xref="GeneID:2888006"
     mRNA            complement(<126180..>129410)
                     /locus_tag="CAGL0G01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446420.1"
                     /db_xref="GeneID:2888006"
     CDS             complement(126180..129410)
                     /locus_tag="CAGL0G01342g"
                     /note="weakly similar to uniprot|P53950 Saccharomyces
                     cerevisiae YNL054w VAC7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446420.1"
                     /db_xref="GeneID:2888006"
                     /db_xref="GOA:Q6FTM4"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM4"
                     /translation="MDDEKKLTVETETVEAVPAAELPRAEERDADGVHSGVHSGVQEA
                     VHGGEESEIGFAPLAVRTPDEFVPQGTASPLNAVKTAPPLQTHKTLIDSNPLSPHVPH
                     ANGNGASESAKNPDMDTSNSAPAMSQTELNKPNAKTTDARNSAEDTLFSTTSGDMIKS
                     KMKIVPSINTESTSLSALNLPAHSSAKHDNVTDLNKNPNHVLDKIPLQRQASGIATVG
                     ASIMSNAIGSTPNNSGQQQQPSQLGQQAQKPEQLTPSAAPPAPLFQNRAKDRPNMVAM
                     MSRERLLNTEGAQKGSEPSMSKKVTTPDEITTQTTESSNAHRPTKTDFFAARLASAVG
                     ENEVSDSEETFVYESAANSTKNMIYPSTSKINDDQHQVPHNIDSSLAGKMHSITTKSS
                     VPVLNGNTKLFNRLKNTTRHISTGGMPNSSLNLPSHTTHPQSNLSQVDSDITSIRSSH
                     KNQSKVEQQSIRSMASEQRSPDRKVGGLASLDESNSVANSPSLHYKSSTNFMPMKNQA
                     RNSHINQRSISVSNNNSNGALGRNPSISGHNQRAKTGAAQKNASKASIENKNTLRTTV
                     SKIFDANGASLRRYSGVPDNVNLEDFIEQNDLYTNQGLNSKEKKLSRQQKYMPSRHSI
                     SGAHTRGSERSSPIDADYLKGITRHTGDSSDSVTNGGERYRGQQRLNNGNDTKGQNRF
                     IEDKHRSQRNSAIEGEANLHETVRAHDSELDVDIDDDEDDDRSMFYYSHGSNLEARPQ
                     ISEYEGDAGDQDSDEEYVNGTMTGDYFTNHTNIHSGYDRNPFYGSTEHNEVGSYYPPI
                     SPLVNVNASSPNKGVHCKTKDSTEFTPLNRNSYYVDNNYQYSPHNFYTKKSNWSKFRQ
                     CFYFTISVLVFVSIGFVLGFLLAANKELREFDIVLMDNVISSTDELLFDLTTTAFNPG
                     IFPIYVDEVEFDIFAKTSFLKCNVYDNRCVVVEEKEAKTSVETIFLGIVKTLETPLKF
                     QGGFFNRNFDISQTSVRLHKPGSDEAKEPNDNDDTSSDSIQQLGHYGLDKRDSDESDD
                     VTKWKLVIKHDYELILRGNIKYKVPFFNTARSIAVQKSAEVRPSKQ"
     gene            <130059..>132050
                     /locus_tag="CAGL0G01364g"
                     /db_xref="GeneID:2888007"
     mRNA            <130059..>132050
                     /locus_tag="CAGL0G01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446421.1"
                     /db_xref="GeneID:2888007"
     CDS             130059..132050
                     /locus_tag="CAGL0G01364g"
                     /note="highly similar to uniprot|P38088 Saccharomyces
                     cerevisiae YBR121c GRS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446421.1"
                     /db_xref="GeneID:2888007"
                     /db_xref="GOA:Q6FTM3"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR027031"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM3"
                     /translation="MTVEDVKQARQAVEFSREKLESVLRGRFFYAPAFDLYGGVSGLY
                     DYGPPGCSFQANVVDQWRKHFILEEDMLEVDCTMLTPYEVLKTSGHVDKFSDWMCRDL
                     KTGEIFRADHLVEEVLEARLKGDQEARGLVKDANAEAEEDADKKKRKKKVKQIKAVKL
                     EDDVVKEYQHILAQIDGYSGPELGEMMKKYNIGNPVTGEPLEPPMAFNLMFETAIGPS
                     GQLKGYLRPETAQGQFLNFNKLLEFNNGKTPFASASIGKSFRNEISPRAGLLRVREFL
                     MAEIEHFVDPLDKSHPKFHEVKDIKLSFLPRNIQQSGSTEPLVTTIGEAVASKMVDNE
                     TLGYFIARIYLFLIKIGVDDTKLRFRQHMANEMAHYAADCWDAELKTSFGWIECVGCA
                     DRSAYDLTVHANKTKEKLVVRQKLETPVEVTKYEIDLTKKLFGPKFRKDAPKVEAYLT
                     ELSQEELEKKAEELKTNGKIVFTVKGIEGEIELDDKFVVIEKRTKVEHVREFVPNVIE
                     PSFGIGRIIYSIFEHSFWSRPEDTARAVLSFPPLVAPTKVLLVPLSNHKDLAPVTAQV
                     SKILRKEQIAFRVDDSGVSIGKRYARNDELGTPFGITIDFDSVKDGSVTLRERDSTKQ
                     VRGSVEAVIKAVREITYNGASWEEGTKDLAPFVSQSDAE"
     gene            complement(<132280..>133878)
                     /locus_tag="CAGL0G01386g"
                     /db_xref="GeneID:2888085"
     mRNA            complement(<132280..>133878)
                     /locus_tag="CAGL0G01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446422.1"
                     /db_xref="GeneID:2888085"
     CDS             complement(132280..133878)
                     /locus_tag="CAGL0G01386g"
                     /inference="similar to AA sequence:UniProtKB:P40485"
                     /note="similar to uniprot|P40485 Saccharomyces cerevisiae
                     YIL105c or uniprot|P53955 Saccharomyces cerevisiae
                     YNL047c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446422.1"
                     /db_xref="GeneID:2888085"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM2"
                     /translation="MSSQADPRSPLAVLVPYDAHPAEQLAQRFTEWRKVLKAIIVYLS
                     EVASVQEEIIRQNAKVSNILASHGISNAGIGSSGSGLSGSFNLTSAANKLASGGAHDK
                     HGKNNNGWFFSGSEEDNTHSANTINHFFLPIGNGSIQDVPIILRQYHDVMAAEAAKGT
                     RELQNSIIPGLESLNKDLVLKIKSIKSLSSDFKNNCSKELDTTRECMVKFQQSINQAR
                     KNVPARDPYLLKVNLDNQIRRQLSEENFLHEAFMNLQSSGQELEKIVVASIQNAFRVL
                     AQILGAEAKIIDDQLVNRLLSSFLSLSPSHEWDNFLLRDNTNFIPLNLPMRKFKEIEY
                     TGKNDPLTLVVQCGYLERRSKYLKSYTKGYYVLTPNYLHEFKTSDRKRDSVPLFSLSL
                     AECKVVQHTPLNECDKKGEGKDSQSYKFILHTKTNGLIHRGHNWVFRTTSSKEMLYWF
                     KNLSELTTFNNQEEKVKYLSTLKAKIERESETLAPMLSARSSTTRSRAIHSMDSTRRS
                     CSDQSAAETNGNTTLTKTLSIGNK"
     gene            <134524..>134928
                     /locus_tag="CAGL0G01408g"
                     /db_xref="GeneID:2888187"
     mRNA            <134524..>134928
                     /locus_tag="CAGL0G01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446423.1"
                     /db_xref="GeneID:2888187"
     CDS             134524..134928
                     /locus_tag="CAGL0G01408g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446423.1"
                     /db_xref="GeneID:2888187"
                     /db_xref="GOA:Q6FTM1"
                     /db_xref="UniProtKB/TrEMBL:Q6FTM1"
                     /translation="MKWFKQAKLKFKIKKKSKRVSKELVQIPASFNTRQALVNADDQY
                     SHKVFMDSKQYILSKYLTLFTVLFCALAICVTLVCAPRIIRIYYSNKVTYTKWALLLS
                     LISPQQQQLPLLSGTFSLGTIFSLYKWLVWFI"
     gene            <135200..>137158
                     /locus_tag="CAGL0G01430g"
                     /db_xref="GeneID:2888012"
     mRNA            <135200..>137158
                     /locus_tag="CAGL0G01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446424.1"
                     /db_xref="GeneID:2888012"
     CDS             135200..137158
                     /locus_tag="CAGL0G01430g"
                     /inference="similar to AA sequence:UniProtKB:Q10740"
                     /note="similar to uniprot|Q10740 Saccharomyces cerevisiae
                     YNL045w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446424.1"
                     /db_xref="GeneID:2888012"
                     /db_xref="GOA:Q6FTM0"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /translation="MINRLIQRIVPFSRPLSTVKKTMLTPFLESKRPQQSPEYDYSTL
                     SNYKSFQIKHTTLNFLLSFEKSTVSGDVVFDLTTLKEAVKHIDLDTSYLDVNEVLVDD
                     KPVEFKIEERKQPLGSKLVIAAELEAERQFKLRVKFSTTKDCTALQWLTPQQTSGDKP
                     YMFSQLEAIHARALFPCFDTPSYKSTFTANIESTLPVVFSGIATGSTPNGESTVYHFK
                     QDIPIPAYLVGIASGDLVSASIGPRSKVYTEPHRLDDCVWEFSNDVEKFIKTAENLIF
                     DYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDKTNIDVIAHELAHSWSGNLVT
                     NCSWNHFWLNEGWTVYIERRIVGALHGEPTRHFSALIGWSDLENSINSMRNPEKFSTL
                     VQNLNDGTDPDDAFSTVPYEKGFNLLFHLETVLGGPQEFDPFIRHYFKKFARQSLDTF
                     QFLDTLFEFFENKREILENVDWETWLFKPGMPPKPQFITTMADNVFSLVNKWIVKAQE
                     LKTTEEFSKEFSESDLSEFNSNQVVLFLEELVAQNCVPVESKIEWSKYSVASESLLSI
                     YKKQVTESQNAEVVFKNYKFQTTARIQPSYQQLANWLGTVGRMKFVRPGYRLLNAVDR
                     DLAIATFEKLKDTYHPICKQLVKQDLEL"
     gene            <137568..>138322
                     /locus_tag="CAGL0G01452g"
                     /db_xref="GeneID:2888189"
     mRNA            join(<137568..137591,137816..>138322)
                     /locus_tag="CAGL0G01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446425.1"
                     /db_xref="GeneID:2888189"
     CDS             join(137568..137591,137816..138322)
                     /locus_tag="CAGL0G01452g"
                     /note="highly similar to uniprot|P53633 Saccharomyces
                     cerevisiae YNL044w YIP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446425.1"
                     /db_xref="GeneID:2888189"
                     /db_xref="GOA:Q6FTL9"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL9"
                     /translation="MNQINAMSQLASFSENLSIDNIKSQAMAIKSKFGSLRSVQDFFN
                     IKRLSKPQNFSEIQSRISYNLNYFSSNYGIIIGCLSIYTLLTNLLLLFVICFVFLGLL
                     GIGKLDGQDLNTPFGSFKTTQLYTGLVCIAVPLGFLASPFSTMMWLIGASSVTVLGHA
                     ALMEKPIETVFDEETV"
     gene            <139439..>140488
                     /locus_tag="CAGL0G01474g"
                     /db_xref="GeneID:2888191"
     mRNA            <139439..>140488
                     /locus_tag="CAGL0G01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446426.1"
                     /db_xref="GeneID:2888191"
     CDS             139439..140488
                     /locus_tag="CAGL0G01474g"
                     /inference="similar to AA sequence:UniProtKB:P53958"
                     /note="similar to uniprot|P53958 Saccharomyces cerevisiae
                     YNL042w BOP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446426.1"
                     /db_xref="GeneID:2888191"
                     /db_xref="GOA:Q6FTL8"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL8"
                     /translation="MSEDKANHTRSKSVLDVIFGNSVTDWNVSEGTLLKSIDFKIEQE
                     KTKQQYYKLEGLNKTIELLKLATNANIPSSQISRLFGDLSPGSEESSRQSQSTNETKT
                     IPATEFLSPNRNGTVPSSPTNDGVSLRAPVSYRFPANSNGGPPRPVRTHHRTNSPARI
                     GAHAVANLNEVISVKEEPEPNNVLHPSSPLGRKSQLVSNHTRNYSEPSRFFTSSTTLN
                     NITGPVTTVLDFEPHNKNGKGRQPRNSTDMLESDAHKLRNGSKRLGGITKRHRRTRSA
                     SSFGVIDLNIINDANSESLEKASINRMMEERKGRAPTLINDNDDRTCSESSSRTESPN
                     RFSRRSSVTKLLNDP"
     gene            complement(<140652..>143150)
                     /locus_tag="CAGL0G01496g"
                     /db_xref="GeneID:2888193"
     mRNA            complement(<140652..>143150)
                     /locus_tag="CAGL0G01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446427.1"
                     /db_xref="GeneID:2888193"
     CDS             complement(140652..143150)
                     /locus_tag="CAGL0G01496g"
                     /inference="similar to AA sequence:UniProtKB:P53959"
                     /note="similar to uniprot|P53959 Saccharomyces cerevisiae
                     YNL041c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446427.1"
                     /db_xref="GeneID:2888193"
                     /db_xref="GOA:Q6FTL7"
                     /db_xref="InterPro:IPR010490"
                     /translation="MEFIDYQAFETAPDNNDKSGTNGEVSLPEPVSRLNISSFSLDYK
                     PLKDNFKLPSILSNVETSLLQTKADVQDDTAMAQKLKKDTSNLYDRMSDYVDLSIQNF
                     GTKNIKDSTPIPEATTRKTLVEPSSIDLEKSNEILAKKLSKVLNEYDTSYHHTIKLRK
                     SLKILEKNRDKLGISEEKLISPDYIGTLARKSLRTDLETQLLKDHVTVLEDFKPIVRR
                     IKRLAAPVQQIENIGEEILKNDKETFSQKYISDIDDCRNHLLKLEIKKKILKALQSKF
                     TLNQLEDDLIENGPLKEEIFDIVDKLTKMKEHATYLLALPNSKAGEVLIKQTNITLDT
                     INKKISNYLIDYMYTFESNSNMGTKHVIDPTERNLALFQKGLVYLSNDIQYYDDFLKR
                     VTTMRSKTLLDEFLSQFGTTSELSTTISSSEDPVRYIGDVLATIHTMIANEVDFVKSL
                     FKFTSEDMDKSSSMIINNNAQYFDGLDLKLVNDIVQYLANSCKLRIEQVIRFEENKVI
                     NFEITQLLDLYSSMFVNKGIRDDNPLVLHLIQLRDISEKKIINSLTKQLAETENTQIS
                     SPDLLPPQWLSDYLNSITELFDHVERLYGGKRFSKDDIDSDKYMFPYDTLKTVIEEPF
                     MTSLIKQIKDSYPLAKKKEEIRIVMLTLQINCFEMINFRLQPYSLSIFSYDESCKHIL
                     ENIQHTLDETVEKLQKLQISLLFERTGLNMYYNLMNMIFPIDSIQDEIDYDMYMSLVD
                     NPLMSLENLEKNIHEKLNDYLPQALPDFQDNLLIKLTSPSIADDVCEICFRTLTDFYC
                     IFRRILKHLYPDNKEKVEAILNFTESEFKTLAGV"
     gene            143832..143904
                     /locus_tag="CAGL0G01518r"
                     /db_xref="GeneID:2888194"
     tRNA            143832..143904
                     /locus_tag="CAGL0G01518r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:2888194"
     gene            complement(<144151..>144810)
                     /locus_tag="CAGL0G01540g"
                     /db_xref="GeneID:2888184"
     mRNA            complement(<144151..>144810)
                     /locus_tag="CAGL0G01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446428.1"
                     /db_xref="GeneID:2888184"
     CDS             complement(144151..144810)
                     /locus_tag="CAGL0G01540g"
                     /inference="similar to AA sequence:UniProtKB:P53615"
                     /note="similar to uniprot|P53615 Saccharomyces cerevisiae
                     YNL036w NCE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446428.1"
                     /db_xref="GeneID:2888184"
                     /db_xref="GOA:Q6FTL6"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL6"
                     /translation="MTKDTIFTLTGKCALDNILDANRQWAQAMHRSQPQLFPTNGQGQ
                     DPHTLFIGCSDSRYNEDCLGVLPGEIFTLKTVANICHTDDHSLLATLEFAILNLKVNR
                     IILCGHTDCGGIKTCLLGRESIKESCPHLYEHLDDIEDLVESHESELNQLDNICSKSK
                     LMSHRNVERQLQRLLQIPVVQDALRNSNQDHEFNIFGLVYNVDSGLVDVVREVYGNQQ
                     K"
     gene            complement(<145796..>146521)
                     /locus_tag="CAGL0G01562g"
                     /db_xref="GeneID:2888137"
     mRNA            complement(<145796..>146521)
                     /locus_tag="CAGL0G01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446429.1"
                     /db_xref="GeneID:2888137"
     CDS             complement(145796..146521)
                     /locus_tag="CAGL0G01562g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446429.1"
                     /db_xref="GeneID:2888137"
                     /db_xref="GOA:Q6FTL5"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL5"
                     /translation="MSKINEDKKRYAISLTEHNGMISATIYKKTYLRDQLLNGICVIV
                     VELLFYHFLQDQVVSLLRKASLPGDCRLHRLLLSLLCFHILNTKLVITIETVTVIPKL
                     GVQISKWHIQSISWKALQLWYDHLSSSDSTASTAAFETIALAARTNTNSNETTFIPRD
                     RVVDIIIHETFSKTGFGVSSHLSILYNGDTSNHHRTKTRDNNRAHDGVREPCLRILYE
                     NARVRLPDQIALYNKLQRALHAK"
     gene            complement(<146813..>148561)
                     /locus_tag="CAGL0G01584g"
                     /db_xref="GeneID:2888231"
     mRNA            complement(<146813..>148561)
                     /locus_tag="CAGL0G01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446430.1"
                     /db_xref="GeneID:2888231"
     CDS             complement(146813..148561)
                     /locus_tag="CAGL0G01584g"
                     /inference="similar to AA sequence:UniProtKB:P46678"
                     /note="similar to uniprot|P46678 Saccharomyces cerevisiae
                     YNL039w TFC5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446430.1"
                     /db_xref="GeneID:2888231"
                     /db_xref="GOA:Q6FTL4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL4"
                     /translation="MSSIVNKSGVRFAPKARQRRTAAAPPVSSSAKTLATLSSGESSK
                     TNSNVASDNEKSTEEETLHADDPHAVPKNLQVPELGDSSHTLVQDSHDPLNTSTQLHP
                     KNVSRRPSIIAGQVPSIGNHNQRRSSRLDSLSGNSNRVLLKSPFGTGNESQTERRLST
                     ISNDSLNRRMRMNSITAENDPTLQAIKKRRLSSRGSIAKKGGSTHRISIVTKIEPPKE
                     KSASPSDHDIYKKQEKAENDENDEDKKFTIKSLKQLPNKVDDESSSKYQIDEEHFTMA
                     ELCKPHLPIGEISENFEKAQEASREKMKRRRERKELREKAKKEFKSIYSLNKEQIEQE
                     REARTKKQQELQAQEESYDSQPAAPSSLQVKLVDGRIELDSESTYIDRHDQARKDNMY
                     KERKYGNPFENLYNSATYGKNNFTDPWTADELVKFYKALSMWGTDFNLIAQMFPYRTR
                     KQVKSKFINEEKKHPIMIELALRSKLPPNFDEYCSDIKKELGTVDEFNKKVEELQKEH
                     EQHFKEIEQAKAKAALEDSEIERKKMENQRSNKKSSGGFMTDDLKVYRKQEVVLGTID
                     EMKMKRVSKQEDEEEI"
     gene            complement(<149686..>151056)
                     /locus_tag="CAGL0G01606g"
                     /db_xref="GeneID:2888303"
     mRNA            complement(<149686..>151056)
                     /locus_tag="CAGL0G01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446431.1"
                     /db_xref="GeneID:2888303"
     CDS             complement(149686..151056)
                     /locus_tag="CAGL0G01606g"
                     /inference="similar to AA sequence:UniProtKB:P53960"
                     /note="similar to uniprot|P53960 Saccharomyces cerevisiae
                     YNL040w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446431.1"
                     /db_xref="GeneID:2888303"
                     /db_xref="GOA:Q6FTL3"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL3"
                     /translation="MTVATPAVVGALKCQREPFLLEDFETNVISCVKVDSKTAKKFLI
                     GKEATHVLELEDTILFPEGGGQPSDTGYVTLRDDETKRINVVKVVREGLHAKHYVDQA
                     IEPGSKISLHVDKEKRLDYMQQHTGQHLLSAILDNYYDNADTLSWSMGGIPSTKKPIL
                     EPSDYLNYLELPRKLSKDEISEITDKFNEIVSTNVMPITVKETIAVEKSESIEDVSTK
                     KIPDDYDYTLGVLRTINIGELDKNPCCGTHLTATSQVQSILILDNQSTVRGTNSRLYF
                     MCGKRVSLYAKMLTDYISSAKVELSCSESQISSKVVALKENLQKAKKKEQYFISQIAK
                     FEGERLYQSLEEGKQLYVLKDEFGSLDLLLAIQKEFQELCDKNSKNCELLILCGRERA
                     SLMGSVVIISPDGEKIQKTVSELQSALKNLKGGGGKNGGKWQGKIMNFTDQEYDVLEH
                     YLEQIA"
     gene            complement(<151262..>152392)
                     /locus_tag="CAGL0G01628g"
                     /db_xref="GeneID:2888307"
     mRNA            complement(<151262..>152392)
                     /locus_tag="CAGL0G01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446432.1"
                     /db_xref="GeneID:2888307"
     CDS             complement(151262..152392)
                     /locus_tag="CAGL0G01628g"
                     /inference="similar to AA sequence:UniProtKB:P53962"
                     /note="similar to uniprot|P53962 Saccharomyces cerevisiae
                     YNL035c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446432.1"
                     /db_xref="GeneID:2888307"
                     /db_xref="GOA:Q6FTL2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL2"
                     /translation="MYSLAGSCNFGSNNWCLKLQPVHNGILTSVSSGEVHLLGLDLSK
                     QDSFKVGETSINALSRVDGQENLFAASNGNKVKVFDLRENKEVATLEQENGANVLSLG
                     SGHGMLAYGSEQQGVDAHLHLFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSG
                     STDGYTNVYDLLEPEEEDALHQVINYASIHSCGWLAPRRIFTLSHMETFAIHELNDKS
                     EELREPQPLDFGDIRQPWDCNYVVDIYPGYISAGVSEEGKGALRIIPFRNEHVQAKDT
                     ITISQAHGDEIVRDTYILPSQSDMLYSCGEDGQVKAWRNDIKLDIPETFWDYSTKMSL
                     LSDEVPEVQLEKQPVEVIADKSEKRKNKKKKKHSKKNRFKPY"
     gene            complement(152606..152679)
                     /locus_tag="CAGL0G01650r"
                     /db_xref="GeneID:2888309"
     tRNA            complement(152606..152679)
                     /locus_tag="CAGL0G01650r"
                     /product="tRNA-Ile"
                     /note="tRNA Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:2888309"
     gene            complement(<152854..>154107)
                     /locus_tag="CAGL0G01672g"
                     /db_xref="GeneID:2888370"
     mRNA            complement(<152854..>154107)
                     /locus_tag="CAGL0G01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446433.1"
                     /db_xref="GeneID:2888370"
     CDS             complement(152854..154107)
                     /locus_tag="CAGL0G01672g"
                     /note="highly similar to uniprot|Q06103 Saccharomyces
                     cerevisiae YPR108w RPN7 subunit of the regulatory particle
                     of the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446433.1"
                     /db_xref="GeneID:2888370"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019585"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FTL1"
                     /translation="MVDDKKFNEEEDGEVQYVDPTVNKVPNYEASELAFVLTQDKLSS
                     KHSEVLDKLMKLIEEEEMAPYYKYLAEEYVPQGGLLKFDKSLYDRLVEKNEQKIADFK
                     KKIEEIEENDEGELERAQAWINLGEYYAQIGDRINAQETLEKALEKAISTGAKIDVML
                     TITRIGFFYNDQLFVKDRLAQTNAMIEKGGDWERRNRYKTYKGIHSLAIRDFKEAANL
                     LVDSLATFTSIELTSYENIATYASVAGLFALERTDLKAKVVDSPDLLSLINTTPALQS
                     ISSLTISLYTSDYASYFPFLLETYDNVLIPSKYLNVHADYFVREMRRKVYAQLLESYK
                     TLSLKSMASAFGVSVEFLDNDLGKFIPNRQLNCVIDRVNGIVETNRPDNKNAQYSLLV
                     KQGDGLLTKLQKYGAAVRLTGSDRL"
     gene            <154400..>155029
                     /locus_tag="CAGL0G01694g"
                     /db_xref="GeneID:2888311"
     mRNA            <154400..>155029
                     /locus_tag="CAGL0G01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446434.1"
                     /db_xref="GeneID:2888311"
     CDS             154400..155029
                     /locus_tag="CAGL0G01694g"
                     /note="highly similar to uniprot|Q06102 Saccharomyces
                     cerevisiae YPR107c YTH1 protein of the 3 processing
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446434.1"
                     /db_xref="GeneID:2888311"
                     /db_xref="GOA:Q6FTL0"
                     /db_xref="InterPro:IPR000571"
                     /translation="MGSVVHPDTEKYPFKFEPFLRQEYSFALDPDRPVCEDFNYKIGP
                     SSCPNGVFCPKKHVLGIFQNKIVCKHWLRGLCKKNDNCEYLHEYNLRKMPECVFYAKN
                     GFCTQSPECQYLHIDPLSKVPPCEDYEMGFCPKGSACEKRHIKKVLCQRYINGFCPLG
                     RRECDMEHPFFYIPDLSSPLRIKKDEEINTRKRDEENERRLNAIINGEI"
     gene            complement(<155248..>156390)
                     /locus_tag="CAGL0G01716g"
                     /db_xref="GeneID:2888375"
     mRNA            complement(<155248..>156390)
                     /locus_tag="CAGL0G01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446435.1"
                     /db_xref="GeneID:2888375"
     CDS             complement(155248..156390)
                     /locus_tag="CAGL0G01716g"
                     /inference="similar to AA sequence:UniProtKB:Q06098"
                     /note="similar to uniprot|Q06098 Saccharomyces cerevisiae
                     YPR106w ISR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446435.1"
                     /db_xref="GeneID:2888375"
                     /db_xref="GOA:Q6FTK9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK9"
                     /translation="MDTPPTSPAFTTSRYMPLSPELEEGKCSQSSLDLLQSDLELCSK
                     NGNKVMDVMALYHGTLASVACQVYGDRNVDLYLNPSLKIGKVRDRGSVSFIFDLEDRY
                     VIKCPMSRRKYDIILREALILRLLQAPDNNIVPLIGVTYLGKSHFRHLRANELVPALV
                     LQKFELNLHTYINLHRGDIQPDKGVWHSLLRDILCALKFMKSKNIVHRDIKTSNILLN
                     LPRHDTDTTRFYLADFTSADIEGPEEFNTTHDHVDTTLEYCAPELISFFSDMPMSNHS
                     SHIVGTPSMHTDLYAAGLCLLSFITGYEPYDQLFNSSSTNETRSRSASPVQKSQWLIN
                     AISKMDPISLNIQDQRIYDIWREELQILNAILVERKPLEEIMQLLH"
     gene            <157053..>157985
                     /locus_tag="CAGL0G01738g"
                     /db_xref="GeneID:2888013"
     mRNA            <157053..>157985
                     /locus_tag="CAGL0G01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446436.1"
                     /db_xref="GeneID:2888013"
     CDS             157053..157985
                     /locus_tag="CAGL0G01738g"
                     /note="highly similar to uniprot|P53252 Saccharomyces
                     cerevisiae YGR086c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446436.1"
                     /db_xref="GeneID:2888013"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK8"
                     /translation="MHKTYSLRESRKPTAQEIQSPPPPAASTKSKFFGKGGLAYSLRK
                     TTAGNVGPELSRKLSKLVKIEKNVMRSMEVASVEKKDAAKTLSLWGLENDDDVSDITD
                     KLGVIIFEMAELDDQFVDRYDQYRLTMKSIRDIEGSVQPVRDRKDKITDKIAYMKYKD
                     PHSQKIEILEQELVRCEAETLVAEAQLSNITRSKMKAAFNYQFDAMIEHSEKIALLAG
                     YGKALLELLDDGPVTPGETRPTYDGYEASKQIIVDAEGALNEWTLDNAQVRPSLSFKE
                     QEYTVEEVEDEEDEYENEPLNETVINPEDMTPVS"
     gene            <158546..>161113
                     /locus_tag="CAGL0G01760g"
                     /db_xref="GeneID:2888334"
     mRNA            <158546..>161113
                     /locus_tag="CAGL0G01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446437.1"
                     /db_xref="GeneID:2888334"
     CDS             158546..161113
                     /locus_tag="CAGL0G01760g"
                     /inference="similar to AA sequence:UniProtKB:Q06096"
                     /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
                     YPR105c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446437.1"
                     /db_xref="GeneID:2888334"
                     /db_xref="GOA:Q6FTK7"
                     /db_xref="InterPro:IPR013167"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK7"
                     /translation="MNQDSVTIDSNQLAKNLARYDLLLRRISTISQVHRLKEIIEKDH
                     AVHLKKLDQYVHESQLRHNKQIRKLELQRTDLTVSLTQFHEALSNVNKTNAEAKQIHN
                     DIKSVELERVLLKQTLEFVTNIRTLKNNISLCNAVIDEENYQVAARAIQEIRNMPNRD
                     GIINSEFAKRVIPSSKIPEEPSVILQQWCDELTEKFKERFQKATEEQNIEELTLIFKM
                     FPMVGQDNLGLDLYSKYVCDIIADESRKLMSSSANADVDATITRRSGFFAQVLLHLFK
                     IVSTIINDHSKIIAASYGVSHMLHVMGKVQKEADLEAGLVFDIFSDTRKVKSVVREIS
                     EWNIAQKNKNKTQAYKDSGTDQNASQERKSMDNKLPSISTGDLSGLIGEFSQILQNWS
                     MYLKFFSVRWNEFSNENPSVLTLPSSLETSKFSNKLREERYLDDFLSLTIYHLQSSFA
                     RSRTIEELPDLNHLVIPTPIKTNDGLAYPVSSVVEDLTLLLRKGLVLTVNSGNFEVVS
                     QFLENLVRFIQNDFLVRFMQDRFKTLQPKITSSLTLKKYVPKDISETGSPDSISRVGS
                     PSGYGEKSSSNKLSQLGRFSLRGAAASAFTNIQSNLQAVVTDEDSVLSLHHYLIYLNT
                     LNWSKLLCKKLLREELLEENPKLLPESFPFNNESDVIREKINKCQDMITSQISKLEKW
                     AVKYLFQNLIQSKMRTLLTPLFVNGSDNTYIANTEDFEDMSEMVNFIKKWKQLITPYQ
                     NILHPDVYTELLAYIVEYCVQSVEQKFNLLQVNELGSTKLEKELSLFISTLCSLNFML
                     RKDFTKLTQMVLLLGFDDDDFDLETGDIKEEFMDTIDWVLTPAERVNTRKLKVDRRQ"
     gene            <161572..>165651
                     /locus_tag="CAGL0G01782g"
                     /db_xref="GeneID:2888330"
     mRNA            <161572..>165651
                     /locus_tag="CAGL0G01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446438.1"
                     /db_xref="GeneID:2888330"
     CDS             161572..165651
                     /locus_tag="CAGL0G01782g"
                     /note="some similarities with uniprot|P39521 Saccharomyces
                     cerevisiae YPR104c FHL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446438.1"
                     /db_xref="GeneID:2888330"
                     /db_xref="GOA:Q6FTK6"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK6"
                     /translation="MESAITGAVNSLSRHSSSDKEDDKPVPESVDHDTFKIPTSLPTL
                     STTDEGDEKVNTNRDGTNNEHGSEQTNIQLEESSEKIDGMQDLPSLADVQADSNPFEF
                     DFSPRDDQISADVMPLAPHNSTHLENSVENNNNIHEQSDSVGSSQNSEPAHIYENNEH
                     VAEDLQINSATNTDNKTENTRNSIQETTEESNSDNHGNNEITLSINITNNKQNSDSAQ
                     TVNDSIFPKDIDQNEKLEQPDNDNTKNAIEGVPRVLEDKVTDASGMDRSSDDKRDGND
                     NFKPNPIENEHDATEKSFFTVNAEHTKGSSLRRDSNSNNDKDNTAITGDTLKKWKNTD
                     QVNDNEEANNSTDFGFPDLDKSNVSFDSLPNEKEDKHQENVSEMLTGQDGHKDNSLEN
                     IGRKELTNEVSSPSKLKSTDQIASPSSNDDISQLEIMNNKNTDDGKKLDHIPEIRAED
                     STKNEDKNNTTNINAKTEDDDKKLDLPDALDHDQLVTLLELDDKHSNIFEDSEMLDEE
                     EELEQLESEIPNTKHNSASMETDKVKAFNDIPVNTQDLQENNADNENPQLNKTVAADN
                     HIKVEPSQPGGIIKREESVDSTKDKTQQPVTKTPPLSPINEEDISPNQHVPGIKSDQQ
                     NLQKSSSANQTSGSSTTQPNKESATDTPASIINEKNSLLYPKRQNSLTPMVFQPHQIK
                     ELIQRPPNADQGNVGSNTTSDTTASQPTIFAYARLDFESFTFYVQTLHAIIGRRSEND
                     YSHKVDVNLGPSKSISRRHAQIFYNFGTGRFELSIIGKNGAFVDDTFVERGNTVPLKN
                     KTKIQIGQIPFQFILPEPDILPTPKKNETKKTQEKAKAKEPMKPDPKKVIKQDVTSAN
                     KQAETKPKPKQAAAPKPKKVVKSPKKVYTPEEIPPEYREKPSLSYSAMLTVCIRKFSK
                     EKGMSLSEIYAGIRELYPYFKYCPDGWQSSVRHNLSLNKSFRKISKEGKGWLWGLDEE
                     FIAERDKLKQQQNSAAASRANTPVNKVAKTETTAPKKPSPKPTTSTNAKVTKKQNISQ
                     TLAANRATSPKNQATDDHQRTMKYLQEQLVILTKDRKGLSKQVIANILTQALAMTINQ
                     VTQAAKNKGISGNPLTALMDKNPQHLNLILAAAVNAATAKITNGEVKQLVNLPSINQN
                     KPATQQVRPTKQENKKPPAKQTTTQKASKPPTPQAKAKSGSSFDPTSLSKFFQPKQAA
                     RTISAVPTADVKSIPAKRTIGGSVVNKKVTENESSSSSGSSSSEDDSSSDDSSSSGSD
                     DSDSDSSSGSDDSSSGESDSDDSDSSSDDSNDESSSEDENDEDDAAENERKKLKTQES
                     VIESLLQHDNDGAFDLDEAVAQLDDDAVGELDDVHSLEF"
     gene            complement(<166048..>166908)
                     /locus_tag="CAGL0G01804g"
                     /db_xref="GeneID:2888365"
     mRNA            complement(<166048..>166908)
                     /locus_tag="CAGL0G01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446439.1"
                     /db_xref="GeneID:2888365"
     CDS             complement(166048..166908)
                     /locus_tag="CAGL0G01804g"
                     /note="highly similar to uniprot|P30656 Saccharomyces
                     cerevisiae YPR103w PRE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446439.1"
                     /db_xref="GeneID:2888365"
                     /db_xref="GOA:Q6FTK5"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK5"
                     /translation="MQAIADSFGTSALVKELQYDEEGNLHDDFIDGNYNFSQLAPAIA
                     MPPIASPQAFLRAHTDDSKNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGQWVAS
                     QTVKKVIEINPFLLGTMAGGAADCQFWETWLGSQCRLHELKEKERISVAAASKILGNL
                     VYQYKGAGLSMGTMICGYTKKEGPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNY
                     KWDLSVEEALYLGKRSILAAAHRDAYSGGSINLYHVTEDGWVYHGNHDVGQLFWEIKE
                     KEGSFNNVVG"
     gene            <167536..>168060
                     /locus_tag="CAGL0G01826g"
                     /db_xref="GeneID:2888415"
     mRNA            <167536..>168060
                     /locus_tag="CAGL0G01826g"
                     /product="60S ribosomal protein L11"
                     /transcript_id="XM_446440.1"
                     /db_xref="GeneID:2888415"
     CDS             167536..168060
                     /locus_tag="CAGL0G01826g"
                     /note="highly similar to uniprot|P06380 Saccharomyces
                     cerevisiae YPR102c RPL16A or uniprot|P06380 Saccharomyces
                     cerevisiae YGR085c RPL16B"
                     /codon_start=1
                     /product="60S ribosomal protein L11"
                     /protein_id="XP_446440.1"
                     /db_xref="GeneID:2888415"
                     /db_xref="GOA:Q6FTK4"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR020929"
                     /db_xref="InterPro:IPR022803"
                     /translation="MSAKTQNVMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVQSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRNRNFSTTGNF
                     GFGIQEHIDLGIKYDPSIGIFGMDFYIVMGRPGNRIARRKRCRATVGNSHKTSKEDTI
                     AWFKQRYDADVLDK"
     gene            complement(<168200..>168670)
                     /locus_tag="CAGL0G01848g"
                     /db_xref="GeneID:2888198"
     mRNA            complement(<168200..>168670)
                     /locus_tag="CAGL0G01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446441.1"
                     /db_xref="GeneID:2888198"
     CDS             complement(168200..168670)
                     /locus_tag="CAGL0G01848g"
                     /note="weakly similar to uniprot|Q06091 Saccharomyces
                     cerevisiae YPR101w SNT309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446441.1"
                     /db_xref="GeneID:2888198"
                     /db_xref="GOA:Q6FTK3"
                     /translation="METYLPFVDDAAVDQAFEAWVDELVEEECGAMPSEGYHPEVPRV
                     MAAKGRDAESGGIDLARYNDAGDVRLLKIVDSYLRHAEITLRELISKTIVNQWVISND
                     CQQSASGVMQAGIDKLQGQLDALEKYRRDVQVRYRRTHPDTVDASCMRLRDMYI"
     gene            complement(<168942..>169364)
                     /locus_tag="CAGL0G01881g"
                     /db_xref="GeneID:2888399"
     mRNA            complement(<168942..>169364)
                     /locus_tag="CAGL0G01881g"
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /transcript_id="XM_446442.1"
                     /db_xref="GeneID:2888399"
     CDS             complement(168942..169364)
                     /locus_tag="CAGL0G01881g"
                     /note="highly similar to uniprot|Q06090 Saccharomyces
                     cerevisiae YPR100w MRPL51"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL51"
                     /protein_id="XP_446442.1"
                     /db_xref="GeneID:2888399"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK1"
                     /translation="MVVKAIARNSIARNGVGAFVQPCKKVVLQYCNWGGSSAGMRAFL
                     RSRRLDMLAAKEPHIQFEVVNKSGHPLVRAQYTNGREKVICVRNQNIDNVENKIKLLK
                     DCSGEILHKRVAGHNVESLNQSVRGIWSPMHAARKHKV"
     gene            <169701..>170054
                     /locus_tag="CAGL0G01892g"
                     /db_xref="GeneID:2888395"
     mRNA            <169701..>170054
                     /locus_tag="CAGL0G01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446443.1"
                     /db_xref="GeneID:2888395"
     CDS             169701..170054
                     /locus_tag="CAGL0G01892g"
                     /inference="similar to AA sequence:UniProtKB:Q06089"
                     /note="similar to uniprot|Q06089 Saccharomyces cerevisiae
                     YPR098c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446443.1"
                     /db_xref="GeneID:2888395"
                     /db_xref="GOA:Q6FTK2"
                     /db_xref="InterPro:IPR025423"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK2"
                     /translation="MFPMFFKLQSVSPVVLGLTAPFALSSWALSSLAVASLGGLTNLL
                     WLMPWTRRIKEQRWEVKEKYKDDAEKLEELDAPLRKEFGKSHGLSLLFNVTHITGLLA
                     YGIILSRNIARYIPK"
     gene            <170682..>172508
                     /locus_tag="CAGL0G01903g"
                     /db_xref="GeneID:2888133"
     mRNA            <170682..>172508
                     /locus_tag="CAGL0G01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446444.1"
                     /db_xref="GeneID:2888133"
     CDS             170682..172508
                     /locus_tag="CAGL0G01903g"
                     /inference="similar to AA sequence:UniProtKB:P36150"
                     /note="similar to uniprot|P36150 Saccharomyces cerevisiae
                     YKR069w MET1 siroheme synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446444.1"
                     /db_xref="GeneID:2888133"
                     /db_xref="GOA:Q6FTK0"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR006366"
                     /db_xref="InterPro:IPR012066"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:Q6FTK0"
                     /translation="MAAHDHQQGLQKTRTTTTTATTMIPMITASVAGGEVSLVVGGSR
                     AGLVKSRVKTIVGAGGVAVVLNVGSQWKQLVAEFGDESGVHLLDRDFQLRDLTTLGRA
                     VTAKVVDRVFVNLPLEEDHKVKYIYEQCVRLRIPINTFHRPEYSTFNMIPTYVDPKGS
                     GLQIAVTTNGNGYLLANRIKREIVSHLPANISEVVTNMGALKDRIINEDMKVLLKERY
                     LATDLASPAVGYGLDEDGWESHKFNRLIHEFDMTEREQREKRVRWLSQVMEYYPLTKL
                     ADVTMETLEGHSHTARTQQSSKQQSSTDSLQQAQDSNSTTDSNVGNHVDKKPKISPDP
                     KASETKKGSISLVGSGPGSLSMLTLGALNEIKTADVILTDKLVPQTVLDIIPKDTETF
                     TARKFPGNAERAQEELLEKGLEYLSQGKKVVRLKQGDPYIFGRGGEEYNFFNAHGYEP
                     SVLPGLSSALAATVVSKIPATQRAVADQVLICTGTGRKGALPEVPEYVKTRTTVFLMA
                     LHRVDVLVKVLLEKEWDPEVLVAVVERASCPDQRITRTKLKYLPAVVEEIGSRPPGLL
                     VIGQAAGVLLPESSVSFNDSNKYHIDEGYRAFELDVNQLIPA"
     gene            <172830..>173891
                     /locus_tag="CAGL0G01925g"
                     /db_xref="GeneID:2888134"
     mRNA            <172830..>173891
                     /locus_tag="CAGL0G01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446445.1"
                     /db_xref="GeneID:2888134"
     CDS             172830..173891
                     /locus_tag="CAGL0G01925g"
                     /inference="similar to AA sequence:UniProtKB:P36151"
                     /note="similar to uniprot|P36151 Saccharomyces cerevisiae
                     YKR070w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446445.1"
                     /db_xref="GeneID:2888134"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ9"
                     /translation="MLSRRFISTSRKPFAFAFDIDGVLLRSKSPIPGASEGLKLLHKH
                     KVPFILLTNGGGHLEKDRTSFISDALDVPISPAQIVQSHTPYKSLTSKFNKILAVGTP
                     SVRKVAESYGFKDVVHQTDIIRYDRSITPFSGLNDQQLQEYSKDKANLEEKPFDAVLV
                     FNDPHDWAADLQIINDLLITQNGKLGTLRDSPSQKPSIPIYFSNQDLLWANAYKLNRF
                     GQGAFRFLVRELYSKMNDGMALEDMCLGKPTKLTYDFAHHVLIDWNKKLEAGQTDSSE
                     INLPQLGTPVSESPFTDVFMVGDNPASDIIGAQNYGWSSFLVKTGVYREGDNLKHVKP
                     THIVKDVRVAVETVLEKYL"
     gene            complement(<174230..>175246)
                     /locus_tag="CAGL0G01947g"
                     /db_xref="GeneID:2888420"
     mRNA            complement(<174230..>175246)
                     /locus_tag="CAGL0G01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446446.1"
                     /db_xref="GeneID:2888420"
     CDS             complement(174230..175246)
                     /locus_tag="CAGL0G01947g"
                     /inference="similar to AA sequence:UniProtKB:P36152"
                     /note="similar to uniprot|P36152 Saccharomyces cerevisiae
                     YKR071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446446.1"
                     /db_xref="GeneID:2888420"
                     /db_xref="GOA:Q6FTJ8"
                     /db_xref="InterPro:IPR007785"
                     /translation="MAKSGLLLIHPAITTTPEEVEKAKADAVAADVKIANQFLINKVN
                     EGSVKLQKGIYDVIYYLTPEAPDAILFPKKLIGALNEALKVGGVLYGLSDKYKIDALV
                     NDFDIVSDSGKYHWVKKVNMAVKAEPVAVPLKKSEKSEPSKTLPSFKKAGESKLPSFK
                     KAANKPLPTFKKKVEEAKPKVEARVHKAENDDDELEDEEDENLFDASRSKYFDEDDSE
                     SLDEDDLLNEEDAKNIGGITMITCGKSKTKKKKACKDCSCGIKEEEEAEIDNIRSQQD
                     TVVKFTEDELTEIDFTIDGKKVGGCGSCSLGDAFRCTGCPYLGLPAFKPGEPINLDSI
                     TDDL"
     gene            complement(<175635..>177251)
                     /locus_tag="CAGL0G01969g"
                     /db_xref="GeneID:2887988"
     mRNA            complement(<175635..>177251)
                     /locus_tag="CAGL0G01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446447.1"
                     /db_xref="GeneID:2887988"
     CDS             complement(175635..177251)
                     /locus_tag="CAGL0G01969g"
                     /inference="similar to AA sequence:UniProtKB:Q08438"
                     /note="similar to uniprot|Q08438 Saccharomyces cerevisiae
                     YOR054c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446447.1"
                     /db_xref="GeneID:2887988"
                     /db_xref="GOA:Q6FTJ7"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ7"
                     /translation="MASKVGLGDANPERDGVRSGTLEENGRVAEGRTDSNSGKEAQTK
                     SIMNASGTSGHVVNNTPEPGLKRVPTVTFSDIKPVTSKSSDVADVDRIAESIERTDFI
                     RGNKIFSVGSGTTINNIVPNRSRTPDAIDPIAFAVHDTAENDHLHFVVGDTLHTPGKT
                     STLTSPRSSVGSNKSPDLSLPIKEEFGQQIKAVSIPKALEAVMEEGTFNSLPSKILKR
                     ENSKNIDPRLPQDDGKLHVLLGATGAVSVFKIKVIIKKLEEIYGRDKIAVQVILTQAA
                     TEFFNKKNGKKNKTDKVANDTHNGEGKSAVLEKTSENSAVSLEEDINCTNTNAHNCIE
                     LNHIHVWTDQDEWDAWSQRTDPVLHIELRRWADILVIAPLTANTLTKIALGLCDNLLT
                     SVVRAWNPAFPIFLAPSMVSSTFNSLMTKKHLQVIKDEMPWITVFKPSEKVMSINGEI
                     GLGGMMDSNEIVDKIVMQLGGYPEDTEENDIEDGDDDDEDDEKASTTPKEVDDDDEDE
                     DEDDEDDEDDDDDEDDEDDEEDQISKSTTN"
     gene            complement(<177532..>179001)
                     /locus_tag="CAGL0G01991g"
                     /db_xref="GeneID:2888297"
     mRNA            complement(<177532..>179001)
                     /locus_tag="CAGL0G01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446448.1"
                     /db_xref="GeneID:2888297"
     CDS             complement(177532..179001)
                     /locus_tag="CAGL0G01991g"
                     /inference="similar to AA sequence:UniProtKB:Q08444"
                     /note="similar to uniprot|Q08444 Saccharomyces cerevisiae
                     YOR056c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446448.1"
                     /db_xref="GeneID:2888297"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR014881"
                     /db_xref="InterPro:IPR017117"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ6"
                     /translation="MRNNEHMMTVPHVNSLVLDATPLITQPYNHYQYYAEKFYTTPTV
                     FHEIKDANARKNLEVWQSLGNLQLVHPRKESIDRVSNFARLTGDYSVLSANDIHILAL
                     TYELEKELNKGDWRLRRKPGDKLKHEIAKPAKNPAEKPAEKPAEKPAEQPAKHAEDKE
                     EVKAELAEGTEASQEIKKKPRRRGGKKQKAKREQRLAEQQLQEGQQEQVQPEQEQMQP
                     EQEQADDETKQDGMPTEASTDEINEEYDEGDDDGEWITPDNLTETLIRDSGEDTTGSK
                     GVLTASGLDSSENPENQVALATGDFAVQNVALQMNLNLMNFMSGMRIKRLRNYMLRCH
                     ACFRMFPLPKDGKAKHFCPSCGGQGTLLRCAVTVDATTGEVTPHLKNNFQWKNRGNRY
                     SMASPLSKNAVKRYGKKGHQHANNTQDAPILREDQKEYEKAIKQEEWTRRHNEKVLNN
                     WIGGGSADNYISPFAISGLKQHSVRVGKGRYVNSSKRKK"
     gene            <179215..>179649
                     /locus_tag="CAGL0G02013g"
                     /db_xref="GeneID:2888066"
     mRNA            <179215..>179649
                     /locus_tag="CAGL0G02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446449.1"
                     /db_xref="GeneID:2888066"
     CDS             179215..179649
                     /locus_tag="CAGL0G02013g"
                     /note="highly similar to uniprot|P36154 Saccharomyces
                     cerevisiae YKR074w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446449.1"
                     /db_xref="GeneID:2888066"
                     /db_xref="GOA:Q6FTJ5"
                     /db_xref="InterPro:IPR018794"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ5"
                     /translation="MTSIDYDDKEPLTSTARPLTNSIITVRVIKSFPYRNVKNLVFHD
                     YDLQNKTAGDLLRDCMARISTEGSFRPFRNVKLDTLKVYTHAHGSKTVNLVINFDHDE
                     DWMLDTTSNRKLCEYGVENETEISLFNREDYVAYKANPEEKW"
     gene            <179911..>180930
                     /locus_tag="CAGL0G02035g"
                     /db_xref="GeneID:2888215"
     mRNA            <179911..>180930
                     /locus_tag="CAGL0G02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446450.1"
                     /db_xref="GeneID:2888215"
     CDS             179911..180930
                     /locus_tag="CAGL0G02035g"
                     /note="highly similar to uniprot|P19454 Saccharomyces
                     cerevisiae YOR061w CKA2 casein kinase II alpha chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446450.1"
                     /db_xref="GeneID:2888215"
                     /db_xref="GOA:Q6FTJ4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ4"
                     /translation="MPLPPSSLNQKSSRVYSVARVYKDACEQRPQEYWDYEQGVTIDW
                     GKISNYEIVTKIGRGKYSEVFSGKCITNDQPCVIKVLKPVKMKKIYRELKILTNLTGG
                     PNVIGLLDIVQDQASKIPALIFEEVKNADFRTLYPSFTLQDLQYYFTQLLIALDYCHS
                     MGIMHRDVKPQNVMIDPAQKKLRLIDWGLAEFYHPGVDYNVRVASRYHKGPELLVNLN
                     QYDYSLDLWSVGCMLAAIIFKKEPFFKGSSNADQLVKIADVLGTKELMAYLAKYGLKL
                     PSEYDHIMRDFTRKPWEHFVTSSTPLAVPVLVDLVDHLLRYDHQERLTAREAMDHEFF
                     KTNFD"
     gene            complement(<181467..>182291)
                     /locus_tag="CAGL0G02057g"
                     /db_xref="GeneID:2888149"
     mRNA            complement(<181467..>182291)
                     /locus_tag="CAGL0G02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446451.1"
                     /db_xref="GeneID:2888149"
     CDS             complement(181467..182291)
                     /locus_tag="CAGL0G02057g"
                     /inference="similar to AA sequence:UniProtKB:P36025"
                     /note="similar to uniprot|P36025 Saccharomyces cerevisiae
                     YOR062c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446451.1"
                     /db_xref="GeneID:2888149"
                     /db_xref="GOA:Q6FTJ3"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ3"
                     /translation="MRFSMDDSIVTKQNHVLLENLTNYDKQSIDYFHHGFRSADYPVS
                     WRILLKMKRQRILRLPSCARENCQDYRNYILRLHYCLWRRWSIQQFDLDRIDPLAINW
                     NKENDLNVLYGPDLTGQAPLHGRSHSNGRKQLLEDYIRIHDIAQMYAIKSSQQTNWQE
                     RFNRIHKSRANSSSTLPPMKGIKFDKLVLRRDIDIYGVFHESTVDIRDKGDATSLRPS
                     HSVDGVYVVEQKHYLYDDRYLFPYMPDEDPLECDAPKDFGTGSFSTLEIDDQLVSS"
     gene            <182970..>184133
                     /locus_tag="CAGL0G02079g"
                     /db_xref="GeneID:2888296"
     mRNA            <182970..>184133
                     /locus_tag="CAGL0G02079g"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_446452.1"
                     /db_xref="GeneID:2888296"
     CDS             182970..184133
                     /locus_tag="CAGL0G02079g"
                     /note="highly similar to uniprot|P14126 Saccharomyces
                     cerevisiae YOR063w TCM1"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_446452.1"
                     /db_xref="GeneID:2888296"
                     /db_xref="GOA:Q6FTJ2"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /translation="MSHRKYEAPRHGHLGFLPRKRAASVRGRVKSFPKDDKSKPVALT
                     SFLGYKAGMTTIVRDLDRPGSKFHKREIVEAVTVVDTPPVVVVGVVGYVETPRGLRSL
                     TTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQNGAEIERELARIKKYATVVRV
                     LVHTQVRKTPLVQKKAHLAEIQLNGGSISEKVDWAREHFEKTVSVDSVFEQNEMIDAI
                     AVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRT
                     SINHKIYRIGKGDDEGNAATNFDRTKKTINPMGGFVHYGMVNNDFVMVKGSIPGCKKR
                     VVTLRKSLYTNTSRKAVEEVTLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL"
     gene            <184862..>185956
                     /locus_tag="CAGL0G02101g"
                     /db_xref="GeneID:2888060"
     mRNA            <184862..>185956
                     /locus_tag="CAGL0G02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446453.1"
                     /db_xref="GeneID:2888060"
     CDS             184862..185956
                     /locus_tag="CAGL0G02101g"
                     /note="highly similar to uniprot|P36156 Saccharomyces
                     cerevisiae YKR076w ECM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446453.1"
                     /db_xref="GeneID:2888060"
                     /db_xref="GOA:Q6FTJ1"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ1"
                     /translation="MSKQWADGKDGVFRRQVSSFRETISNSHPVFKPAKGRYWLYVCL
                     ACPWAHRTLIARALKGLTSAIGVSVVHWHLDEKGWRFLQGDAQELLAGKAYEIAGGIE
                     GANSDVSTRVGDIKNDSERLFVDGSVEPHHHFERLSELYLKSNPDYKDRFTVPVLWDT
                     ETQTIVNNESSEIIRILNSDAFDQFRDSDAEVPDLVPKELEAEIDEVNKWTYDNINNG
                     VYKAGFSENGSNYEDEVTNVFTHLDKVESLLADKYKKLEKELGDKAKILSKYFIVGNQ
                     ITETDIRLYTTIVRFDPVYVQHFKCNFTSIREGYPYIHLWLQNLYWNYPAFGKTTDFN
                     HIKLHYTRSHPRINPLGLTPLGPKPDIRPL"
     gene            <186276..>187691
                     /locus_tag="CAGL0G02123g"
                     /db_xref="GeneID:2888061"
     mRNA            <186276..>187691
                     /locus_tag="CAGL0G02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446454.1"
                     /db_xref="GeneID:2888061"
     CDS             186276..187691
                     /locus_tag="CAGL0G02123g"
                     /note="some similarities with uniprot|Q08471 Saccharomyces
                     cerevisiae YOR066w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446454.1"
                     /db_xref="GeneID:2888061"
                     /db_xref="GOA:Q6FTJ0"
                     /db_xref="UniProtKB/TrEMBL:Q6FTJ0"
                     /translation="MQRSGSVNIEVSRFSSIDGVLGAEDTRVHRKTRSEVVFTTPVKE
                     SASQHATPPSTFSVLFSAEKKSQESPVSRHSPNDLFQMKNKLNKLAFKFSLDIGADGK
                     AAIVNGGNSSAPASVKKEDQDTKAEDKVPEKEEESEDSAATKTRILSILKQMRNNNKK
                     RRTNDASPKRITKASQIVSSVSSSPSKKLILPPTTQLVRDKVTSNSGSKLPTLLVTET
                     QSPSTPKPAPLLPNDCNVTPGYNMIDQALLSRPGSKFASPNGLSFSPRNRLLPRMSIS
                     GEKKFSKGFSPRGLTDTTNGNSLDSFLMGNDLENNWSDLYFNQAQTNGASRRNSVQFS
                     VNGASSPNWFKYDSANITLSPLRNLENIQNQNTNGNNNPTSIISSPVFIRHDDTTDEN
                     QIMRINQHEKEHYKQQNQSFLQKLTSSYSQPNGDTNQITMSHIYRTLHNNSKAPNSAG
                     IAAGHDNLEDDASSALKTLIK"
     gene            <188047..>189636
                     /locus_tag="CAGL0G02145g"
                     /db_xref="GeneID:2888062"
     mRNA            <188047..>189636
                     /locus_tag="CAGL0G02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446455.1"
                     /db_xref="GeneID:2888062"
     CDS             188047..189636
                     /locus_tag="CAGL0G02145g"
                     /note="weakly similar to uniprot|Q92331 Saccharomyces
                     cerevisiae YOR069w VPS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446455.1"
                     /db_xref="GeneID:2888062"
                     /db_xref="GOA:Q6FTI9"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="InterPro:IPR028648"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI9"
                     /translation="MEQNTRGEDEINDSTLSDSSSMNNETAVSNGESKGDNEVLEEQS
                     QGFDNESNLEEQMNTSLHINEDVKIQDNYNINFEECNKLIKRKWTRRRPIIVDHCLPN
                     RSPDIDKPSTNGKLHNNSKTENVGGQEDDEKEEELIINIEPIENGGESGIDNIQFKII
                     LHSGLTTKSTVIRKLSDFYVLYRQLQSNNWGVIIPPPPLLCQLPDKVKPSITDTCRNQ
                     MQMMLEHILNNEYLRNDIDFKCFLNSDDYINESVKRANITNSLALDTTRPFDSAHISL
                     LKLFGSEEGKEIILNGGIESEYKGLFSFSTIPTYKENDEYLIKAFDRISIIEQQFKTL
                     VTSLTLIDKERGELKSVQLEYYKTLQGLADEELNKHCSEVIRAFARNHQQTVLFIDED
                     SVQEYENVWTSVDLFLRYCTSIRATLDQRVILGTYCLIVKTQLQKATAALEKLNGGSV
                     FVFRSVDKKEQLEKTIQILSRRKTKIEAEIESITTEIKKNLRNFYGFISKIFMKNTEK
                     YVDALLVTHNKQKESWENFPL"
     gene            complement(<189698..>192178)
                     /locus_tag="CAGL0G02167g"
                     /db_xref="GeneID:2888008"
     mRNA            complement(<189698..>192178)
                     /locus_tag="CAGL0G02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446456.1"
                     /db_xref="GeneID:2888008"
     CDS             complement(189698..192178)
                     /locus_tag="CAGL0G02167g"
                     /inference="similar to AA sequence:UniProtKB:P36159"
                     /note="similar to uniprot|P36159 Saccharomyces cerevisiae
                     YKR079c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446456.1"
                     /db_xref="GeneID:2888008"
                     /db_xref="GOA:Q6FTI8"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR027794"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI8"
                     /translation="MFTFTPVAHPTADTQHPLLLLQADSGERYFFGKVSEGSQRCLTE
                     NKIKISKLGNIFLTGMLDWSAIGGLPGMILTIADQGKDNLVLHHGSQILNYIVSTWRY
                     FVFRFGINLRTNTLVPSKNIYKDKLLQVNPIVISKKHSEEVKLGNKTVESLLNDIVAH
                     MFPKKTDTNMKYEPSKDPHLNVKLPENISVPSETTNYEVQFNSIRGRFKVEEAIRLGV
                     PKGPLFAKLTKGESITLEDGTIVSPDQVLEKERNFGKVLILDIPDNSFIPSFMEKFKT
                     HDLSGTAAIYYFLDDKVVFNDDIIELMETLNHGNVQHLISHSKISPNSLNFRGSALTT
                     LKLKSMQPESYNLPKCDQILSKDFFDCFEKSTPLGTTLIQTSEGDIKSSIDKENVHIF
                     KRGTDVTLEPYTKNSELEVQDLNSKVITTELPSTADFWKRAFHNHVVPLQIPGATYEN
                     IVENQFHVNNFNSSPEKATQPEIITLGTGSALPSKYRNVISTLVKVPFNNNGVISNRN
                     VILDAGENTIGMLKRMFNSTELLSIFKDLKLIYLSHLHADHHLGIISILREWNRYTKN
                     DENAKIYIVTPWQYKKFVDEWLNYEDESILSRINYISCEHFIHGNYVRKEIKPLDINE
                     FEAVISENTNKKRKLQLSLDDTSSFKDYTSIKMMCKDLKIFKFETCRAKHCDWAYSNT
                     ITFYKNSFNSDLFKVSYSGDTRPNLERFAYEIGKGSDLLIHEATLDNELIEDAIKKRH
                     STINEAINVSNAMEAKKLILTHFSQRYPKLPSMDNNIKVEANEFCFAFDGMIIPYNTL
                     GKQKEVFPMLSKAFAEEQQEEEEESNDD"
     gene            <192990..>193961
                     /locus_tag="CAGL0G02189g"
                     /db_xref="GeneID:2888286"
     mRNA            <192990..>193961
                     /locus_tag="CAGL0G02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446457.1"
                     /db_xref="GeneID:2888286"
     CDS             192990..193961
                     /locus_tag="CAGL0G02189g"
                     /note="highly similar to uniprot|Q02046 Saccharomyces
                     cerevisiae YKR080w MTD1 methylenetetrahydrofolate
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446457.1"
                     /db_xref="GeneID:2888286"
                     /db_xref="GOA:Q6FTI7"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI7"
                     /translation="MSVSNPGRTILASTISKTYDYHIVEKINELKENGVRPNGPLLVG
                     FLANDDSAAEMYAKWTQRTSEALGVRYELRRIADKDFLEEAIIQANRDENVDGIMIYF
                     PVFGNAQDQYLQQVVAKEKDVEGLNHVYYQNLYHNVRFLDEAQTLKSILPCTPLAIVK
                     ILEYLKFYNEFLPEGNRLYGKTCVVVNRSEIVGRPLAALMANDGATVYSVDINNIQKF
                     TRGESLKFAKHHVEDLGPFSDELLKQVSKDADIIITGVPSKSYKFPTEYIKDGATCIN
                     FSSFKNFDDDHVKQKASLYVPMTGKVTIAMLLRNMLRLIENREHMKN"
     gene            <194550..>198014
                     /locus_tag="CAGL0G02211g"
                     /db_xref="GeneID:2888277"
     mRNA            <194550..>198014
                     /locus_tag="CAGL0G02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446458.1"
                     /db_xref="GeneID:2888277"
     CDS             194550..198014
                     /locus_tag="CAGL0G02211g"
                     /inference="similar to AA sequence:UniProtKB:P36161"
                     /note="similar to uniprot|P36161 Saccharomyces cerevisiae
                     YKR082w NUP133 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446458.1"
                     /db_xref="GeneID:2888277"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI6"
                     /translation="MTDVKPMFQLRKDILNDETTGTSAIENVDSGNEESMIYQQVGDQ
                     TKVLTENDKYLVKCINSFNAEQLPIPSHVPFYSTIDGVNKQCSYNDNENLYVWNFINS
                     KWDDSNYCKIPLNTDSSSSVNALPKSVFILPTNYDTDAEMLGLENSNSSNGIVGGVIL
                     VENTADATYLVYYEDMRSINHLSTSISKNMAHLLDLKLHSEEKVTLMLNSEPAGLVLA
                     TTEGRLMFITIRETNGKPCLTLKQQLIRPKGSGPLAFLSLFSSSNEIISLRNGPIIGK
                     GERIVYVLTRNGRFQVWKLSVASKCVKMMDTNFYDSILDDLVELYPFAQGSLKILDTH
                     PITNQPFSPQVVLTQISSSDETNFILSTIILDEQTNSFTIFSTYRLNTYIMKGNSALA
                     KPKLCVPSSLQSATSKYFDLFIVFDKAVVITQTSSKLDSTYTLKRKWEDIISFNKEIQ
                     ILAESNDASTVYLLTKGMGIISIIPKKERGETAYEESFVKSHLDQAIYFSSSSSNPVE
                     FNLPGGLHLEQDEVENDLKTASEEILLSSSKYIPPLTDNIEKHLSLRLVYFRNLISFV
                     KDNFAFSISPSKKLDIIENFELLNCFHKFNNFISSSNFELKSFWDRTLEANGNINEIE
                     LAVEKIHRFPDLFSTYLNTIIKELPSKSYTFKLTLADLIIETIYDAILEEGEKKLRYE
                     FLSLDPLELNTHLPWFISIDILDSINQLFFDLKFSLEGQEKNANTQLLVIVKTLYYLF
                     NQVRLFFLKENNMNDVSAQDFMKKCDQLYENNHLAWNQTLCELGLNEDSLEISEFYHD
                     FVSLVETLDTLEAVESKALYEEYFARFGEQFAHTLFEYYVKKSKLQDLFYRFPEQQEF
                     LVSFFKKYPQYGRVSWIFSIINYDYASAAATLYDITSGDRASAMTLESAQLYLNIAKL
                     STLAAHENHANVNLLGALKRIQANLDVVDGGKDLVEKLKRVDGAPSHLQANYKGTEFE
                     KLFDLLVKKVTNGTMLQFVEVVILYSLIDDKECLYHALKLLAIDGDILELELKKFLIS
                     LIWRRSILFDIQNAYDTTSEDSTLHFVLKQYLEDELFRANCPLPTVGVLTEKTMFTES
                     LLSSLFSNYELDTKKLQDILEKEYNTVESTAVDIEKRIIETISSLDKANDNSYTVNYH
                     DLTIEYQN"
     gene            complement(<198269..>198652)
                     /locus_tag="CAGL0G02233g"
                     /db_xref="GeneID:2888276"
     mRNA            complement(<198269..>198652)
                     /locus_tag="CAGL0G02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446459.1"
                     /db_xref="GeneID:2888276"
     CDS             complement(198269..198652)
                     /locus_tag="CAGL0G02233g"
                     /inference="similar to AA sequence:UniProtKB:P36162"
                     /note="similar to uniprot|P36162 Saccharomyces cerevisiae
                     YKR083c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446459.1"
                     /db_xref="GeneID:2888276"
                     /db_xref="GOA:Q6FTI5"
                     /db_xref="InterPro:IPR013963"
                     /translation="MDGLEQQKLAKQQELAALKRITALTDQMRTELDEMSIEVSKINK
                     NAESVANVMANWDSIRKYISEASLGLLRYAEGDYQVGAWDGKENKSDKSNADKSYQSD
                     DEHKTEPLPEALVRISVANNEESRK"
     gene            complement(<199088..>200872)
                     /locus_tag="CAGL0G02255g"
                     /db_xref="GeneID:2888110"
     mRNA            complement(<199088..>200872)
                     /locus_tag="CAGL0G02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446460.1"
                     /db_xref="GeneID:2888110"
     CDS             complement(199088..200872)
                     /locus_tag="CAGL0G02255g"
                     /inference="similar to AA sequence:UniProtKB:P32769"
                     /note="similar to uniprot|P32769 Saccharomyces cerevisiae
                     YKR084c HBS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446460.1"
                     /db_xref="GeneID:2888110"
                     /db_xref="GOA:Q6FTI4"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015033"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI4"
                     /translation="MADYDDDDYMSDELPDFADEAEFDDYLNDEEYDLMNEVLPQAKK
                     ELSEYQGWDNLSVKLAIFENEFDLQAALTELKRKFKKKKPKKEVTPATTTTKKVTKDL
                     GKLSLNQNKKQDDEWLDLDEPRKTEEEDDTKIVYKKVTVPTKPRKPIDIESYIQKSKP
                     HVSFVVLGHVDAGKSTLMGRVLQDVGAVDKTYIRKLKKESENIGKGSFHLAWVMDQTK
                     EERERGVTVSICTSDFDTPNANFTIVDAPGHRDFVPNAIAGVSQADVAILSIDCGINA
                     FESGFNLDGQTKEHALLAKSMDIKRVIVAMNKMDTVQWSHERYEDIKQKLVKFLYDIG
                     FTDNQLLWVPCSGFSGEGVYKIPYPEDAAWYTGPTVIQTLENVASDVGMVTYQEVKDQ
                     SFIFSILESSASNKNEEAIISGKVESGTIQPGETLTIYPSEQSVTVDKIIMGKEQAPV
                     PIAVKGEFVTIKLRHAHPEDIQGGDIAASVEFDIAAYQKFNLRMLTFKMDRPLLPGTP
                     FMLFRGVCEQPARISKLISLVDKDDFETVIKKKVRHLSSHQAAIVEIELTEKRRWIPL
                     LTFSQNEHIGRIVCRKDGRTIATGTIMP"
     gene            complement(<201395..>202024)
                     /locus_tag="CAGL0G02277g"
                     /db_xref="GeneID:2888009"
     mRNA            complement(<201395..>202024)
                     /locus_tag="CAGL0G02277g"
                     /product="mitochondrial 54S ribosomal protein YmL20"
                     /transcript_id="XM_446461.1"
                     /db_xref="GeneID:2888009"
     CDS             complement(201395..202024)
                     /locus_tag="CAGL0G02277g"
                     /inference="similar to AA sequence:UniProtKB:P22354"
                     /note="similar to uniprot|P22354 Saccharomyces cerevisiae
                     YKR085c MRPL20"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL20"
                     /protein_id="XP_446461.1"
                     /db_xref="GeneID:2888009"
                     /db_xref="GOA:Q6FTI3"
                     /db_xref="InterPro:IPR024388"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI3"
                     /translation="MMMKRGFHSGSAMMKGVDKFVVRNSTKPMKELRGSPTIYNSTNS
                     SSNSKGYLKAQRLLEPGLYLNRAQSSPMGSTNIETIPLGFIPKDDPRREYIRHLKYQE
                     KDKQLSKLAPPVLVSKSTVEGKKYHLQPEDISEIKRLRLEDPVKNNRKALAEKFGVSP
                     LFISIVSEPPKSHKEEMKSRLETIKSKWHAKRAIARSDRQKRQELWYRA"
     gene            <202351..>205524
                     /locus_tag="CAGL0G02299g"
                     /db_xref="GeneID:2888361"
     mRNA            <202351..>205524
                     /locus_tag="CAGL0G02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446462.1"
                     /db_xref="GeneID:2888361"
     CDS             202351..205524
                     /locus_tag="CAGL0G02299g"
                     /inference="similar to AA sequence:UniProtKB:P15938"
                     /note="similar to uniprot|P15938 Saccharomyces cerevisiae
                     YKR086w PRP16 RNA-dependent ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446462.1"
                     /db_xref="GeneID:2888361"
                     /db_xref="GOA:Q6FTI2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI2"
                     /translation="MEDVTSWLESRGITEKLTTNFYKTLKRFAERNKGDKFRKSCVSL
                     GKFKGQDNHFFDELKQLLLEGAGSTDTLANTGFVAKDSSLNVMKRSRNDEAPDDEEDL
                     QLHTPVIQKDVLLRNSYNNNDATSCSFRPIEEKGEGQVTGEEDGDEEDQEDQEVLSSA
                     ISEVSEDEDMQWYNYDDDYGNTVVDEDALFNVQTGNISVTSETPRETINSLVDLTPFS
                     VSTRKNWLPYFLNKCSEQYDLDSSVLLGSFSESSHDGLVNPFKNPEGQFALNARKGSR
                     SVAMKRNQNDSAEKAKESTNLSGTSLGEALGLNKDSNILDNSRKTNKNIDKQTATEDV
                     DKTRKSLPIYKARANVLQMIRDNQVSILIGETGSGKTTQLAQYLYEDGYTRDGGLIAC
                     TQPRRVAAMSVAKRVAQEMDKKVGDLVGYSIRFEDKTGPSTKIKFMTDGILLRETLID
                     ENLEKYKVIIIDEAHERSLNTDVLLGLLKNLVKRRRDIKIIITSATLDANKFSQFFGG
                     LPQYKVPGKTYPVQVMHTSGTVPDYVEAAVSQAVRIHLTTAIQSGDILIFMTGQEDIL
                     CCIELIKERIVDLYGKKYGINTFDKVDDVELFPIYSALPAEIQNRIFLDLDIGKRKIV
                     VSTNIAETSLTISGIRYVIDCGYSKLKVYNPKIGLDSLAIAPISIANANQRSGRAGRT
                     APGIAYRLYSEETELTDMYQQTIPEIKRTNLSNIVLTLKSLGIKNVVDFPFLDPPSIE
                     TLMASMYELWFLGVLNDDGELNALGKKMVNFPLQPTLSKVLIQSISFGCSKEVVTIVA
                     MLSVPQVFERPKERQKEADEARKRFFISESDHLTLMNVYDQWKSAKYSPKWCKKNFVL
                     YKSLIRAREIRTQIVSLLKQQKHKLKSAGSDLSIIRKCICSGFAQQAAKASGLTKYVH
                     LRTGMELRVHPTSSLYGLPNLPPYVIYHEMLLTEQEYICCVTSVDPLWLADYGSLLYD
                     VQLLKSITNDNLLLDDVSSRDDYDFTEIKKAEAKVSYIVSERMQRIKQIKQVYSDQDA
                     FQVKNQPIKSVISKGNSKSLFKRRRPL"
     gene            complement(<205593..>206627)
                     /locus_tag="CAGL0G02321g"
                     /db_xref="GeneID:2888031"
     mRNA            complement(<205593..>206627)
                     /locus_tag="CAGL0G02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446463.1"
                     /db_xref="GeneID:2888031"
     CDS             complement(205593..206627)
                     /locus_tag="CAGL0G02321g"
                     /inference="similar to AA sequence:UniProtKB:P36163"
                     /note="similar to uniprot|P36163 Saccharomyces cerevisiae
                     YKR087c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446463.1"
                     /db_xref="GeneID:2888031"
                     /db_xref="GOA:Q6FTI1"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="UniProtKB/TrEMBL:Q6FTI1"
                     /translation="MFARLNMLAKGVSGKLWTKGKVHSRFTGNRSYATYKRFNNNSST
                     DFTKLLLDESGRKYLAVTFGLGGLFYVTHLEKAPLSERNRFIWVPIGIERQIGNYSYK
                     SILNQTKGAILPENHPLTLRVDKIFRKIVQAAMHQPGVDQKQIENIQWKIHIVNDPRA
                     PPNAFVLPNGKVFVFSSMLNICQNDDGIATVLSHEFAHQLARHTAENLSKAPLYSLLG
                     IILYTVTGAEGINRLLLDGILRMPASRQMETEADYIGLMLMSRACFQPNESVRLWERM
                     TQFEKRTMNGANFEFLSTHPASSRRIENMQKWLPQARQIYEQSECGMFTGFQNSIFNT
                     AESFSNSIWH"
     gene            complement(<206880..>207851)
                     /locus_tag="CAGL0G02343g"
                     /db_xref="GeneID:2888032"
     mRNA            complement(<206880..>207851)
                     /locus_tag="CAGL0G02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446464.1"
                     /db_xref="GeneID:2888032"
     CDS             complement(206880..207851)
                     /locus_tag="CAGL0G02343g"
                     /inference="similar to AA sequence:UniProtKB:P36164"
                     /note="similar to uniprot|P36164 Saccharomyces cerevisiae
                     YKR088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446464.1"
                     /db_xref="GeneID:2888032"
                     /db_xref="GOA:Q6FTI0"
                     /db_xref="InterPro:IPR015414"
                     /translation="MPTDNADLGQEDIDVFDNGRESFDRLNKPVLDGIGIEGNDDDDD
                     DYLTLYNMTPRERLMYTFRRSMYKALDHFNSLPKWQRLLIILFGALVIVLGILMLIFH
                     NKILDKVLETSKDLNERSSTNFILLVLLFFVGFPPMIGYSFLSTSTGLIYGVSFHGWF
                     VLALGSVTGSVASFYVFKNLLHSRAEKLVHMNKRFEAFASILQEDNSYLMLALLRLCP
                     FPYSLTNGAIAGIYGISVKNFTIANIITTPKLLIYLFIGARIKNMAEDHSTSSRIFDL
                     VSILITLIIFTLTAWLLYFKTKQRYAQLKNQAVAQNSSANREVDFEI"
     gene            complement(<208231..>210882)
                     /locus_tag="CAGL0G02365g"
                     /db_xref="GeneID:2888267"
     mRNA            complement(<208231..>210882)
                     /locus_tag="CAGL0G02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446465.1"
                     /db_xref="GeneID:2888267"
     CDS             complement(208231..210882)
                     /locus_tag="CAGL0G02365g"
                     /inference="similar to AA sequence:UniProtKB:P36165"
                     /note="similar to uniprot|P36165 Saccharomyces cerevisiae
                     YKR089c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446465.1"
                     /db_xref="GeneID:2888267"
                     /db_xref="GOA:Q6FTH9"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH9"
                     /translation="MAVPVKTLKRYISERQSSFDDLARLIEEDHEFDQIDGGVQQAIT
                     QPLIERYYQYLLGRNSQTEANTTAEEEPSEPLEPILDYAFDRATKEKLKTTSAESLVS
                     EDTPTDPLKSENIPQLYRDDDEEPEELHENSVSESNPSNEQSEISYLESLKQYYDSTK
                     RTLYNTFIGNYDKNVLIDRYLRKKKLAQSYEEWKYACLKLDSLTNTNEWKEEQESTLY
                     DYTLIKTVTNKMRELRLQNDYLGLLYVIRTNWVRNLGNMGNVNLYRHSHVGTKLLIDH
                     YITESKLCLEALLQSDLDDNYLLGILQQTRRNIGRTALVLSGGGSFGLFHIGVLATLF
                     ELDLLPRVISGSSAGAIVASILCVRHKEEIPELLQKVASKDFNIFNDDKQKTESENLL
                     IKISRFFKNGTWFDNKQLANTVIEFLGDMTFREAYNRTGKILNITVSPATMFEQPRLL
                     NNLTAPNVLIWSAVCASCSLPGIFPSSPLYEKDPITSEVREWSGSASVRFVDGSVDND
                     LPISRLSEMFNIDHIIACQVNIHVFPFLKLSLSCVGGEIEDEFSARLKQNLSHIYKFV
                     SNEMIHLFELGSELGIAKNLLLKLRSVLSQQYSGDITILPDMMTLYRINELLCNPTKE
                     FILREITNGAQATWPKISIIQNHCGQEFALDKAISFIKGRMIVSSSTKSPLQFFDAPI
                     GLIQNNIQKETNGYSHVLDDNLLESESAKSLSLLSEKNTTHQLHSTENLSLYSTPMSA
                     RHRRRTSDVSIRAIAKNKSKSFSVTSPSSMILKGNRNYSNNSQINRVDLAEKESNECH
                     RSGDYKFSRNKNVGFQINVNKVVETPRSTQTSSQSTSVGGSPRMERQEYFRKSGRRIL
                     NSNRPAKILRSRSSSASFGESSVSLSR"
     gene            <212288..>214417
                     /locus_tag="CAGL0G02387g"
                     /db_xref="GeneID:2887987"
     mRNA            <212288..>214417
                     /locus_tag="CAGL0G02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446466.1"
                     /db_xref="GeneID:2887987"
     CDS             212288..214417
                     /locus_tag="CAGL0G02387g"
                     /note="weakly similar to uniprot|P36166 Saccharomyces
                     cerevisiae YKR090w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446466.1"
                     /db_xref="GeneID:2887987"
                     /db_xref="GOA:Q6FTH8"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH8"
                     /translation="MYSSMYGSPFPKINPNVRYKTALERAGFDVKTGNSKRSVSERPM
                     DRYPAAKAADTPLKNSSTPVSPSKYKSPNASNKSIHKPSRKSNDSHLMEKQRDIDDRQ
                     EISMYKPQGNIGGKFRSTSEQSTFGQYTNDRNSGNNQQSLPIDHNVLTNASPAVPIVT
                     PSIANPIEKSFQMLTQNDTSMSLNSNTSEEIEQKSSVLDDNIINSDNWDERENKHASY
                     ESANEYHQKSHSQQVSQYSHHTNENHFSETEIDNDLNFNAEPSPANNINETDTESDDA
                     DSLEFNPNADLSANLDETDYNFQKDLDLNDPITNDDGDDFTKPLVLDNNYEKETAPNE
                     LSTQKFIQIPNRSFERLNKSNNNTIASIQDTPEEDITGTVTSTNPQLQKLIAQLDDVS
                     LTRNAEIDTLLQPKDSIAILPSDSDVQRNLSKYKKSSAYLSGFPKDLNMPNDDSTLPT
                     EQQNTLLSNRSSNSSDRSDPRYQSDNISPGNGTPVFYKFNQPSPFTSNTPPELNHDEQ
                     LLYTPSKNDAKGSYDLSNIQVPSIVTEDMSETRSTPKITKYPPGEGPCRRCNKIIEGK
                     RIFSRKDNELSGQWHRECFQCTKCDIQFNKNVPCYILNDQIFCQQHYHEENNTICCVC
                     KTFIEGECLENDKMERFHTHCLTCILCKKIITSDYYIFNGEIPLCAEHNIEEMLSDGI
                     IGDMINQEGIDRNNTVSRRRTRLINFN"
     gene            complement(<214837..>215952)
                     /locus_tag="CAGL0G02409g"
                     /db_xref="GeneID:2888185"
     mRNA            complement(<214837..>215952)
                     /locus_tag="CAGL0G02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446467.1"
                     /db_xref="GeneID:2888185"
     CDS             complement(214837..215952)
                     /locus_tag="CAGL0G02409g"
                     /note="highly similar to uniprot|P32583 Saccharomyces
                     cerevisiae YKR092c SRP40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446467.1"
                     /db_xref="GeneID:2888185"
                     /db_xref="GOA:Q6FTH7"
                     /db_xref="InterPro:IPR007718"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH7"
                     /translation="MAKEQPPKLSAKAKEAEASSSSSSSSSSSSSSSSSSSSSSSSSS
                     SSSSSSSSSSDSESSSTSSSSSSDSSSSSSSESSSSSDSGSDSESSSSSSSSSSSSSS
                     SSSSDSDSDSDSSSSSSSSSSSSSSSDSDSDSSSSSSSSSSDSSSSSSSSDSDSDSSS
                     SSSSSDSSSSSSSSDSDSDSESDSSSSSSSSSSDSSSSDSSSSDSSSSDSDSSSSDSD
                     SSSSDSDSSDSGSESDTEDSESESESNNNESTTDETTLKRAREDAKEGDSSSGSDSSE
                     SSKRAKLAIPAGKDEIKEGQRRHFSRIEREKISFEAWELTDNTYQGAAGTWGEKANEK
                     LGRVRGKDFTKNKNKMKRGSYRGGTITMATGSYKFTD"
     gene            <218003..>219796
                     /locus_tag="CAGL0G02453g"
                     /db_xref="GeneID:2888413"
     mRNA            <218003..>219796
                     /locus_tag="CAGL0G02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446469.1"
                     /db_xref="GeneID:2888413"
     CDS             218003..219796
                     /locus_tag="CAGL0G02453g"
                     /note="highly similar to uniprot|P32901 Saccharomyces
                     cerevisiae YKR093w PTR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446469.1"
                     /db_xref="GeneID:2888413"
                     /db_xref="GOA:Q6FTH5"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018456"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH5"
                     /translation="MLNRFSKRNDEKNAVEVQKDVSSIDDNSSKEVYEIEDQEIHHLD
                     RDKSNAESNFALGEDDDFEAPTEEELKTLRHVAGHIPLRCWLIAIVELSERFSYYGLS
                     APFQNYMQNGPNDNPKGLLGLKSQGATGLSYFFQFWCYVTPVFGGWVSDTYWGKYNTI
                     CVGTFIYVCGIFILFITSIPGVTNSDGALGGFIAAIILIGIATGMIKSNLSVLIADQL
                     PNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFTINVGSLSVMATTELEYHKGFWAAY
                     LLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFKVLYILSKNKFNAEAAKPSFNPD
                     KNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLNNFVTQGGTMELHNLPNDFLQ
                     AFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMVGSGAMVWAAVLQHFIYTK
                     GPWYDHPLDHDTPNHIHVAWQIPAYVLIAISEIFASITGLEYAYSKAPESMKSFIMSI
                     FLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFWFIYSGLNDEEEAMNA
                     LDYEHDEFMYKHHSDDEEAAEHVRSIKSEKS"
     gene            complement(<220990..>222110)
                     /locus_tag="CAGL0G02475g"
                     /db_xref="GeneID:2888345"
     mRNA            complement(join(<220990..221368,222103..>222110))
                     /locus_tag="CAGL0G02475g"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_446470.2"
                     /db_xref="GeneID:2888345"
     CDS             complement(join(220990..221368,222103..222110))
                     /locus_tag="CAGL0G02475g"
                     /note="highly similar to uniprot|P04838 Saccharomyces
                     cerevisiae YKR094c UBI2 ubiquitin and highly similar to
                     uniprot|P04838 Saccharomyces cerevisiae YIL148w UBI1
                     ubiquitin"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="XP_446470.2"
                     /db_xref="GeneID:2888345"
                     /db_xref="GOA:Q6FTH4"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH4"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            <223375..>228717
                     /locus_tag="CAGL0G02497g"
                     /db_xref="GeneID:2888346"
     mRNA            <223375..>228717
                     /locus_tag="CAGL0G02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446471.1"
                     /db_xref="GeneID:2888346"
     CDS             223375..228717
                     /locus_tag="CAGL0G02497g"
                     /inference="similar to AA sequence:UniProtKB:Q02455"
                     /note="similar to uniprot|Q02455 Saccharomyces cerevisiae
                     YKR095w MLP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446471.1"
                     /db_xref="GeneID:2888346"
                     /db_xref="GOA:Q6FTH3"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH3"
                     /translation="MATNTESEIATFLNVERSNVESLAQELKDAILSKAEEFAQLQSD
                     NLRTNVLLEETKANLSSKYEKLKEELDYVVEDNTKVRAENKTLSEKVWSLETSDNSKL
                     AEINQLKTSNEGLQNNIDRANERYKELNGSYDEKVTELEHIRDEKKELQTQIKTLNDK
                     ILELELKCQEYQSSELNRKSELERNAQEILLLRKNQEWLEQELTNKNQHFMFYRKKTD
                     LMVHDAVTNVEKLKSDLKIEKSSKEILSKKLDETTEQLQNNLIENKDLKDVLAVEKQE
                     FDKELSIKDKLIKLYENQIKSLESTLQQKFKTAEANEENSSEVVKSLKEELSLAERKL
                     QDMEEKCVRLESILDHDSNDVSLQTKGRKRTYSNDSNSNSSDELGSFDDSSISLSRMQ
                     GDIKILKRQLVQEKRQKEKLQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALL
                     LEHATKENELKTNELQSLKKKISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDH
                     LLNEDEIKFIKNLVSNDNMASTNDSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQ
                     QLEENEEKKKSTSNNTVDEDNEIFAEAKEAILTLEKVNENLEKNLQIVTKERDAFKLL
                     VSEDRERNFKSSNSVHKYHELKSYNETVVKDLENRLTQLTNDSNAHSKALTEELNLLH
                     KEISQLNVQIEKYRSAKSLAEERLKITQNSMELLSKENEQLRIRSSRLEDSLLQQDKE
                     TQKTFSSYVEAISKNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVT
                     QLQSLQSERETLLERVQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEW
                     YQKKIDEASQQQQQIQGQLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNS
                     ENQEENDVIKELEKTKIELADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAI
                     KTLTEEKTEIEGRFEILKQQLENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEE
                     VKKMFEEKLQKLENDLEEQTVYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDT
                     KSLTAELQSLQDQMSQNEKHLKSERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNR
                     AESVNENSSDDEANGSTALVLSLRRERDILDTKINVIETEKNSLQQKLDDIQNELENT
                     KRSAALLESEYSEHSDLINNYQTIRGDLEQLNLLRESNVTLRNELKQALDEKDKIAKD
                     LQICRNELLPLQSNLESANNLIKEKDLKIASANDESQRWKTRLEEMIEKHQKVNVDDY
                     TKLEETLNETKQLLDNKVQETNELNDRFNRLKKQAHEKLNTSKELQSSLQEQISNLIS
                     EKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNKEISKSEELEVKLQNEI
                     ESSSLASRNTNKEIEELQKVIDDLKTQLAANSTDADEQTNRNVEAIKREFENQKTKFI
                     AEKTEEFNKRLIEETEKIRNEFQENEKPDTELNVDVEALRKQWEEDSEELIQKRIAEA
                     EDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKIRDKARDLLMNDHSNEFNNELKEA
                     LEKELKERFEDELQAARKKAFEEGKQQATMKTTLLERKIQKLESQIQEKEKDSEETQD
                     VKPEENSTPSVKKIPETLNSSDTSFGNSNNVKVLKPSSPFGATSAFNNPFTFNNNGNP
                     PAFASAFAPTFKDLMSGQGGQQSELSQNKRVGDDDIETNELKKSKSDSESDQSS"
     gene            complement(<228822..>229958)
                     /locus_tag="CAGL0G02519g"
                     /db_xref="GeneID:2888367"
     mRNA            complement(<228822..>229958)
                     /locus_tag="CAGL0G02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446472.1"
                     /db_xref="GeneID:2888367"
     CDS             complement(228822..229958)
                     /locus_tag="CAGL0G02519g"
                     /note="similar to KLLA0A00550g Kluyveromyces lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446472.1"
                     /db_xref="GeneID:2888367"
                     /db_xref="GOA:Q6FTH2"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH2"
                     /translation="MAAIVELCRNNGIKYSVEIVEVKGKVESYKLIKANDRSTDCFLK
                     FDRDTQIIVIDSVKSGTSRNDRSDLYKLVIEPLFQSLGVEYKYIKTESENSIRDFARR
                     TSFQSGFKYDILFLSGDTSISEFINALDTTILRSAKYRISILPVPLGSGNALATSLGF
                     KTPLQALITYLNSNKKCSPLPLYDAQLPNSTSMIFFIILSLGFHANLLHCAEDPKYKS
                     MGVERFQVASKTVFESYDLNVGIAVNGLQSQSYSYFAVIAAPNLEPTYKPSPKSSVLK
                     KELHILGYKAGICLEDLQDKIMRGYHNKDGEDIQEIGTIYQCFQKNLELSIKTGHNAP
                     KYRYDMCIDGYLLNLEDCNSKDNEYKILIRFIDDHAIMVYQNQM"
     gene            <230231..>230942
                     /locus_tag="CAGL0G02535g"
                     /db_xref="GeneID:9487990"
     mRNA            join(<230231..230268,230360..230570,230769..>230942)
                     /locus_tag="CAGL0G02535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999497.1"
                     /db_xref="GeneID:9487990"
     CDS             join(230231..230268,230360..230570,230769..230942)
                     /locus_tag="CAGL0G02535g"
                     /inference="similar to AA sequence:UniProtKB:Q3E833"
                     /note="similar to uniprot|Q3E833 Saccharomyces cerevisiae
                     YKR095W-A PCC1 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999543.1"
                     /db_xref="GeneID:9487990"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:B4UN00"
                     /translation="MSKNNTRDLSHTFTLTCITFLICTGYIYRDLHVPFETARDALIA
                     QRVLQPDPILRPEDFQVEYEAKATVLDIHFKAIDDRVLRTYAYQGSMSIFHLLGTDDS
                     EVVSKLRYIGQGRRGLKSSSYQVYHKMLLCTIRYTDHI"
     gene            <231428..>235315
                     /locus_tag="CAGL0G02541g"
                     /db_xref="GeneID:2888019"
     mRNA            <231428..>235315
                     /locus_tag="CAGL0G02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446473.1"
                     /db_xref="GeneID:2888019"
     CDS             231428..235315
                     /locus_tag="CAGL0G02541g"
                     /inference="similar to AA sequence:UniProtKB:P36168"
                     /note="similar to uniprot|P36168 Saccharomyces cerevisiae
                     YKR096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446473.1"
                     /db_xref="GeneID:2888019"
                     /db_xref="GOA:Q6FTH1"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH1"
                     /translation="MPQTFIQQPFGLPDSDTGLSRNNSNSPSARDILLEKNVTNEQRY
                     PRKDGYNYSHNISKTNTSINTNTNTTNLREKFSKIGKDTSRYNRTALHILDSLKKNKL
                     LLQGQLQDKSSRRSSLEGENNFEVYTYQNPIDENKQNGEESASPKLMLSRSTSKVNDL
                     NDSILVQFDDRSKLNSRRSSIFEPANVDMGINNDLASKEIGIDNVTKSISRLANSNDY
                     VVSRSHNEEISQIAGNPRVKKYLSKRGALKGDSIDNKADQKLYMYGNGENRIESHTET
                     GHFEQHAFGNCNDVVKGNPDINGYENIDDDDGQYPNEPEDCSNEFNNDDTDTTDTNQR
                     KNNEESKDDEEEDEDQGNNSNSNDKANNSNKPTQALVQKLQDIYKNIVRQEVELQEKC
                     AQLTSSQTTDLNSIWSIYRINVELVTNYVTFISTALLSSQSQYDLMIGQEIVETYRIG
                     RRLWVYGTITFLDVLKNFSSFMDPEVCSQFITHVFISISTMLADIPTKYSIPWMQRLG
                     DLSRMAIALYPSGFIDWKLSSEYWYNQALKYTYGYGKLYYHMSTIQQNTLEAFVNLGK
                     SVFCQDTFIPSPQYMQLVIDNIYQRAFIERGSNNTRNSQLIEYLKHSEVMLLPNFIGN
                     ENLQKVVMTYFEHKFGTDLHDLNIFQPRDIFLQNPENLKYFFRHAPAFAESHILQTVG
                     FGDSKNPFALLFDLPKFLKEKKDKKDRKKTKSSGEPTSNESVMSLDNISTDSLISSDQ
                     YFSNLESMQHPYLPPPRYDIWLKSLSYLNLTAVQCGVIVLRKFLHGPFVVALPHLMVW
                     TYFIISVCLKSETLVDEESRYFWSSFMRRLLPLNSIVSFLNVLIAYALDNSYYSTLIS
                     SISEELDSMDLQELLTKFNNNEELPEVWKCWGTLWFDAITDKSNTDTNSYEKIGVSDH
                     LFFDSPIDGIVFDSKDENGEKFWKRALRIIFLFKKIAETFDIGITLSHTAPVYCRRDD
                     VELNHILGSFSFKIEQHLLNGNTVQVEIENCLGAIIEMTEMPNEVNITMDATPPMSLQ
                     ENENIFEYTGYKRIAPELQNFDKNGELRSAANYTSWYSAQEIVPKSAASPENSVAGSS
                     PGRSFQSQDVEENIFSVFTNEEENSTSLLDGLNLETTSFVLDATSWLRHSAHIYKLAS
                     NSFLVFSICLTTFQELRFLRKSKDENVMEAAARAIIIIRQLYSDGKVIPLRFTGNIAT
                     HIEEHLEFEEQITWRSHVDEFVIESISKAQKKFLQPFVQNPVDNDSRFFVLVSDDENM
                     KRKAHEKEIRTFTTRFVFALCSEMGKGRLICTN"
     gene            complement(<235498..>237393)
                     /locus_tag="CAGL0G02563g"
                     /db_xref="GeneID:2887980"
     mRNA            complement(<235498..>237393)
                     /locus_tag="CAGL0G02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446474.1"
                     /db_xref="GeneID:2887980"
     CDS             complement(235498..237393)
                     /locus_tag="CAGL0G02563g"
                     /note="weakly similar to uniprot|P36026 Saccharomyces
                     cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446474.1"
                     /db_xref="GeneID:2887980"
                     /db_xref="GOA:Q6FTH0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FTH0"
                     /translation="MTADLVICNTEILKSLVSQVFETSIKKQYWVLTLCKVSQLLGQA
                     AKYLDKTETLGQEKLLESSYMNYAAGCFYIYLLVPNANQFQLEDTEYGTYLQLKNNYL
                     VKGEGDLTFQYLLDRVREKCRTSQTLEMNKNRNSGNFSVKLSQKANSCCDLSTVEDKS
                     QNTSTDSSGSSLECSDSKSALAKSPIDIDHDSKQYTLPIIINAITEEQKLSVFGIRNM
                     GNTCYMNSMLQCLFGSTQFRDLFLTDKFEMFKAETNSESLSIANDLSLLFKKMYQNGG
                     CAIIPKSFMETCKRLRPDFKIPHCQQDTQEFLMFVLERLRVELANTSATVKDRSLIAS
                     RSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFRGDVESKLICKHCNESASTFSSFYI
                     LSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTGENSWACPSCETKARYNVIDNDK
                     TYQQKHTNIGKHSKFPRFFSHIEAGKTERNSGANKFSQLKYDNLENEQRHRQQKKSET
                     ILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDNSSVTYRLYGTINH
                     IGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKTEINSITNNDAY
                     VLFYERI"
     gene            <238931..>240049
                     /locus_tag="CAGL0G02585g"
                     /db_xref="GeneID:2888168"
     mRNA            <238931..>240049
                     /locus_tag="CAGL0G02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446475.1"
                     /db_xref="GeneID:2888168"
     CDS             238931..240049
                     /locus_tag="CAGL0G02585g"
                     /note="highly similar to uniprot|P40495 Saccharomyces
                     cerevisiae YIL094c LYS12 homo-isocitrate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446475.1"
                     /db_xref="GeneID:2888168"
                     /db_xref="GOA:Q6FTG9"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG9"
                     /translation="MLRGSATRLTAMRGFSSTRLAQKALTIGLIPGDGIGKEVIPAGK
                     QILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTT
                     KVEGYSSPIVALRKAMGLFANVRPVKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTD
                     PATGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLF
                     REICKDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAA
                     LVGSLGVVPSANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAA
                     QPIYKAVDSNIRENQIKTPDLGGKSTTQQVVDDILSKI"
     gene            complement(<240244..>242310)
                     /locus_tag="CAGL0G02607g"
                     /db_xref="GeneID:2888400"
     mRNA            complement(<240244..>242310)
                     /locus_tag="CAGL0G02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446476.1"
                     /db_xref="GeneID:2888400"
     CDS             complement(240244..242310)
                     /locus_tag="CAGL0G02607g"
                     /inference="similar to AA sequence:UniProtKB:P40494"
                     /note="similar to uniprot|P40494 Saccharomyces cerevisiae
                     YIL095w PRK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446476.1"
                     /db_xref="GeneID:2888400"
                     /db_xref="GOA:Q6FTG8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG8"
                     /translation="MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSM
                     GLFNGSNVACLKRVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGT
                     YEVFLLMEYCEGGGLIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDI
                     KIENVLLSKGGIYKVCDFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLY
                     RGLPIDEKADIWALGVFLYKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIK
                     SMLREHPSDRPNVCQVLEEVSRMQNVPCPIRNFYLLRAMEKVKLSTEIDYPQLQLQKL
                     RNAQADNLSNPMIKPMPIAQRPTFSGNGMVNNNRTLPTVMVSNNVIGNGSQVWDNSKP
                     PEPQPIPQSRSFVKSSTLIGAPLSKSWGHNEFNFGSISNSPSVFQGAIVPAANQLQNK
                     DSSHQPKPSGMMKKNEQLQVTSTFASSPNTRTRTNSQGSSLYIPTSSEYRTRHVHTGD
                     NNSLKSSKLDSDKLDIAVQRSPSSRSDGSDFRLPLNPNSEKRKSIQLRVQHLLDNMSS
                     NEVKKSAQGYGKYTDELSSTGTNIPKVTPDSPVLADLIDFNDVPTIRIPSDKNQLSKS
                     GKIKPAPPPKPKKLRSNKKISTLSALRLEPKQNDRITSDATDVLMHLNVDDLEEDFKR
                     RFPSAV"
     gene            <243429..>244400
                     /locus_tag="CAGL0G02629g"
                     /db_xref="GeneID:2888401"
     mRNA            <243429..>244400
                     /locus_tag="CAGL0G02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446477.1"
                     /db_xref="GeneID:2888401"
     CDS             243429..244400
                     /locus_tag="CAGL0G02629g"
                     /inference="similar to AA sequence:UniProtKB:P40493"
                     /note="similar to uniprot|P40493 Saccharomyces cerevisiae
                     YIL096c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446477.1"
                     /db_xref="GeneID:2888401"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG7"
                     /translation="MARRLKGKGGAKGLKAALLNHKANVQQNKVLKKKTENKIKQKTQ
                     LNKNQKKQQQNSVEKSFIPFEKNETLMLVGEGDFSFARSIIEESYILPENLIVTSYDN
                     SYNELKLKYPHSFEENFKFLVDNNVKILYQVDATKLIKSLKLSKHTPWSKLMGPSWKF
                     KYLQNIMFNFPHTGKGVKDQDRNIRDHQELLFGFFDSAKQLYSLVNSNKKNLEVGQTM
                     GYNLSNNHDAKSNITEEGYGRIILSLFTGEPYDSWSIKILAKNNGLQLERSNKFQWEN
                     FPQYSHKRTNSEQDTTKPAKERDARIYIFKKYEKTKPKKVSEDSDEE"
     gene            complement(<244496..>245962)
                     /locus_tag="CAGL0G02651g"
                     /db_xref="GeneID:2888366"
     mRNA            complement(<244496..>245962)
                     /locus_tag="CAGL0G02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446478.1"
                     /db_xref="GeneID:2888366"
     CDS             complement(244496..245962)
                     /locus_tag="CAGL0G02651g"
                     /inference="similar to AA sequence:UniProtKB:P40492"
                     /note="similar to uniprot|P40492 Saccharomyces cerevisiae
                     YIL097w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446478.1"
                     /db_xref="GeneID:2888366"
                     /db_xref="GOA:Q6FTG6"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /translation="MAETTSLINEPDVDFHLKLNQHSFNIPYEQLQRNSRYLNRLIEK
                     EIDELNSHYERLNIALGSGNIEGDKKALQELKDIIRSVEIFEKRLQKRVNEEVPILKR
                     LEVRINFFKELENAKQQVADITPLMEWYLKFTNILIGDYLTRHTTSNSSPELGLPGVT
                     FLEQEGIQDLLDTDILLTGNRISTALVDNHDLRPLLDWINDSKSYLKKNGSRLEFEAR
                     FQQYIELLKASEYEEAIKCFQDYLLKFVNTNFNELTHASGLLLSINYCKEIMKAKASE
                     RSAILTKDDGNPLENEIRAYKYFFHKKPKIVEQQHVKPVDLSYMNLSQNTDFEKYMLL
                     LDDKRWGLLNELFLKDYYSLYGISQNDPLLIYLSLGISTLKTRECLHHRRVAKSSSPL
                     VDKKVEEEVLQNSCPVCDKTFAPIAESLPFAHHTQSQLFDDPIMLPNGNIYEAKRLKR
                     LAKYLVDIKAIELGETEVIDPIDKQIYNEADFITMYPT"
     gene            complement(<246455..>247531)
                     /locus_tag="CAGL0G02673g"
                     /db_xref="GeneID:2887990"
     mRNA            complement(<246455..>247531)
                     /locus_tag="CAGL0G02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446479.1"
                     /db_xref="GeneID:2887990"
     CDS             complement(246455..247531)
                     /locus_tag="CAGL0G02673g"
                     /note="highly similar to uniprot|P28834 Saccharomyces
                     cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
                     cerevisiae YOR136w IDH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446479.1"
                     /db_xref="GeneID:2887990"
                     /db_xref="GOA:Q6FTG5"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG5"
                     /translation="MFRTVQRRGMASMAKELVLPKKYGGRYTVTLIPGDGVGKEITDS
                     VVSIFEAENIPVDWERVDISTSDNIQDVSQAVESLKRNKIGLKGIWHTSADIADHGSF
                     NVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESL
                     KIITKAKSERIARFAFDFAKKYNRKSVCAVHKANIMKMGDGLFRNTVTEIGANEYPDI
                     QTSSIIVDNASMQAVAKPHQFDVMVTPSMYGTIIGNIGAALIGGPGLVAGAHYGREHA
                     VFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGLTESAKRIAKATHDVISLGQVT
                     TKDIGGSASTTEFTEAIIKRLGEL"
     gene            <248357..>248839
                     /locus_tag="CAGL0G02695g"
                     /db_xref="GeneID:2888063"
     mRNA            <248357..>248839
                     /locus_tag="CAGL0G02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446480.1"
                     /db_xref="GeneID:2888063"
     CDS             248357..248839
                     /locus_tag="CAGL0G02695g"
                     /inference="similar to AA sequence:UniProtKB:P40491"
                     /note="similar to uniprot|P40491 Saccharomyces cerevisiae
                     YIL098c FMC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446480.1"
                     /db_xref="GeneID:2888063"
                     /db_xref="GOA:Q6FTG4"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG4"
                     /translation="MSAAHTYRSVVRSIVKFERPNVLQQLAKKQKEDIAKLTYRRIQV
                     VRDQMTHKSDPVKLKELNKEAILLGAQVEKLKKWDPARDKRALFMKDRDLVRDIVMSS
                     LQDTRSKSHLKNIEMFLTNQREYEELIERYNPGKKLSQDEKVKRTANKVGLEIPPDLV
                     "
     gene            complement(<249013..>250560)
                     /locus_tag="CAGL0G02717g"
                     /db_xref="GeneID:2888278"
     mRNA            complement(<249013..>250560)
                     /locus_tag="CAGL0G02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446481.1"
                     /db_xref="GeneID:2888278"
     CDS             complement(249013..250560)
                     /locus_tag="CAGL0G02717g"
                     /inference="similar to AA sequence:UniProtKB:P08019"
                     /note="similar to uniprot|P08019 Saccharomyces cerevisiae
                     YIL099w SGA1 sporulation specific glucan 1
                     4-alpha-glucosidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446481.1"
                     /db_xref="GeneID:2888278"
                     /db_xref="GOA:Q6FTG3"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG3"
                     /translation="MFLWIVGVLSLYVSLPFVKFLRSDAVSWHDRYVPRGNFTEWVHA
                     QNSIALERLLDNFIDENGAILASPSRNEPDYYYQWVRDSAIVVNTLVKQLPAIEQNLQ
                     YDQLVHRRILQFLNNSFVLQRLDNLSGKGVPTSIRGLGEPKFNVDNTQFNENWGRPQN
                     DGPPLRIITILNYLQHLNNTGKQIDHIITHNAKEGFLPFKVTKDIFDNILFWDLQFIV
                     DEWKSENFDLWEEVRGHHFFTSVMQLYAIERTLPIAKQNHLLRKKFVESLVDTRHKIR
                     EFILDNRTGFISKSANHIISCPEIYGKRSGLDIATILASIYTHDGSNTSEHLDLFHVD
                     NRYILNTLYGLTESMSDLYPINKENERHSKKHNLAAVALGRYPEDVYDGVGISEGNPW
                     YLATAAAAEHMYKLARKFIEDEKSIPISPSDEFWKFIIETDSKDKFDVKYHSHAFNET
                     IKSFVALGDSFLDKIRLHVADDGSMSEQINKYTGYNQGASDLTWSYGSYLNAYQAREE
                     ILAYLSH"
     gene            <252478..>254559
                     /locus_tag="CAGL0G02739g"
                     /db_xref="GeneID:2888068"
     mRNA            <252478..>254559
                     /locus_tag="CAGL0G02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446482.1"
                     /db_xref="GeneID:2888068"
     CDS             252478..254559
                     /locus_tag="CAGL0G02739g"
                     /note="weakly similar to uniprot|P40489 Saccharomyces
                     cerevisiae YIL101c XBP1 stress-induced transcriptional
                     repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446482.1"
                     /db_xref="GeneID:2888068"
                     /db_xref="GOA:Q6FTG2"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG2"
                     /translation="MRLTDSPLDDYQRLCFSQSMDLKDRVRHQTYKSNLAPTMHSLVS
                     HLKPQLNHSSMTAADSKSDKGLMCFEYQFPDLVAQSQETADSNTHIQYESGNRPYGLN
                     AETDTPTAHRMSTEPSDGALDATLLLPELQQTTSPRLTGHKRGYSSPSGPNGTTISKN
                     QQFRISNQSNTHKFINTNNCILWTNFDKNEPASEENFVFLTGIWRLYQDVMKGLIQIP
                     RKGKTSKERQDFCRQEFDFIMSNCFCDDQLKTAKDQSDPVDYSRKFHRRRSTGSISFT
                     QKTKSNNSVTSENSGNTHSTSNSSVNYLDFHWFDISEKVRSQIFEQFKQHLEKDRNVD
                     CSTIPKAEEYIQRIRGGYIKIQGTWVPWYIAKLICIRFCFPIRYLLVPIFGEQFPVEC
                     ENYFFNVHMTNLKEFLENEHLINTVRRRQKSTGLATPPFLTSSTFGNGSIDSPFSDER
                     EEMEISPFHKYSNNLSPNYSPRMRKRRRSDNNLSPMSPSTKLAFRKTPPIREEPEPYE
                     HYTSGFSTIDNKLSTNNTVKEETHPYRKRALSWSYTQNTSQRTKLPPISSLIESINWK
                     TNSDHVNVSEPTPTVQTLSKLASFYTTRGHKYSYPSNICTVSSNEHNKLASPVKNSNM
                     ETFLTARENQTGSHHYNHITEPHMKHNYIRQRDMVPRVISDSLYPDLGYKENKVDFIC
                     LRNQTHLQENV"
     gene            complement(<254976..>256262)
                     /locus_tag="CAGL0G02761g"
                     /db_xref="GeneID:2888069"
     mRNA            complement(<254976..>256262)
                     /locus_tag="CAGL0G02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446483.1"
                     /db_xref="GeneID:2888069"
     CDS             complement(254976..256262)
                     /locus_tag="CAGL0G02761g"
                     /note="highly similar to uniprot|P40487 Saccharomyces
                     cerevisiae YIL103w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446483.1"
                     /db_xref="GeneID:2888069"
                     /db_xref="GOA:Q6FTG1"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /translation="MDNTTEKKEPTKVPRRRFVGKRKTDGKTITTVKADGNEVVRQTK
                     SRVHVGRSLNHIPDDIMEDEELNEAIKLLPQNYNFEIHKTVWNIRKHGAKRVALQMPE
                     GLLIYSLLISDILEQFCNVETVVMGDVSYGACCIDDFTARALDCDFIVHYAHSCLVPI
                     DITEIKVLYVFVTIAIDETHVIKTLQKNFPKGSRLATFGTIQFNPTVHSIKDTLLNDK
                     EHMLYIVTPQIKPLSRGEVLGCTSERLDKNQFDAMVFIGDGRFHLESSMIHNPEIPAF
                     KYDPYNRKFTRERYDQKQLVQVRGEALQVAQKGKVFGLILGALGRQGNVDTVRNLEEK
                     LIKAGKTVVKIILSEIFPQKLAKFDKIDVFVQVACPRLSIDWGYAFPKPLLTPYEANV
                     LLNHDVMFSEEYYPMDYYETNGYGRGRIPEHALVKN"
     gene            <256580..>258052
                     /locus_tag="CAGL0G02783g"
                     /db_xref="GeneID:2888335"
     mRNA            <256580..>258052
                     /locus_tag="CAGL0G02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446484.1"
                     /db_xref="GeneID:2888335"
     CDS             256580..258052
                     /locus_tag="CAGL0G02783g"
                     /inference="similar to AA sequence:UniProtKB:P40486"
                     /note="similar to uniprot|P40486 Saccharomyces cerevisiae
                     YIL104c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446484.1"
                     /db_xref="GeneID:2888335"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q6FTG0"
                     /translation="MITPKFEVSQDDDFVYVNIKITNIRFNSGGLEVVVDKTMLFFYL
                     SPYYLRLRFPNEVLDDDDHPTEAQYRSKDECIFIKLPKAVKGQYFDDLDIPTKLLARQ
                     GDIIGADMVEKSTEIKKGPLIQEIDSTTNTEKNVENITQMGEQFDWEIKQNVSSEPTL
                     SLNKYGFDAQYNGLIGVSIPNGNDINELNDPENTTENDRIKERLSKENLKFDPDYYVS
                     EYMVSKYGSEEDLEVNGIKKLLGFTPRIVKDFLGWYKSIEDKESFYPVEFTEFEQNQM
                     VNNIPKKEYLVNEIDHIKKLYLTIVNVVFAYIYDSIENEDASNSESAWNIGKLTPQIA
                     FLDQKLQLEEVEGVSIIKVLIYTGFRRALSYPLHRNYDLCNKAWEYTYYILRGGKKLV
                     LRALLKVHEIFRFHDAYYVYNKILLDDLVSWFINNGNENVLRGLTMEFKKELDTISKE
                     TIDFDCLVELDQETGEPVWENMTIKEMEILAEAEYQSTQE"
     gene            <258452..>259330
                     /locus_tag="CAGL0G02805g"
                     /db_xref="GeneID:2888285"
     mRNA            <258452..>259330
                     /locus_tag="CAGL0G02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446485.1"
                     /db_xref="GeneID:2888285"
     CDS             258452..259330
                     /locus_tag="CAGL0G02805g"
                     /note="highly similar to uniprot|P40484 Saccharomyces
                     cerevisiae YIL106w MOB1 required for completion of mitosis
                     and maintenance of ploidy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446485.1"
                     /db_xref="GeneID:2888285"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF9"
                     /translation="MSFLQNFHLSPGQTIRSTRGFKWNSGSNQNGMADSQDTSSGVKS
                     DRMLFNNSPLNPSNDNIQILSTPKKQQQTAPVVTDFNYTPSHQKPFIQPQAGTTVTSH
                     QDIKEIVEMTLGSEGVLNQAVKLPRGENENEWMAVHCVDFYNQINMLYGTITEFCSPQ
                     TCPRMIATNEYEYLWAFQRGQPPVSVPAPKYVEALMKWCQDQFDNESIFPAKTSGQFP
                     DKFIERHVIPILRRLFRVYAHIYCHHFNEILELNLQTVLNTSFRHFCLFTQEFQLLKA
                     SDFGPLLELVTELRDR"
     gene            complement(<259569..>261818)
                     /locus_tag="CAGL0G02827g"
                     /db_xref="GeneID:2888354"
     mRNA            complement(<259569..>261818)
                     /locus_tag="CAGL0G02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446486.1"
                     /db_xref="GeneID:2888354"
     CDS             complement(259569..261818)
                     /locus_tag="CAGL0G02827g"
                     /inference="similar to AA sequence:UniProtKB:P40485"
                     /note="similar to uniprot|P40485 Saccharomyces cerevisiae
                     YIL105c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446486.1"
                     /db_xref="GeneID:2888354"
                     /db_xref="GOA:Q6FTF8"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF8"
                     /translation="MSKHNTMTSNISEMMSQQQQNLQHLHSLQKHTRSLTDYTNTYLQ
                     NFQQQMQQQPHVQVQGAVQDNSQRNPQLQQVRTYSGSMMLPNGYNLNGAVNQSANPPQ
                     VVINPSQNMSTITSIDNPVLQQQQQPQQQPQQQLQQQLQQQLQQQQQQQQQQQQQQIN
                     SPTPLSPPIGSTIQQPIQQLQPQQQQQGKNSFTSITSKNIQNNNQTQLDYSTKAKSPL
                     AVLIPTTGQPTDVLAARFSAWRNVIRSIIVYLTEIASIEDEIVRQQLRLSHAVQFPFF
                     TIENQYQPTSSEDRYTQKFFLPLGSGSVQDLPTILNQYHEALASNASNASRELTNDVI
                     PRLEDLRRDLLVKIKEIKSLQSDFKNSCAKELQQTKQDMKHYIDSLKEARYGTPKQDP
                     YLAKIALDKQIKKQLIEENFLHEAFDNLETSGAELEKVVVMEIQNALTIYARLLGQQS
                     QLIFDILISKLDMGFFNMNPQYEWDTFISRDPNFLQPNVPMRNLKEITYKYQHDPFTY
                     EIRSGYLERRSKFLKSYSKGFYVLTPNFLHEFKSIDRKKDLVPIMSLSLNECTVTEHS
                     KKGSHEAKFVLHGKQNGLIRRGHNWVFKTDSYESMLEWFNDIKVLSSTSNYKEKCKFV
                     QNKLNLDADGKKLTKININENSNMQSPNPNESLNTITTPGRDIGTPQISINIDQNINE
                     PVTPAHMTEDNISEMADRSTYIRSSTPRLDNQTNTNTSMSSIPDTNTSELHANGGGVY
                     IQTPFSKDY"
     gene            <262926..>263609
                     /locus_tag="CAGL0G02849g"
                     /db_xref="GeneID:2888355"
     mRNA            <262926..>263609
                     /locus_tag="CAGL0G02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446487.1"
                     /db_xref="GeneID:2888355"
     CDS             262926..263609
                     /locus_tag="CAGL0G02849g"
                     /inference="similar to AA sequence:UniProtKB:Q08926"
                     /note="similar to uniprot|Q08926 Saccharomyces cerevisiae
                     YPL186c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446487.1"
                     /db_xref="GeneID:2888355"
                     /db_xref="GOA:Q6FTF7"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF7"
                     /translation="MVAIIYRHKAKEFNELKIAGGFNNWEIVPMQWSPAKEQWEYELD
                     LEKIPAAVTKIHFKFIDDQGNWFTDSNYAKEIDEHNNENNVKLLPGHQETATASDDKD
                     VSYQDEQLEKGPITPAPSLVAEKTSEKHTTTEDPKPVPEALPEVTETIVEEPAKALTD
                     EEDTANSSEEQTRVEEEEPEQIEEVTDTNETKNTVIKGSDADMYKTLLQKIIEFFVSW
                     FAWIRGDAK"
     gene            complement(<263943..>264266)
                     /locus_tag="CAGL0G02871g"
                     /db_xref="GeneID:2888058"
     mRNA            complement(<263943..>264266)
                     /locus_tag="CAGL0G02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446488.1"
                     /db_xref="GeneID:2888058"
     CDS             complement(263943..264266)
                     /locus_tag="CAGL0G02871g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446488.1"
                     /db_xref="GeneID:2888058"
                     /db_xref="GOA:Q6FTF6"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF6"
                     /translation="MISSPSVKVPKTLKTKSSREQNLRNSRCSEISIRSWAKNAPEGF
                     NLLKDAVITAIGCEICVTFFKIETKSKLKDTLKRYQVLGTTCKALYTVKVFQTKKKLL
                     EENIS"
     gene            complement(<264566..>265861)
                     /locus_tag="CAGL0G02893g"
                     /db_xref="GeneID:2888057"
     mRNA            complement(<264566..>265861)
                     /locus_tag="CAGL0G02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446489.1"
                     /db_xref="GeneID:2888057"
     CDS             complement(264566..265861)
                     /locus_tag="CAGL0G02893g"
                     /note="highly similar to uniprot|Q06892 Saccharomyces
                     cerevisiae YPL188w POS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446489.1"
                     /db_xref="GeneID:2888057"
                     /db_xref="GOA:Q6FTF5"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF5"
                     /translation="MLTSYRILPRRVLLSGVNRAIIRYYSPDIGGANVGKGRFVKIKP
                     VSNLRASTAADFFTSPNSKLQSLVWRNPLQNVLVTKKPWTPTTREAMVQFITHLHESY
                     PEINVIVQPDVAEEISQDFKATVHNDPNRPHLLFTGTEEDIATRTDLLVTLGGDGTIL
                     HSVSMFGDKIAPPVLAFSLGTLGFLLPFDFKEHEKVFSQVISSRAKCLHRTRLQCHVV
                     RNGNSTPIVAHAMNDIFLHRGNSPHLTNLDIYIDGEYLTRTTADGVTLSTPTGSTAYS
                     LSAGGSIVSPLVPSILLTPICPRSLSFRPLILPHSSYIKIKVESKMNMNVANHIVKLS
                     IDGIPQEDLVAGDEIHVINEVGTIYIDGTQFPIAAKKQTADKATITGKTPDKDVQKRS
                     GIYCVAKTENDWIKGINELLGFNSSFRFIHRGKDDDEKK"
     gene            complement(<267032..>267967)
                     /locus_tag="CAGL0G02915g"
                     /db_xref="GeneID:2888072"
     mRNA            complement(<267032..>267967)
                     /locus_tag="CAGL0G02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446490.1"
                     /db_xref="GeneID:2888072"
     CDS             complement(267032..267967)
                     /locus_tag="CAGL0G02915g"
                     /note="highly similar to uniprot|P53252 Saccharomyces
                     cerevisiae YGR086c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446490.1"
                     /db_xref="GeneID:2888072"
                     /db_xref="GOA:Q6FTF4"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF4"
                     /translation="MHRTYSLRSSRAPTASQLQNPPPPPSSTKGRFFGKGGIAYTFRK
                     TTAGQIGPELSRKLSQLVKIEKNVLRSLEVAANERRDAAKQLSLWGLENDDDVSDITD
                     KLGVLIFEISELDDQFIDRYDQYRLTMKSIRDIEGSVQPSRDRKDKITDKIAYLKYKD
                     PYSNKIEVLEQELVRAEAESLVAEAQLSNITRSKLKAAFNYQFDSIIEHSEKIALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKPTLSFKQ
                     DYEEYEEDEEEGEQQEGEAWAEEEHQEGVEESQAA"
     gene            complement(<268985..>270679)
                     /locus_tag="CAGL0G02937g"
                     /db_xref="GeneID:2888349"
     mRNA            complement(<268985..>270679)
                     /locus_tag="CAGL0G02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446491.1"
                     /db_xref="GeneID:2888349"
     CDS             complement(268985..270679)
                     /locus_tag="CAGL0G02937g"
                     /note="highly similar to uniprot|P06169 Saccharomyces
                     cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
                     cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
                     cerevisiae YGR087c PDC6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446491.1"
                     /db_xref="GeneID:2888349"
                     /db_xref="GOA:Q6FTF3"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF3"
                     /translation="MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLR
                     WAGNANELNAAYAADGYARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     STVSRAKQLLLHHTLGNGDFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQ
                     RPVYLGIPANMFDSKVSSKLLDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILA
                     DACTSRHDVKKETKRLIEVTQFPSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFV
                     EESDLVLSVGALLSDFNTGSFSYSLNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLL
                     EELPAVVKGRTDNRVVPRQKEPSTTLNGKDAIKQEWMWKHVGKFLQEGDVVVTETGTS
                     GFGIVESKFPRNTVGISQVLWGSIGYALGSTVGAAFAAQEIDPKKRVILFIGDGSLQL
                     TVQELSTAARWGLTPYIFVLNNNGYTIERLIHGETQGYNDIQSWDHSLILPAFGAKNY
                     ENKRVATYGEWNDMVNDKQFNKNDKLRMIEVMLPTMDGPENLKKQAKLTASINAKN"
     gene            <272520..>275276
                     /locus_tag="CAGL0G02959g"
                     /db_xref="GeneID:2888352"
     mRNA            <272520..>275276
                     /locus_tag="CAGL0G02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446492.1"
                     /db_xref="GeneID:2888352"
     CDS             272520..275276
                     /locus_tag="CAGL0G02959g"
                     /inference="similar to AA sequence:UniProtKB:P53253"
                     /note="similar to uniprot|P53253 Saccharomyces cerevisiae
                     YGR089w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446492.1"
                     /db_xref="GeneID:2888352"
                     /db_xref="GOA:Q6FTF2"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF2"
                     /translation="MVSQRTKRNPDVEVLSFARNHRFKDTLALFLVFLSFNHVMLFLL
                     LVVFIVATRFKNALANSFILFFLSKKPSPDIQVVSNSAKNKKRYVTPPTLYKLLAMKN
                     IPFIGTLHDNSILRPVPLIVIEYLFVTILRIYGGNYFTDPIEYFAIGIVASFLINDPN
                     TCLTHAMICSVLYSLSKHFFYSVLPLVFGKGIMGFILSFKSSGHRGQLIRQYLLRNSA
                     ILRLFDNLCGKVNSTDSSLSLYIDEICFYLSFHIIFYLIGRRYFMPVPIPESDLPSSL
                     RTSTDTRLPSSGNQKTQSSSTHKNNTSETRNNTQVRNRSNSHAKHGRNVSMSTNRTQH
                     QSTAINGHSHASNLPTTQANVSDTKSINASDSYIINAISNNLRTLRQTPFFSNLVSKY
                     NVFEPDIVSPERSNSLAMPTNVDYKDVKKNESNSASNLEGLRNEFYQLKVDFSQTTDE
                     RNLDTDITPTSNIENFIRQLFEKKKSYIIPPLWSMFLTVKTANLERKYLEKKSEDVLT
                     PISSRDTDNDAKESNDIDMLDIDTKLAIAELSDNGIKKSVFDEGTGQENLAMIIQSSS
                     DDYNQLNLVSMKDNIFNRQENDYKVCIANIGCNSITFHIENLFEGELIVLVNGVIWSE
                     VSCSLIMEHEGEELAVVNGLVPSCSYDIQFVNRLNQTQDHLMSDIVVRTASGNSGDFN
                     GNFGSVDFTFPSYYHRKFLSPLLTLKHSVLTTNTNLAEERMKLKKSKKEISKKITSLK
                     QEIDHFRSKIENNATNEEKNASKVESLKIALQQSNSTILAWEEELKQLSEKQIEVEEK
                     YLIQKDLHLRKQLEFSKEEEKLKALVKVKKENVERLQEEVQQLTGKLEKLNARNSKVS
                     KEVEQQNKAIDDFINQLAKAIEKNRQSWEQQQSLKYNEYELVVKALQQDIARFESGNT
                     DQNR"
     gene            275527..275598
                     /locus_tag="CAGL0G02981r"
                     /db_xref="GeneID:2888353"
     tRNA            275527..275598
                     /locus_tag="CAGL0G02981r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (TGT) cove score=79.33"
                     /db_xref="GeneID:2888353"
     gene            <276362..>279937
                     /locus_tag="CAGL0G03003g"
                     /db_xref="GeneID:2888356"
     mRNA            <276362..>279937
                     /locus_tag="CAGL0G03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446493.1"
                     /db_xref="GeneID:2888356"
     CDS             276362..279937
                     /locus_tag="CAGL0G03003g"
                     /note="highly similar to uniprot|P53254 Saccharomyces
                     cerevisiae YGR090w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446493.1"
                     /db_xref="GeneID:2888356"
                     /db_xref="GOA:Q6FTF1"
                     /db_xref="InterPro:IPR005554"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF1"
                     /translation="MSGVKRKGPEVVEEEPVQKRQVIEKHTDGSDDEASGDEHEVKRT
                     KSDTTSQNIQIARETAELFKSNIFKLQIDELLAQVKLNDKHILKMEKVLHKFYDMVQQ
                     IPEWKDKSLSDVESFFDNKIVAVPFADPKPSLANTNYKFGYLKPGVDLIGSFALKMGI
                     YQPQGSNVDILLTMPKELFDKKDFLNFRCLHKRSVYLAYFTHHFSILLKKNKLDHFMS
                     VKYSYLNNDPLLPILTVTCSKNPEHSSDEYNFHKTKFSIKFIIGFPDGLFDPKKLLPN
                     KNCIRLAGTQDVNDLPATPLYNFAVQSSTTFSSYLKFLYHNKKQTAAFRQAAILGKIW
                     LEQRGFSSKTAHSGTLGGFGSFEFSMLMAALLHGGGNNANKILLHGFSSYQLFQGTIK
                     YLATMDLCNDGHLQFSSDISSETHKHSKYIEEGFQTPTIFDKTRKVNILTKMTTNSYY
                     MLKQYANETLGMLNNVVQDKFSSVFLINLNRIPEIKYDSCIEVKLQPDDTLISKFGSA
                     ERIKFITFENYLTNKVSTVLKYALGKRVKYMEIKLEGKRSDFPITKRKVYSHSSGYNF
                     EYILIQLILDTDEAEKLVIRGPEHTSELTPEAAMFKNFWGKKSSLRKFKNGEISHCCV
                     WQSSSEVSVVTSIVDYVIKMHISERANVNNEGTKHLHKQLPLPNLPSSSATSIQNLSS
                     FFNLKKSFDELYKILFKMELPLSIKSILPVGSAFRYTSLCQPVPFSYSNPDFLQDVVL
                     EFETSPKWPDEIIALEKAKTAFLLKIHDKLVENYAPEYKSYFLRDESIPYNLDIATLN
                     ILTPEGYGFKFRVLTERDEVLYLRAISNARNELKPALEKTFLKFTARYQASVRHTRTI
                     ENLSHAYQLYSPVVRLFKKWLDKHLLLSHLDEELVELIAMKPFVDYTPFNVPGSLQNG
                     FLKVLRFISQWNWKEDPLILDFVKPGTENENSGDISNGELTSSTLKKLSERLTLQQYK
                     AIQSNFANIRNSDPNGVHLQYFVASRNDPSGILYSSGIPLPIATRLTALAKIATNIIS
                     THGFNNQTIDLLFTPGLKDYDFVVQMKTPVSLKISSGIIEPSEFKNISNGASRSFPDD
                     LDDMSEKMDPTLQLVKYLNMKYSNSIVFSSHKYVGVNGGEKGDVNVITGLIKPTFKKE
                     NKFRVGMDCNVKPIDEEKVILNKEAIFHEIAAFGHELITDFEVNN"
     gene            <280230..>281669
                     /locus_tag="CAGL0G03025g"
                     /db_xref="GeneID:2888350"
     mRNA            <280230..>281669
                     /locus_tag="CAGL0G03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446494.1"
                     /db_xref="GeneID:2888350"
     CDS             280230..281669
                     /locus_tag="CAGL0G03025g"
                     /inference="similar to AA sequence:UniProtKB:P49704"
                     /note="similar to uniprot|P49704 Saccharomyces cerevisiae
                     YGR091w PRP31 pre-mRNA splicing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446494.1"
                     /db_xref="GeneID:2888350"
                     /db_xref="GOA:Q6FTF0"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="InterPro:IPR019175"
                     /db_xref="InterPro:IPR027105"
                     /db_xref="UniProtKB/TrEMBL:Q6FTF0"
                     /translation="MSDIESEADLLADLDNDFEDNEISDGGDELEDKSIEDLDVTEAY
                     DFKNQHYEANDEDQIIVDNSAKTLKDLVKYLGAKSNVDHKGLQTEIVNLETIKHLIAI
                     SSNEPEIIKTLNEIQQYCKVISEKCYFELTEIYEDKFSELKSILRLPHQYAQCISLLE
                     QGLELEQVVLRFEELCSTSRELIMVLNMSLRADYKGNYKLTDTNKKSLHKLTSIIFEA
                     HDIIRFVSVEIANRIGEIAPNLCALLGTNTASLLVSHTGGLLQLSKIPSCNIANIGKK
                     NTKDHNILNFSNPGGYIFQNELVQNQPIENHKQMMRMLSSKVSLAARVDAGLKTGDKN
                     NKLGKQWRVEIEEKIKKIRAPPNISDVKALPIPEDKPKKKRAGRKFRKYKEQFKLSGT
                     RQLQNRMVFGKQEATIYDTFGDEVGLGMTSQRKNGLAISTTGSSFGVKKPQYIQKKLK
                     DSKRSTQEYIDALADRIDEHANLIKPNGS"
     gene            <282299..>283918
                     /locus_tag="CAGL0G03047g"
                     /db_xref="GeneID:2888351"
     mRNA            <282299..>283918
                     /locus_tag="CAGL0G03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446495.1"
                     /db_xref="GeneID:2888351"
     CDS             282299..283918
                     /locus_tag="CAGL0G03047g"
                     /note="highly similar to uniprot|P22204 Saccharomyces
                     cerevisiae YGR092w DBF2 ser/thrprotein kinase or
                     uniprot|P32328 Saccharomyces cerevisiae YPR111w DBF20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446495.1"
                     /db_xref="GeneID:2888351"
                     /db_xref="GOA:Q6FTE9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE9"
                     /translation="MNHFNHAYLRDHTPTPSPKKDGVNNLEQELSAMDIDDSANDTNI
                     DELLHSPKKLPAGFRSKASNNKTQRLVGVCKMYFLEYYCDMFDYVISRRQRTKQIMEY
                     LRQENENGRLDEHTADTEWRGYLAKENNILRKRRLKPKNNDFEMLTQVGQGGYGQVYL
                     ARKRDTKEVCALKILNKKLLHRLNETNHVLTERDILTTTRSEWLVKLLYAFQDSSSLY
                     LAMEFVPGGDFRTLLINTKYLKSTHARFYISEMFCAVNALHELGYTHRDLKPENFLID
                     AKGHIKLTDFGLAAGTVSNERIESMKIRLEEVKNLEFPAFTERPIEDRRKMYHDLRDT
                     DINYANSMVGSPDYMALEVLEGKKYDFTVDYWSLGCMLFESLVSFTPFSGATTNETYE
                     NLRHWRKTLRRPRLGNGRYAVSDRTWAFITSLIADPINRLKSFEHVKRMPYFSEIDFS
                     KLREMSPPFIPQLDSEVDAGYFDDFTNEADMAKYADVFKRQNKLNAMIDDSAVDSKLV
                     GFTFRHRNGKHGSSGILYNGAEHSDPFATFY"
     gene            <284268..>285728
                     /locus_tag="CAGL0G03069g"
                     /db_xref="GeneID:2888363"
     mRNA            <284268..>285728
                     /locus_tag="CAGL0G03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446496.1"
                     /db_xref="GeneID:2888363"
     CDS             284268..285728
                     /locus_tag="CAGL0G03069g"
                     /inference="similar to AA sequence:UniProtKB:P53255"
                     /note="similar to uniprot|P53255 Saccharomyces cerevisiae
                     YGR093w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446496.1"
                     /db_xref="GeneID:2888363"
                     /db_xref="GOA:Q6FTE8"
                     /db_xref="InterPro:IPR006767"
                     /db_xref="InterPro:IPR006768"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE8"
                     /translation="MKIMVANPGLENTKEALDKIQIANEKNGPFETVFLLGQNKEDTS
                     YDLKDTNTILVTNQLKNGRTTRKSSVIILHGFGIMKLASGLVVGYITLSKNSLQQEKK
                     SILEYFKASKEFIDVLVTNIGSKAVASHLQYKANGNSIIDEVMKHCKPQYHLTYDGDR
                     GYHDMKPFCWGETSSDSQITRYYNLPSYSPITKSKWIVAFSIEPGKDFNEINDYKNEL
                     GTNPYLLKPALKRDRSGIEQNAHTKKTKIDSTTCHFCFSNPNVEDQMIVAIAKHSYLT
                     LAKGPLTVPKGDMSFSGHALITPINHVAKIDKSLDNELSKEIELFESRVAKMNYKLFD
                     CSTVVFEIQSDKAIHFHKQVIPVPKYLITKFERALDRQVHINSERGNCKLEFEKFDGL
                     DNEEYRKIVGRKDTNYLQFTIYETDTSKATIYISSFDITERLDLQYGRRTLAFVLNLP
                     KRVQWNSPICQQSKEQELKEAQLYQKSFKNFDFTLE"
     gene            <286259..>289576
                     /locus_tag="CAGL0G03091g"
                     /db_xref="GeneID:2888362"
     mRNA            <286259..>289576
                     /locus_tag="CAGL0G03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446497.1"
                     /db_xref="GeneID:2888362"
     CDS             286259..289576
                     /locus_tag="CAGL0G03091g"
                     /note="highly similar to uniprot|P07806 Saccharomyces
                     cerevisiae YGR094w VAS1 valyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446497.1"
                     /db_xref="GeneID:2888362"
                     /db_xref="GOA:Q6FTE7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002303"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE7"
                     /translation="MSRRLLSLTHNCFRYQQKFHVSLLSPVNNSIWKSHFYNQKRYFR
                     MSDLDNLPPVDPKTGEVIINPLKEDGTEKTPKEIEKEKKKAEKLLKFAAKQAKKKAAS
                     NAGGNSEKKEKKKAKKEVEPIPAFVDATVPGEKKILVSLDDPALKAYNPANVESSWYD
                     WWVKSGAFDPEFTADGKVKPEGLFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMK
                     GKTVLFLPGFDHAGIATQSVVEKQLWAKEKKTRHDFGRTKFVEKVWEWKEEYHQRIKN
                     QIKFLGASYDWNREAFTLDPQLSKSVVEAFVRLHDDGTIYRAARLVNWSVKLNTAISN
                     LEVENKDVKGRTLLSVPNYDEKVEFGVLTSFAYPVADSDEKLVIATTRPETIFGDTAI
                     AVHPDDARYKHLHGKFVQHPFLPRKLPIICDSEAVDMEFGTGAVKITPAHDQNDYNTG
                     KRHNLEFINILTDDGLLNENCGPEWQGMKRFDARKKVIEDMKKLNLYIGQEDNEMTIP
                     TCSRSGDIIEPLLKPQWWVAQGEMAKDAIKAVKNGEIKIAPKSSEAEYFHWLENIQDW
                     CISRQLWWGHRCPVYFIDIEGQENDRNDGNYWVAGRDLAEAETKAKAKFPDAKFTLHQ
                     DEDVLDTWFSSGLWPFSTLGWPDKTKDMEDFYPFSMLETGWDILFFWVTRMILLGIKL
                     TGSVPFNEVFCHSLVRDAQGRKMSKSLGNVVDPLDVITGIKLEDLHAKLLMGNLDPRE
                     VEKAKLGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRVEGYRKFCNKIYQA
                     TKFALMRLGDDYVPPAKEGLSGNESLVEKWILHKLTKTSQTVNDALEKRDFLTSTSAI
                     YEFWYLICDVYIENSKHLIQEGSDLEKKSARDTLYILLDNALKLIHPFMPFISEEMWQ
                     RIPKRSTETVNTIVRASYPVYQKVYDDEKSAASYELVLDITKEARSLLAEYNILKEGK
                     VFVESDHTESFETAQSQKDSIVSLIKAINEVDVVRSASEIPEGCVLKAVNPQVNVHLL
                     VKGHIDIDAEIAKVEKKIEKARKTKQGIEQIINGKDYDTKANEQAKEANKVRLENSIA
                     DIEGFETTIENLKRLKL"
     gene            complement(<289747..>290448)
                     /locus_tag="CAGL0G03113g"
                     /db_xref="GeneID:2888364"
     mRNA            complement(<289747..>290448)
                     /locus_tag="CAGL0G03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446498.1"
                     /db_xref="GeneID:2888364"
     CDS             complement(289747..290448)
                     /locus_tag="CAGL0G03113g"
                     /inference="similar to AA sequence:UniProtKB:P53256"
                     /note="similar to uniprot|P53256 Saccharomyces cerevisiae
                     YGR095c RRP46 involved in rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446498.1"
                     /db_xref="GeneID:2888364"
                     /db_xref="GOA:Q6FTE6"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE6"
                     /translation="MSQDIVVELGLLSEVDGSAKLLMNSTNVLCAVTGPVEPKARQEL
                     PTEMALEVIVRPAKGVPTPREKYLEDKIRAIFTPLITRHKYPRQLCQITCQIMEAGEN
                     EQLHNQKELSACVNSALLALVNAGVALNDLAAAVTIAVIDDQSQENKAQYIIGPSDEE
                     LEKSSSVHTIAMEVGDNGKKVKRVLLIESNGIFNDKVIFDILELSESACLNLCSNWRG
                     VLTKHIQKELDLQSS"
     gene            <290834..>291757
                     /locus_tag="CAGL0G03135g"
                     /db_xref="GeneID:2888325"
     mRNA            <290834..>291757
                     /locus_tag="CAGL0G03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446499.1"
                     /db_xref="GeneID:2888325"
     CDS             290834..291757
                     /locus_tag="CAGL0G03135g"
                     /inference="similar to AA sequence:UniProtKB:P53257"
                     /note="similar to uniprot|P53257 Saccharomyces cerevisiae
                     YGR096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446499.1"
                     /db_xref="GeneID:2888325"
                     /db_xref="GOA:Q6FTE5"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /translation="MNKKDHLRKDEEVSTTNSLVAGSLSGLFARTCIAPLDTVKIKLQ
                     VTPHNKNANVLINILKREGIRGFWKGNVPGSIMYIIYGGAQFGSYTYIGSFLRGGLDL
                     NISPQLYSCLVGSLAGMTSSLASYPFDVLRTRFAANSQGQLIKLRDEIMAIWSHEGLM
                     GFFSGCGSSMINIGLNTAIMFGVYESIKIFTEERSKLSDRRDPFTLLNELAGPISGFT
                     SKLATFPLDTVRRRIQIRNSPNEERHDREFTKDIYKSYKNRRFLGVGISMVQQEGPLS
                     LYRGVTMSLIKSVPSTAISLWSYELFMNKLG"
     gene            <292181..>292840
                     /locus_tag="CAGL0G03157g"
                     /db_xref="GeneID:2888326"
     mRNA            <292181..>292840
                     /locus_tag="CAGL0G03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446500.1"
                     /db_xref="GeneID:2888326"
     CDS             292181..292840
                     /locus_tag="CAGL0G03157g"
                     /note="highly similar to uniprot|P06197 Saccharomyces
                     cerevisiae YPR113w PIS1 CDP diacylglycerol--inositol
                     3-phosphatidyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446500.1"
                     /db_xref="GeneID:2888326"
                     /db_xref="GOA:Q6FTE4"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014387"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE4"
                     /translation="MSSTEQVTAKDVVWYIPNKIGYMRVISAIISFATMRDYPFLTML
                     VYGVSCLLDALDGTMARKYNQVSRLGAVLDMVTDRSTTSGLMCYLCFAYPSRIWCVFF
                     QVLLGLDISSHYMHMYANLSGGQGSHKNVSKESSRLLHLYYTRRDVLFTICAFNEVFY
                     GGLYFYSFPQYATVGKWLCIICLPGYIFKQVANVIQLNRAALMLAELDAKDANERAKS
                     Q"
     gene            <295541..>298726
                     /locus_tag="CAGL0G03179g"
                     /db_xref="GeneID:2888229"
     mRNA            <295541..>298726
                     /locus_tag="CAGL0G03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446501.1"
                     /db_xref="GeneID:2888229"
     CDS             295541..298726
                     /locus_tag="CAGL0G03179g"
                     /inference="similar to AA sequence:UniProtKB:P48361"
                     /note="similar to uniprot|P48361 Saccharomyces cerevisiae
                     YGR097w ASK10 involved in SKN7P-dependent transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446501.1"
                     /db_xref="GeneID:2888229"
                     /db_xref="GOA:Q6FTE3"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE3"
                     /translation="MSEPYDQYDESNPNAIPFPSGSTSGYSTRSTSISATPGYLTPQS
                     RTPSYAALNDDAVSIKSSDYLMDMVPDSMTLKDGASISTAKRKEFILPETDERSPYFV
                     GVPVPVIAASAVVDNGDKSLEKSTRSKTVIGDTEGYDGQFVREYPTDMLIDRFYKWKK
                     ILKSIIAYLREVAYAQEQFARINNQLRNSVKFPFLTDLTEGSNKIIDPLSQAPKKNAP
                     TTMAQKRKQKEEEQNAPNVDLPPVDPSEQFMPVQATDNTSASSGFLRFGSGSIQDIQV
                     ILKKYHVSLANQQFKISKEIVSTVIPKLEEIKKDLSFKIKEIKELNGDFKTNINYHIK
                     MTGILLKKYIAACRFVDRNNYLQDVQNKLKPKHDPYLLKLQLDLQLKRQIAEENYLQE
                     AFVNLQSSGLQLEKIIYSRIQHVLQRYSTLIDSEARLMIKNLCQELQYGILAKPPAME
                     WDNFVSHHPLCLLNWKSNDPVPVPRNASAVIYPNMKSPMSKCIRAGYFMMKSESKSSK
                     SNNFQKSYFILTSTYIHQFSSSDFYKPKKGAPNQQNSIQFQFQPNIYHNYNNNSINTR
                     KVSGNVNAVSGHNGVTVENSPFSRHSEVIPIASIPLSECRLVESSDAIFVIEGKAEYS
                     NNLTEKVPKKQVYKSMAHAGSNTISNPLASIPGAKYGQDASTKVLHKTKLSKLVKGAK
                     AKTLGTETSKHSKSGLEKDANKVVTNKVYTTEQVKWTFKMVAEKPTEDEVKYFNKWII
                     DIKNLTKFEKPKERFNFIEDRLMKSQTKSQMSVAEEGRSNQNSTSNFAGKPTYISLGV
                     DSKSTFTPDGSVMNTPAIDDNGNLITFGQRHSVVSPHYSNNSDNSYRQSYRPTNSLPG
                     SRNLSPLPVNSPTSVNSEGSGGGYFAIPVNKQMSHPGSNVQVSEFGSRSNVNTAGSSP
                     NITGMGYFVPVQSTGVVPKVKVNNEEMGQNSPQPPASPYNSLRKNISTGSIPTLNNEG
                     SRPESGNFYKNNNSSTNLVAAANGTARVQAVRKHKKNVSFSSLNSLMFSKKGSVGYGG
                     QPINGISENSDNEDEGNSKESKIKLNQSLYS"
     gene            complement(<299021..>299668)
                     /locus_tag="CAGL0G03201g"
                     /db_xref="GeneID:2888217"
     mRNA            complement(<299021..>299668)
                     /locus_tag="CAGL0G03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446502.1"
                     /db_xref="GeneID:2888217"
     CDS             complement(299021..299668)
                     /locus_tag="CAGL0G03201g"
                     /note="similar to KLLA0D15103g Kluyveromyces lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446502.1"
                     /db_xref="GeneID:2888217"
                     /db_xref="GOA:Q6FTE2"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE2"
                     /translation="MFPFVRLGVVRCLPLQHLVTKRCLSYGGKHVVTQQKFKESMAKV
                     ANQAMVLTAASPVGTSHELFHGLTISSMTSLALKPHPMIQFNLQLPSATSDTLHQNRY
                     FAIHLLNPTNESIDIIRNFSKGALQGINRTMPFKDLEMNEHYMIHKIGNKTNYDLPIL
                     KEAQLAIICKKKNVFRVGDHEIWVGVVEDTIVMNDDTNGGVLYCNRNFHKLGSHI"
     gene            complement(<300119..>304933)
                     /locus_tag="CAGL0G03223g"
                     /db_xref="GeneID:2888336"
     mRNA            complement(<300119..>304933)
                     /locus_tag="CAGL0G03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446503.1"
                     /db_xref="GeneID:2888336"
     CDS             complement(300119..304933)
                     /locus_tag="CAGL0G03223g"
                     /inference="similar to AA sequence:UniProtKB:Q03018"
                     /note="similar to uniprot|Q03018 Saccharomyces cerevisiae
                     YGR098c ESP1 required for sister chromatid separation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446503.1"
                     /db_xref="GeneID:2888336"
                     /db_xref="GOA:Q6FTE1"
                     /db_xref="InterPro:IPR005314"
                     /db_xref="UniProtKB/TrEMBL:Q6FTE1"
                     /translation="MVRFDNSLHEVDLNAQLGDEYKTLSHSLKRGVTHDNNCTHHLMH
                     QYTVSNLSYAVSNLTVSDEGSSSEIETTLSNTYSYYYRIHGLRVINLITKQHLLLIVK
                     LINGNCLNSASRNIISLYNNTNRNSISEIQQLLLCDYTKNNKEYLSSLKILVLQTLLK
                     KHDVSESIISVIKLFAYDRKLLLEDHKLKKNTVIKLILNYYSKFKEYRLLFGLKFLQY
                     IAQFNFRYDEFIKNMTRDAFLQQLGRQKTSNNTLTSRYLSMFYFSYQMQYKSNNDQLF
                     SSTSAEHVPEGFFNLQNVVTNLERNERFFDKYMMSTKQLNDLINIIAEEGRVFEKELD
                     EKSILLIQRILSIFQIKCYEISKPVLKFLDKIIILLNSNVKYLSNDISPLIKLIESMI
                     QFCTTNSLHKTFENTMAVAYNIALKTKNSELLLLVSKFEFSRLLLNYKETEKIKPSDL
                     NKFNVFLSATKEIRNRYKILQIFYHHTLFDGKEHFNEVYAVCEYIAAIVKRKIGTLKW
                     ENLECKSEVMKGIIAGVTNDRYPNNECMEPCILLLQSSFFPEKVLTSEEYNDSSNQDG
                     IVYDVFPLLKCNYLLNNDIAKGRTMYLVQVTKTFCQFATKDNKVNYCSRIENDFIKKL
                     LNYLSINGYHKLLLSVVGILEKRTEYYKTLSNDYITYKAHSCMRLKLKNRTKHVFDQF
                     TNQKGEIKFDDEKDIYNHLIMSLLYASWEDSPELFTSSNERVPKDIKEHILDFSTNDK
                     SNLNKYFQKLIFNIKFANYYASLLNQKKCYSYAVEVSKKGLKIGKSVLKIIEKLDLND
                     RLTVLNQLVSSYSNLIKIYTAVGLAKGAQYYCKEVTKLLPVFDQPIFLFSVHVLLFEF
                     YLENGDYDSALTHKKNANYVFDNLNAEHDIINTTSFLYINEEYDKIQESLRLYFGYDL
                     NDTDFFLSWKLKLGNICDECPTQYSNMNFFNKIVHINQRLVLEIDADPFLKSLNETIL
                     ANLNCVSPGSLSNILDVGMISSNSTNRSSNMTPKRRPTSFKTNKHIVMDILDEFFTTF
                     NAMRQELTERNVILKVSDIYRLNYFYLISLLSVPESRKQLIEETITQLNELPSEITHT
                     YESLLADKNCDIYGKTIFELESSNYEIMKSKNVTLNWEEQIGKDRLLDLCNITVEVIC
                     IDICKLTNTLIIRRISNLDSKNIMAKIPIDRNVSRDLDADSLTFQQASESLQKIINDS
                     NESVSKNVTETIKDKNDVRNWWKRRYDLDELLGNLIERIEKTWLNGLSGILNGLYCDK
                     DALLEFQSKITAILNQILPSRRNCCNRANFLQLDEWIISLLLDLDPSDLGFFTALEDV
                     IYFILDTLSHKGEENAYDEIDFGLLHVLLEEEIRKVRVNKKLFTKIEHTFLVVGPSCH
                     TFPWEIMKPLKGRSVTRVPSLTILSNLLSSIKGNLPVKIERTNDISMILNSNSDLVRT
                     EKTFKDIFERIQDSRAGSRLLVNQKPTEEEYMDYLTNSKVFLYVGHGGGEQYVRNCTI
                     ERCDKLPPVFLMGCSSAATKLNGNLNPNCVAESYMYGNSVMVLGNLWDVTDKDIDKFS
                     IEMLEKCNLLDAKPNTVITGVPQAVADSRTVCHLKYLNGAAPVVYGLPVVFI"
     gene            complement(<305550..>307805)
                     /locus_tag="CAGL0G03245g"
                     /db_xref="GeneID:2888070"
     mRNA            complement(<305550..>307805)
                     /locus_tag="CAGL0G03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446504.1"
                     /db_xref="GeneID:2888070"
     CDS             complement(305550..307805)
                     /locus_tag="CAGL0G03245g"
                     /note="highly similar to uniprot|P36114 Saccharomyces
                     cerevisiae YKR018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446504.1"
                     /db_xref="GeneID:2888070"
                     /db_xref="GOA:Q6FTE0"
                     /db_xref="InterPro:IPR019412"
                     /translation="MFSFFGGNKAPELTQEEKTKLILQQAYDFEVALRAMDYVLDDNP
                     ERGLNLLKESDDSANEDERTINVLARGVIEFLEATLSFEAEEMKKASATLAKAETLSQ
                     KSKANAEKLNLSNSSKYPPGTVFAVTYTESLLLHALLMIFSESMMEVAKALLKLRKAY
                     YTLQEVLEQIKAANEASITNAENNGEESKSSSASFISEGDIFNSIDIPYKLTEEEAKD
                     KELLEFADKVHKMRAKRLSGAHIDNPPAINRLRNDLGLQAMNSLPKEEIKEHLPLSDD
                     VDRSQATIDEFIHSGVNLCFGILQVVLSLLPPAIGAVLSAVGFRGSREEGLRLVWKAT
                     KHRNVHGCIGLLGLMFYYDGPFQFTDDDFDVPASVKEYLNSTEDKKGQEENNDDTSTM
                     TKDMESLKLKDDDLHMDSNTILHPGKILEDALLKSRALFPNSALWLLNEARMLSGKGR
                     LEDAVALMDSIDVNSIQMRQVKTLMIFDRAITLIHLHEYDRAADDILSLLDISDWSHA
                     FYSYFAGCCYLENWRMIQMGDLKSDKEEFYKEKATTLIFKSVDYLGKKTWRSKNLPLD
                     RFVARKVDQFKAMQVKLNLTNPLDAIATGPVYEIAYFYNGFNRMSQKHLDISKKMLTE
                     YKNPAVEANDPDQNLIRDLLVSLCLRRSDKIKEGCDLLDQKVLPTFFKELPDGKVEYV
                     KKNEDPWLYPSALYERALFCWKLNGVQGLSECKEWLLRAQNYADDYELSSRVGMKIKA
                     AIDRVDSALNN"
     gene            complement(<308963..>310240)
                     /locus_tag="CAGL0G03267g"
                     /db_xref="GeneID:2888071"
     mRNA            complement(<308963..>310240)
                     /locus_tag="CAGL0G03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446505.1"
                     /db_xref="GeneID:2888071"
     CDS             complement(308963..310240)
                     /locus_tag="CAGL0G03267g"
                     /note="highly similar to uniprot|P35183 Saccharomyces
                     cerevisiae YBL069w AST1 or uniprot|P39945 Saccharomyces
                     cerevisiae YER101c AST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446505.1"
                     /db_xref="GeneID:2888071"
                     /db_xref="GOA:Q6FTD9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD9"
                     /translation="MSDKLKNDPTLQLMTVEHESPAPKEIKPDAPKLTRVARPLRHIK
                     HIPVKALCFHSKQGPIEFTYDNKIKMPVPKNKIVVEVNYFALNPVDQKIKNGYASAIY
                     GQIGLGREYSGVITEVGSNASEYWNVGDEVYGIYYHPHLGKGCAASSILVDPSTDPIL
                     PRPSSLSPQEAAGALWCMGTAYNIMSYLKKNKYLNENSNVLINGGTSSVGLFMIQLLK
                     YHLNLKKKLVIVTSGTNSDYLMEKFPDIAEEMIFINYLTCRGKSSKPLRQMINEQQIV
                     DYDDSKGEVTIPYTEGKFDVVLDFVGGYDIIAHSKDLIKTGGAYITTVGDYVANYKED
                     IFNSWDNPSANARKMFSTMLWSFHYHHFYFDPSSKLNTKDSWLVKCGELLESGLIKCL
                     VDKQYDWKNCKEAFSYMNTQRARGKLVLKTEKF"
     gene            <312871..>314814
                     /locus_tag="CAGL0G03289g"
                     /db_xref="GeneID:2888055"
     mRNA            <312871..>314814
                     /locus_tag="CAGL0G03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446506.1"
                     /db_xref="GeneID:2888055"
     CDS             312871..314814
                     /locus_tag="CAGL0G03289g"
                     /note="highly similar to uniprot|P09435 Saccharomyces
                     cerevisiae YBL075c SSA3 or uniprot|P22202 Saccharomyces
                     cerevisiae YER103w SSA4 or uniprot|P10591 Saccharomyces
                     cerevisiae YAL005c SSA1 or uniprot|P10592 Saccharomyces
                     cerevisiae YLL024c SSA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446506.1"
                     /db_xref="GeneID:2888055"
                     /db_xref="GOA:Q6FTD8"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD8"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPKNTVFDAKRLIGRKFDDAEVTNDAKHFPFKVINKDSKPAIE
                     VEFKGETKTFTPEEISSMVLGKMKETAEQFLGTTVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGASEHNVLIFDLGGGTFDVSLLSIDDGVFEVK
                     ATAGDTHLGGEDFDNRLVTHLANEFKRKNKKDLTTNQRALRRLRTAAERAKRALSSSS
                     QTSIEIDSLFEGVDFYTSITRARFEELCADLFRSTLEPVEKVLRDSKLDKSQIDEIVL
                     VGGSTRIPKVQKLVSDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLL
                     DVAPLSLGIETAGGIMTKLIPRNSTIPTKKSEVFSTYADNQPGVLIQVFEGERTKTKD
                     NNLLGKFELSGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRL
                     SKEDIEKMVAEAEKFKAEDEKEAERVQAKNQLESYAFSLKNTLNEASFKEKVGEEDSK
                     KLETAAQETIDWLDASQAASTDEYKDRQKELEAVANPIMSKFYGAAGGMPGAGGMPGA
                     GGMPGAGAGTGAADSGPTVEEVD"
     gene            <315470..>318688
                     /locus_tag="CAGL0G03311g"
                     /db_xref="GeneID:2888027"
     mRNA            <315470..>318688
                     /locus_tag="CAGL0G03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446507.1"
                     /db_xref="GeneID:2888027"
     CDS             315470..318688
                     /locus_tag="CAGL0G03311g"
                     /note="highly similar to uniprot|P09436 Saccharomyces
                     cerevisiae YBL076c ILS1 isoleucyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446507.1"
                     /db_xref="GeneID:2888027"
                     /db_xref="GOA:Q6FTD7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD7"
                     /translation="MAEASAHFSFPKEEENVLALWNEIDAFHRSMELTKDKPEFSFFD
                     GPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDTHGVPIEHIIDKKLGIK
                     GKEDVFKYGLDNYNNECRAIVMTYADEWRKTIGRLGRWIDFDNDYKTMYPSFMESVWW
                     AFKQLHEKGQVYRGFRVMPYSTGLTTPLSNFEAQQNYKDVNDPAVTIGFNVIGQEKTK
                     LVAWTTTPWTLPSNLALCVNPEFEYVKIYDENKDCYFILLESLIKTLYKKPAAEKYKI
                     VEKIKGSELVGLKYEPIFPYFYEQMKETAFRVIAGDYVTADSGTGIVHNAPSFGEEDY
                     AVCLENGVISEDTVAPNPVDDNGKFTSDVTDFAGIYVKDADKLIIKHLTETGNLLLAS
                     QIRHSYPFCWRSDTPLLYRSVPAWFVRVKEIAPKMLDSVMNSHWVPNTIKEKRFANWI
                     ANARDWNVSRNRYWGTPIPLWVSDDFEEIVCVGSIEELEQLSGVKNITDLHRDKIDHI
                     TIPSKMGKGDLKRIEEVFDCWFESGSMPYASQHYPFENTEKFSDRVPANFISEGLDQT
                     RGWFYTLSVLGTHLFGEVPYKNVIVSGIVLASDGRKMSKSLKNYPDPNIVLEKYGADA
                     LRLYLINSPVLKAESLKFKEEGVKEVVTKVLLPWWNSYKFLEGQLALLKKTSDVDFKY
                     DPKLSSDNVMDRWILASMQSLVQFIHQEMAVYKLYTVVPKLLHFIDELTNWYIRFNRR
                     RLKGENGVDDCLKALNTLFDALFTFARAMAPFTPFLADGIYQRLRAYIPEEVLAQFGQ
                     DGRSVHFLSYPEVRQELFDEAIETAVGRMQSVIDLGRNIREKKTISLKTPLKTLVILH
                     SDETYLKDIEALKNYIIEELNVRDVIITTDEEKYGVEYKVVADWPVLGKKLKKDAKKV
                     KDALPKVSSDEVKQYMETGKLVVDGIELVAGDLNVIRGLPESAAANGQETRTDQEVLI
                     ILDTNVYEDLKTEGLARELINRIQKLRKKCGLEATDDVLVEYELVKDTINFEDVVNTH
                     RDMLTKTCRSNIALCDGSKDHALVDEEQSINDTIFKLKIFKL"
     gene            <319139..>319699
                     /locus_tag="CAGL0G03333g"
                     /db_xref="GeneID:2888005"
     mRNA            <319139..>319699
                     /locus_tag="CAGL0G03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446508.1"
                     /db_xref="GeneID:2888005"
     CDS             319139..319699
                     /locus_tag="CAGL0G03333g"
                     /note="weakly similar to uniprot|P40063 Saccharomyces
                     cerevisiae YER104w RTT105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446508.1"
                     /db_xref="GeneID:2888005"
                     /db_xref="GOA:Q6FTD6"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD6"
                     /translation="MSESIDQESDLSFHTAIEEPFTSLTSTPHKSSNGWVSYPTNEGK
                     DSTNSSSPNLGNESIVNDIISRRRNASSGPANNLSQSARRDTENKKLKELRRLKRLQK
                     TIKNRGGLDNMRDFVLNSEIDAEYARLAKEAEQFALPIDELERIEKQTEEDLDDDEIL
                     EFIEQRDKYQYELDQILNENIAKEGL"
     gene            complement(<319894..>324252)
                     /locus_tag="CAGL0G03355g"
                     /db_xref="GeneID:2888010"
     mRNA            complement(<319894..>324252)
                     /locus_tag="CAGL0G03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446509.1"
                     /db_xref="GeneID:2888010"
     CDS             complement(319894..324252)
                     /locus_tag="CAGL0G03355g"
                     /inference="similar to AA sequence:UniProtKB:P38181"
                     /note="similar to uniprot|P38181 Saccharomyces cerevisiae
                     YBL079w NUP170 or uniprot|P40064 Saccharomyces cerevisiae
                     YER105c NUP157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446509.1"
                     /db_xref="GeneID:2888010"
                     /db_xref="GOA:Q6FTD5"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD5"
                     /translation="MYSTPLKNRYDYGATQFVDAQQVNGVTNNNIIGSSNGVATGNMG
                     TTYKTPGPLSTNVGIRSTLNYPPSLDSSILTTTTEHVRIPGLASAKPLELASQYVDHL
                     YRMDANTPILDERSYYNNGVNYNFTKEVGGLGAFTPFERQKVVSIPDDILQEASNTEL
                     KSDMGIFPEIDRCWFTIDNRIILWNINDSTEYQTIDDIKHAILKIQLVKPKPNTFVSH
                     VKHLLVVATVFDIYILAVSYKKETNELSIFNTGMSVNVQGMNVNNITCYEKTGQIFFS
                     GKSNGLNVWELQYTGSDDWFNSKCTKSCRTQSTFSSLLPTNILSKLPGSNLVQSMFDD
                     SNSHGQESIIQITIDQSRGILYTLSSTSKIHAYIITGKSLEGAISVEPSYIKRIIGAT
                     TARGAPILAPKYLKLAKLSPVVQAENGNLFLVAITIGGVRLYFNGFVGRTSIEALRLE
                     SIKFPPSSVTPEILQKELEQQQLEQQKRSLPFYSTLNSTESVVLKFQKKSSVLLETTT
                     SAEIISPGIFFSAVVKNNENNNNANQNKDNTTPSDNKFTEPENKLFVSVPDYGILKTF
                     GKYVENATFLDTVSPVKEIKVLTKTFNASNKPEGYANTFATQYSSEELKIAVLTNSSL
                     EIYRYRTPDEIFESLIDNPLPFILNYGLTEACSSALFVTCKFDKSELLRSKALTFYTV
                     GIPGAIDIKPSYSRNIVTSLLSRSSLSSTTPQKSTMSLDTLRSQHSSRSENDVGYDVD
                     DVILSPRFYGSTLLITRLFRDVWRKNVFVSDPKVTSSQTNNSSKENNVITNISVSKSD
                     IEYYLSSISILGEFFTKYGDTIATVSSANVVTENGYKTFDKSEDVANQAESIAFNSLF
                     KLVQSMKEALSFLNVLFEESEMEGIENPYAAFKDIIGFLNRNTQLQLSRLTFKDLFSP
                     NENTRSLLREILLSIINRNISRGTSIEYIASALQERCGSFCSSDDILSFRATEHLRKA
                     KEIGLKDSDTLKLHLNSAVKLFESIAKCLSMEKLREITSIMLSLDCYAKTIEFLLNIA
                     NAIDKGNLAAQYVDNGSLINDERKKFYDRRIQIYDLVFEVLVKVDQLSVSPNLSYPTA
                     SVCSETDIAAMRTETYRVILNYNDKLFHYHMYDWLVRENNEDKILQLDTRFILPYLQE
                     KSQSSLQISNIMWIYLSKKSRYYQAAQVLYSLAISNFEIKLSERIECLSRANGFCNSA
                     CQLSEKQKMIQLASDIQEVLDIATVQEDILSLVLSDSRIDPTTKSELQTNLEGKILPV
                     SDLFNDYAEPLGYHEICICIFKVSDFRDQDEIMSKWHELFDSLKKEVNFEQNPDETTN
                     FLNLLSNVVIKIGRTVHTSEYVFPITELFPIICDIIQSLPQKYVREGFISSIFISAGI
                     SYSKLYYIIKDLIETSDSVNELFKKEMISLIKNWYENDAKVRDAFTYEEINNLSQYEV
                     SNDPINKFVKRTGLNL"
     gene            <325048..>325698
                     /locus_tag="CAGL0G03377g"
                     /db_xref="GeneID:2888011"
     mRNA            <325048..>325698
                     /locus_tag="CAGL0G03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446510.1"
                     /db_xref="GeneID:2888011"
     CDS             325048..325698
                     /locus_tag="CAGL0G03377g"
                     /inference="similar to AA sequence:UniProtKB:P40065"
                     /note="similar to uniprot|P40065 Saccharomyces cerevisiae
                     YER106w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446510.1"
                     /db_xref="GeneID:2888011"
                     /db_xref="GOA:Q6FTD4"
                     /db_xref="InterPro:IPR018847"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD4"
                     /translation="MVLAEKSANIPVVKSFDGTKAGPDGSPLTKNNLKLLQKSIFELE
                     NKNFECPHYLCSLDNMAQIRHSRTWFLFELEMTYDGYFNLRNSCYFTRVYRNILPVWP
                     NTSCLSLNKTAFDSRVQLMPLNHIIISNYAAAIPERKRKYNPDDINDIYVEIADIAEF
                     GNVQKYIPPTILTKRRNMESFNDCKVNTKDIISFKDVNQEYETWLDKHLSLAKDRD"
     gene            complement(<325879..>326988)
                     /locus_tag="CAGL0G03399g"
                     /db_xref="GeneID:2888186"
     mRNA            complement(<325879..>326988)
                     /locus_tag="CAGL0G03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446511.1"
                     /db_xref="GeneID:2888186"
     CDS             complement(325879..326988)
                     /locus_tag="CAGL0G03399g"
                     /note="highly similar to uniprot|P40066 Saccharomyces
                     cerevisiae YER107c GLE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446511.1"
                     /db_xref="GeneID:2888186"
                     /db_xref="GOA:Q6FTD3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD3"
                     /translation="MSFFQRNSAAGNTTSTVMATEKDLQNEIVINNPADDSISDIAFS
                     PQHDFLFSVSSWDGKVRIWDAQNGVPQGKAQYEHNGPVLCTRWSLDGARIASGGCDNT
                     VKLYDVASGQSQQIGSHNDAVKSLRFVQCGPTNTECLVTGSWDKTIKFWDTRQPQPIT
                     TIAMPERVYTMDNKQQLLVVGTAERHIAIINLANPTTIFKSSQSPLKWQTRVVACYNE
                     GDGYAIGSVEGRCAIKYVDDEAQKKSGFSFKCHRQTQPNRAAGSSSQSLVYPVNSIAF
                     HPIYGTFVTAGGDGSFHFWDKNQRHRLKGFPSMQGSIPVCNFNRNGSILAYAVSYDWH
                     QGHMGNRPDYPNVIRLHPTTDEEVKEKKKKTTFGR"
     gene            complement(<327833..>330883)
                     /locus_tag="CAGL0G03421g"
                     /db_xref="GeneID:2888188"
     mRNA            complement(<327833..>330883)
                     /locus_tag="CAGL0G03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446512.1"
                     /db_xref="GeneID:2888188"
     CDS             complement(327833..330883)
                     /locus_tag="CAGL0G03421g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446512.1"
                     /db_xref="GeneID:2888188"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD2"
                     /translation="MFNSQSKPELNRYILDFFRKCNLSGTAESFEKESDVEVEEVVDT
                     PQGFLYEWWQVFWDIFNTTTNRGGSETAQSYFKLVLQQQRQEHIYRSLAIHAARMQHI
                     AEQRGDYDNEETDPMLFAMMLANMNSNPQREATQSSPSKQQQQQQQQQNTQPQPQPQS
                     QSQSQQFQYQKQQQAMPLDYNQMMMMTMMMPEYANMFNPSVASSQAQQPSPNTENQDR
                     NSAGKNTRPASHIDPSAYQYSNDTNSPNMASPCNTTHKSSIDSISRTEAGTATVTATP
                     ATLKSSDPRPSSNVKDAPTPQHMGTNEAEPARRQDPAMWNSMNPQMYMPFAPGMFMMN
                     PQQLQFYMEMQKRAQLSQNFDFTKQAHLNGRNPAFGSPEQMMMAQMMSSPMFDMSMMN
                     GFQMPPMSAMGQLPMTGQIPSWYMQGAPFFNGSPTMEQFNSMMLNGKTPQAANAFSSM
                     AQTMNMQSSPSPKNMGKTKMNRNSSSPEDAPTPQQGKAQTLQKSQVQPQLKRTRSSSQ
                     RSPDVPMAKAREISTHGSPNIDEDHALSKYSNNSLSEGTPGTSKVVGTNSPAYHGASD
                     IHSSTSRGTSPDSNNAATPLTGASRSAKSSSVRSKSKTPATQPPKKKRKPASQGVTTP
                     KTMVVTPVLTSSVNQNGTPVPTTIGDEQDLKDDMYDHPSVGNTSIASKKSTISPRDEM
                     SSESNQTPLTGSLPTPLESAGAMKLKRLAKSVSAGVSPNVMQSPTSRSVASETNSPRS
                     SQNTRKISRRKSTPMLHEHESSDPTTIRKAISNVSTSFAEENLNHLTPPNSMNFNGIS
                     VMNYTNKPALSSPLSTVPESCFGNDDHDAPQKDTNTDNQVSKMKSHSQTPSSFTKFQD
                     NNADNAFDSNINSHASTNSNDHIQSQMSPIDFIPKNDGFHASPDSNKHYSNSNSHSDI
                     NSLANNDSKIDFGADSNSHMSNSNDSSKISNNLYKFSNQEDLLFFDSMFGDPVVSGEQ
                     GSHNSMGSPSKEENAHGHNLENHDGTSDANILLETNDTNFHFMD"
     gene            complement(<331868..>335209)
                     /locus_tag="CAGL0G03443g"
                     /db_xref="GeneID:2888192"
     mRNA            complement(<331868..>335209)
                     /locus_tag="CAGL0G03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446513.1"
                     /db_xref="GeneID:2888192"
     CDS             complement(331868..335209)
                     /locus_tag="CAGL0G03443g"
                     /note="highly similar to uniprot|P40069 Saccharomyces
                     cerevisiae YER110c KAP123 RAN-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446513.1"
                     /db_xref="GeneID:2888192"
                     /db_xref="GOA:Q6FTD1"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD1"
                     /translation="MDQQFISQLEQALAAVTQPNSAGLKEATKTLQKQFYTQPNSVAA
                     LVHILHHSNDDALKQLAGVEVRKLIPKHWASIDVATKNGIKETVLQYAFSEQKEIIRH
                     SNARVIAVIGSEEMSDNQWPELIPNLVQAAAGEDSKTRETAVFILLSLLEDFDSSLVS
                     YIDDFLTLFSQTINDTTSLETRSLSAQALNHVSALIEEQEEINPQQAARFAAMIPSVV
                     SVLEAVIKADDVPNTKQIFNCLNDFLLLDSQLTGNAIVDLIKLALQVAINTEIDEDVR
                     VYATQFIISALSCRKSKIIQAKLGPEITLTALKIAAEEIDVQDELNNEDEAGENEENT
                     PSMVAIRLLAFASTELPPSQVAAVIIEHLPTMLNSQNVFERRAILLAISVVVTGSPDY
                     ILSQFDKVIPATISGLKDNEQVVKLAALKCVHNLTTDLQDEVAKFHEDYLPLIIDIID
                     NAGTVVIYNYATVALDGILEFIAYEAIAKYLEPLMNKLFHMLSTSNSSKLKCAVVSAI
                     GSAAFAAGLAFVPYFKTSVQYLEQFIQNCSQIEGMSEDDIELRANTFENISTMARAVR
                     SENFAPFAEPLVNSAYEAIKTDSARLRESGYAFIANLAKVYGENFSPFLETILPEIFK
                     TLELDEYQFNFDGDADELAALADGATEEELQSKFTVNTGISYEKEVAAAALSELALGT
                     KEHFLPYVEQSLKVLNQQVDESYGLRESALNTIWNIIKAVLLASKVQQDEYPKGFPAA
                     SYVDPSVLAVIQTARETTLSYLENEFETSMVITILEDFANMIKLFGPIIIMDNGNSSH
                     LENLCLQVSSVLENKHTCQVADLEEDIPRDEDLDASETEATLLDVALEVLVSLAVALG
                     PDFAKVFEPFKTTLLTLCQSKSKNKRSSAVGAASEIALGMKEQNPYIHEMLEALVIRL
                     TSDKSLEVRGNAAYGVGLLCEYAPFDVSQVYEHVLKALYQLLSVADEKAADDDEATRE
                     IIDRAFANASGCVARMALKHQNLIPLEQTLPALLSHLPLKTGFEEYDPIFKLIMQLYE
                     SNNEVISGLTPNVVELFGHVFTMENERLKLERESTLGREENMERLRQFQSEDVRVKVV
                     ELLKYLNSKYNGVVAQNQVLAPVIA"
     gene            <335869..>336387
                     /locus_tag="CAGL0G03465g"
                     /db_xref="GeneID:2888182"
     mRNA            <335869..>336387
                     /locus_tag="CAGL0G03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446514.1"
                     /db_xref="GeneID:2888182"
     CDS             335869..336387
                     /locus_tag="CAGL0G03465g"
                     /inference="similar to AA sequence:UniProtKB:P40070"
                     /note="similar to uniprot|P40070 Saccharomyces cerevisiae
                     YER112w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446514.1"
                     /db_xref="GeneID:2888182"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q6FTD0"
                     /translation="MLPLYLLTNAKGQQMRIELKNGDIVEGELTNVDNWMNLTLANVN
                     EYKGSENNTNLPQVKVVKSKEIYVRGVYIKYITLQDDIIEKVKQQINNNNNNNNNRKF
                     NNRNHQNNYGYRRNNTGGNYNNGNNNNNNNNNNNNRRNYNNRRYYNNQNQNQNQNQSQ
                     GQSQGQKNQQFE"
     gene            complement(<337133..>339247)
                     /locus_tag="CAGL0G03487g"
                     /db_xref="GeneID:2888183"
     mRNA            complement(<337133..>339247)
                     /locus_tag="CAGL0G03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446515.1"
                     /db_xref="GeneID:2888183"
     CDS             complement(337133..339247)
                     /locus_tag="CAGL0G03487g"
                     /inference="similar to AA sequence:UniProtKB:P40071"
                     /note="similar to uniprot|P40071 Saccharomyces cerevisiae
                     YER113c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446515.1"
                     /db_xref="GeneID:2888183"
                     /db_xref="GOA:Q6FTC9"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC9"
                     /translation="MTTSRPANRMKSAVSMLLLLALVASLIKFCFWIIPSVLSAITLN
                     YNSHGWVNPNLYKIGDHVELIVNKVESDLTQLPYAYYDLPFICPPTKEKKPLHLSLDE
                     IFRGDRKWQSDYKLSFGIDSPCEILCARKTKKEGMIKAKELVQQGYVTQWLIDESLPA
                     ATTFISSTNHNKYYAAGFPVGYVDDRTGKTFLNNHVMLVIRYHPVSEEEFTIVGFEVY
                     PKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHRWNYFLN
                     NGELSNSKANQFHWMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTNLGQD
                     NEDDNDDKISGSVFVNAKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSLSK
                     LHNIRFTVLTMSLICFICGAAISGYIGSRLYIEYQILKGYLRNEVNRTKVYKFSVVCG
                     SSLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLALNCK
                     VDSYNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSF
                     IIIWVELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRY
                     LRHTWGWKSFLMGSSCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWAL
                     GSLSYLTSYMLVTQIYKVDLQI"
     gene            complement(<340079..>342835)
                     /locus_tag="CAGL0G03509g"
                     /db_xref="GeneID:2888136"
     mRNA            complement(<340079..>342835)
                     /locus_tag="CAGL0G03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446516.1"
                     /db_xref="GeneID:2888136"
     CDS             complement(340079..342835)
                     /locus_tag="CAGL0G03509g"
                     /inference="similar to AA sequence:UniProtKB:P39969"
                     /note="similar to uniprot|P39969 Saccharomyces cerevisiae
                     YER114c BOI2 BEM1 or uniprot|P38041 Saccharomyces
                     cerevisiae YBL085w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446516.1"
                     /db_xref="GeneID:2888136"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC8"
                     /translation="MSGVNTPKLAQLDTSFARNASTSSAATPSSQTFSSKSRFPLYIA
                     INAYTKRMEDELDMNPGDKIQVINDDGEFNDGWFYGRNLRTKEEGLYPVVFTQVLATE
                     RKSTVMRAKSSKRIYSPSSREDLVNSPALSNSEVMNDLPSPYLVESGASAFTNNVNRN
                     VSVKSTISDIDKALEDLQHANVNDTTLSSANYNSGDVTQNTVYSTTQGLNVNEASTVS
                     LPRNQNEIMELMNVENWTPDEVTAYFIGHGFDIKSASSFQQHKISGKILLELQLEHLK
                     ELDISSFGTRFEMYKQIEMIREVVAREGKVGSHDVIRVEKNRDRNDASALMPAPTLNT
                     SAPRSHPRNASHSLEDLPSSETRTPSTKHRPTSLWIGGGSVSEEKGDLFVSPRRAPKP
                     PSYPSPVQPQRLPTFSNDEQKAVREVSQSTQIDTNVGNSKSSSADQSNSETPLSPFKT
                     VMNRVSLLSPIKSEKKRDEANESAISEDASATSSIYASPSRSLSMVDIKKNSDKPQTK
                     THRRNSSIASFSSNGKVTERKPSGNDRSKVASIFLSPFKQQFTNNATKSSPSTTPTSP
                     SAAKQPTPVKRSPQPEKRSVSAKTQSKTKSAIASTAIAEEPQKRSVSEAVKSKNKSTK
                     PGLRKQHTSAFTEGLRSISVRDAMKNADYSGWLSKKGSGAVSVWKTRFFTLHGTRLSY
                     FANTTDTRERGLIDITAHRVIPAKEDDKLVSLYAASTGKGRFCFKLIPPQPGSKKGLT
                     FTQPRTHYFAVDTKDEMRGWMAALIKATIDIDTTVPVVSSYSTPTVSLSKAQELLAEA
                     REETKLREEQLQNQESLWNEDDHGSHPDKSLNHTASSHNAETTVITSDSDTSMNTPNL
                     SSTTAGTNGFSSPFLLASGMASPAIARKTSRQTKEPGKLEDSTKAEDTGYFDTEHHKP
                     AEHI"
     gene            complement(<343363..>343866)
                     /locus_tag="CAGL0G03531g"
                     /db_xref="GeneID:2888213"
     mRNA            complement(<343363..>343866)
                     /locus_tag="CAGL0G03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446517.1"
                     /db_xref="GeneID:2888213"
     CDS             complement(343363..343866)
                     /locus_tag="CAGL0G03531g"
                     /note="some similarities with uniprot|Q01684 Saccharomyces
                     cerevisiae YER115c SPR6 sporulation-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446517.1"
                     /db_xref="GeneID:2888213"
                     /db_xref="GOA:Q6FTC7"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC7"
                     /translation="MIAKENANTVLECFKMNFMNANISSNKQKGYRKYSSSSRQRFLE
                     FNNVLSPRIKSRASVKKKTHVARFLSRQRKNKKPTPVEPEELEGPTLLRFGQLAGGRD
                     ERATRCPLRGIKHGLHINPDLHCSCGSLSIKPSPLQQSQKQTKEKDCSMAHMSKPSHI
                     ATKLYLI"
     gene            complement(<345057..>345689)
                     /locus_tag="CAGL0G03553g"
                     /db_xref="GeneID:2888230"
     mRNA            complement(<345057..>345689)
                     /locus_tag="CAGL0G03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446518.1"
                     /db_xref="GeneID:2888230"
     CDS             complement(345057..345689)
                     /locus_tag="CAGL0G03553g"
                     /note="weakly similar to uniprot|P40072 Saccharomyces
                     cerevisiae YER116c YEU6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446518.1"
                     /db_xref="GeneID:2888230"
                     /db_xref="GOA:Q6FTC6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC6"
                     /translation="MAKSESGEHAGSVPTDGNDSDGSITVIREERSNSDFGSEMINML
                     QDDEDSQRETSVSEDQIETDLDIEHSPKKRSHASMEGEGSDYDDDDDDLEVTNMNKRR
                     NADLTPETINLEAEEQQVVEIPDEEANDEESKKREYKRVRDYKCPICFEPPDVAIMTP
                     CGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQIKMLVLRKVQKKT"
     gene            <346786..>347866
                     /locus_tag="CAGL0G03575g"
                     /db_xref="GeneID:2888305"
     mRNA            join(<346786..346827,347495..>347866)
                     /locus_tag="CAGL0G03575g"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_446519.1"
                     /db_xref="GeneID:2888305"
     CDS             join(346786..346827,347495..347866)
                     /locus_tag="CAGL0G03575g"
                     /note="highly similar to uniprot|P04451 Saccharomyces
                     cerevisiae YER117w RPL17B and highly similar to
                     uniprot|P04451 Saccharomyces cerevisiae YBL087c RPL17A"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_446519.1"
                     /db_xref="GeneID:2888305"
                     /db_xref="GOA:Q6FTC5"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC5"
                     /translation="MSGNGAQGTKFRISLGLPTGAIMNCADNSGARNLYIMAVKGSGS
                     RLNRLPAASLGDMVMATVKKGKPELRKKVMPAIVVRQSKAWRRKDGVYLYFEDNAGVI
                     ANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            complement(<348369..>349430)
                     /locus_tag="CAGL0G03597g"
                     /db_xref="GeneID:2888306"
     mRNA            complement(<348369..>349430)
                     /locus_tag="CAGL0G03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446520.1"
                     /db_xref="GeneID:2888306"
     CDS             complement(348369..349430)
                     /locus_tag="CAGL0G03597g"
                     /inference="similar to AA sequence:UniProtKB:P40073"
                     /note="similar to uniprot|P40073 Saccharomyces cerevisiae
                     YER118c SSU81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446520.1"
                     /db_xref="GeneID:2888306"
                     /db_xref="GOA:Q6FTC4"
                     /db_xref="InterPro:IPR001452"
                     /translation="MSGRRGKIINPRTRGAVRNVGFRNLISDPFAISSILIGLISWVI
                     TLGGCISVQVNEDFPRFTWWGIAFQFLIILMLIGFYIYDLVDYYRNFLTASIGVAFVY
                     STNSANYLIYGSGNQKAAASAGVVLLSMVNLIWIFYYGGDNASPINRWVDSFSLNGIR
                     PSPFEAAKIKAYRRSSKQTQFRGSSVKLTHSTNNLHSASENLGLDNGFYNNPHTSNYV
                     SSTALTEFENTGPPYPSASDLPTNNNAPLRSPQLGNNTIGDTYITATTNNNTNTTMGD
                     TMGLYADLADESFPYRVKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESG
                     ETGIIPSNYVTIIDNDTEA"
     gene            complement(<349789..>351171)
                     /locus_tag="CAGL0G03619g"
                     /db_xref="GeneID:2888310"
     mRNA            complement(<349789..>351171)
                     /locus_tag="CAGL0G03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446521.1"
                     /db_xref="GeneID:2888310"
     CDS             complement(349789..351171)
                     /locus_tag="CAGL0G03619g"
                     /inference="similar to AA sequence:UniProtKB:P40074"
                     /note="similar to uniprot|P40074 Saccharomyces cerevisiae
                     YER119c or uniprot|P38176 Saccharomyces cerevisiae YBL089w
                     or uniprot|P40501 Saccharomyces cerevisiae YIL088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446521.1"
                     /db_xref="GeneID:2888310"
                     /db_xref="GOA:Q6FTC3"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC3"
                     /translation="MSSTVGSGVLTLLHTACGAGILAMPYAFKPFGLIFGILMIMFCG
                     LCSMMTLLIQARVAGYAPDSKNASFFSLTQVINKNLSVIFDLAIAIKCLGVGISYLIV
                     VGDLLPQIAGSITTKPLLLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAY
                     LCVLVIIHLVSSDGDIEQMKGHVSIGLPHHGPSPLTTLPIFVFAYTCHHNMFSVINEQ
                     KDNRFKTTKYIPLISTSLACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSIIGRIA
                     IALLVTLAFPLQCHPARSSIHNILAFFYPSLNPDLKNTQEPTANADTMSSSQLLATER
                     TPLVRSISSIEDNELAEEQGSIKDVPIEMERKLFLAITAAILIPSYLVAMSVHSLDKV
                     LAIVGATGSTSISFILPGIFGYRLIGSDGATLTRGDRLLKKLGLAATIWGFFVMTASL
                     FATFKYNAHH"
     gene            <351476..>352723
                     /locus_tag="CAGL0G03641g"
                     /db_xref="GeneID:2888308"
     mRNA            <351476..>352723
                     /locus_tag="CAGL0G03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446522.1"
                     /db_xref="GeneID:2888308"
     CDS             351476..352723
                     /locus_tag="CAGL0G03641g"
                     /note="highly similar to uniprot|P38174 Saccharomyces
                     cerevisiae YBL091c MAP2 methionine aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446522.1"
                     /db_xref="GeneID:2888308"
                     /db_xref="GOA:Q6FTC2"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC2"
                     /translation="MSDEVAVPPVQEGEKVEAQVEEVAEEVVNEGGDSGKKKKNKKKK
                     KKNNIKRIELIYPDEVYPEGEWMDYQQDFNLERTTDAEKRYLARDMEKQSEWNDVRKG
                     AEIHRRVRKNVQNKLKPGMLLTEVADIIENATRKFTGAEDLTKMDNPVSQGIGFPTGL
                     SLNHCAAHYTPNTGDKTVLKYEDVMKVDIGVQVNGHIVDSAWTVSFDPQYDNLLAAVK
                     DATYTGIKEAGIDVRLTDIGEAIQEVMESYEVEIKGKTYQVKPCRNLCGHSIGPYTIH
                     AGKSVPIVKNGDQTKMEEGEHFAIETFGTTGRGYVVSGGEVSHYARLPSDGLPQPNLA
                     SAKQLLKVIDDHFGTLPWCRRYLDRLGQDKYLFALNSLVKQGHVQDYPPLNDVIGSYT
                     AQYEHTILLHPHKKEVVSKGDDY"
     gene            <353235..>354011
                     /locus_tag="CAGL0G03663g"
                     /db_xref="GeneID:2888371"
     mRNA            <353235..>354011
                     /locus_tag="CAGL0G03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446523.1"
                     /db_xref="GeneID:2888371"
     CDS             353235..354011
                     /locus_tag="CAGL0G03663g"
                     /inference="similar to AA sequence:UniProtKB:P40075"
                     /note="similar to uniprot|P40075 Saccharomyces cerevisiae
                     YER120w SCS2 required for inositol metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446523.1"
                     /db_xref="GeneID:2888371"
                     /db_xref="GOA:Q6FTC1"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC1"
                     /translation="MSLVDISPDVLEYKSPLTRQSTAYVTVKNNSDQAIAFKVKTTAP
                     KFYCVRPNASVVAPGEIVDVQVIFLGLPEAPAPDYKCRDKFLVITLPSPYDLGSKSVS
                     EAWADLEAEFKQQAISKKIKVKYLIDTEVEKNPQSVPETEDARETIQPAHQPAPIAET
                     KPSEVTENKMPMTKEVPVAAPVTAAPITADIEEKNAMPKTETHENVDELKEEPPVTTT
                     EKEEAKVQSSVTKKSGNEGSTNTMLIVICLAVLILGWLYR"
     gene            <354696..>354923
                     /locus_tag="CAGL0G03685g"
                     /db_xref="GeneID:2888368"
     mRNA            <354696..>354923
                     /locus_tag="CAGL0G03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446524.1"
                     /db_xref="GeneID:2888368"
     CDS             354696..354923
                     /locus_tag="CAGL0G03685g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446524.1"
                     /db_xref="GeneID:2888368"
                     /db_xref="GOA:Q6FTC0"
                     /db_xref="UniProtKB/TrEMBL:Q6FTC0"
                     /translation="MGLLETPISIPSDDKNYQLTSSPRYINWHMFGTATSQELVSNGA
                     PGMNGKRALASESSSLGLKRQKSDKTTRSMS"
     gene            complement(<355469..>356929)
                     /locus_tag="CAGL0G03707g"
                     /db_xref="GeneID:2888369"
     mRNA            complement(<355469..>356929)
                     /locus_tag="CAGL0G03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446525.1"
                     /db_xref="GeneID:2888369"
     CDS             complement(355469..356929)
                     /locus_tag="CAGL0G03707g"
                     /inference="similar to AA sequence:UniProtKB:P38682"
                     /note="similar to uniprot|P38682 Saccharomyces cerevisiae
                     YER122c GLO3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446525.1"
                     /db_xref="GeneID:2888369"
                     /db_xref="GOA:Q6FTB9"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB9"
                     /translation="MDDGEVFVEDSVRQQVFTKLGSRLENRVCFDCGNKNPTWTSVPF
                     GVLLCIQCSAVHRNLGVHITFVKSSTLDKWTVNNLRRFKYGGNHKAKEYFMKNNGKQY
                     LNSSNVNAQAKYTSLVAKKYKAHLDSKVEKDMQQYPGELVLTEMDNQGDETSSDSNSV
                     ASTPKEGSVDDFFSNWEKPKVDNGSVTPTLSPRPTGGLNANSSNNNSSTSLGRKTGSS
                     ILNSRRKTSTPQATQGAKKHSILSSSRKPTRLGAKKVDKSKAEDLFDQFEKEAEEEKE
                     LELHNSSTTSSFPNKYQAPSFGSTEKDDEDSFAKKEDVFNGEEESFVDPAPVEDLKPK
                     FAKLGFGMTNNEANELAQQHKEAKRAASGPKYTGSIAAKYGGQKAISSDMMFGRGTYD
                     EAASREAREKLKTFDNATSISSSSYFGEEQSEEDLLEGGNGAYNPQRNYGGAAGSNGA
                     FIDFNSSTDDELQMLKDMVETGAEKLGNYLRDYLRK"
     gene            complement(<358028..>359812)
                     /locus_tag="CAGL0G03729g"
                     /db_xref="GeneID:2888372"
     mRNA            complement(<358028..>359812)
                     /locus_tag="CAGL0G03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446526.1"
                     /db_xref="GeneID:2888372"
     CDS             complement(358028..359812)
                     /locus_tag="CAGL0G03729g"
                     /note="weakly similar to uniprot|Q08887 Saccharomyces
                     cerevisiae YOR372c NDD1 protein required for nuclear
                     division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446526.1"
                     /db_xref="GeneID:2888372"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB8"
                     /translation="MEETPEWKRLNPHGEDLEAHLLHVFSENMKYFASPLGNSIQPTA
                     GGNGVKSFPTPYSRVQSSADNSCASNAEVAVANGRNGNAGSSPFLDNSILPMNTTMTT
                     ALGEGSATKQLQHGAEPSLDDINLQPSSVFNNALNQQPSVRISGPPGNNVRTQGNGHG
                     MLIDPNSAGPQNGNCEFLASPEQLREFLLDSPNFSLLNNNNTKTPAKTPLKFLNSSAQ
                     INWDLLNSTSSTKFLYSNSNRTPLRRIDQNVLTFNNMPSSVSPYREKKDALNFFGTNS
                     TGLTPFAKREIGNDFDPNNIQTSNSALADFQRARKDTMGLSLNSTPNVASIRKNKNNF
                     LMKTPNNNKSPSKLSKLGNIPNFTNRDDENKENNIYGSSPTTIQLNSSVTKSPLKIDH
                     SRLNIIPSQEQKNLPAKNRQLKAGKQSDYNIDDRLLLFDRDSGVLKHDDEDSKLAIPL
                     SPTPISHNKSNISLDAKNRPILPIPELPKMGSFKSDSMATAPKVFNTVPNNSQKAMKS
                     KSKDGKVKKKIKKQPKFQIIVSNAHKFNVTKSSTTLQSGAKGPTNSKKANLQRSASTL
                     TTNQKPKKNGLPKSKSFSAAPIQNKKQP"
     gene            <360146..>361096
                     /locus_tag="CAGL0G03751g"
                     /db_xref="GeneID:2888373"
     mRNA            <360146..>361096
                     /locus_tag="CAGL0G03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446527.1"
                     /db_xref="GeneID:2888373"
     CDS             360146..361096
                     /locus_tag="CAGL0G03751g"
                     /note="weakly similar to uniprot|Q12373 Saccharomyces
                     cerevisiae YLL022c HIF1 HAT1 Interacting Factor 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446527.1"
                     /db_xref="GeneID:2888373"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB7"
                     /translation="MDECRDIARRLDEGEAAGEAADCGLLLKLARGLIQHGIANSDLF
                     NGMEGGDGDDDDDDEQGEYEDEEGDEDGDDDNENDNDNANDVDVDVDDEGEGVGAQPT
                     VNTKFYQFDLEEEEDLDDDEESGAEDEEEEFRFSDYVDGDPFENALVVLQRGEEIAQG
                     EMLVDVYKLMGEAYAEVGAEDDSINCYERAIEVIESRESGERDLTKQIEILERLSQNL
                     KLSAEVSADKKLEIANKLKGYLEKQLSQDKDDETNLARLEEVKLDIREIKMEKEMDQS
                     GNSKELLKNLILTQMAKLDPLKGKRKAVNDLSGMIVKKKK"
     gene            <361610..>362464
                     /locus_tag="CAGL0G03773g"
                     /db_xref="GeneID:2888374"
     mRNA            <361610..>362464
                     /locus_tag="CAGL0G03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446528.1"
                     /db_xref="GeneID:2888374"
     CDS             361610..362464
                     /locus_tag="CAGL0G03773g"
                     /inference="similar to AA sequence:UniProtKB:Q12164"
                     /note="similar to uniprot|Q12164 Saccharomyces cerevisiae
                     YLL023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446528.1"
                     /db_xref="GeneID:2888374"
                     /db_xref="GOA:Q6FTB6"
                     /db_xref="InterPro:IPR005344"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB6"
                     /translation="MPPKVPATTVKDRFLKVAKSLQFAWFAGHFLVVVSSLLYLFRFC
                     ETLYRCAYVGVLASFGIITYQQGLHQQLSLSLLTNENVLYFALALVWFFTPRFSLSLV
                     PYFMFSVFHVLVYLKTTLLPQVFNQTVESKSKVVMFIDKFVLDYNERCMYWVSTTELL
                     MLFLLFVRAVLFFSRSWIVLVVFTLFIKVKYETSKYMQAAFAQWRVRMDGVISHPSVP
                     PQIKSLYNQLKFQLVQLSKVTITRAAPGTHGSTSASTGSTGTSTSTSTSTSGASASAT
                     ATHSAKMD"
     gene            <363008..>364930
                     /locus_tag="CAGL0G03795g"
                     /db_xref="GeneID:2888331"
     mRNA            <363008..>364930
                     /locus_tag="CAGL0G03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446529.1"
                     /db_xref="GeneID:2888331"
     CDS             363008..364930
                     /locus_tag="CAGL0G03795g"
                     /note="highly similar to uniprot|P10592 Saccharomyces
                     cerevisiae YLL024c SSA2 or uniprot|P10591 Saccharomyces
                     cerevisiae YAL005c SSA1 or uniprot|P09435 Saccharomyces
                     cerevisiae YBL075c SSA3 or uniprot|P22202 Saccharomyces
                     cerevisiae YER103w SSA4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446529.1"
                     /db_xref="GeneID:2888331"
                     /db_xref="GOA:Q6FTB5"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB5"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAMNPHNTVFDAKRLIGRNFNDNEVQTDAKHFPFKLVDVDGKPQIE
                     VEFKGETKKFTPEQISSMVLGKMKETAEQFLGSAVNDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGGEENVLIFDLGGGTFDVSLLSIEDGIFEVKA
                     TAGDTHLGGEDFDNRLVNHFVQEFKRKNKKDLSSNQRAMRRLRTACERAKRTLSSSAQ
                     TSIEIDSLFEGIDFYTSITRARFEELCADLFRSTLDPVEKVLRDSKLDKSAVHEIVLV
                     GGSTRIPKVQKLVTDFFNGKEPNRSINPDEAVAYGAAVQAAILTGDQSSKTQDLLLLD
                     VAPLSLGIETAGGVMTKLIPRNSTIPTKKSEIFSTYADNQPGVLIQVFEGERAKTKDN
                     NLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLS
                     KEDIERMVAEAEKFKEEDEKESERIASKNQLESIAYSLKSSISEAGDKLEEADKEAVS
                     KKAEEVIQWLDNNTTATKEEYDDQLKELQEIANPIMTKLYQAGGAPGGAGAAGGFPGG
                     APPAPEAEGPTVEEVD"
     gene            complement(365402..365510)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0G03817r"
                     /db_xref="GeneID:2888332"
     tRNA            complement(join(365402..365438,365474..365510))
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0G03817r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2888332"
     gene            <365892..>366824
                     /locus_tag="CAGL0G03861g"
                     /db_xref="GeneID:2888333"
     mRNA            <365892..>366824
                     /locus_tag="CAGL0G03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446530.1"
                     /db_xref="GeneID:2888333"
     CDS             365892..366824
                     /locus_tag="CAGL0G03861g"
                     /inference="similar to AA sequence:UniProtKB:P53230"
                     /note="similar to uniprot|P53230 Saccharomyces cerevisiae
                     YGR046w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446530.1"
                     /db_xref="GeneID:2888333"
                     /db_xref="InterPro:IPR015222"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB4"
                     /translation="MSQFLLRDARRSLLRPLRRCYSSNFSNQAIEIESGLQRELDGIL
                     NSFDAPITYAFGYGSGVFKQVGYDSTDKPQIDLILAVEDPVEFHSRNIKQNSHHYSSL
                     KYFGPKVISRFQDVGAGIYFNPYANINGNEVKYGIVSMKRILNDLKNWESFYIAGRLQ
                     KPVKVLKTNPTIEHYNHLNLKAAATLAKHLISVKYPEKFDEFQFYKEITGLSYLGDIR
                     YHLGAENPKKVENIVTKNFDKFRMYYKPIYEDVVVNNGYYLPPGFTLKNSLKKIQYRI
                     QRTSLTQMLKGVATAGITKSVKYAWAKRMKSRSK"
     gene            complement(<367226..>369952)
                     /locus_tag="CAGL0G03883g"
                     /db_xref="GeneID:2888376"
     mRNA            complement(<367226..>369952)
                     /locus_tag="CAGL0G03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446531.1"
                     /db_xref="GeneID:2888376"
     CDS             complement(367226..369952)
                     /locus_tag="CAGL0G03883g"
                     /note="highly similar to uniprot|P31539 Saccharomyces
                     cerevisiae YLL026w HSP104 heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446531.1"
                     /db_xref="GeneID:2888376"
                     /db_xref="GOA:Q6FTB3"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB3"
                     /translation="MNDETQFTERALHILTVAQKLATDHQHPQLQPIHLLAAFIETPE
                     DGSVAYLQNLIEKGRYDYDLFKKTVNKALVRVPQQHPAPAEVTPSYALGKVIQDAVKI
                     QKQQKDSFIAQDHLLFALFNDASIKQVFKDAGVDTEAVKQQALELRGSQRIDSRGADT
                     NTPLEYLGKYAIDMTEQARQGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGK
                     TAIIEGVAQRIIDDDVPTILQGSKLFSLDLAALTAGAKYKGDFEERLKGVLKEVEESK
                     TLIVLFIDEIHMLMGNGKDDAANILKPALSRGHLKVIGATTNNEYRSIVEKDGAFERR
                     FQKIDVQEPTIRQTVAILRGLQPKYEIHHGVRILDSALVTASQLAKRYLPYRRLPDSA
                     IDLVDISCAGVAVARDSKPEELDSKERQLQLLQVEIKALERDKDADCTTKDRLKQAKK
                     REASLIEELEPLRQRYNEERKGHEELTKLKKKLDELENKALDAERRYDTATAADLRYF
                     AIPDIKKKIDDLENQVAEEEQRAGANSMIQNVVDSDTISETAARLTGIPVKKLSESEN
                     EKLIHMERDLSSEVVGQMEAVKAVSNAVRLSRSGLANPRQPASFMFLGLSGSGKTELA
                     KKIAGFLFNDENMMIRVDCSELSEKYSVSKLLGTTAGYVGYEEGGFLTNQLQYKPYSV
                     LLFDEIEKAHPDVLTILLQMLDDGRITSGQGKTIDCSNCIVIMTSNLGAQYINLQKGS
                     KIMDETKTLVMEAVKQHFRPEFLNRISSIVVFNKLSRKAIHKIVDIRLKEIEDRFEMN
                     DKHYKLELTPEAKDFLAKYGYSEDMGARPLNRLIQTEILNKMALRILKGEIQDKETVK
                     VVLKVGKERGSASTEDEEESLDVLPNHEATIAIDNDTMDIDDDDDDDAVDVD"
     gene            complement(<370798..>371550)
                     /locus_tag="CAGL0G03905g"
                     /db_xref="GeneID:2888377"
     mRNA            complement(<370798..>371550)
                     /locus_tag="CAGL0G03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446532.1"
                     /db_xref="GeneID:2888377"
     CDS             complement(370798..371550)
                     /locus_tag="CAGL0G03905g"
                     /inference="similar to AA sequence:UniProtKB:Q07821"
                     /note="similar to uniprot|Q07821 Saccharomyces cerevisiae
                     YLL027w ISA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446532.1"
                     /db_xref="GeneID:2888377"
                     /db_xref="GOA:Q6FTB2"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR017870"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB2"
                     /translation="MSIRSIYNGRLPVLLRSARYLHGSRAVLGPAVSNERPTNTVAFK
                     FSFNKPRKETSPVSAKWSSHRMPSKEVLQEQAQVIKAKEEEKKVATEKFIKENMIELK
                     EPEAVEKVQDTPTNKATATAKASDSSAPAKKKGKRRILRPRKAVITLSPKAIYHLKAL
                     LDEPEPKLIRVGAKNRGCSGLTYDLQYITEPGKFDEVVEQDGVKIVIDSKALFSVVGS
                     EMDWVDDKLASKFVFKNPNSKGTCGCGESFMV"
     gene            complement(<372896..>374599)
                     /locus_tag="CAGL0G03927g"
                     /db_xref="GeneID:2888403"
     mRNA            complement(<372896..>374599)
                     /locus_tag="CAGL0G03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446533.1"
                     /db_xref="GeneID:2888403"
     CDS             complement(372896..374599)
                     /locus_tag="CAGL0G03927g"
                     /note="highly similar to uniprot|Q07824 Saccharomyces
                     cerevisiae YLL028w TPO1 polyamine transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446533.1"
                     /db_xref="GeneID:2888403"
                     /db_xref="GOA:Q6FTB1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB1"
                     /translation="MVEEISPKYTNEQAEASSSSSSSVSGEPKDFSGSLENQEDLGEL
                     IERTNTMTSGAESKVETNRRMSRILTGTQDDPEKIAIDYSNCPPMGGDRPFPPALPEQ
                     SQFEVTFDGPNDPIHPFNWSMKTKTIICIVLCLNCICISMGSSIFASGVPQICKIYHV
                     IPVVAILGVTLYVFGFAASPVIYAPLSEVYGRRGVLVISAFGFAVFQFAVATSKDLQS
                     IMICRFFGGLIGAAPMAVVPAAFADMFDVRVRGKAICLFSLGVFVGPILSPVMGSYIA
                     QRTTWRWLEYVTGCFASALFVAVALTFKETHHPTILVQKAKEMRKSTNNWGIHAAHEH
                     VELSVSEIAKKTITRPIKMLFTEPLLLIITIYNSFVYGILYLMLEAYPIVFVEGYGFE
                     ANGELPYIALIIGMLVCTAFLWYFENDYLKRIQKAGKLVPEARLIPMVYAGVIFPIGI
                     LWFCWTGYYPHKIHWMCPTVAGSFIGFGLMGIFLPCLNYIIESYLPLAASAVAANTFM
                     RSAFGAVFPLFAGYMFHGMGTGWAGLLLGLFAAALIPVPLFFLKYGERIRKNSKDAYY
                     A"
     gene            <375421..>375924
                     /locus_tag="CAGL0G03949g"
                     /db_xref="GeneID:2888206"
     mRNA            <375421..>375924
                     /locus_tag="CAGL0G03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446534.1"
                     /db_xref="GeneID:2888206"
     CDS             375421..375924
                     /locus_tag="CAGL0G03949g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446534.1"
                     /db_xref="GeneID:2888206"
                     /db_xref="GOA:Q6FTB0"
                     /db_xref="UniProtKB/TrEMBL:Q6FTB0"
                     /translation="MHVRNGPATELLSTRRCFSSVYRVVYVVCSICYTPDRELYGSVM
                     QAEFLFCLRYVSLSEWFHWNSVRDGEVGAEEDNGPPRLSYLPMRKKSNGSVSTHKTYG
                     IILRERELGVHPFTPDPPFTHPHQVTLQIHITIPLSLFYPRSCDSFILKIYGNGSTTC
                     SCWNYRK"
     gene            complement(<376258..>378525)
                     /locus_tag="CAGL0G03971g"
                     /db_xref="GeneID:2888252"
     mRNA            complement(<376258..>378525)
                     /locus_tag="CAGL0G03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446535.1"
                     /db_xref="GeneID:2888252"
     CDS             complement(376258..378525)
                     /locus_tag="CAGL0G03971g"
                     /inference="similar to AA sequence:UniProtKB:Q07825"
                     /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
                     YLL029w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446535.1"
                     /db_xref="GeneID:2888252"
                     /db_xref="GOA:Q6FTA9"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA9"
                     /translation="MLVSLKNSKDLIRTMVSGLAASGTVRRYNPPPAPMPHGGARMSR
                     PCADCTCSPGLLSRQGRRVSLFMRQMENTRRRSQRNSVLMSAAGSPTTAVNSGNVSVY
                     SSDSLCQSTREINTTERLLALRKEMAKEGICCYLVPSADEHQSEYVSAVDQRRAFISG
                     FSGSAGIACVTRDLLNFNEKHPDGKSILSTDGRYFNQARQELDFNWTLLRQGEDPLTW
                     QEWCIREAVEMSEGLGGKPAKIGVDPKLISFEEVKAFEKLIKEKTEDKNCDVSLVPVE
                     RNLVDTIWKKFEPIPEKPNNGLLLLGSEYHGEDFKTKKEKVLKDLNEKHLQPSSGSAK
                     KNATFITVALDEICWFLNLRGSDIEYNPVFYAYLFVNDKETILFTDDTYNDEIKKYFE
                     DNEIIVKPYNEVWGHLVSVAQAPVSSDSGKTAFLLPDVSSWQLVRSVAGSPYKIVHSP
                     IDMLKSVKNDTEIANAHRAQVKDAVCLIQYFAWLENQLINKEALIDEYSAAERLIDIR
                     KTQKNFMGNSFETISSTGANASVIHYAPPKEGSSMIDPSKIYLCDSGSQFLEGTTDIT
                     RTLHFSEPTEEEIKNYTLVLKGNLALERLVFPEKTNGMSIDVIARQYLWSFGLDYRHG
                     TGHGIGSFLNVHEGPIGVGIKPHLANYPLQAGNIISNEPGFYKDGEYGIRIENDMLVK
                     YADGLKFGDRKFLKFENITLVPYCRKLIDANMLTHEEKKQLNEYNQRIWDSLVQLIQP
                     QSISYKWLKREVAPF"
     gene            complement(<378876..>379229)
                     /locus_tag="CAGL0G03993g"
                     /db_xref="GeneID:2888245"
     mRNA            complement(<378876..>379229)
                     /locus_tag="CAGL0G03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446536.1"
                     /db_xref="GeneID:2888245"
     CDS             complement(378876..379229)
                     /locus_tag="CAGL0G03993g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446536.1"
                     /db_xref="GeneID:2888245"
                     /db_xref="GOA:Q6FTA8"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA8"
                     /translation="MPLLVYKILFSTELCYAPRCDWEYLSQPCHTRKPTFSVLWDSRA
                     ILGEETKRVAVTGSASIFSIFSIIFQLIVRGDYLLVSTYVHGHMKYYVHGYMCISLFT
                     QTHDRHVQQYNRVQF"
     gene            <379330..>382389
                     /locus_tag="CAGL0G04015g"
                     /db_xref="GeneID:2888246"
     mRNA            <379330..>382389
                     /locus_tag="CAGL0G04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446537.1"
                     /db_xref="GeneID:2888246"
     CDS             379330..382389
                     /locus_tag="CAGL0G04015g"
                     /note="highly similar to uniprot|Q07830 Saccharomyces
                     cerevisiae YLL031c GPI13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446537.1"
                     /db_xref="GeneID:2888246"
                     /db_xref="GOA:Q6FTA7"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA7"
                     /translation="MDERVVRQAVLSTSSDEKRIYRSRMQKFSKSHALYVILLGALAF
                     LQFVAIAFFAKGFLLSRTVLDNVSTTSDNPLAVDKKFDKMVLLVVDALRFDFVVPVST
                     SHPNYNENFHNNLDVLYNTWLSTRHGGRGGYSNSGSSILLKFIADPPTTTLQRLKGLT
                     TGSLPTFIDAGSNFDGSVIEEDNLIKQLFLANKSVSFVGDDTWDALFHPFLANNSEPY
                     PSLNVWDLDTVDNGVISYFKSHLLDKSADRNWDILVGHMLGVDHVGHKYGPNHFTMRE
                     KQNQVNRFIQEIIESIDNDTLLVVMGDHGMDHTGNHGGDSQDELESTLFFYTKRQNTW
                     KNQNGNYDIENLAQNYHSVNQIDLVPTLSLLLDIPVPFNNLGWPISEAFENEKEELAC
                     DNVVLQQLKRYADVMQLTYTEELEETMSALWRNSTADVFAASQYQQKFLEVCKDKWAR
                     FDYWSIASGTILLTISLILLLSITKLIPSIVVNQMVPEFVPWIIIMSLISNVCFHGIF
                     YVFHQPVFLDNVWWCTLFASAVGIITGCSISIFDRYSFVWLVMKMVEILSDYWSRIGA
                     MFVVIHAMLFTSNSFTIWEDRIVAIMLITFGMLTLYEFTFLPTRQSTSALLTAAIGEK
                     QGTTSGVSQSTANSNNLPLTRFARLLGSYHSIVLIVSTRVASVITICREEQGEYCTPT
                     FTTKNNYAWWCLGLCLLIVILLPICIKGYYNLSSSYQAAAPIWVDMFLKGALFVNFLY
                     WSITAVENSTESLEWDTKTVKITIARIIAGFSLIATNVGWMMGPLCIKLNVKNADLKS
                     NQATILGYTNIYGSEFFLLVINALMAIMLFNKPLAQLSLFLMVNQILSIFEIIDLLKL
                     KENIVGPIALGLVAYQQFFSTGHQATIPSVQWDVGFILSDKIIFPFTHLGILLNTFGP
                     HIIVSLSVALLTLWSQPPDVLKPQTLLGRIVSNCGVLLTYNTVLCLSSFIWVTHFRRH
                     LMVWKIFCPRFIFACLSLIVMQLVITFGTIGFASGRLIRHINDIFWK"
     gene            <383068..>385404
                     /locus_tag="CAGL0G04037g"
                     /db_xref="GeneID:2888315"
     mRNA            <383068..>385404
                     /locus_tag="CAGL0G04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446538.1"
                     /db_xref="GeneID:2888315"
     CDS             383068..385404
                     /locus_tag="CAGL0G04037g"
                     /inference="similar to AA sequence:UniProtKB:Q07834"
                     /note="similar to uniprot|Q07834 Saccharomyces cerevisiae
                     YLL032c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446538.1"
                     /db_xref="GeneID:2888315"
                     /db_xref="GOA:Q6FTA6"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA6"
                     /translation="MPIETIVPLSLNLFLKPKALYITEEQWQNILKHFGISTDVEKAI
                     FRTPSDFNFVQSNEIKNNTSKLLGNTRTRNVEDVDICTFPIKNLPQGKDIKDLFTELQ
                     VIASNFKVACIINDTHLFGNEIKKTDFYAYVIGACEVLNQIKPLIDVTILNFLRDEFF
                     IDTIKLNTQSLIPFLAGVKQNNIKYIKDSFQVDVYYTWPSTNNYELEPIVYIAGSIYA
                     NVLAAKELLTACLNKCQSTLFYQELTGISPGKLEYVRRYFKKEIQSLMNQYGSFVFIS
                     SDFVGFQSTSVTMLKSLTKEFTLTILQSIAEIRVTMDSEFEFTDEMVIDILSAKDEQQ
                     LIVRDDEISNQFILIRNSSQKSKVNGKSTTPLHSLKKYLEDHESQIEELKAIFEIHPD
                     YDDFISGKKNGKLTRIMEKSQAQLDLNFEEDDKNMFLSIISNKVNNLESAFTLLLDEL
                     PCEGTFFIPEVYHRPAIGSGGSIIQTTMRKHNVFIQFSNTFLLPQSGLSFVRFDNVII
                     RCPFKNRKGIDLAIEDLKVLIQEYSEQQPSTNIRLSPAQYKHVLFEHINTIGHLEKQN
                     NVFLDFPQNIPKTTVNISIRGNDTSSIQCADEVTNRLYGFERTFQLSECIPNDKLLSN
                     KKLQNELVVPLFIRLHAFVSCQDKTFTLVYDKAKVNNKDFENQIQQYLEENGLIIEDK
                     KTVSKFITDTTAYAGFDQHDSPRAYKQQNPNMSPNYSQNSYKKPIPPLQALAEQNSMR
                     GKPPLLKQYGQHSPYYRYGYGYAYNYVYDYNNMYPPPK"
     gene            complement(<385570..>386889)
                     /locus_tag="CAGL0G04059g"
                     /db_xref="GeneID:2888065"
     mRNA            complement(<385570..>386889)
                     /locus_tag="CAGL0G04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446539.1"
                     /db_xref="GeneID:2888065"
     CDS             complement(385570..386889)
                     /locus_tag="CAGL0G04059g"
                     /note="highly similar to uniprot|Q04673 Saccharomyces
                     cerevisiae YLR005w SSL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446539.1"
                     /db_xref="GeneID:2888065"
                     /db_xref="GOA:Q6FTA5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA5"
                     /translation="MSSDEDEVVRKPRNDDMRKRALRNGNAGKKKKVVKKKKKLANEN
                     LQGASGGYAWEDEIKRSWDLVAVEDEGDMATLVASIVEARKKRAAKSDVTPYQRGIIR
                     TLILTIDSSEAMLEKDLRPNRHAMIIQQAIDFVHEFFDQNPISQMGIVTMRNGLAQLV
                     SQVSGNPQDHIDALKSIRKQEPKGNPSLQNALEMARGLLLPVPAHCTREVLIVFGSLS
                     SNDPGDIHQTIASLVQEQIRVKVLGLSAEVAICKELCKQTNMGDTSFYQVLLDETHLK
                     KLFDEAVTPLPVNKINRGFTLVKMGFPTRIFEEQPTFCACHAKLIYGGYFCPNCNSKV
                     CSLPTVCPCCDLMLILSTHLARSFHHLMPLKTFVEVPAAESFPTENCYSCQMKFPIIK
                     SQKSNQMLTSSRYRCEECKNDYCIDCDVFIHESLHTCPGCESKATII"
     gene            <388383..>389924
                     /locus_tag="CAGL0G04081g"
                     /db_xref="GeneID:2888127"
     mRNA            <388383..>389924
                     /locus_tag="CAGL0G04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446540.1"
                     /db_xref="GeneID:2888127"
     CDS             388383..389924
                     /locus_tag="CAGL0G04081g"
                     /note="highly similar to uniprot|Q07904 Saccharomyces
                     cerevisiae YLR004c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446540.1"
                     /db_xref="GeneID:2888127"
                     /db_xref="GOA:Q6FTA4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA4"
                     /translation="MEKDLEKESQLSKAYTSESSFSENEVDVALKFLKQNGDVERVID
                     DHSVDRRAIFYGSKKLDKKIKRKLDKYILSFLCVTYLLMFLDKALLNYAAAMGIKKNL
                     KGDEFSNLSTIFSAAYIFMEPIVTLLIQYFPLSKIMGTFICTWGAVLACHSACKTYAS
                     LMIVRTLLGMFESASAVGCIAISGMYYTKSEQSARIGFWATQAGTGYVIGGLISFGFL
                     HYHGRDFTSWQIMFLVVGLITVVFGIVTFLYLPDNVTNAWFLDHDEKVAVIEHIRDNQ
                     TGVENKKFKKSHIKELFLKDKLTWPMLMITACSQISTGAIGSFSTTITKTFGFDSYES
                     ALLQLPIGAIVAIIIIVTTQMISRWGHFTLVTTSMYIPAVIGSIVLISLPLEHKIGNL
                     FSLYLVYSGSCVITNIYIWNTCNTSGYCKRIFRNAITMIVYNISCIVAPQMFRAYSAP
                     RYIPAKIALLVTQAVCIPLQLYVGYLSKKENEKRDKEQEGQAPEKYMFLDLTDIENRN
                     FRYVY"
     gene            complement(<390249..>392405)
                     /locus_tag="CAGL0G04103g"
                     /db_xref="GeneID:2888268"
     mRNA            complement(<390249..>392405)
                     /locus_tag="CAGL0G04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446541.1"
                     /db_xref="GeneID:2888268"
     CDS             complement(390249..392405)
                     /locus_tag="CAGL0G04103g"
                     /inference="similar to AA sequence:UniProtKB:P27351"
                     /note="similar to uniprot|P27351 Saccharomyces cerevisiae
                     YJR005w YAP80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446541.1"
                     /db_xref="GeneID:2888268"
                     /db_xref="GOA:Q6FTA3"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA3"
                     /translation="MSDQRVFSRYKASEINAELQSYEVNKFKLNSIKRKNALRKIVAN
                     LTLGNYNEMSLLGDAIHKFWQIDDDFEVKRICHEYVSVIGSMKPRLVVDFLPSIQDDL
                     KSRNSKVQVLALRTLMQIPSSEFLDEAMKFSKLIVSRKTTMSKDVTKAAILNLIQLDE
                     MNHEEILKLVPYLFEISEDQSEAITIRVAALHTLYLIHEKNPQMAPLNIGVDAAFNIL
                     ENIEKANEWDKGLIIETLPVTVVPNTHDDAYDLIDLILPQLQNVNTYVALGTLKFILY
                     LLNYVDSISETVIKRISNSIVALLDNPPEIQFLILRNVILLLLSRGSDMLKLDISYFF
                     IQFNDPIYIKDTKLECLYLLANKNNLIQILDELEQYATDIDIQMSRKAIRAVGNLAVK
                     LDDSAAANCCDTLADLLDFGVDFVIQEIISVFRNIFRKYPNNFKDYVPDLIKCIDIVE
                     EPESINAMIWIITHYYNSIPNYLDEFKQFSDSIEGQALEVQYSILSSSVKFFLRSPSE
                     ETEANCINILKYCTEKADNIDLRNRAFGYWRLLALTKSEKAEEQLPIDTALKIIDGEL
                     PMLELNTKLDSAVLEELELNMGSIVSVYLKPASQIFKNSKLKSLPKNSILIENREQLV
                     IRPDSNNSIPEDVEVNDYFAPRKFMSGTGTGNSTPGTPHSGSSSQRKTMADYDRPAEK
                     VNQLSGKRKSSTSGTTNLSRKPSQLLRRISLKKTPF"
     gene            <393879..>396170
                     /locus_tag="CAGL0G04125g"
                     /db_xref="GeneID:2888269"
     mRNA            <393879..>396170
                     /locus_tag="CAGL0G04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446542.1"
                     /db_xref="GeneID:2888269"
     CDS             393879..396170
                     /locus_tag="CAGL0G04125g"
                     /note="weakly similar to uniprot|P20840 Saccharomyces
                     cerevisiae YJR004c SAG1 alpha-agglutinin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446542.1"
                     /db_xref="GeneID:2888269"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA2"
                     /translation="MLFIGIIQILLLIQYVCTTEIRNIRFSNLKLDPLTDQAHPHQGW
                     KAAFDFQIPDSFKVYKDDYFELELPRVYIIKFAKDSTELLIPLKDRNSEEIFHCSVPQ
                     QAAYKYKSTILRCVTLTDLAPHPEISGHIEFSLSFSNGDSTYQYELENANYFESGLNN
                     IEFTQELNAEVYFDAAKFNDHFYTTIRSTTYKEVEIYFLSMRCPNGYLLGGSQKINFD
                     SKDANCQLNCNTPQIFVSKHFNDWWFPKSYQEIVDADILCFGNNLWITIGEQEKGHLL
                     WVNAMQDVADGQNTLYHDVFIEYTCSDTIAKTTYQTEHTAHLEYRIYEGTNTAIAEVP
                     ASVPSPSKLISSLSSSTSSESISTVISTVCPHCSPSRISSSSSSTSSSSSTSSISITS
                     SSSSSSSSSSSSPSSSSSSSSSTSSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSS
                     SSSSSSSSSSTSTSSISSSSSSTNSSSSSSSSSSTSSSTSSISITSSSSSSSSSSSSS
                     SSSSSSSSSSISTSSSPNSSGSFSSTSSIQSTPYTSSTSLTSSFSSYSSFNTITTSTS
                     SNTTMPPTNERITTVWSTAISFSKYETSSSSIFSLSSGNTSTMTTSKPSTYIITTTVS
                     KYSTSSTFTASTSLPSLSSFEFPSTSISITVTGSVSISLQEPSRSLKPSSREESPPEM
                     PTIDSNNVPPVAQAPTTTKLNNLSSLPLRLTPISLQVDTFPSAQITRSAISSISIYEG
                     CASLKGGISSSFLLFFISILIFF"
     gene            complement(<396363..>396935)
                     /locus_tag="CAGL0G04147g"
                     /db_xref="GeneID:2888120"
     mRNA            complement(<396363..>396935)
                     /locus_tag="CAGL0G04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446543.1"
                     /db_xref="GeneID:2888120"
     CDS             complement(396363..396935)
                     /locus_tag="CAGL0G04147g"
                     /inference="similar to AA sequence:UniProtKB:P49775"
                     /note="similar to uniprot|P49775 Saccharomyces cerevisiae
                     YDR305c dinucleoside 5 5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446543.1"
                     /db_xref="GeneID:2888120"
                     /db_xref="GOA:Q6FTA1"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA1"
                     /translation="MSGSTPIYFSKFLVTEQVFFRTRFSYALVNLKPITKGHVLVVPL
                     RSQVVQLSQLTPQENADYFNTVQLIHQFMKWVYKAQAVNIAIQDGPEAGQSVPHLHTH
                     IIPRYKENNIGDKVYERLDDWDLRRDEYMKARDMNEEGTNLRPDQDDVRIARSMEEMK
                     KEVDFLKAQLEEFLSNHCDVKKWLPTDARQ"
     gene            complement(<397504..>399084)
                     /locus_tag="CAGL0G04169g"
                     /db_xref="GeneID:2888319"
     mRNA            complement(<397504..>399084)
                     /locus_tag="CAGL0G04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446544.1"
                     /db_xref="GeneID:2888319"
     CDS             complement(397504..399084)
                     /locus_tag="CAGL0G04169g"
                     /inference="similar to AA sequence:UniProtKB:Q06640"
                     /note="similar to uniprot|Q06640 Saccharomyces cerevisiae
                     YDR306c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446544.1"
                     /db_xref="GeneID:2888319"
                     /db_xref="GOA:Q6FTA0"
                     /db_xref="UniProtKB/TrEMBL:Q6FTA0"
                     /translation="MANKSRPRRAAVPYRKYVGGQGYMQNVMLSRYKTTGKRVVDGED
                     DLSDEYYDGDEYDGNEKNTNKSGELKIIGAKTRRTDSVGNDILTESDDEGQDEESKTS
                     KRKNRNKRLSSHGRKRSTNLSLEGLTIQDDEVECEPPMIPMKIPLEIQRRVVKYYFDL
                     VEETEYEKENTEFENIMNVMLVSKYWYYLSLGRLYRAPKLSSRNFNAFVETITSAVTT
                     TSMPGAGSKKIDRYRLGDLVQMLDLSTILQSGKNSNVSKLLRRCSNNLLAFTAPQTSF
                     GYAPLISLKNCHKLRFLDLGLVSETVKLKDLFKAISNFNELTHLSFPRSSIDCEGFQE
                     FCWPNNLQYLKLSGGITNEFVAMTNWPETITTLEFSFCPQVDEQSIYTVLAKIGHNLK
                     HLSFFYPMPALRENSLDFIFRYCRNLLSVRLQVDYCSKWLFSEYILTPIEPDLPLEVR
                     RQARPLRTIYLDCSGSLGLASKIHPDDFTIALLESRLPSLKNISVSSKLGWDMNGDDV
                     ADLLTAFEEQDGSLYVSY"
     gene            complement(<399519..>400466)
                     /locus_tag="CAGL0G04191g"
                     /db_xref="GeneID:2888073"
     mRNA            complement(<399519..>400466)
                     /locus_tag="CAGL0G04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446545.1"
                     /db_xref="GeneID:2888073"
     CDS             complement(399519..400466)
                     /locus_tag="CAGL0G04191g"
                     /note="some similarities with uniprot|P53298 Saccharomyces
                     cerevisiae YGR179c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446545.1"
                     /db_xref="GeneID:2888073"
                     /db_xref="GOA:Q6FT99"
                     /db_xref="UniProtKB/TrEMBL:Q6FT99"
                     /translation="MSLLDGIVTSSGSEDDDIVHSSDDEVRNQRHLFVNEETSSVVGT
                     DEGKVRFQTFNAGGDSSSSDEDQEENPWQFPKLIRREMKNRLPNNYNLKRWRKPSRIL
                     VDSVMQLLETNSANSVDIVFEKYDDELMRLLRGKRQEIELIKEDKEKMLGDILQRIEK
                     KLRFSKFPSRLTENDLNIEYIYEKRRFLQERYVQELRKAEILEQEIAKERKLLQDAKE
                     LTENIQQTNDKRLTDKLVRNEIHPVMLQSISDSLDSATQKIAYRRDVIELNLENSHQI
                     HQTTHSIRRPIAQLIDETNQLTSVFNDQNRLHKLEKMIL"
     gene            complement(<400977..>401984)
                     /locus_tag="CAGL0G04213g"
                     /db_xref="GeneID:2888383"
     mRNA            complement(<400977..>401984)
                     /locus_tag="CAGL0G04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446546.1"
                     /db_xref="GeneID:2888383"
     CDS             complement(400977..401984)
                     /locus_tag="CAGL0G04213g"
                     /inference="similar to AA sequence:UniProtKB:P49723"
                     /note="similar to uniprot|P49723 Saccharomyces cerevisiae
                     YGR180c RNR4 ribonucleoside-diphosphate reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446546.1"
                     /db_xref="GeneID:2888383"
                     /db_xref="GOA:Q6FT98"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:Q6FT98"
                     /translation="MKEGEKDEVLLMENKRRFVMFPIKYHEIWAAYKKVEAAFWTAED
                     MELAKDVKDWETLSAGQKEFFGNYLAICSRTDNIVNKNIVEKFSAELQNPEGKSFYGF
                     QIMMENIYDEIYSMLVDALFTSVDNIPLFKAVCQQEEVKAKSEWAHRWVFDDESLYAE
                     RLVASAAREGIFMSGAFAALYWLTKEKGIMPGVAMATNHICRDRGFYADFACLLFAHL
                     KTKPNPKIIEQIITEAVEIEKAHYRNSMPIEKLGMDLKEIDQYIESVADKLLVSFGNE
                     KFYNATNPFPFMEEATSIGKTNFFEKKVSDYQKASATSGTAKTAGSVASSDKIKFDSD
                     F"
     gene            complement(402836..402954)
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0G04235r"
                     /db_xref="GeneID:2888384"
     tRNA            complement(join(402836..402880,402916..402954))
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0G04235r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2888384"
     repeat_region   complement(403020..403983)
                     /note="solo LTR of gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /rpt_type=long_terminal_repeat
     gene            complement(<404144..>406126)
                     /locus_tag="CAGL0G04279g"
                     /db_xref="GeneID:2888078"
     mRNA            complement(<404144..>406126)
                     /locus_tag="CAGL0G04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446547.1"
                     /db_xref="GeneID:2888078"
     CDS             complement(404144..406126)
                     /locus_tag="CAGL0G04279g"
                     /note="weakly similar to uniprot|P40549 Saccharomyces
                     cerevisiae YIL014w MNT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446547.1"
                     /db_xref="GeneID:2888078"
                     /db_xref="GOA:Q6FT97"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FT97"
                     /translation="MSIEGLRYIFYGCKDVLGNRHSFNRRASFLLSFFISLCLLIWYN
                     QHEDTAKLSSIKYRYTEYESQLKLGSSSQLFGRITSKAYKMEQENNRQQQWKNLLFWK
                     PLTVEQLEYNTLPYWNAASDLDRCSLLVKALYDGDPKWNNSEILVWNKDMAMKKYSLL
                     HPVERIRMYNHCFLDKGVDVIQVFKKLGLDEHNATEFNHRMFPMFQFVNVTSDQYLYP
                     KLTDLRTGKVITKPKTKQRALEYNLNFLRNWRNEAKGKGLVITIESNNLHILRKLFKF
                     LKENGNTLPIQLVFKRNVTLARFKDAIISYAEESDQHVTIIEIEALIDDSFNKGTFVG
                     YDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENEEYKNSGLYMWRDKYLGALLHAY
                     ICTDVMKSLEPSMDEYKTIGSKFPLRMNDPRLTDTSDPMGAILHGYYNLYLMHQVDGG
                     VILLNKKQKLGGLIMGMVMNMHRDYAHCSTGTKEAFWFGPYVAGMEFAVGTIDAGIIG
                     PIRRSTIEDRLGVPEICSNQVIHVDHEDKLLWGKGTFYECESDKLQEIDIESEVGIRK
                     RSLPSTDVNVVRRDEQQFASKEPKRGFLAITGFIIPSRVVKKWKYRIGSSVEYYCTFV
                     DRIGDADSKLVRFDKKTKRFVNHLAQIWRETKISVG"
     gene            complement(407139..407211)
                     /locus_tag="CAGL0G04301r"
                     /db_xref="GeneID:2888097"
     tRNA            complement(407139..407211)
                     /locus_tag="CAGL0G04301r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:2888097"
     gene            408152..408223
                     /locus_tag="CAGL0G04323r"
                     /db_xref="GeneID:2888098"
     tRNA            408152..408223
                     /locus_tag="CAGL0G04323r"
                     /product="tRNA-Asp"
                     /note="tRNA Asp (GTC) cove score=60.99"
                     /db_xref="GeneID:2888098"
     gene            <408842..>410977
                     /locus_tag="CAGL0G04345g"
                     /db_xref="GeneID:2888015"
     mRNA            <408842..>410977
                     /locus_tag="CAGL0G04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446548.1"
                     /db_xref="GeneID:2888015"
     CDS             408842..410977
                     /locus_tag="CAGL0G04345g"
                     /inference="similar to AA sequence:UniProtKB:P47025"
                     /note="similar to uniprot|P47025 Saccharomyces cerevisiae
                     YJL112w MDV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446548.1"
                     /db_xref="GeneID:2888015"
                     /db_xref="GOA:Q6FT96"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MTDQISHLGKTLSTAASVLIGSQDIEKNVENNLLSNSPRNPYRK
                     TLQESLTAADFMNHETFDKLRKTRAIASTLSEDSKGLYSQRSREKYFTNKVSDKKTTF
                     KVLSHLSDDLLKDLPETAESKSNTRDQGETKLLKESDSTDASQERIFSLYQGFEASIP
                     VINRSVEKEHLLLEQNNQESAAQILPQMGNKPRIRSGPWEDLLESKEDTYISLDFNPE
                     RISNIKSKKELERINELANNNLVMLDIRKKLSADEIDEIKKQIQDLQLKQNLLVKKIA
                     AIEENELFLEDIIRLIGHRSADFSNDTQIEFDQAKSLSGLNNPESMIDATRPTALERK
                     NSIDIVETSLNEIRTSFDGSKQSIEGKDNHNALNGFFEDASNKKSRKAQPTVQKYYNS
                     GKKLSTIPKAHDDAITCLDFDPHFSTLCTAGYMDHIVKLWDYTKKRQIGAMEGHVATI
                     SCMQVDKNYNMVATGSKDATVKLWNANDVIGRYEEGNNSEALHTLDAHLDEVSSLYID
                     GANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPI
                     IGSIQSFDAALATGTKDGLIRLWDMRTGEVVRVLEGHMDAITSLKFDATTIISGSLDG
                     TIRLWDLRSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRNDGNKWDLQDEE
                     QDTTSLFVKYKERYTMEGRSNGDIGIWIV"
     gene            <411500..>413152
                     /locus_tag="CAGL0G04367g"
                     /db_xref="GeneID:2888016"
     mRNA            <411500..>413152
                     /locus_tag="CAGL0G04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446549.1"
                     /db_xref="GeneID:2888016"
     CDS             411500..413152
                     /locus_tag="CAGL0G04367g"
                     /note="highly similar to uniprot|P42943 Saccharomyces
                     cerevisiae YJL111w CCT7 component of chaperonin-containing
                     T-complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446549.1"
                     /db_xref="GeneID:2888016"
                     /db_xref="GOA:Q6FT95"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FT95"
                     /translation="MNFGNQTPTIVVLKEGTDASQGRGQIISNINACIAVQEALKPTL
                     GPLGSDILIVSSNQKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     ILAGELMKEAKPFLEEGISTHLIMKGYRTAVKLATDKIKELAVDIGSDGEVNRELLER
                     CAKTAMTSKLIYKNADFFVKMCVDAVLSLDRDELNDKLIGIKKIAGGAMEDSIFVDGV
                     AFKKTFSYAGFEQQPKKFNNPKILSLNVELELKAEKDNAEVRVEHVEDYQSIVDAEWQ
                     LILDKLKQIEDTGANIVLSKLPIGDLATQYFADRNIFCAGRVGADDMNRVIQAVGGAI
                     QSTTNDIHDEHLGTCEVFEEIQIGSERYNLFKGCPNAKTSTLLLRGGAEQVIAEVERS
                     LHDAIMIVKRALQNKMVVAGGGAIEMEISKYLRDYSKTIAGKQQLIIHAFAKALEVIP
                     RQLCENAGFDAVELLNKLRLAHSKGEKWFGIDFENENVGDNFAKFVWEPALVKINALS
                     SATEATNLILSVDETIKNKESQGANAGMPAPAGRGRGMPMGM"
     gene            complement(<413376..>414764)
                     /locus_tag="CAGL0G04389g"
                     /db_xref="GeneID:2888022"
     mRNA            complement(<413376..>414764)
                     /locus_tag="CAGL0G04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446550.1"
                     /db_xref="GeneID:2888022"
     CDS             complement(413376..414764)
                     /locus_tag="CAGL0G04389g"
                     /note="some similarities with uniprot|P42944 Saccharomyces
                     cerevisiae YJL110c GZF3 transcriptional repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446550.1"
                     /db_xref="GeneID:2888022"
                     /db_xref="GOA:Q6FT94"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FT94"
                     /translation="MAEHSEDMSGKSPRREAQDYKKGDVVDSEHKQSISTESSTASKD
                     TSVVQSKVEQKVDSKKEKVVAQGDTAGIVSEFGNSAPVCKNCMTSTTPLWRRDEQGSV
                     LCNACGLFLKLHGKPRPISLKTDVIKSRNRKNVQTSPTGAPAELVHDRYKHSFTNFIP
                     TSYEAYKEKKGHMLDKRRHPPSDLRHSITEHGRPYVGESAEADLIRKHKKAKIKSERA
                     VSESSIDSYNSQSKDSAQIKSGENTPLSPQSHSPSGTPLPRLSAVLGDFGSDSRTTAA
                     SNSNIGSMHAKSSEDDKNGNIASLEQSMVEKRKTSIPQVVNSNQSYGGLPTALRGAPI
                     RDSRSTGSNIKEKMSQPQPLDTSHLSHIPPNPHLLMKGKVPSSENLPIRRGSMIDTQK
                     QRNSVDIIDPSNADDEHKIPVSVQLHNEEEVIRLRTRINELELVTDLYKRHIYELDER
                     CKKLEKELRRYK"
     gene            complement(<415927..>421239)
                     /locus_tag="CAGL0G04411g"
                     /db_xref="GeneID:2888167"
     mRNA            complement(<415927..>421239)
                     /locus_tag="CAGL0G04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446551.1"
                     /db_xref="GeneID:2888167"
     CDS             complement(415927..421239)
                     /locus_tag="CAGL0G04411g"
                     /inference="similar to AA sequence:UniProtKB:P42945"
                     /note="similar to uniprot|P42945 Saccharomyces cerevisiae
                     YJL109c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446551.1"
                     /db_xref="GeneID:2888167"
                     /db_xref="GOA:Q6FT93"
                     /db_xref="InterPro:IPR012954"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022125"
                     /translation="MSSLSDQLAQVAASNASVAFDRKKRQKLHSASLIYNPKTAATQD
                     YETIFENALGALQELCDIEPRFQVFSKTLFSETSITIDRNVQSKEENKNLDNAINAYL
                     LMVSSKWHLAPALHATEWLVRRFQIHVHNTEILLLSTLNYYQSPIFKRILNIVKLPAL
                     FQPLSNFVKNDSNPTNITIIKMFNDTDFLKLYSNYLSKCIKHKSTYTNQLLFVTCCFI
                     NLIAFNSSNDEKLEFLVPIILEIAAKLLASGSTDCQIAAHTILIVFTAALPLKKDIVV
                     AAIETILANLKDKKAEQSAFWAVIKISQTLKGQQAIEHLPANIYKIFDKHYTWVRVLD
                     LLTEEPSIKCDKFMTSYIRAMIRFDHSKLDMVVPLVQKLSLEKYEFRSIVIDLIHLSE
                     VLEDKSKLIDLFEFLVKENESLVINCLSSLNLTGEMFEIRLTTSLFSKTNDDNELELL
                     KTLNSHKNTSSDKKEETKPFKQFLEENSEFIVTSNKSMISEDDEKFNKILGLFIEAIG
                     TGYQAGLFLSSFMTTLEARLTFLLRVIVSPSAPIALRLLAMNNISKYIQSIDKELNLF
                     TLIPFLLVAQSGSSKNLKISVKKILGQIGNRPFTKHYFMSNQLYGEGKDIKVPSPSDS
                     EMWTKNFIENYVVENVDISGVFIPKQAEKVFLLFWAQQVLDIPLPYPQYMILNFLGKY
                     VPNTASYSGLFEESISSYLERREELLLRCALNKTDPIQFETAMVNLISNKEKHHFMLD
                     FIINVLQSDYEDLIQILVDRLVEVFATFKTSNQLRIVQEILQSVTKEDQIYDALGTLQ
                     SLQIDPDTFVCIFKENSINSESDVTSFPKRRRRRSSTNKAALQSAEVSQIAEDHLKKL
                     TIMLETLDKQKVKGSEELLSSLFFTLADFETLDQDGGLPVLYAEELLASAMLNTIRSL
                     KDQGLTQLQNVRADIIVSAIRTSSSPQVQNKLLLVIGELATLSSEIVLHSVMPIFTFM
                     GAHSVRQDDEFTTQVVEKTILTVVPAFLAANSENITEEIEFLVMSFATALQHIPKHRR
                     LRLFTTLVQALGSDNSLGPLLLLISQQYSNAVKSFKISESRSLVEFTKLLLSKFEVQE
                     QITGFRKFLELYEKLLLANKNPEKKVTLETQALFSSKILNLTQSEFCDLTNNSYDFLT
                     KVIVDTNDDYYDSSRNFKIRLYSIILDPTVSNATRKALDESYSSVLKMILSLIADYPD
                     IFVFETNENSEKQNSVHFIGDILEEIKQSLYGLLHAILDVLPINVFLTTTVPLLESSI
                     DKEIRYHIASNIFDKFENETVDDHELTQSVVHTLNEKIPQEENNVAQVLLNLQSSLIN
                     KYGSFFDNNLLVEVLNLASGLISTGPRELQISSIAVITNCVSVMGVKFISFYPKVVPI
                     CIKLFNETRASKEELAPQLQLSILLLFTALVKSIPSFLTSDLISLMKLIFFSSGVEVT
                     TRLSVIQLVTEKLDLKNVLGTLLKVWNSEVKESGDSTAISLFLSLLEGTVEKIEKKSA
                     TSQSPLFFKLLICLFEFRSQSEFDTNTISRIESSVYAVANTYVLKLNDKVFRPLFVIL
                     IKWAFDGEGVSSESITEKERLTAFFKFFNRLQENLKGIITSYFTYLIEPVNELLKRFI
                     SGDISDVNLRRLLLNSLTSSLKYDRDEYWQSTSRFELICPSLVNQLSNIEPTIGKYLV
                     KAIGSLAAKNSSVDEHNQMMNKLLVEHMKATCSSNEKLWAVRTVKLIYSKVGESWLVL
                     LPQMVPIIAELLEDDNEEVESEVRGGLVRVMENVLGEPFDRYLD"
     gene            complement(<421718..>424078)
                     /locus_tag="CAGL0G04433g"
                     /db_xref="GeneID:2888410"
     mRNA            complement(<421718..>424078)
                     /locus_tag="CAGL0G04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446552.1"
                     /db_xref="GeneID:2888410"
     CDS             complement(421718..424078)
                     /locus_tag="CAGL0G04433g"
                     /inference="similar to AA sequence:UniProtKB:P42946"
                     /note="similar to uniprot|P42946 Saccharomyces cerevisiae
                     YJL108c PRM10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446552.1"
                     /db_xref="GeneID:2888410"
                     /db_xref="GOA:Q6FT92"
                     /db_xref="InterPro:IPR010619"
                     /db_xref="InterPro:IPR024528"
                     /translation="MADSGDKDVSKSVRFDKESIESKKRSSVDDSASSYSSSSSGQDR
                     SEGKRNNVKFSTEDSDDEDGNLFSRMIKNLKSNGGAGLAPGLSKANSNQEKTDLEDND
                     NVVTGHSDDIPMEDFTSEAQNILQGHSNLTPAQIEALNGQGLSDIETTASSTDLNFLA
                     PAIDHFDDFDGDGEEENDGFVDTHGYVAPPTQVRGGVLGSLLKLYQEQDNATIETSSM
                     YSQSSYGESTANLMSIDSGETEVPSEHKPKDHKNVFMRSGGKVAGLAMNAPGQIYGHG
                     SKAAGHIYGHGRKGAGHIYNQGKKGAGHIYSQKNKLSSADLSTEGLKKSGHKAKKVAG
                     KMPKLRKRMLAEAKITVHIAELLQRQRFILRMCKALMLYGAPTHRLEEYMIMTSRVLE
                     IDGQYLYLPGCMIVSFGDATTRTSEVQLVRCTQGLNLWKLHQVHGVYKKVIHDQMGAD
                     EGNIEIDRILREKNLYPPWVCVFLYGFCSAMVTPYAFGGHWINLAITFFMGSCVGMMQ
                     FILSEKSLMYSNVFEITASIVVSFCGRAFGSIPNSNICFGAITQGSLALILPGYIILC
                     GSLELQSRSLVAGSVRMFYAIIYSLFLGFGITLGAALFGWMYKGATNEISCGYPISPW
                     FRFLFVPAFTIGISLINQANWTQLPAMVFISCTGYVVTYWSGKHFQNSTEFTAALASF
                     VIGILGNLYSRIWQGLAVSAMLPAIFVQVPSGIASQNSLLSGLQSANQIVGRNGTNAV
                     QTVDLSNSMSFGITMIEVSIGISVGLFASTLCVYPFGKKKTGLFSL"
     gene            <426386..>428641
                     /locus_tag="CAGL0G04455g"
                     /db_xref="GeneID:2888279"
     mRNA            <426386..>428641
                     /locus_tag="CAGL0G04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446553.1"
                     /db_xref="GeneID:2888279"
     CDS             426386..428641
                     /locus_tag="CAGL0G04455g"
                     /inference="similar to AA sequence:UniProtKB:P32581"
                     /note="similar to uniprot|P32581 Saccharomyces cerevisiae
                     YJL106w IME2 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446553.1"
                     /db_xref="GeneID:2888279"
                     /db_xref="GOA:Q6FT91"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FT91"
                     /translation="MFQNKARNSDTEMRSGNQMESSIEDIQELEPPPDLDSPPSTIPL
                     KSMHENYEILEELGNGSFGSVTLAKYKINDCFSKDQDRKRMTMMDPKYNNRPENISNS
                     RKQGLVAIKTMLTRLPTLHDYTRVREVKFILSMTANKHLIQVYEIFVDSEKYQLHIAM
                     EYMEQNLYQMMRRRKKRVFSIPSLKSILAQVLAGLRHIHDQNFFHRDLKPENILITPS
                     TRYFDSSWLEKGNYPDNYVVKLADFGLARHVENKNPYTAYVSTRWYRSPEILLRSGYY
                     SKPLDIWAFGCVAMEVTVFKPLFPGSNEIDQIWKILEVLGTPHTLEESKNSNYTPHGG
                     LWELSKAYAAKLNLKFPYVEGSSLEKLLCSNQLTDLLAVIKLCLKWDPNERASVEQLS
                     SMPFFTNTVADNSIYEKENNTNKNTLRSIAEQALLFAGLPSSLSLKSLRGNIKLRDTE
                     ELVTDEQPNDREKDTNFENVPLDDRSESLSIRREDRVPLTTSTNKKESQCSAKDICRD
                     SSFMLRSISQSKKRKKLDNNKLQIDSSANSNNNESNKIIGCSTYRFPNFQGNFASKQD
                     QNIELGNCNGSEITKTDFMKSGQLHQCNRINEEIQNELSKPITFEEQNANNIEKEPFS
                     TVPERCPTDYTAFTFNNITGNDYTFGCQFFKTKKETGRLPHESSHSVNELLDNMSIED
                     LPLKSNQMTELEPRTIPISLVDQFGSDNLNYNIFENNSELRSPNTNEAKASTYEFAFS
                     NPCHAIGNITF"
     gene            <430669..>431721
                     /locus_tag="CAGL0G04499g"
                     /db_xref="GeneID:2888020"
     mRNA            <430669..>431721
                     /locus_tag="CAGL0G04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446555.1"
                     /db_xref="GeneID:2888020"
     CDS             430669..431721
                     /locus_tag="CAGL0G04499g"
                     /inference="similar to AA sequence:UniProtKB:P42948"
                     /note="similar to uniprot|P42948 Saccharomyces cerevisiae
                     YJL105w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446555.1"
                     /db_xref="GeneID:2888020"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q6FT89"
                     /translation="MTNSSPVKERISNGIHHHSSDKFKVAKKRRGSSVSENANRSGIA
                     AAVALAKAATVPFPLKRNSVSSSSSTSPPTEYTKTIANPITLSPIVISELIKPGEKTI
                     KAPIKAPPNEFEDKYVKLFIDSHHDDDSVITIPEESKLKFLPIVLKPLASKDIQDFGV
                     FTSIPCSKKDYIQEYSGMISFSKQYVNNAENKYDILGTPTRNILFHPHWPLYINTSGT
                     KGAHNVLEHLRCSCNPNVELVTVRIMDNKPRIKFVIRAIRDIAEGEELQIAWQWDINH
                     PMWHVVQELQEFDSLNNKDKCRVSRAAEALLQSNQCACTDFKKCKLRKVQQDSRNFIN
                     NLSALMKKELKNEMGG"
     gene            <432221..>432661
                     /locus_tag="CAGL0G04521g"
                     /db_xref="GeneID:2887993"
     mRNA            <432221..>432661
                     /locus_tag="CAGL0G04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446556.1"
                     /db_xref="GeneID:2887993"
     CDS             432221..432661
                     /locus_tag="CAGL0G04521g"
                     /inference="similar to AA sequence:UniProtKB:P42949"
                     /note="similar to uniprot|P42949 Saccharomyces cerevisiae
                     YJL104w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446556.1"
                     /db_xref="GeneID:2887993"
                     /db_xref="GOA:Q6FT88"
                     /db_xref="InterPro:IPR005341"
                     /translation="MAHRALVKIVITGTRVLGHAFAEAYRQAAAQSAAKQGASAMGRN
                     KTGRGNAAAEYGGITLDESCKILNLDAAKDLKLDKVNQRFDYLFNINDKEKGGSFYLQ
                     SKIYRASERLKWELAQREKEAAEEKLPKAEDASEDTGEKSPPSS"
     gene            complement(<432932..>433615)
                     /locus_tag="CAGL0G04543g"
                     /db_xref="GeneID:2888287"
     mRNA            complement(<432932..>433615)
                     /locus_tag="CAGL0G04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446557.1"
                     /db_xref="GeneID:2888287"
     CDS             complement(432932..433615)
                     /locus_tag="CAGL0G04543g"
                     /inference="similar to AA sequence:UniProtKB:Q03390"
                     /note="similar to uniprot|Q03390 Saccharomyces cerevisiae
                     YDR486c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446557.1"
                     /db_xref="GeneID:2888287"
                     /db_xref="GOA:Q6FT87"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FT87"
                     /translation="MNRIFGYGNKKTHDQMLQESGAAMDQAQQGLQHRLSQLDTQIAQ
                     INFQLQALQKKMKGMKSSVGQRPLRAQALKLLNKRKQLEQMRDSIDAQSWSMTQAQMT
                     SDNLKNTMVTVNALKSTNKALKAQYGKIDIDKLQDMQDEMMDLIDQGEELQQVLATNF
                     VGNDIEDIDEGELDAELEALADEDLTAMMANDIGEGEGTEVPSYLAGTVPKFIDEDAD
                     SEQVLESAQ"
     gene            complement(<434012..>435706)
                     /locus_tag="CAGL0G04565g"
                     /db_xref="GeneID:2888424"
     mRNA            complement(<434012..>435706)
                     /locus_tag="CAGL0G04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446558.1"
                     /db_xref="GeneID:2888424"
     CDS             complement(434012..435706)
                     /locus_tag="CAGL0G04565g"
                     /note="weakly similar to uniprot|P40960 Saccharomyces
                     cerevisiae YDR488c PAC11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446558.1"
                     /db_xref="GeneID:2888424"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FT86"
                     /translation="MSESVKEKWTYLEELRRRKQVLLNGATETEPITFESKGDDETTA
                     QIEPIIDENKQSFKMTTNSLVTEDVGVQTMAVEMIDEGFDARPLKGNDDDILVVSEQF
                     VTVGQPILLSRFEHSKDEDDIKFDLGQSGYKILTRWIFDELIVSTGGKLVCVSTDYFD
                     GKVIFVFQQEVVDKNDIQLMLNSWLILIDINRLEDKIQRVKFEGQKIIRGQFVNKSLK
                     SKILTILLTSNIGKTIICEFKTDSHTGELQHSIALKNYHYSPIYAIDEFQNVSSGDER
                     FLTASANGILNMISSTSLQIYDKVDSGCSVVGSIKIVPPKRALVLERYNKFSDDDITD
                     IDERELWSPTRLFVEKLYRVSMFEEIGVTSLSISPENNNQVFVGTEDGGIYKIMLDSI
                     KDKKISISMDNHGFLPEMSQQSRLRSIFHTSDVTSLKFLDITISNKFMPSILLLSSSM
                     DNSACIWDTLSSQLLTIINEQLPVLQADWLLTAKGLMVCILTWTELKLYSITYNNKGL
                     EHQISTRILASSLLQRENQETAPSFSTFNIITEPDKTAKILIGTTSHATFELELPE"
     gene            <436054..>436983
                     /locus_tag="CAGL0G04587g"
                     /db_xref="GeneID:2888425"
     mRNA            <436054..>436983
                     /locus_tag="CAGL0G04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446559.1"
                     /db_xref="GeneID:2888425"
     CDS             436054..436983
                     /locus_tag="CAGL0G04587g"
                     /inference="similar to AA sequence:UniProtKB:Q03406"
                     /note="similar to uniprot|Q03406 Saccharomyces cerevisiae
                     YDR489w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446559.1"
                     /db_xref="GeneID:2888425"
                     /db_xref="GOA:Q6FT85"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="InterPro:IPR021151"
                     /translation="MDIDIDDILAELDRDTTAVASSSGQHGFLDANSSMQHVTQTTAF
                     DSSLPHANNLQKDYSPVTPEQDYLQLLKHWRNERCAPELLPLPKLLVSRMLKRIQDQM
                     EHIENISMGFLEHEILEKDGEEAIGQNEYQNNALNNGKLPLLCMEAELERVKFVMRSY
                     LRCRLNKIDKYSLYLRQLGDQGINLISLDELMSEQELKYHAKHSVILLKLLNNSILRH
                     MPPELQAINDTEGSVSMIEEPNWKKFVFIYVNGPANVADDPQLQQSEDGKYYYNITIP
                     EFDEIVELTTGSIYVMRYDIVKDLLRDGKVELI"
     gene            complement(<437162..>440059)
                     /locus_tag="CAGL0G04609g"
                     /db_xref="GeneID:2888021"
     mRNA            complement(<437162..>440059)
                     /locus_tag="CAGL0G04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446560.1"
                     /db_xref="GeneID:2888021"
     CDS             complement(437162..440059)
                     /locus_tag="CAGL0G04609g"
                     /inference="similar to AA sequence:UniProtKB:Q12236"
                     /note="similar to uniprot|Q12236 Saccharomyces cerevisiae
                     YOL100w PKH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446560.1"
                     /db_xref="GeneID:2888021"
                     /db_xref="GOA:Q6FT84"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FT84"
                     /translation="MGKGHDSKPGVRPLLPSDEVELTAKLSSHRTHSHTTVISSVRSN
                     SVTMPDLVSLHRVSTLEKALTDTSHFIPPVSENDEDINADKEVQTDVMTATDADIKDA
                     EIFRRQTIIRKGIKDFKFGDMLGDGSYSQVFLATSKTDSSKTYAVKVLNKEYLIKQKK
                     VKYVNIEKTALQNLKSVTGVINLSFTFQDEANLYFLLEYAPNGDFLSLIKKFGTLNEE
                     CTIYYSAQIIDAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNG
                     KPHYNLLTRSSSFVGTAEYVSPELLSDNYTDYKCDIWAFGCLVYQMIAGKPPFKATNE
                     YLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKEHCLFENINFSDNS
                     VWNRDPPKILPYRINAKSMQPFSPPIPQSPFQKSKDDKHIIVGKNIKYIRKRTNLPNS
                     ISSPNLDTKSAPNSPTVSQPRNMDRNIDIAIPSQNFKSSAQGLALSSKGSNFIKDTQT
                     KKQEGADNNKETKLTTSNTTKLSRSQSQKIDLHSKIYAKKKSSGNSKAHELHVITKEI
                     PMKKNIDSPRPYSADSYTPKNNYEKSRNSGAPDLPERIYKFDKAESSPYNSDSDTPTD
                     RNMIKRRFSKILLTDFMDIQKEHVLNNIIGDIIVVDTNIFEDKKQNLYNCILNESFRN
                     ATITKQDTVFKSTRENYPHKEEDYYYKSDIPFKTVSGIKELDISEEVISMKSVGDETA
                     AGLYFSPCAFVVTTFGRALMIMETCDKLNFKRIFSINLFCSGTSICMNEVGIISIVNP
                     FKTFILRCSKNDVLIVLSAIKRSIKLNPDSAPPPSIPESPKGANIGKNSAVFDAVQAA
                     RLANPILSREKYHRPTSTYHNRKAQNNTDKNNNRIFNSFVNAKASSKKSVLPVPNSRN
                     LVNGLPSNKEPQTHMVGLGLSQRMRRSGDRTRNETFQQKFNSKNESFLRQR"
     gene            <441149..>442099
                     /locus_tag="CAGL0G04631g"
                     /db_xref="GeneID:2888024"
     mRNA            <441149..>442099
                     /locus_tag="CAGL0G04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446561.1"
                     /db_xref="GeneID:2888024"
     CDS             441149..442099
                     /locus_tag="CAGL0G04631g"
                     /inference="similar to AA sequence:UniProtKB:Q03419"
                     /note="similar to uniprot|Q03419 Saccharomyces cerevisiae
                     YDR492w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446561.1"
                     /db_xref="GeneID:2888024"
                     /db_xref="GOA:Q6FT83"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q6FT83"
                     /translation="MSATTTLRKRASKSVGESGGRNDGSIHAHGEEKSEKLLWHFNEL
                     PEWQKDNDKILRGYVRETNSFKRCLQSLLYLNNESVNIYTHLIPAVFYISLSLYLANV
                     FLIPVYPSTSSVDYVIINVFFLGAFFCLLCSSCFHCMKQHSESQCNVWSKLDYLGIIC
                     LISCSTVPMIYYGYFDHISEFTIFTGITLLLAIGCSVFVLTDKFNTTEYRPIRASFFT
                     LFGFSGIIPLGAGFLKFGAEGVLQRISLPFIGLEALFYISGAIIYGFRFPETIAPGKF
                     DFFGSSHQIFHIMVVLGSICHLFAMVESYHLIHSNFLRPV"
     gene            <442618..>442965
                     /locus_tag="CAGL0G04653g"
                     /db_xref="GeneID:2888026"
     mRNA            <442618..>442965
                     /locus_tag="CAGL0G04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446562.1"
                     /db_xref="GeneID:2888026"
     CDS             442618..442965
                     /locus_tag="CAGL0G04653g"
                     /inference="similar to AA sequence:UniProtKB:Q03429"
                     /note="similar to uniprot|Q03429 Saccharomyces cerevisiae
                     YDR493w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446562.1"
                     /db_xref="GeneID:2888026"
                     /db_xref="GOA:Q6FT82"
                     /translation="MIPEALRKQALIAYKHGLRATRVAFDGDNRVLLAARAEMRKGME
                     NPDSSKTTQEQIQHLEEVATFLKRNLVQGQKIEGEEKYHLKIHKDIELGDNESIKQPT
                     KFKARPFKKCSDN"
     gene            <443571..>444536
                     /locus_tag="CAGL0G04675g"
                     /db_xref="GeneID:2887994"
     mRNA            <443571..>444536
                     /locus_tag="CAGL0G04675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446563.1"
                     /db_xref="GeneID:2887994"
     CDS             443571..444536
                     /locus_tag="CAGL0G04675g"
                     /note="some similarities with uniprot|Q03430 Saccharomyces
                     cerevisiae YDR494w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446563.1"
                     /db_xref="GeneID:2887994"
                     /db_xref="UniProtKB/TrEMBL:Q6FT81"
                     /translation="MWGLKSISTVGVRTYSSQVTHDFLNSILARAQEATAKNKEVVQA
                     NHARAPLRNRTRQQDGGQQRPANKIRQRNGKVQAKFQVRDENSNRAIPDLKTKQPQFK
                     RAQRNNRDGQADVLDVMDAGTGKTNRASMSAKRSNKFTKRGKGSHVIEAVSLSKKPTS
                     AREIALKKSVDSVSYEPVEPTPLSLLAYSTPIFNTHKSNILQISMQTIKNAASPKNTP
                     SGFDAIHSGIMNKERLLNSSQLDVDVDRLKQIARGQYFSLPVLQNKAFDSLTKSEDKK
                     KQLVENSNVVRRSLDSLDIEPEKKEILYAVCSGTQPVSEVSQLSQ"
     gene            complement(<444732..>447584)
                     /locus_tag="CAGL0G04697g"
                     /db_xref="GeneID:2887995"
     mRNA            complement(<444732..>447584)
                     /locus_tag="CAGL0G04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446564.1"
                     /db_xref="GeneID:2887995"
     CDS             complement(444732..447584)
                     /locus_tag="CAGL0G04697g"
                     /inference="similar to AA sequence:UniProtKB:P23643"
                     /note="similar to uniprot|P23643 Saccharomyces cerevisiae
                     YDR495c VPS3 vacuolar sorting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446564.1"
                     /db_xref="GeneID:2887995"
                     /db_xref="GOA:Q6FT80"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="UniProtKB/TrEMBL:Q6FT80"
                     /translation="MTKDPNDSRENLADDPTDSSPTASITDEDNTDHQSSGHLEDDPQ
                     NNNPPPQTDYNDVISMLDPFMSNILVDDLPKDITITCMDADENHIYLGTSEGELLHYY
                     EIEGGEYLLVSRMPFENNSTSSIKKIKLLPNIDRALILCGTRLAMFLLPEFAPCPNVK
                     SINDVNDFDIHSYSRSTNTYRTLVASDKNIMVFKYGSNAISAGKILIDYKNVQYIKAH
                     DNILLLVRDYEYELYNLEDRNSIPLFRVSETGNGSINPLMEDFNSKMFILSSGGNSKD
                     DNAMGLVVDHVGEIVKATLVFEHYPQNVVIHYPYILALFHDGQLLIYRLKIDEEPELV
                     QRITNNDGNTLLTRVRMRFKVSYQNNKMVAELVEKIRKVPLSHDDNSFGVDREKALAE
                     NMIEPTSSIIMWYNAKIYCLFTKPFLCSINKYGNDEVKRIQEYIEHRKNSDLKISKLQ
                     KVEMKYLSNLVLLWDLFDTNIINKHTIQKWVDNSDRVDVRQLLFLLDYEIFGEIWIFN
                     GLNRMMKHLKTLPLKNKCNKSSQLDDLQYFQKILKDKYCTRDKLPREYKSTMKSLTIA
                     IFRILLAEGKHINLDEFEDAYLPELIHIIQKESEPNDHNEMLIRIYTKMKDHVSVLHV
                     LKSERNFSELMSYLDKNVEKLSKEFLETELIDIIYFVLSETKDVNSKLISDIFKILNR
                     ASIDSSLFLGKIQNNTHLKVKVLEVIGTKNTKDENFLLDYYIANMKEEFEDNNLSTFL
                     LEQSDNYKNTYNYFKKPLHEFLTTRVDNESTFQKFRVWKTQCSRLTTRNTLLEKEYFD
                     QVKTFNDTNTNILLFYLFFDIPDMLSKYWLNNELHELIIDYNDFLQIEEYTNEKNFID
                     ILNKYLMINDRYDKMLIVTTFLKRNQKVYLHNRDLKNKVLDVLPSELPLNIIHEVLHS
                     ILTKGEMCITEFEIKKSLLKADTKLYSKVLNTILDK"
     gene            complement(<448089..>450968)
                     /locus_tag="CAGL0G04719g"
                     /db_xref="GeneID:2888163"
     mRNA            complement(<448089..>450968)
                     /locus_tag="CAGL0G04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446565.1"
                     /db_xref="GeneID:2888163"
     CDS             complement(448089..450968)
                     /locus_tag="CAGL0G04719g"
                     /inference="similar to AA sequence:UniProtKB:Q12271"
                     /note="similar to uniprot|Q12271 Saccharomyces cerevisiae
                     YOR109w INP53 or uniprot|P50942 Saccharomyces cerevisiae
                     YNL106c PIE3 phosphatidylinositol phosphate phosphatases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446565.1"
                     /db_xref="GeneID:2888163"
                     /db_xref="GOA:Q6FT79"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6FT79"
                     /translation="MIILSTKGHNRRIAIASNSQALLLKAEVASTGRLSCSVEVVPKK
                     ECIEKGFEKLSDLEIYAFIGLIEIDGLLFIGTITGKREVAQPIPETSINRVLAVDFFC
                     LNSNRWDGYDIDDNGYPMDTDKSKPPPNKNDNVRHPCWALMKLLSNGSFYFSNEFDLT
                     SSLQNRGFYSSGLNDNVYDEKYMWNNFMMIQLIGYRDRLDSETKELFDTEGFITSIIR
                     GYCETAITYINDFKVGMTIISRESFKRTGYKNRVRGTNDDGETADFIETEFIMYSGSF
                     CYAYTQIRGSVPLFWEQKEYSTNPKIHITRALEATKPVFERHMTALLNTYGHMRIVNL
                     LSTKSDESELNEKFHELLSLYPESCEIIDFDLKREYIQDGIIATKRLIPMVLKFVEQD
                     GYYSYYISKHRTLSEQQGIFRTNCLDCLGRTNLAQQIISMTAFRTFLEDSQIIKCSDY
                     IEDKEFFLTHNKIWEDNGLELAKIHTGNTNDNNIVQKKSKLSLSSRFSSVKNSVNRKY
                     FKVFTEEIELDTTDLLLGRKDDQYPVEIFDLLTEFVNNGLRQRISEYSSYRQVSIFVG
                     SYNASGKVIDDDLTKWLFPIEEKFKADIVVIGLQEVVEMSARSILNADESKGGMWEET
                     IRTYLGFYGDSYLLLRIEHMTSLTLLVFAKKGMIDLVKNVEGTYKRTGFGGIAANKGA
                     AACSLKVGESSFCFVNCHLAAGESNVDDRKNDYVSIKDGLKFSVGKTLDDHDNIFWFG
                     DMNYRVTMPNENVRDELIQKKDGYLENLLMHDQLTQEICSGTVFHGYKEPEIRFNPTY
                     KYDIGTELYDTSDKERTPSWTDRILYKGSNIQVLSYSDVDLLYSDHKPIYGAYRVKVL
                     TVDSLKRQVIKEGLHKEFENLDNINHLSIDDDVNSSVSSLSVSSSQKTTSRSLSVKRN
                     SSGSIQRRPPPMESPPFNASSTVTKKNSFKRPPPPSISSTNSSHS"
     gene            complement(<451365..>453182)
                     /locus_tag="CAGL0G04741g"
                     /db_xref="GeneID:2888153"
     mRNA            complement(<451365..>453182)
                     /locus_tag="CAGL0G04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446566.1"
                     /db_xref="GeneID:2888153"
     CDS             complement(451365..453182)
                     /locus_tag="CAGL0G04741g"
                     /note="highly similar to uniprot|P06208 Saccharomyces
                     cerevisiae YNL104c LEU4 2-isopropylmalalate synthase or
                     uniprot|Q12166 Saccharomyces cerevisiae YOR108w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446566.1"
                     /db_xref="GeneID:2888153"
                     /db_xref="GOA:Q6FT78"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FT78"
                     /translation="MRQTIPNFAEHVSRAAKTIAPVKLGFKNMLANPSVKYRPFQGPK
                     LTNRQWPNKTIKRAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLVEIGFKEIEVSFP
                     SASQTDFDFTRYAVENAPDDVSIQCLVQSREHLIKRTVEALTGAKRATIHTYLATSDM
                     FREIVFNMSQEEAIAKAVEATKLVRKLTKDDPSQKATRWSYEFSPECFSDTPVEFAVE
                     ICEAVKAAWEPTVDNPIIFNLPATVEVATPNVYADQIEYFSTHISEREKVCISTHAHN
                     DRGCGVAATELGILAGADRVEGCIFGNGERTGNVDLVTVALNMYTQGVSPGLDFSDMR
                     SVIEIVERCNKIPVPARAPYGGDLVVCAFSGSHQDAIKKGFALQQKKRAQGETLWRIP
                     YLPLDPKDIGRDYEAVIRVNSQSGKGGAAWVILRSLGLDTPRNMQMQFSTIVQNEADT
                     RGKELSAEEITALFKSTYNYNNETHQYVSLLDYDVKKIDNDRRILTGQVEINDKIIPI
                     KGIGNGPISSLVDALSNLFNVKFGVENYTEHALGSGSKTQAASFIHISYRDAATNEKE
                     YSWGVGVSEDVGEASVRAIFSTINSIIHSGEVTLPTENN"
     gene            complement(<454297..>455520)
                     /locus_tag="CAGL0G04763g"
                     /db_xref="GeneID:2888302"
     mRNA            complement(<454297..>455520)
                     /locus_tag="CAGL0G04763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446567.1"
                     /db_xref="GeneID:2888302"
     CDS             complement(454297..455520)
                     /locus_tag="CAGL0G04763g"
                     /note="some similarities with uniprot|Q99188 Saccharomyces
                     cerevisiae YOR107w RGS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446567.1"
                     /db_xref="GeneID:2888302"
                     /db_xref="GOA:Q6FT77"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6FT77"
                     /translation="MSQFPTLYDILLQPGNRNVENRKDDGPFNIETFHRFLLKAHCEE
                     NLEFFQYCNTYICTKTRKEAISLDMANSKSETDLATTESHQHRLLKMWNNRIYLKYIA
                     LNSPRECNFPQEIREVFEKCYEEQQLPSDESVLIAMQHILQLLMDAYRQFIKFVNNSN
                     DPLEELISEKSEAIITNFGEGDSTASTISKENEEDELKKTSALNWFDSNIPSTLESTT
                     SHWGISSGHFPESNYLMTPKVNLSANDILLSSTTKLAPSVSPLISREISDIMNKNKSS
                     VKRASTDQSLQTNTDPVSPKRRSLETDKRKSVSPILISPNNKSHSNKYSKSNGSSHVN
                     RSIKASTSPLSHRVVLPNDRKIQRPISPPMTNLPHEHHSSTIVGKGKQLFNKLSMVGR
                     KKNYSSHIPQQHSNQ"
     gene            complement(<456011..>456307)
                     /locus_tag="CAGL0G04785g"
                     /db_xref="GeneID:2888298"
     mRNA            complement(<456011..>456307)
                     /locus_tag="CAGL0G04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446568.1"
                     /db_xref="GeneID:2888298"
     CDS             complement(456011..456307)
                     /locus_tag="CAGL0G04785g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446568.1"
                     /db_xref="GeneID:2888298"
                     /db_xref="GOA:Q6FT76"
                     /db_xref="UniProtKB/TrEMBL:Q6FT76"
                     /translation="MELEEDPFSLLCICALCTLPISMMNSNRVPTQFHRDMPAQYMEA
                     VSSYFTSELYNEEKKRNSQHGNRSQKKQKNKKTKKSCEKKEGRTQKSVYRWQWK"
     gene            complement(<458085..>458822)
                     /locus_tag="CAGL0G04807g"
                     /db_xref="GeneID:2888299"
     mRNA            complement(<458085..>458822)
                     /locus_tag="CAGL0G04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446569.1"
                     /db_xref="GeneID:2888299"
     CDS             complement(458085..458822)
                     /locus_tag="CAGL0G04807g"
                     /inference="similar to AA sequence:UniProtKB:Q12241"
                     /note="similar to uniprot|Q12241 Saccharomyces cerevisiae
                     YOR106w VAM3 syntaxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446569.1"
                     /db_xref="GeneID:2888299"
                     /db_xref="GOA:Q6FT75"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FT75"
                     /translation="MDKGNVLESLESNIRLLEKEVEKVGTRRDDEALRCKVRELIGET
                     TQTVERSRDGFLGAGKRDKDFKFLESELRRLSAVFRVREGQNPLKINTETAVASTTMN
                     SSKNLENQVALADETTERTPLLHTNTQQQHMHLQDQMEQGLINDDELDFHTIVQEDRS
                     RQISRIHSSVQEVNAIFKQLGTLVREQGTQVDTVDENIANFDNNMHRANEQLNRADEH
                     QRQRNRCGLMTLIIIIVVVIIILGASS"
     gene            <459677..>462151
                     /locus_tag="CAGL0G04829g"
                     /db_xref="GeneID:2887986"
     mRNA            <459677..>462151
                     /locus_tag="CAGL0G04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446570.1"
                     /db_xref="GeneID:2887986"
     CDS             459677..462151
                     /locus_tag="CAGL0G04829g"
                     /inference="similar to AA sequence:UniProtKB:P50109"
                     /note="similar to uniprot|P50109 Saccharomyces cerevisiae
                     YML017w PSP2 suppressor of DNA polymerase alpha mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446570.1"
                     /db_xref="GeneID:2887986"
                     /db_xref="GOA:Q6FT74"
                     /db_xref="UniProtKB/TrEMBL:Q6FT74"
                     /translation="MGSKSNGAKKMSLEEFLGNDSLGESVWDEEEINLDAINNISNTT
                     NPELFRPKHNSNRFSSGYGGGHSGYGGGLGGNQRFSSGNRHLDPAYDGGAGFGPPGGH
                     HQSYGRVQQHHYSEQEQRMESSGFDYLASAGPPYIVKFSNLPPRFSNYDIEDLFHMKF
                     TKFVKYRLFWELQSNPSLDLLNKGDYFEKTFKDNLKVAFVELLGMRDLMKIIDYWSVP
                     LAEMYQINVSVAKFDDFKNYVEKSKPLIDPSYDAGKSFDAPRIQKSHPFTSEKNEMAP
                     AKSDASTLNKNAQRQEPKKPKVNPFGTAKPVDTQSKILEIENKMQSLHVEDTSTLRAI
                     LEEKSDASKQSKTLSKTATSTLDNGQGKTKIKILKKPVSSGGQDKSSNTTQLGSAKVT
                     EPKPSIADVNSKVKQLVDIKKSDAKGASNSQKTQANDSKENVNGNANEDKSKEPKNKD
                     ESSLTKETNNLSAMPDGKSKVDDETKTFVTKPGQRELCKTKSNDKPTDIHVSKTDEST
                     LDVSVAKNETAENTSSDNSHVSYNSARGRGGIKGRGRGGTYQRGNARGRDVTRGRGKR
                     GKRPLQDNNFSSRIIDNTKEEGIGKPNVHHINERVKLTGAVNTENSSRKNDQDVFYDA
                     KDDLNVQGIDIRKQNFKDERYMESKDSSRIDAKSVPRSTADKEIQVGNKSEHESSGNN
                     TNVATAVASNTGESEKASTKDVTSAEVTHRGGYRGGFRGSRGAYRGAYRGAYRGGYRG
                     SYRGGYRGSTRGSYRGDYKGPFRGNYEDRQGQEEEHRSSNEVNGVSLSPAEKSKKNVR
                     GGSYKRGRGSNRNKYQKNHEVNDQSG"
     gene            complement(<462671..>463771)
                     /locus_tag="CAGL0G04851g"
                     /db_xref="GeneID:2888002"
     mRNA            complement(<462671..>463771)
                     /locus_tag="CAGL0G04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446571.1"
                     /db_xref="GeneID:2888002"
     CDS             complement(462671..463771)
                     /locus_tag="CAGL0G04851g"
                     /note="highly similar to uniprot|P40319 Saccharomyces
                     cerevisiae YLR372w SUR4 sterol isomerase fatty acid
                     elongase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446571.1"
                     /db_xref="GeneID:2888002"
                     /db_xref="GOA:Q6FT73"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q6FT73"
                     /translation="MDQPVSQVTSAVASGAASAATAASSAAATAASVAVDQLEVLFQG
                     APSWIKVHTPSIDHPFGLELWPLFSAVFEKIAGYPAEDFRFIYNETFLANGYQAIGII
                     IFYYIVIFGGQAILRAINASPMHFHFLFQLHNLFLTSISFILMVLLIEQLVPMIYHHG
                     LFWAICSPQAFAPKLVVLYYLNYLTKFVELFDTVFLIFKRKKLLFLHTYHHGATALLC
                     YTQLVGETSVEWVPIVLNLGVHVVMYWYYFLSSCGIRVWWKQWVTRFQIIQFLIDLVF
                     VYFATYTFYANKYFDGILPNKGTCYGTQDAAAYGYLILTSYLVLFISFYINSYKKGSK
                     KKAEKEAEKAAAASATSSAVKTKSSKPSSRKA"
     gene            complement(<464641..>468750)
                     /locus_tag="CAGL0G04873g"
                     /db_xref="GeneID:2888003"
     mRNA            complement(<464641..>468750)
                     /locus_tag="CAGL0G04873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446572.1"
                     /db_xref="GeneID:2888003"
     CDS             complement(464641..468750)
                     /locus_tag="CAGL0G04873g"
                     /inference="similar to AA sequence:UniProtKB:P51862"
                     /note="similar to uniprot|P51862 Saccharomyces cerevisiae
                     YLR371w ROM2 GDP/GTP exchange factor for RHO1P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446572.1"
                     /db_xref="GeneID:2888003"
                     /db_xref="GOA:Q6FT72"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FT72"
                     /translation="MVDNVQRNAIFADVFGIERQGLGMGMGDPMSVPDRVEDIQGLDS
                     VLRESLAPLGSAPIVNKRAGATYMIMSQEARIKDVPDTQSLSSADNTPISSPQRPLIH
                     SATSPIPMAYKSHHVPTHMGPVPSLNNANMSTGMGTHHTSGTAVSTAGEEAAIGQKAG
                     FGITPAMHHAKSSPHLNHQKHQFGSKHQEKLRAANSNNSTGNSAVQNREREARKKPSL
                     PQLALAGLKKQASFSNISNKNGSTTTPTSAQKSPLQAFHLFTRSTSRDLSNDNSHGVS
                     NSAMENSRNNSNSNVHNENGASRSLSINSSTFKNIANSFQNRKTSAGSNPGGTYHSGA
                     NIAQRNDSMHSNYSMQNSLDSHSTIGLGLKTRVSSSSLSSKRYHSASSTSLHSHYHHG
                     AHYNNGSATTLTNSGSMSGRRNSSIASPQSRPILSASTKRPQVYPALLSRVAAKFRQT
                     IQLGEYKKDGLLYRDAFTGQQAVDVICALVRTSDRNLALLLGRSLDAQKLFHDVVYEH
                     RLRDSPYEVYEFTDNSRYLGKPAPTTSSSTTNNSMVGISHSTTRTTLPYSISEVASSK
                     STTSLNSSYMEHSTIQASSRPHAVPSATNSINGVFTLLAECYSPTCTRNALCYSISCP
                     RRLEQQARLNIKPNGGLKRNISMALDDDEEEKPSWTSSVSKELWENLPKKEIKRQEAI
                     YEVYISEKKFVKSLEVTRDTFMKTLSETNIIPADIRKNFVKHVFAHINDIYSVNRRFL
                     EALQDRQKSSPVVKGIGDILLRFIPFFEPFVQYVASRPYAKYLIETQRSVNPYFARFD
                     DDMMNSSLRHGIDSFLSQGVSRPGRYMLLVREILKSTESENNKDDYENLSRAMDALKN
                     FMKRIDKASGAAQDRHDVKLLKQKILFKNEYVNLGLNSEKRKIKHEGALSRKELSKSD
                     GTAGDTQFYLLDNMLLFLKAKAVNKWHQHKVFQRPIPLPLLFVCPSEDMPSLRRYIGD
                     NPGCSGTVIQPENNVSNPKNALTFLYYGAKQRYQVTLYAAQYAGLQTLLDKIKTEQQR
                     IIDETDMINITKISDRFFDYMNKINSVSTCDGGRKLLIATNLGLYMSNIKRQQDKDTQ
                     KTFTYFSTPVQLVQRSNITQVAVLEEFKSILLLIDKKLYSCPLSLIENEVNGTTYFKK
                     HSKELINHVNFFSEGDCNGKRLIVTAHSSSHSIKFFEHEHPLLSEDGGHSKKSLKKKI
                     TEVTFDSEPVSISFLKANLCIGCKKGFQIVSISQNAHESLLDPADTSLEFALKDTLKP
                     MAIYRVGTMFLLCYTEFAFFVNTQGWRKKESHIIHWEGDPQKFAIWYPYILAFDSNFI
                     EIRKIETGELVRCILGEKIRLLQTNTQEILYAYEDSRGYDTVASLDFWG"
     gene            <470015..>470545
                     /locus_tag="CAGL0G04895g"
                     /db_xref="GeneID:2888300"
     mRNA            <470015..>470545
                     /locus_tag="CAGL0G04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446573.1"
                     /db_xref="GeneID:2888300"
     CDS             470015..470545
                     /locus_tag="CAGL0G04895g"
                     /note="highly similar to uniprot|Q05933 Saccharomyces
                     cerevisiae YLR370c ARC18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446573.1"
                     /db_xref="GeneID:2888300"
                     /db_xref="GOA:Q6FT71"
                     /db_xref="InterPro:IPR007204"
                     /db_xref="UniProtKB/TrEMBL:Q6FT71"
                     /translation="MPAYNSTFPSDPQTDRMVGNLVLLPLNTKFRGPAYQANSDYDIV
                     DECLDLFRANSFFKNFEIKTNSDRLLIYGILYINDCLNHLKQTTSHNEAIKVLTNLAL
                     DDFSLPGTSGFPLNSVYSIPTADHNAMELLKSYLQQFRQELASRLIERIYAESQDHPS
                     KFWLAFTRRKFMNKSL"
     gene            complement(<470710..>472650)
                     /locus_tag="CAGL0G04917g"
                     /db_xref="GeneID:2888301"
     mRNA            complement(<470710..>472650)
                     /locus_tag="CAGL0G04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446574.1"
                     /db_xref="GeneID:2888301"
     CDS             complement(470710..472650)
                     /locus_tag="CAGL0G04917g"
                     /note="highly similar to uniprot|Q05931 Saccharomyces
                     cerevisiae YLR369w SSQ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446574.1"
                     /db_xref="GeneID:2888301"
                     /db_xref="GOA:Q6FT70"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:Q6FT70"
                     /translation="MLRLSRRQFLPRSIRKLSTKVIGIDLGTTNSAVAYISDSNNKKS
                     AKIIENEEGQRTTPSTVAYDKDGKVIVGQRAKRQSILNPDNTFYATKRLIGRLYEDDE
                     VTRDKKNMPYAIVRSPTNGQAYVALKDGTQKSPSEIASEVLKYLKHCAEDYLNTEGGI
                     EKAVITVPAYFNDGQRQATKEAGKLAGLDVLRVVNEPTAAALSFGIDEKQNNGMIAVY
                     DLGGGTFDISVLDIEDGVFEVRATNGDTHLGGEDFDNVVVDHLLEQFVKGAKAVSRQD
                     VLKNREAMQRLKDAAEKAKIDLSHVKETSISIPFFFNSEHLNVKITEDELDSMTMHLI
                     ERTVEPVESALRDADIEPEDIDDVILVGGMTRMPRIRKLVEDIFGKKPNVSVNPDETV
                     ALGAAIQAGVLSGEIKNVLLLDVTPLTLGIETFGGAFSPLIPRNTTVPVKKTEVFSTG
                     VDGQTGVDIKVYQGERGLVKDNTMIGDFKLTGIKPMKKGVPQICVTFDIDADGIINVS
                     AMEKSSGKNESIKVVPRSGMSEEEIQKIIEDANRNRELDNKIRTKIELLNKCDIMLSD
                     TASVFEQYRDTLERNVKEHNREQDLVDIVQEVNDLKGIVDEIKKMDSDKILEVDVDSL
                     KKDVDALQGRSLKVFQELMAKK"
     gene            complement(<473085..>474854)
                     /locus_tag="CAGL0G04939g"
                     /db_xref="GeneID:2888289"
     mRNA            complement(<473085..>474854)
                     /locus_tag="CAGL0G04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446575.1"
                     /db_xref="GeneID:2888289"
     CDS             complement(473085..474854)
                     /locus_tag="CAGL0G04939g"
                     /note="weakly similar to uniprot|Q05930 Saccharomyces
                     cerevisiae YLR368w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446575.1"
                     /db_xref="GeneID:2888289"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6FT69"
                     /translation="MGKTVIELIPQEVFNIIAGFLESDDLWRIRQCSHQLKVNVEHSS
                     YWSSYCRARWPVEDLDLILEDYDKDDVKILQSVLGKTAKDRDWFYYYTYRSRYDDRIT
                     KYITSLCQFDELGVEFWGLYRMAILVKPYLYIPHLMRITCSAEQKWSLEERSWSYYLL
                     GSIRRRYFYALFQENAKFLKPTRFSFERDILLRFAALDPQYDKLIKYRNIVFEEVKMK
                     VFHKYNGNSELFSQVTAKQRMQDIISALSNTISISENHQRHVIEDAYLLRAYANESRP
                     LPVITLSIIEKIAKFFKIRCNFNGNYLAFQDNTLPGACGFVISDTRKIRMFSKTEFLR
                     FIRNRLPISHHESIETSLSLDETVEPRKLLCHFLNDEITKCNGLKVDSLTAVELQDLY
                     PCSNLPPCEKSLRWVTSFFKKMEDEFNGTYPVESTGLKDDKMRISSCIDTDSWFFKAI
                     NMHPPDFLYFASPSKSVIPSLTDFFHLSHYPCIDCTELGTFIKGPDRRLCVTAIVQRL
                     ADTEPPILLYTYIKASGEIFLSSSHNDEIYPEESEFRKFISNMPYQVGLIFDQVDWSS
                     RRLLLNNKARSLFKLPQPSIPKH"
     gene            complement(<475115..>475444)
                     /locus_tag="CAGL0G04961g"
                     /db_xref="GeneID:2888344"
     mRNA            complement(<475115..>475444)
                     /locus_tag="CAGL0G04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446576.1"
                     /db_xref="GeneID:2888344"
     CDS             complement(475115..475444)
                     /locus_tag="CAGL0G04961g"
                     /inference="similar to AA sequence:UniProtKB:Q05926"
                     /note="similar to uniprot|Q05926 Saccharomyces cerevisiae
                     YLR364w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446576.1"
                     /db_xref="GeneID:2888344"
                     /db_xref="GOA:Q6FT68"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FT68"
                     /translation="MTDYVKEAKDMVANNRLFQFSASWCPDCVYARSIWNKYHVENQI
                     HVFDIGSLDKEIQAKWRDAFEEVLGVRNLPTIVVDGKVWGTETRLHEVEDNGSLSDEL
                     TKMGFKL"
     gene            complement(<475728..>475982)
                     /locus_tag="CAGL0G04983g"
                     /db_xref="GeneID:2888398"
     mRNA            complement(<475728..>475982)
                     /locus_tag="CAGL0G04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446577.1"
                     /db_xref="GeneID:2888398"
     CDS             complement(475728..475982)
                     /locus_tag="CAGL0G04983g"
                     /note="highly similar to uniprot|Q3E747 Saccharomyces
                     cerevisiae YLR363wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446577.1"
                     /db_xref="GeneID:2888398"
                     /db_xref="GOA:Q6FT67"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:Q6FT67"
                     /translation="MPQKPLKVTKKAKDPRRVTKKQKNLRKAAPIQIKSKKKSLRHLK
                     KLSKTSSLTEATERLVASKVGHLELLRGTRKEIEAANKKK"
     gene            <476392..>477126
                     /locus_tag="CAGL0G05005g"
                     /db_xref="GeneID:2887981"
     mRNA            <476392..>477126
                     /locus_tag="CAGL0G05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446578.1"
                     /db_xref="GeneID:2887981"
     CDS             476392..477126
                     /locus_tag="CAGL0G05005g"
                     /inference="similar to AA sequence:UniProtKB:Q12129"
                     /note="similar to uniprot|Q12129 Saccharomyces cerevisiae
                     YLR363c NMD4 NAM7P interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446578.1"
                     /db_xref="GeneID:2887981"
                     /db_xref="GOA:Q6FT66"
                     /translation="MNQYNFILDASAFEKGLGNVKRWCQSNGNVDGKKNVYLRFYVPT
                     FTLQELNFLQYRHKSFSAKEALKFIDKLETATSEGQRNHVVIGRKKEEDLRSDLELFI
                     EFPDILDAVTWPTVLSYCTEGQATIDSLNKLPKRFKILLKSCVYKCHLEDDDRIRWIL
                     VTEDPQVRKIASQCHIPWCSIVDADSIISKDMNDRSFRDSEKFNSMMLKRGVAKSENM
                     DGKEVIKTNFDQTVYATRGSGKLWTP"
     gene            complement(<477815..>479104)
                     /locus_tag="CAGL0G05027g"
                     /db_xref="GeneID:2887982"
     mRNA            complement(join(<477815..478249,479084..>479104))
                     /locus_tag="CAGL0G05027g"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_446579.1"
                     /db_xref="GeneID:2887982"
     CDS             complement(join(477815..478249,479084..479104))
                     /locus_tag="CAGL0G05027g"
                     /note="highly similar to uniprot|P05756 Saccharomyces
                     cerevisiae YDR064w YS15"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_446579.1"
                     /db_xref="GeneID:2887982"
                     /db_xref="GOA:Q6FT65"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:Q6FT65"
                     /translation="MGRMHSSGKGISSSAIPYSRNAPAWFKTSTESVIEQIIKYARKG
                     LTPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPNWKYESATASALVN"
     gene            complement(<479605..>480054)
                     /locus_tag="CAGL0G05049g"
                     /db_xref="GeneID:2887989"
     mRNA            complement(<479605..>480054)
                     /locus_tag="CAGL0G05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446580.1"
                     /db_xref="GeneID:2887989"
     CDS             complement(479605..480054)
                     /locus_tag="CAGL0G05049g"
                     /note="highly similar to uniprot|Q12156 Saccharomyces
                     cerevisiae YDR063w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446580.1"
                     /db_xref="GeneID:2887989"
                     /db_xref="GOA:Q6FT64"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR011171"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6FT64"
                     /translation="MSNLYQIDSETKERIRKFRISTSRADTIKALPLKIEPKPSYKIV
                     IEEDELEELDEADGLADYGEALPDNSPRYVLIAYPLTNKDGIKQTPLILIYWIPQTVV
                     SQEWKMLYAGALELIRNECGTSKLVEVTSGLEDDSDVEELIAQIETR"
     gene            complement(<480906..>482603)
                     /locus_tag="CAGL0G05071g"
                     /db_xref="GeneID:2888433"
     mRNA            complement(<480906..>482603)
                     /locus_tag="CAGL0G05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446581.1"
                     /db_xref="GeneID:2888433"
     CDS             complement(480906..482603)
                     /locus_tag="CAGL0G05071g"
                     /note="highly similar to uniprot|P40970 Saccharomyces
                     cerevisiae YDR062w LCB2 serine C-palmitoyltransferase
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446581.1"
                     /db_xref="GeneID:2888433"
                     /db_xref="GOA:Q6FT63"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FT63"
                     /translation="MSTNGSTVSDYKYVPLIKHEPLSDEQQKENEFGELTSDAYRFKV
                     HSREGKPIRKPVIDTPPYYISLVTYLNYLILIILGHIHDFLGMRLQRNKHLDILEHDG
                     MAPWFSNFDSFFARRMKMRIDDCFSRPTTGVPGRFIRCITRISHNLNEYFTYPGTTSM
                     CLNLSSYNYLGFAQSKGQCTDAALESVDKYGIHTGGSRTQIGTTDLHRLTEELVADFV
                     GKEDAMVFSMGYGTNANFFNAFLDRKCLVISDELNHTSIRTGVRLSGAAVRTFKHGDM
                     EGLEKLIRDQIVLGQPKTNRPWKKILICVEGLFSMEGTMCNLPELIALKKKYKCYLFV
                     DEAHSIGAIGPTGRGVCEYFGVNPHDVDILMGTFTKSFGAAGGYIATDKWVMDRLRLD
                     LTTTSYAEPTPAPVLAQIVSSLRTIKGDICPGEGRERLERIAFNSRYLRLALLRLGFI
                     VYGIPDSPVIPMLLYCPSKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCMSASIT
                     KEDIDYLLRHVDEVGEKLNLKLNSGKSSIDGKAPRWDIEEVIRRTPEDCKDDKYFVL"
     gene            complement(<483230..>484864)
                     /locus_tag="CAGL0G05093g"
                     /db_xref="GeneID:2888059"
     mRNA            complement(<483230..>484864)
                     /locus_tag="CAGL0G05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446582.1"
                     /db_xref="GeneID:2888059"
     CDS             complement(483230..484864)
                     /locus_tag="CAGL0G05093g"
                     /inference="similar to AA sequence:UniProtKB:Q12298"
                     /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
                     YDR061w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446582.1"
                     /db_xref="GeneID:2888059"
                     /db_xref="GOA:Q6FT62"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FT62"
                     /translation="MSKSVLKISNALFRSSLMKNVPPVFSKPVKDFEILTGEKWVIWG
                     NGKAKFMNVLSNKYLCDPPLSLQYNVSKDGVTLPRIEQVQFKGAIPTAHLSARYEFFK
                     DEFDQTCKKFILDNAIGSNAVEYDVSTTDRVVDMGLYDFLVRELKLEELQNRWAMGLS
                     NGQMRRARLARSLLKQPDLILVDDPFLGLDPTATAIISKFLSNWGGAGKENSYHSPVV
                     IGLRYQDTIPSWCTHICCVDPESGIKFQGPINEYRDAIENKRASVIEDLKNAKTQRRK
                     EIGLSGASEEYSIDDLISPHPMYNCASHEMIKMPPTIELKGLGVTYKGEPVLENLHWQ
                     VKPGSKWHIRGDNGTGKSTLLSLLTAEHPQSWNSKVVENGEPRRTGKSNYFDINSRIG
                     MSSPELHAIILNNCADRLTVREFIATGFHQGSSNNFLPLWDKLDDSQKRIVNMYMNYF
                     ELDLIARDKTINQLSVSEQKLALLVRSLVKMPEILVLDEAFSGMEVTPMLKCHEFLDH
                     WPGTVLVVAHVAEETPACHHYLRLISPGQYEIGDIV"
     gene            <485461..>485923
                     /locus_tag="CAGL0G05115g"
                     /db_xref="GeneID:2888064"
     mRNA            join(<485461..485514,485690..>485923)
                     /locus_tag="CAGL0G05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446583.1"
                     /db_xref="GeneID:2888064"
     CDS             join(485461..485514,485690..485923)
                     /locus_tag="CAGL0G05115g"
                     /note="highly similar to uniprot|P38203 Saccharomyces
                     cerevisiae YBL026w SNP3 Sm-like"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446583.1"
                     /db_xref="GeneID:2888064"
                     /db_xref="GOA:Q6FT61"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:Q6FT61"
                     /translation="MLFFSFFKTLVDQEVVVQLKNDIEIKGTLQSVDQFLNLKLDNIS
                     CNDDKKYPHLSSVRNIFIRGSTVRYVYLNKNMVDTNLLQDATRREHLSDRK"
     gene            complement(486404..486477)
                     /locus_tag="CAGL0G05137r"
                     /db_xref="GeneID:2887991"
     tRNA            complement(486404..486477)
                     /locus_tag="CAGL0G05137r"
                     /product="tRNA-Val"
                     /note="tRNA Val (AAC) cove score=68.42"
                     /db_xref="GeneID:2887991"
     gene            <486778..>487911
                     /locus_tag="CAGL0G05159g"
                     /db_xref="GeneID:2887992"
     mRNA            <486778..>487911
                     /locus_tag="CAGL0G05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446584.1"
                     /db_xref="GeneID:2887992"
     CDS             486778..487911
                     /locus_tag="CAGL0G05159g"
                     /inference="similar to AA sequence:UniProtKB:Q12167"
                     /note="similar to uniprot|Q12167 Saccharomyces cerevisiae
                     YDR065w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446584.1"
                     /db_xref="GeneID:2887992"
                     /db_xref="GOA:Q6FT60"
                     /db_xref="InterPro:IPR011063"
                     /translation="MITHFCELAAHRNYVLALYRHSLRNVSRINSGFVKHKMKKVITN
                     EARKHKNDKSSWSIYRRLKELKLLSDKLEDDQVNDAYNLLDSFMKSVKKPKNELKGHL
                     MKIRTEIETNKNIQDKTRLTRLNLLHRYIAKKQQNQLLTKHIPDEYKEKLLLPLALHE
                     KGILRLAAIRNQFKKGGYHAKLSFTMAGKTRIWFIRSMLNKRKKQSLRLRNLITSEKR
                     RYLEVCKIVESLNENANWALHEAIWERYLDDGYLHATSSKGYLKMVEIEDNSVKLQNQ
                     NDSKVVKCQRLQQWLSPIQSSILSLENYLNQRQMKYAKLKTKILEPKGVYDYYQKKSK
                     RVFQNHMKTYKRMVKNELPFVNPFIERLSIGSILKRNGINVKY"
     gene            complement(<487974..>488492)
                     /locus_tag="CAGL0G05181g"
                     /db_xref="GeneID:2888067"
     mRNA            complement(<487974..>488492)
                     /locus_tag="CAGL0G05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446585.1"
                     /db_xref="GeneID:2888067"
     CDS             complement(487974..488492)
                     /locus_tag="CAGL0G05181g"
                     /inference="similar to AA sequence:UniProtKB:P40084"
                     /note="similar to uniprot|P40084 Saccharomyces cerevisiae
                     YER139c or uniprot|Q12378 Saccharomyces cerevisiae
                     YDR066c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446585.1"
                     /db_xref="GeneID:2888067"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:Q6FT59"
                     /translation="MATIEDVQLILRDHRTHYQLSQKEGEMIVEKLQQLLTMTDCANG
                     TVLKYICAFLTPLTYRMIVLSRNINAGKCGYPLCRLTLIQGGYTSNEASSYCSEYHQN
                     CSQYISRQLFDEDLECRIGIHLRRGYDEDSPDYKYRIRLFEEVLDPDEISDLDGITSQ
                     LCTMGIRSNNIY"
     gene            complement(<488794..>489447)
                     /locus_tag="CAGL0G05203g"
                     /db_xref="GeneID:2888160"
     mRNA            complement(<488794..>489447)
                     /locus_tag="CAGL0G05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446586.1"
                     /db_xref="GeneID:2888160"
     CDS             complement(488794..489447)
                     /locus_tag="CAGL0G05203g"
                     /note="highly similar to uniprot|Q12454 Saccharomyces
                     cerevisiae YDR067c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446586.1"
                     /db_xref="GeneID:2888160"
                     /db_xref="GOA:Q6FT58"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FT58"
                     /translation="MSLITPLQFSTVQPNLYRGSYPRELNIPFLRSLRLKYVVSLTPH
                     SLAEDPVMSRFCTEDGIEMIHILCQDEKKSKDKTKPKVKRKKKTVPIEYTVVEECARF
                     LVDKQHYPCYMHCTNGELITSLVVACLRKLSYWSTVSILNEFLAYNSSINIHERNFIE
                     NFSSEIQIENVDLRNKVPWMAIQVVKKRDKKDIDDGKHDDSPSPMPKPLPKLTFHSV"
     gene            <489785..>490885
                     /locus_tag="CAGL0G05225g"
                     /db_xref="GeneID:2888254"
     mRNA            <489785..>490885
                     /locus_tag="CAGL0G05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446587.1"
                     /db_xref="GeneID:2888254"
     CDS             489785..490885
                     /locus_tag="CAGL0G05225g"
                     /inference="similar to AA sequence:UniProtKB:P54858"
                     /note="similar to uniprot|P54858 Saccharomyces cerevisiae
                     YDR068w DOS1 involved in genome stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446587.1"
                     /db_xref="GeneID:2888254"
                     /db_xref="GOA:Q6FT57"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:Q6FT57"
                     /translation="MDFAIEQDDTLISSTSKAEVKDTKVDADKGTPATRGHKREDASG
                     KSAGEATGEIIGETAGEVTGEDVNVNKYFDELEDKVTQQYEKTSNVLKKIVKERDDGI
                     ELNLGLDPETSAKAQEYIQKLDENLQSVEKLAQSYWSKMSVSVSKSVTESLSTGKAAI
                     EKVQKENNAGSFWSSWKPMLSGVIGSEDEPSTQKDLSVGAMGGNRTELELRMLETDKS
                     IYTNNKLPLDKEFNADSKTVEIANLIRTNKDLEKMMNELVPKEVPYADFWNIYFTHQK
                     RILEMEERRKRILEEKLKNDDNADEEVAWDDDEDEGITAPAADAEQQSIKEKKISETK
                     SEQPVEKQPKEVKEAVTIPAVAGDDDDEDDWE"
     gene            complement(<491024..>493867)
                     /locus_tag="CAGL0G05247g"
                     /db_xref="GeneID:2888255"
     mRNA            complement(<491024..>493867)
                     /locus_tag="CAGL0G05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446588.1"
                     /db_xref="GeneID:2888255"
     CDS             complement(491024..493867)
                     /locus_tag="CAGL0G05247g"
                     /inference="similar to AA sequence:UniProtKB:P32571"
                     /note="similar to uniprot|P32571 Saccharomyces cerevisiae
                     YDR069c DOA4 ubiquitin-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446588.1"
                     /db_xref="GeneID:2888255"
                     /db_xref="GOA:Q6FT56"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FT56"
                     /translation="MQMVPSNVPDIDVHIGLPQLINKAQEAVEFIVQESRCDAVIMRT
                     LKRTSSFSNGKKPKGTDVTNNEMKYLLDQCLDHLSKLNECTKAIRKKSHGNLDIQYVH
                     AYFYYKIVHILMTNVIPGLAEFQSLKNTIKKKAGSIESELLQIYNVILSSLISDETIE
                     IIHHSKAILKVNESNYNEKQVSEKHTPSDKSSLTENDQPQLCAHINSSQLDKLLRQNS
                     NDLLIIDVRERESYNNVHIRAQNILCLEPIAFSENYTYRDLVKRSMITAPKDEILLLG
                     NLSNFKYIILTTALSSDLLKSYSSKLDCLKEILYQYLTMQPNGRFSRLLVHKDGIEAW
                     CKDGYIVEHSDDHEKSIGDDSEESLMDSTRESSGESNEVITTKDDSVYVSGDLRSLSL
                     QELPELTPSVSNSMDSSMMAMMRPEAVTQGYNNIYQNPTERKVSRSSSFKNFFNKKRT
                     SSMSLGSHTRSVSTPMAPINDLYNDTKLNPNSFNDRSLSGLSLDPPLKPMPISYPSNP
                     VIKTTKTQAMSPGPAKSVSPSSLTFVGDDVSKSPTGLRSSSNATIKEVLSSPTGRKFN
                     HSVLPNTKKDYDLNFTVGLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHININS
                     KLGSKGVLARYFARLAHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFRNTNQQDCQ
                     EFCQFLLDGLHEDLNQCGNNPPLKELSEEAEKKRELLSLRIASSIEWERFLTTNFSVI
                     IDLFQGQYASRLKCSVCSNTSTTYQPFSVLSVPLPTGTKSSVNLMDCFNEFTKCEKLE
                     HDEYWNCPTCKKKQPSTKQLTITRLPRNLIIHLKRFDNRMNKNTKLIDYPFNLDLTSF
                     WANDKDDRLPPGVSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSRGW
                     YYFDDQNYRLVKKTSEVVNSNAYVLFYRRVHGI"
     gene            complement(<494671..>494955)
                     /locus_tag="CAGL0G05269g"
                     /db_xref="GeneID:2888258"
     mRNA            complement(<494671..>494955)
                     /locus_tag="CAGL0G05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446589.1"
                     /db_xref="GeneID:2888258"
     CDS             complement(494671..494955)
                     /locus_tag="CAGL0G05269g"
                     /inference="similar to AA sequence:UniProtKB:Q12497"
                     /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
                     YDR070c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446589.1"
                     /db_xref="GeneID:2888258"
                     /db_xref="GOA:Q6FT55"
                     /db_xref="UniProtKB/TrEMBL:Q6FT55"
                     /translation="MLRQVIANTRVSVRQPECARFLSTTRQLFTKDHLKKDQNAAEKA
                     EQKMFDENQKDLEQLEHGKSTKSHNYKCDDLREKGENARIEQNRPDDGVY"
     gene            complement(<496008..>496586)
                     /locus_tag="CAGL0G05291g"
                     /db_xref="GeneID:2887996"
     mRNA            complement(<496008..>496586)
                     /locus_tag="CAGL0G05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446590.1"
                     /db_xref="GeneID:2887996"
     CDS             complement(496008..496586)
                     /locus_tag="CAGL0G05291g"
                     /note="highly similar to uniprot|Q12447 Saccharomyces
                     cerevisiae YDR071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446590.1"
                     /db_xref="GeneID:2887996"
                     /db_xref="GOA:Q6FT54"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FT54"
                     /translation="MASPTLPLHMYIRPLIIEDSDQVIALESKGFPPHERASEKTIEY
                     RLLTCPELCSGLFIRELDSNGKDIKDEKLIGHVMGTKIKGSFITLSSMQAGSHVEGSS
                     TIAIHSLVIDPEYQKKNLATLLLTDYIQKLSNQEVGNRIVIIAHEHLIPFYERIGFKV
                     IAENKEVTKDPDFSNTKWIDMERELVKEEYDS"
     gene            complement(<497360..>498913)
                     /locus_tag="CAGL0G05313g"
                     /db_xref="GeneID:2888164"
     mRNA            complement(<497360..>498913)
                     /locus_tag="CAGL0G05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446591.1"
                     /db_xref="GeneID:2888164"
     CDS             complement(497360..498913)
                     /locus_tag="CAGL0G05313g"
                     /inference="similar to AA sequence:UniProtKB:P38954"
                     /note="similar to uniprot|P38954 Saccharomyces cerevisiae
                     YDR072c IPT1 mannosyl diphosphorylinositol ceramide
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446591.1"
                     /db_xref="GeneID:2888164"
                     /db_xref="GOA:Q6FT53"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FT53"
                     /translation="MIDILWFVKSVVLSGLNQRNLLTLPLNFAVNFSPIFLWLFVFHH
                     AQWIPTDIRPAIHSRCAFYLDQLLFGDFWYEFLEQLDDIDLVNISFVTTALFALSLMV
                     IPALVWFYLYKVKRISYNIYEWYDSLTPKMYKNRYIMPFALPILSYCALNVAHHFAVQ
                     EEENFTKTKDMIAWFFYVIMHLTAPILTAVYLYVFHAPGVVKCFGFALGLQNMAGVCT
                     HLLLPMASPWFTHMYGIDDKEHVNYQQEGYAAGLTRVDTHLGTHLNTNGFHLSPIVFG
                     AVPSLHSAIAFQCFLFLCFRATTLKHTFAKRTGLRSNHGGEQHSTPYDISEEDRLSQS
                     GSPLNLASENEGDEESYVSKNEEQSPFATKNSSSTLSGTEEYPLQDLENMGATEQEQQ
                     LRFGDSKPSVFVETYVEDTTLTSKWYLKPITTGILPPLLASIFICVQWWTTMYLDHHW
                     RFDLFIGEIYALVSYTIINYFLLQPRVLKEWYDLRRGLKFDSRNEARTMGMRVFQGTR
                     WEWFFDPLA"
     gene            <500204..>500491
                     /locus_tag="CAGL0G05329g"
                     /db_xref="GeneID:9487991"
     mRNA            <500204..>500491
                     /locus_tag="CAGL0G05329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999498.1"
                     /db_xref="GeneID:9487991"
     CDS             500204..500491
                     /locus_tag="CAGL0G05329g"
                     /inference="similar to AA sequence:UniProtKB:P38956"
                     /note="similar to uniprot|P38956 Saccharomyces cerevisiae
                     YDR073w SNF11 transcription regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999544.1"
                     /db_xref="GeneID:9487991"
                     /db_xref="UniProtKB/TrEMBL:B4UN01"
                     /translation="MDVDEQKQYKVQLLLHVNSLLLARALRLSQQQDQLQHQPQYLKR
                     IHANLQCISQLNQGLPNAKPMIMDPPPQQDSPQQDILAKLYLLMARVFEIW"
     gene            <501279..>503951
                     /locus_tag="CAGL0G05335g"
                     /db_xref="GeneID:2888142"
     mRNA            <501279..>503951
                     /locus_tag="CAGL0G05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446592.1"
                     /db_xref="GeneID:2888142"
     CDS             501279..503951
                     /locus_tag="CAGL0G05335g"
                     /note="highly similar to uniprot|P31688 Saccharomyces
                     cerevisiae YDR074w TPS2 alpha alpha-trehalose-phosphate
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446592.1"
                     /db_xref="GeneID:2888142"
                     /db_xref="GOA:Q6FT52"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FT52"
                     /translation="MTVPATKKQRIINCVSQLPYKIQLGETNDDWKITHVTGNSALYS
                     SLDYLNYDLQGEVEHHVVGWTGEVTREASVPNFTKEDKDKHDASEEDPMYLTKEQISG
                     LTSTLQDQMKVEDSNSTVHPVWLLRRDQSRWRSYAEKVIWPTFHYILNPSSANIQQEN
                     NWWYDYVKFNEAYANKIAEIYQKGDIIWIHDYYLLLLPQLLRMRYDQDVAIGYFHHAP
                     WPSHEYFRCLPRRKQILDGLLGANKICFQNESFSRHFVSSCKRLLDSSAKKTKNADGF
                     EQYQISAYGGDLIVDSLPIGVNTKQLLKDAFTKDIDSKVLAIKQAYQNKKIIIGRDRL
                     DPVRGVLQKMRAFETFLEMYPYWRDQVVLIQVSSPTANRNSPQTIKLEQQVNELVNSI
                     NSKYGSLNFSPVQHYYMRIPKDVYLSLLRVADLCLITSVRDGMNTTALEYVTLKSNKS
                     SANALSYGNPLVLSEFSGSSTLLKDAILVNPWDSVAVAKSINMALNMTKDEKSALEDK
                     LWSEVPTIQDWTDKYLKSLKEIIHDSSLGTPSADKRITPALNRPILLENYKQAKRRLF
                     LFDYDGTLTPIVQDPAAAIPTARLYSILQKLAADPKNQIWIISGRDQKFLNKWLGSKL
                     PQLGLSAEHGCFMKDIGNEDWVNLTEKVDMSWQARVNDVMEDFTRRTPGSFIERKKVA
                     LTWHYRRAVPELGEFHASELQKELLKFTDDSDLEVMEGKANIEVRPRFVNKGEIVKRL
                     VWHEHGKSQDMLKGINDTLPITEMPDFILCLGDDFTDEDMFRQLNTIESVWDKKFPDD
                     RNNFGHFGFYPVTVGSASKKTVAKAHLTDPQQVLETLGLLVGDVSLFQSAGTVELDAR
                     GHVKNSESSLKSEQATAQYVLKRTASSQNVKKDK"
     gene            complement(<504344..>505084)
                     /locus_tag="CAGL0G05357g"
                     /db_xref="GeneID:2888143"
     mRNA            complement(<504344..>505084)
                     /locus_tag="CAGL0G05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446593.1"
                     /db_xref="GeneID:2888143"
     CDS             complement(504344..505084)
                     /locus_tag="CAGL0G05357g"
                     /note="highly similar to uniprot|P40165 Saccharomyces
                     cerevisiae YNL200c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446593.1"
                     /db_xref="GeneID:2888143"
                     /db_xref="GOA:Q6FT51"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="UniProtKB/TrEMBL:Q6FT51"
                     /translation="MSALKVVSSKLAAEIDQELMGPQVGFTLQQLMELAGFSVAQAVS
                     REFPLSSKLNDNKHVFVIAGPGNNGGDGLVCARHLKLFGYNPIVFYPKRSERTEFYKQ
                     LVHQLNFFKVPVLGQDDDETRWLSYLEPEKTLCIVDAIFGFSFKPPMREPFQSIMSQL
                     KKIENDIPIISVDVPTGWDVDEGPISEQCIVPKVLVSLTVPKLCSNYLKEKTTKHYVG
                     GRFVPRDFANKYGFEPFAYEGTDQVLKL"
     gene            complement(<505531..>507183)
                     /locus_tag="CAGL0G05379g"
                     /db_xref="GeneID:2888216"
     mRNA            complement(<505531..>507183)
                     /locus_tag="CAGL0G05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446594.1"
                     /db_xref="GeneID:2888216"
     CDS             complement(505531..507183)
                     /locus_tag="CAGL0G05379g"
                     /inference="similar to AA sequence:UniProtKB:Q01722"
                     /note="similar to uniprot|Q01722 Saccharomyces cerevisiae
                     YNL199c GCR2 glycolytic genes transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446594.1"
                     /db_xref="GeneID:2888216"
                     /db_xref="GOA:Q6FT50"
                     /db_xref="UniProtKB/TrEMBL:Q6FT50"
                     /translation="MHHQVKLDVFIIRAFALLSETRVILTNTLLSATSSPQTSTNTPT
                     NLTNTNLPNSVGKKELSIEDSNNNDFSDTKNSGTPNNSSSQSGSTPSGGPFSGGLVSA
                     QYMKVFIKISKLYNATLNTGSVDDRSTSPKSSIELYQRFQQIIRELGLSYDASPYAKY
                     FSRIDEDSWKVRSNEELANDNLWNLATMSILNVYDLETGQMIVQGRGKKAQNINLNGR
                     GKNVSDVNSNTSNKGTVSVENDLTPNSGNSNKRNTPDNDVTQTRNKRKNIRAQRQQRI
                     SRPKSNQQIGDQTSQNAELKQDDPIMVQNHNGNQSMNENNTNFNNMLFDSYLQQQLQK
                     RLLSVPQDIHSRSLNGYYTQPTSPGANNFEFNFGNDINSTVPNGASGLPFLNSVTSNT
                     TNNQINAALNTTMPAPQHNWKRRSLGSLDVNTLDDDTVEELLQLPNLSNKKTKYTNDN
                     EKPSSADVIGNDDSGNNYVNEGQDNSNNLLKQKSTDSTVELDSIVRQMKTMYESIVSE
                     KGQRIMQLERELELQRQETQWLRKMLIEDMGCVRSMLKDLKR"
     gene            complement(<508557..>510572)
                     /locus_tag="CAGL0G05401g"
                     /db_xref="GeneID:2888232"
     mRNA            complement(<508557..>510572)
                     /locus_tag="CAGL0G05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446595.1"
                     /db_xref="GeneID:2888232"
     CDS             complement(508557..510572)
                     /locus_tag="CAGL0G05401g"
                     /inference="similar to AA sequence:UniProtKB:P34761"
                     /note="similar to uniprot|P34761 Saccharomyces cerevisiae
                     YNL197c WHI3 involved in regulation of cell size"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446595.1"
                     /db_xref="GeneID:2888232"
                     /db_xref="GOA:F2Z6C1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:F2Z6C1"
                     /translation="METTSRNSSTDSQNHDTNVNVAIPFAPNFATSASQQKGSQQTSP
                     FAITSMLHDLSIATPGVTSGPTSDISTNKNSGSLVDSLLADIGHGPYLLKIGQIPEDL
                     TERESHLIFSLADGIESVRLVDDKDGKEVEKEHKSNVSEPGKRIEATMKNLRLLAQYA
                     TILSRKDTLFGPQQSKKCTIEAIDQESNKSIDLELLKQVFEAHKSMHPEHKNESIGQR
                     HSRFSFNDPFSSEGVNSSLVFQTNQSNQSSNPATQLSGISENPVPIESTIHQSNRANS
                     FLVRENNDINESIWNDNGINNSLNGLVASSQPQTPSVDWTGQNDRKKSAAFYFPNNPS
                     QANVMPAPTGAKQTQVGLASQLPSGELGQQMQINTNMGMPNASQPFASSTSLSSFNVV
                     PQLHGDGQSFVNPITASDLNIGVHDGSRFTPFNPVGQTPTLSMQNNQVTTENAQLPLM
                     QGNTAHKMGPSRITSQRNALSSNMIPKVGNVNSSNMGMTSEAQFNKQSGLNSTASSTS
                     NIANIPGSNNISQADLSLLARIPPPANPADQNPPCNTLYVGNLPSDATEQELRQLFSN
                     QFGFRRLSFRNKNANGTGHGHGPMCFVEFDDVSCATRALVELYGSQLPRATVNTKGGI
                     RLSFSKNPLGVRGPTNRRNTNTSSTNVSSNNLGSTQGQNSGIVYNKP"
     gene            complement(<511175..>512911)
                     /locus_tag="CAGL0G05423g"
                     /db_xref="GeneID:2888324"
     mRNA            complement(<511175..>512911)
                     /locus_tag="CAGL0G05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446596.1"
                     /db_xref="GeneID:2888324"
     CDS             complement(511175..512911)
                     /locus_tag="CAGL0G05423g"
                     /inference="similar to AA sequence:UniProtKB:P09932"
                     /note="similar to uniprot|P09932 Saccharomyces cerevisiae
                     YDL227c HO homothallic switching endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446596.1"
                     /db_xref="GeneID:2888324"
                     /db_xref="GOA:F2Z6H8"
                     /db_xref="InterPro:IPR004042"
                     /db_xref="InterPro:IPR006142"
                     /db_xref="InterPro:IPR007868"
                     /db_xref="InterPro:IPR007869"
                     /db_xref="InterPro:IPR027434"
                     /db_xref="InterPro:IPR028992"
                     /db_xref="UniProtKB/TrEMBL:F2Z6H8"
                     /translation="MFEKGTFILMADGHLEDISAIKSNSYVMCEDGTPGRVAYTTKAK
                     QTIYEIVQKTKHRANEGEPGRLDPRRRTVYNRLGFNCSATHKLVLKTPSIPTLENNPR
                     RPNLTVKWRCLEEILTTDGRAITVPKNHHKNFPKTKEGQLQAQNFMRDKRLIWGPDID
                     YEIQVRDLEYLDASMRVTSTLKCNPVFSGNGILSNFLSGQRHLITPAIVSMAWLLGLW
                     IGDGTTKEPEITVDSVDEKLMESLTVLGRYWGLYPTYKDEKVPLRAKHVRLYYGKGPE
                     ERRKTRNLRKNNPFWNTIQNLGIKREIDGEKQVPEFMWHEDIEIREAFLAGLIDSDGY
                     VVKRKENPDVYKVSIQTIYPSVMNAIVHIARSLGISATVTTRSARNEVIEGRRVQCRF
                     TYDCNISGSTPLQNVLSYCRSGHKRKPAPEVVIRDPQYVGFIDRKLREAEVYGIHLDQ
                     PRNILLGNKIVVYSCTECCETDAVHITKIKNLKHCVSCPRTGVRYFYRDWTGKSHVCG
                     RCYGRYKFSGYRCLHCKYIPEAREIKKARMRGEETRLFEQSYITGLVCSRCEGILTFD
                     EIRGPAKKQAVQ"
     gene            complement(<514769..>515833)
                     /locus_tag="CAGL0G05445g"
                     /db_xref="GeneID:2888347"
     mRNA            complement(<514769..>515833)
                     /locus_tag="CAGL0G05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446597.1"
                     /db_xref="GeneID:2888347"
     CDS             complement(514769..515833)
                     /locus_tag="CAGL0G05445g"
                     /inference="similar to AA sequence:UniProtKB:P35197"
                     /note="similar to uniprot|P35197 Saccharomyces cerevisiae
                     YDL226c GCS1 ADP-ribosylation factor GTPase-activating
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446597.1"
                     /db_xref="GeneID:2888347"
                     /db_xref="GOA:F2Z5X9"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:F2Z5X9"
                     /translation="MSDWKVDPDNRRRLLQLQKIGANKKCVDCGAPNPQWASPKFGIF
                     ICLECAGTHRSLGVHISFVRSITMDQFKQEELVRMEEGGNEPFTEYMTAHGIDMTLPH
                     KFKYENPIAEDYKEKLTCKVEGREFVEPQHPDFDPKSLGKSEPVSEPSIASEQSSRQN
                     TPIESRRIGSPTRKEKNEEYFAQLGKKNDSKPDHLPPSQGGKYQGFGNTPVNNRNATD
                     PSTNTMSLENLQTDPLGTLTKGWGLFSSAVAKSFDDVNETYIKPNVQQWNTGELSEET
                     KRAAAQFGQKFQETSTYGMQAFSSFTKNIQKQYINGDESYSQLPASQKNQSASTSRDD
                     LLGDTKKSVPKAGEDEWEEF"
     gene            complement(<516813..>518000)
                     /locus_tag="CAGL0G05467g"
                     /db_xref="GeneID:2888348"
     mRNA            complement(<516813..>518000)
                     /locus_tag="CAGL0G05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446598.1"
                     /db_xref="GeneID:2888348"
     CDS             complement(516813..518000)
                     /locus_tag="CAGL0G05467g"
                     /inference="similar to AA sequence:UniProtKB:Q01722"
                     /note="similar to uniprot|Q01722 Saccharomyces cerevisiae
                     YNL199c GCR2 glycolytic genes transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446598.1"
                     /db_xref="GeneID:2888348"
                     /db_xref="UniProtKB/TrEMBL:Q6FT46"
                     /translation="MDEFNLDLFIIISFQMLIGGSNNAHNLQNNSTTHSANSGYNLSN
                     RDPGSALSHYSGFHMSDGSPNSINSNLTNMTTPIFNSDNGTKFDDLYIISIFEKINNI
                     LVNSSSSSNLLRTFLNTLSVGSDTDYPNQLYKRFLGVRKELKDNYNESRFNQFFTANG
                     DLRDYQTLEKNKTWSTIRNYILSIYDPIADKFLVPKSWTTNNSPRKMSVINNFTSSGM
                     LSNLASNNNSNKDLVNYGSFFTNNKSLNGYYTQPTSPTPNDFSINFNLPITNNNNSNS
                     NNSNNIPLPTGDEFDSAMVDMLDFPINTPVEEKFKRSEEPRSPVFVEEPPQDIVCSKS
                     AQKALLALRQHYDGVISYNDEKIRKLEKELNEQRQESICLRKLLLEAMGSIRSTLNEM
                     RSQ"
     gene            <520095..>521696
                     /locus_tag="CAGL0G05489g"
                     /db_xref="GeneID:2888405"
     mRNA            <520095..>521696
                     /locus_tag="CAGL0G05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446599.1"
                     /db_xref="GeneID:2888405"
     CDS             520095..521696
                     /locus_tag="CAGL0G05489g"
                     /inference="similar to AA sequence:UniProtKB:Q07657"
                     /note="similar to uniprot|Q07657 Saccharomyces cerevisiae
                     YDL225w SHS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446599.1"
                     /db_xref="GeneID:2888405"
                     /db_xref="GOA:Q6FT45"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FT45"
                     /translation="MDSPSIPNSLFRRKDKHKRGIVYSVMLCGASGTGKTTFANNLLE
                     SNLFKHKYNGGLHEFNPNTNDYLTVTKPTKIISFNSNNGLPSQSMENLMDLTNSSEFD
                     QVFNPATQNKDSGIAITSTSFEIRSKNEEKNKYDVDMDTIYLNLIMTLGLGENIDNSI
                     CTSEIDLFLRQQFDTVLAEETKIRRNPRFEDTRVHIALYFIENTGHGLREQDVELMKT
                     LTKYTNVLPIISKADSFSPEELKTFKTAVMNDIERYNIPIYKFDIDLTDPSQEFDLDQ
                     QTIEENEYLAALQPFATICSDQRNAEGKAVREYPWGSILIDDENISDLKILKNVLFGS
                     HLQDFKDTTQNVLYENYRAEKLSSVTNNKYEATNPQSNDQNIKRQSTVPSLSNFQSLI
                     QTGQIKSYQNLPISPSPSQNGNTNQATENLEDTTNMSVISEHSGMSQGGVPERSQLRN
                     ISETVPYVLRHERLLAKQQKLEELEAQSAKELQKRIQELERKAHELKMKERRLLSVSD
                     VPNSPQVSIKRGDTYNDLASMASNR"
     gene            complement(<522026..>524050)
                     /locus_tag="CAGL0G05511g"
                     /db_xref="GeneID:2888075"
     mRNA            complement(<522026..>524050)
                     /locus_tag="CAGL0G05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446600.1"
                     /db_xref="GeneID:2888075"
     CDS             complement(522026..524050)
                     /locus_tag="CAGL0G05511g"
                     /inference="similar to AA sequence:UniProtKB:P34761"
                     /note="similar to uniprot|P34761 Saccharomyces cerevisiae
                     YNL197c WHI3 involved in regulation of cell size"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446600.1"
                     /db_xref="GeneID:2888075"
                     /db_xref="GOA:Q6FT44"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FT44"
                     /translation="MKMTESEYMFGGNFDSHHSGVTMETMIHPVSPTSNVKALHGSFL
                     NNHIHDNAPLKEIENMLTMGVNKADYIPNSMTSTVHTNMPHLHTLFDNSLRNHGVFDA
                     EKNFSLLMTGLPVTLREAHCIFAFAQGVDSIEVVPSSDVTLALKAMEEYRSLPEICKV
                     SVEVKFQNPSYLSQCAFELIIKLESIKEQFGGTKLYLGVYEHQTDNYLSMSNLLAGTN
                     TDGSLHDENIGKNMHFSSSDSHIDSMVQSSPIQSLGKLSRPNLFPRRSRFSFGDPFNS
                     ETVPDTSINMGLGGDTSLNSLHQMDGINSRKSTSRDTGKALLLMENDEINENIWGTDT
                     LPTTVDDLPLTSGANTTDTGVWKDEGNKGVNHNLYLLPESKTSNKYSTRKPDFADENT
                     HVFQNGSALLPEIHGAQNDQLNGGASNANGSFDHQTFSNISHQPSNNYVNNLGPSDMG
                     SITRVEMTNNRNQDPYIGTMAYRADNFQDNLVHNDSTIFQSNTDLTKNVMVDNKMATN
                     GNKPGLSPSQSFSSANGMGYSEKGMSQADLSLLAKVPPPANPADQNPPCNTLYVGNLP
                     PDTSEQELRQLFSPQPGFRRLSFKNKNNNGHTHGHGPMCFVEFEDVSFATRALAELYG
                     RQLPRTGANSKGGIRLSFSKNPLGVRGPNNRKMTSIGKAPNSYKANYMKN"
     gene            <524170..>524448
                     /locus_tag="CAGL0G05522g"
                     /db_xref="GeneID:2888148"
     mRNA            <524170..>524448
                     /locus_tag="CAGL0G05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446601.1"
                     /db_xref="GeneID:2888148"
     CDS             524170..524448
                     /locus_tag="CAGL0G05522g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446601.1"
                     /db_xref="GeneID:2888148"
                     /db_xref="GOA:Q6FT43"
                     /db_xref="UniProtKB/TrEMBL:Q6FT43"
                     /translation="MELDIQWASEVHDYRIKQRDPWETHKGTIAIVLPLGSPLFLQSF
                     VVVTFTRNGLPAWRTHMPTINTSLQDATCLPSPPRGVIAVTGYGKCRS"
     gene            complement(<524827..>527250)
                     /locus_tag="CAGL0G05544g"
                     /db_xref="GeneID:2888337"
     mRNA            complement(<524827..>527250)
                     /locus_tag="CAGL0G05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446602.1"
                     /db_xref="GeneID:2888337"
     CDS             complement(524827..527250)
                     /locus_tag="CAGL0G05544g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446602.1"
                     /db_xref="GeneID:2888337"
                     /db_xref="GOA:Q6FT42"
                     /db_xref="UniProtKB/TrEMBL:Q6FT42"
                     /translation="MLKFSKPRSPNKDKEENNKDKEPLALGNKPFEKVNSADIGNDSK
                     YADFFDEQRRKEKQFSHSTTKPVEYKLPEMQTGDDTARKLEGDGTKTQAGLGFGSLTK
                     PFRRFSASHKSGNDQSVAAVHGEIDNTGQTADRSLKPTNLFTGFTERRKSKSKQESSA
                     DRRRSSLPTSHVAIEDKPPTNTGVVIPSHPQGGFTGNTGIKNEIQTEKQNFSHAVEMH
                     NNNNKTKSDSGSMWNSTSKNATARESGDNSNEDSHMGNPNVQLSGTVFDRTSAKGRDI
                     LKKDEPKTYSSNNQNFSGINRKPSAVEENYSTAKGYSEYNDSNEIPLSTITGTVGNDS
                     TSKTQFEKNVISTPSKTGIQKTHVNPTPPLSPKEIQQADHLDHEGRTFTGIGLGTKKE
                     SLGSGNNYSDNPHIIKKTNNSNGSGVNNGKSLDPKTADTDNSSSGKEVHNGVSTMTAG
                     LGLNKHVNSYTGTNNNSNRGQKQFGVQSGHTDSGHNKTPKTEDLVEELTQGGALFGTL
                     ADQDKNTSHSKSTQSGGSMGQNHHSGTSHPQNKGMSNTSTSMQSGKLGPEQMNITEPK
                     DMNSRKFVERESHNNDLEQSLDPRSKEINPLKNLNISEPKTDDAKQYVQRENSAAKPQ
                     RQNNFPVGMMNVEEPQEVYSEKRNTGMTTSGLPNLDRSELQTSQSFTSRNSIKSKNLD
                     DLDPIKDNDQDQRHGTRQGSGLGHGHDHGAGRGYNNFNDDEKLSPVTSNDQAGHNHLK
                     YRNSLVDPDVPTYQAVPKSHGEHVIHGSPMDYKYSEGKSSSTPRSEQRKSQSKASTGK
                     KKLKETQRS"
     gene            complement(<528776..>529618)
                     /locus_tag="CAGL0G05566g"
                     /db_xref="GeneID:2888338"
     mRNA            complement(<528776..>529618)
                     /locus_tag="CAGL0G05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446603.1"
                     /db_xref="GeneID:2888338"
     CDS             complement(528776..529618)
                     /locus_tag="CAGL0G05566g"
                     /inference="similar to AA sequence:UniProtKB:Q07651"
                     /note="similar to uniprot|Q07651 Saccharomyces cerevisiae
                     YDL222c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446603.1"
                     /db_xref="GeneID:2888338"
                     /db_xref="GOA:Q6FT41"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6FT41"
                     /translation="MQYKRFVNAIVCLFIVGAGLLSFFLILSGARDSGTLKNFYWFEA
                     DTSGFNDAPDVTRWYNYMYCGYADHETYDCSDKGADKPFSPKDNFGESPNMPRTFIDH
                     RKTYYYLSKVGWAMLLISLFFTVLAIVPIFLSIFKLARPLSITTCVLCWLSWFFITLA
                     ACLYTGCYAKAKNAFHHDDRHAKMGAKNFAFLWTTVFLMGVSSIWTMIDAITRRKEKY
                     NKYRTTDVYSDTEVVGAVPPVESQPSSGRTFFRKLRTKKHETPAGVMAEEESHEKVVE
                     GVQT"
     gene            complement(<531450..>533711)
                     /locus_tag="CAGL0G05588g"
                     /db_xref="GeneID:2888025"
     mRNA            complement(<531450..>533711)
                     /locus_tag="CAGL0G05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446604.1"
                     /db_xref="GeneID:2888025"
     CDS             complement(531450..533711)
                     /locus_tag="CAGL0G05588g"
                     /note="weakly similar to uniprot|P32797 Saccharomyces
                     cerevisiae YDL220c CDC13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446604.1"
                     /db_xref="GeneID:2888025"
                     /db_xref="GOA:Q6FT40"
                     /db_xref="InterPro:IPR011564"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="PDB:3RMH"
                     /db_xref="UniProtKB/TrEMBL:Q6FT40"
                     /translation="MSIEIIAVLTSISKDDNGFHIALDDIAGEVRVLDIDEAQAREVV
                     NECDLEVSDTNAFNITKIQLEKLCFVVAKCTSSGLQLVNGDMTFKLQPVDVKVLDINY
                     IQENWNTLDKKKKDKISKILLALKKLDSDIKSEFNFVKLNNYKNTLVHFLSGIKMTKQ
                     TKLTSFFTKQTTMVESQNDFNSQAMNTQQFTSQASIPGISDDELIDSDDDLDNISEGS
                     YPTVTRLGSTKHDLPTNHNGSSANKHSKKDSCLYVNFMDPHRNQLWTYNGDNSSVIIS
                     HCSLQSMSPVGFKSLDDLDKFTLRLVFKQKTMVDELLIPNNNCCEVVIKNKLEYMETF
                     GRLADTSSKLRKYLNGDLNITVKKWKYEIRGYDSFKWTIEKLDFNPEMPVKEKVPEQG
                     KCSNRYDFNSINFIDESTRDQVIQFKDMIIEEENTAKFYIVFGYLLACSTDNSNYANF
                     VFTDFTTNRKYEQKYTFDRYINDYNTKLDHDQSFRVISYYNHFNEFNMKVKAKYGKDL
                     NAMVNENSQIADKNVSKYGILCRIVMKCKLYQSVLNLVERDIELLDNLHELSIGEKPY
                     IKELFNKTEPYLTASPTLNVNGDIASSKTTRESKEQVPCITDITQYEVVEDHNISQLN
                     HLQHLTPKIYVLNVYIIDVEIVYDQEIRIKVVNELPMVGKYVPPVDILEVYITGKEEV
                     QNFLGDEALTMDIFTPLLNETSRLRVFQRPSKTDRIIRWSPIECTIQELRLQRMFRLR
                     DTIKVEETLSLTQ"
     gene            <534171..>534620
                     /locus_tag="CAGL0G05610g"
                     /db_xref="GeneID:2888282"
     mRNA            <534171..>534620
                     /locus_tag="CAGL0G05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446605.1"
                     /db_xref="GeneID:2888282"
     CDS             534171..534620
                     /locus_tag="CAGL0G05610g"
                     /note="highly similar to uniprot|Q07648 Saccharomyces
                     cerevisiae YDL219w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446605.1"
                     /db_xref="GeneID:2888282"
                     /db_xref="GOA:Q6FT39"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /translation="MRIVIQKVSQAMVKVDNEIVSQIAKGYMLLVGISTEDTIADAQK
                     LSNKVLNLRLFETGDQFWKHSIQDVQGEILSVSQFTLMARTKKGNKPDFHKAQKGEHA
                     QELYNQFLDLLKTTLGADKVKDGQFGAMMSCSLTNEGPVTIILDSTE"
     gene            <537072..>537842
                     /locus_tag="CAGL0G05632g"
                     /db_xref="GeneID:2888219"
     mRNA            <537072..>537842
                     /locus_tag="CAGL0G05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446606.1"
                     /db_xref="GeneID:2888219"
     CDS             537072..537842
                     /locus_tag="CAGL0G05632g"
                     /inference="similar to AA sequence:UniProtKB:Q07629"
                     /note="similar to uniprot|Q07629 Saccharomyces cerevisiae
                     YDL218w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446606.1"
                     /db_xref="GeneID:2888219"
                     /db_xref="GOA:Q6FT38"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:Q6FT38"
                     /translation="MTASSAMKNFGLFSLRFFEFGSAVVVLGTLGYTVHGYHFHGSKR
                     TNFVLAQAAISTFYSLCTCLLTLAVPQLIFVGLYWFWELIMTMLWLAAFIVDAKVQGD
                     DGCHNRRSTTYEPHRGSQEEFQATNGEYNPFTGKYTTNDYKRPCHTGKASIAFAGLCF
                     VLYLTSTIILGVRVMTPIVKKYGSKGLMMKGSDMNDNSLNRFHGLDLVKPLDDAYNYD
                     PEQGMGETAPQDSASSHEYNQEKLNEQPRASGDTAVQA"
     gene            complement(<538517..>539098)
                     /locus_tag="CAGL0G05654g"
                     /db_xref="GeneID:2888408"
     mRNA            complement(<538517..>539098)
                     /locus_tag="CAGL0G05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446607.1"
                     /db_xref="GeneID:2888408"
     CDS             complement(538517..539098)
                     /locus_tag="CAGL0G05654g"
                     /note="highly similar to uniprot|Q12328 Saccharomyces
                     cerevisiae YDL217c TIM22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446607.1"
                     /db_xref="GeneID:2888408"
                     /db_xref="GOA:Q6FT37"
                     /db_xref="InterPro:IPR003397"
                     /translation="MVYRGFGLEYLSPPEKKAFGELSPDEQGERGAEMVVGFMSSCPG
                     KSVISGATGFALGGVLGLFMASMAYDTPLHTPVPGGMSGAVQQMADLPLRQQVKLQFA
                     DMGKRAYSSAKNFGYIGMIYAGVECAVESLRAKNDIYNGITAGCITGGGLAYKSGPQA
                     ALVGCAGFAAFSAAIDMYMKSEDGRPPENDFKQ"
     gene            complement(<539441..>540838)
                     /locus_tag="CAGL0G05676g"
                     /db_xref="GeneID:2888409"
     mRNA            complement(<539441..>540838)
                     /locus_tag="CAGL0G05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446608.1"
                     /db_xref="GeneID:2888409"
     CDS             complement(539441..540838)
                     /locus_tag="CAGL0G05676g"
                     /inference="similar to AA sequence:UniProtKB:Q12468"
                     /note="similar to uniprot|Q12468 Saccharomyces cerevisiae
                     YDL216c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446608.1"
                     /db_xref="GeneID:2888409"
                     /db_xref="GOA:Q6FT36"
                     /db_xref="InterPro:IPR000555"
                     /translation="MDDFPSLNVSDLESKLLDYNIRDYEVQNSKHKNNIAGNEKESID
                     QLSLLNQVCSLKNRKAIDSTKNSPLFYQNVLLSKLACSKILCHATKGGNIEVMGMLLG
                     NVIGNTFVIFDCFELPVEGTETMVNAHMESYEYMVQFYHEMVERSYTRNEENLNIIGW
                     YHSHPGYDCWLSNIDMQTQSLNQQHQDPYLAIVVDPHKSKNDQKVRIGSFRTYQDQND
                     DTNFYELNTTVFDSELNKLENPLSVKIPFNSIESRNLESNYLQKLSETVKQWRNFKIM
                     EKIENTAHTEDTTTNKSISTPGRIIQTAHEFAFAATSNGNGSRVNIMRSNSVSSIGSS
                     SDIEMEDRNCSAFDSVASSINTIADPSRTSSIHTQMNNQNNQQERNSPKRPHILPAIQ
                     SSRYGVIFEGKDRPENKNFNIRTASAQDAFESKCIDDFHESLKNDYLTQKEILLRLKL
                     RQYYRLRMYRDMFSK"
     gene            complement(<541468..>544755)
                     /locus_tag="CAGL0G05698g"
                     /db_xref="GeneID:2888100"
     mRNA            complement(<541468..>544755)
                     /locus_tag="CAGL0G05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446609.1"
                     /db_xref="GeneID:2888100"
     CDS             complement(541468..544755)
                     /locus_tag="CAGL0G05698g"
                     /note="highly similar to uniprot|P33327 Saccharomyces
                     cerevisiae YDL215c GDH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446609.1"
                     /db_xref="GeneID:2888100"
                     /db_xref="GOA:Q6FT35"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:Q6FT35"
                     /translation="MFKQRLSNPEVPEIATLSISSMSDYHVFDFPGKEQQREQVVDLL
                     DQQGFIPDDLIEQEVDWFYNSLGIDDLFFSRESPQLIANIVHSLYASKLESFAKSNFV
                     GVQPQHFNIKNKIITDSSHAIFMESNSASPEFLEKTDQTGGIDQQLEGGKATTKKHTD
                     NPPYELDEEIDHLFLDNKEKGNCRLVSFTAPESELKLTFVYESQSDEPQAAIDSTQLL
                     KGQIDSISDKTMAQVTSIENKKLYGLLIKLVQDREGPVIRTTQSVEDSDEIRMLVAYK
                     RFTTKSYFSAINSLFHYYKLKPSKFYLESFRVKNQASAVKTNKNPYDDIIIFSIYLHR
                     SQQPEEILKNDLELAIKQVEREASLLYAIPNHAFTKVCAERQFSPQEAVYAHVSAIFI
                     NHFINRLGSDYQSLLSVLTIKDSDTTLLEILSNLKRKLRNETLSQQSIINALEKNHKV
                     VSKLYKNFADVHSHHAKSDSLQKTLSYQRLEQIEPFKNDQEFQSFLNKFIPNDSPDYL
                     ILQTLNLFNKAILKTNFFVTRKVAISFRLLPELIMPKVEYPDTPYGLFFVVGNTFKGF
                     HIRFKDVARGGIRIVCSRNQDIYDTNSKTVIDENYQLASTQQRKNKDIPEGGSKGVIL
                     LNPGLVEHDQTFIAFSQYVDAMIDILIKDPLKENYVDLLGKEEILFFGPDEGSAGFVD
                     WATTHARSRNCPWWKSFLTGKSPDLGGIPHDEYGMTSLGVRSYVNELYKTLHLNEKTV
                     AKFQTGGPDGDLGSNEILLSTPNESYVGILDGSGVLCDPEGIDKEELTRLAHTRKMVK
                     EFDTSKLSKQGFFVSVDDMDVMLPNGAIIANGTTFRNNFHTEIFKYVDHVDVFVPCGG
                     RPNSINLNNLHCFIDEKTNKCKIPYIVEGANLFIAQPAKLALEAHGCVLFKDASANKG
                     GVTSSSLEVLASLALNDDDFVNKFVAKRETTPEGIKFIKSPLYKAYVVEAQSRIENNA
                     RLEFGQLWKINQETGTPISELSNVLSQTINKLNDELVESEELWLNDLKLRNYLLLEKI
                     IPKLLIDVAGKDQILTSIPENYLKVLLSSYLSSTFVYKFGIDVNIGKFLEFIGELKRD
                     AEKFYSN"
     gene            complement(<547617..>549833)
                     /locus_tag="CAGL0G05720g"
                     /db_xref="GeneID:2888257"
     mRNA            complement(<547617..>549833)
                     /locus_tag="CAGL0G05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446610.1"
                     /db_xref="GeneID:2888257"
     CDS             complement(547617..549833)
                     /locus_tag="CAGL0G05720g"
                     /inference="similar to AA sequence:UniProtKB:P22211"
                     /note="similar to uniprot|P22211 Saccharomyces cerevisiae
                     YNL183c NPR1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446610.1"
                     /db_xref="GeneID:2888257"
                     /db_xref="GOA:Q6FT34"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FT34"
                     /translation="MLESLIPRLFPRTDNRIRSTQELTAVFESNPSLSATEIAEEINR
                     YNDSYDFSIRELVLSRSTAGTMLSKSNMLDTAVGNSNGTWLKLHDNEAESSKPPSYDF
                     SWLKSYTYSESSHILTPVNVGSQQSVMSFEEVLPNLVFQNPSLTIGSEGTIPIESLKR
                     ANKSDNPFKIPENATLIETEQLWSPVIENIPSRFKIDSETYKRKRMEQLLFFERSSKL
                     GKLFRRTSSNSNGNYCDDCSSNVSSQSTTFSTTNNSTYNGDVNIPNNTAPIRHNIQRK
                     LPMDGIYLNTSNTKKSIWKQYQLLQLEGKKVVYMDGENVEERSNILGFGASGEVKLAT
                     KMGDNKLYAIKVFHDIAMDEISRLENSSEMSVDIETNDAPSSVEHSLGTHEGIDIFKL
                     SARMRSLKRIHTEYAIGSALNHENIIKTYDLFYENGSLYTVMEYCDYDLYALVVSNKL
                     TYDEVCCYFKQVLHGISYLHDIGISHRDLKLDNCVVNKEGVLKLIDFGSSTVFNTPYL
                     EHRVVMRSSGIHGSNPYLAPEVCYYWSYDPRPTDIWAAAIMFICMITKRFPWREPRCS
                     DLQFTRYIKYKEPQEQIMSRHVNSKVLLRLLQKTPYEHLNNSSRGVSERHKHRKNLHD
                     YEHYCRFLEKNRYLMDPLVLVPEEAQQVLSHMLELAPACRFNIHEVLSDQWVDGIEAC
                     TIRNEAPLSGCKSDNKSKMSAAQDVYADTIITHKHSSLPQASAHMGQLQNEQENKR"
     gene            complement(<551640..>552266)
                     /locus_tag="CAGL0G05742g"
                     /db_xref="GeneID:2888001"
     mRNA            complement(<551640..>552266)
                     /locus_tag="CAGL0G05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446611.1"
                     /db_xref="GeneID:2888001"
     CDS             complement(551640..552266)
                     /locus_tag="CAGL0G05742g"
                     /inference="similar to AA sequence:UniProtKB:Q07623"
                     /note="similar to uniprot|Q07623 Saccharomyces cerevisiae
                     YDL213c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446611.1"
                     /db_xref="GeneID:2888001"
                     /db_xref="GOA:Q6FT33"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FT33"
                     /translation="MAEEGKVGEKKLSKKQLKAQQFRKSKEEKTTDAKRKIEEEEKKE
                     EEQPKKKRKTRRGKKGKGNKNASGNRFIVFVGGLPKDITASELQVHFKSSGPDVIRLR
                     AEKGIAFLEFDGDKDKTGIQRRMDVALLQNKTMLKDRRINVELTVGGGGNSQDRLEKL
                     RKKNEKFEAERQERMAKFINKSTPKDKKSDSDTTTTTGIHPDRAKLLK"
     gene            complement(<552809..>553681)
                     /locus_tag="CAGL0G05764g"
                     /db_xref="GeneID:2887978"
     mRNA            complement(<552809..>553681)
                     /locus_tag="CAGL0G05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446612.1"
                     /db_xref="GeneID:2887978"
     CDS             complement(552809..553681)
                     /locus_tag="CAGL0G05764g"
                     /inference="similar to AA sequence:UniProtKB:P53879"
                     /note="similar to uniprot|P53879 Saccharomyces cerevisiae
                     YNL180c RHO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446612.1"
                     /db_xref="GeneID:2887978"
                     /db_xref="GOA:Q6FT32"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FT32"
                     /translation="MKSLKCVLVGDSEVGKTAFLMSYTTGSFSPEYVPTVFDEYLTTI
                     QDKETGYTFHTTFWDTSGDKQHDHLRPLTYPQTDVFLACFPYNDIRSFRNVKDKWIPE
                     LKKYIRKSDNSSTVPILLVATKCDLNDDNSSNNILNQSQEVDGMPLPESLVDGLVIDE
                     NLLGFVKCSSKTGYGLQDVIDNVAKYVGAKERELRSLSSRDVPELYTKTSDVDLVDNN
                     DFVKVSSTPLECVDGDDDIRTIPALAKAQSKSRMSNSSKRTSVKRMYSRPQSEKSLKS
                     KKWQDKRGCICVIL"
     gene            <557656..>558291
                     /locus_tag="CAGL0G05786g"
                     /db_xref="GeneID:2887979"
     mRNA            <557656..>558291
                     /locus_tag="CAGL0G05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446613.1"
                     /db_xref="GeneID:2887979"
     CDS             557656..558291
                     /locus_tag="CAGL0G05786g"
                     /inference="similar to AA sequence:UniProtKB:Q02774"
                     /note="similar to uniprot|Q02774 Saccharomyces cerevisiae
                     YDL212w SHR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446613.1"
                     /db_xref="GeneID:2887979"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:Q6FT31"
                     /translation="MLSYAEFCTIGSAMILTSTGFLMGVFFACQPYDYHLLFNPQATQ
                     EQFDLALKHYQVLSTTPMPVLYLLGFVVALGIIGNTIRIYKPNPDLQLFEYASLGLFV
                     LAVCVFITNVKTGIECSITGNWGEVTQNQGLAVIASSNIILLVMFLGVILLQIGLWYT
                     NYDYQKQLQAFYAEERKEQEAINQRKEEEFKKLSKKQQKKLAKEEATRKTD"
     gene            complement(<558635..>560227)
                     /locus_tag="CAGL0G05808g"
                     /db_xref="GeneID:2888256"
     mRNA            complement(<558635..>560227)
                     /locus_tag="CAGL0G05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446614.1"
                     /db_xref="GeneID:2888256"
     CDS             complement(558635..560227)
                     /locus_tag="CAGL0G05808g"
                     /note="weakly similar to uniprot|P53882 Saccharomyces
                     cerevisiae YNL176c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446614.1"
                     /db_xref="GeneID:2888256"
                     /db_xref="GOA:Q6FT30"
                     /db_xref="UniProtKB/TrEMBL:Q6FT30"
                     /translation="MADSNITMSSSDVYVDGPPTVLNANTSVPMESDPLSISIPSNSV
                     TIHTSQNVTDVEPVTANAASSNNTTSMPVSSLSSQQNTTTTPVPITPYYSQSYSSISK
                     NSSISTSSLPSITSAISITPASSKNSTSSSTSITSSLFSSSYLTSVTSSYNTTSNIIP
                     FSTSKSTETYISSQSTSFSISSESSVQISSSSSSSSSPSSSSSPNSSSALSSSSSSSS
                     NTESSSSSTPIISSTISKNYIIYIYDQKFEFTDASTTFDTDIPVETRIKVTPNKMVSF
                     TPPTGILTTDAALYQKYLAGTLDWNSHDTDARIRNSKIIGGVVGSVCGLLVCSVVIFL
                     LFFRRKRNTHNYMPDDDLTSIKDEKGSYYGFSTENTPYKPAISTRDLTASNQRLKKLF
                     SKKENSTPTKNWKKATTEYMSTPSTNPFQDEFDFDKRLPSPPNLDNKDMTPSDKIINP
                     RNGENDVSIPHLLLPDNESISLISEPEIEQSTNTDTNEQFSYVSSMNSYGPGSSFVPS
                     SVGDYSTLSPTSIHIDEDGSIL"
     gene            complement(<561943..>564474)
                     /locus_tag="CAGL0G05830g"
                     /db_xref="GeneID:2888165"
     mRNA            complement(<561943..>564474)
                     /locus_tag="CAGL0G05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446615.1"
                     /db_xref="GeneID:2888165"
     CDS             complement(561943..564474)
                     /locus_tag="CAGL0G05830g"
                     /note="weakly similar to uniprot|P38845 Saccharomyces
                     cerevisiae YHR146w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446615.1"
                     /db_xref="GeneID:2888165"
                     /db_xref="GOA:Q6FT29"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FT29"
                     /translation="MQEIVSFTFRWPAGPQEVLVTGSFDKWQSKIPLVKEADGSYAVT
                     IPLKFEDEGERLYFKFIVDDEWVVSKDYRKEFDSNGFENNFVSINEAKKSLKDQTKGM
                     GSRIPESGGLMALSAMSAGSGSAMKNDMEIGEQKFTTQPVDTPEADTNVFKNSGYSFG
                     GPGPAIPGNMAAFEMKKADDSMDMSHGTETAMSESMGEPSMNMSDNMDTTKDMSDDMG
                     MSARDVHVNVPGQFNTMPIETDPASTNAFANEQTAIMAGPGPAIPSKDKMGAFTKFRN
                     SKGEFVEKEELDKENASAEKSMGMETQTTKDMMNEKQESMDMQSKKMEHEEKKMKEAE
                     EKQVKMAEEQKMKADEEKRMKEAEDEKRNMAMEEQKMKSNAEQKRQEEMAIDMEKQKR
                     QEEDAATETEMKMKQSQKAEAAAAAAAAATTGMASGAMMSNSTTAKKSATPMEKNVSG
                     MSMDDKTPKMGMPRETPSMSMDPKSSGMTMEKETPSMSMDPKSSGMTMEKETPAMSMD
                     PKSSGMTMEKETPAMSMDPKSSGMTMEKETPAMSMDPKSSGMTMEKETPAMSMDPKSS
                     GMTMEKETPSMSMDPKSSGMTMGTSAAAMTMDHKQPHGMSESSTTHKHTKKDDTMMGK
                     MKETDEKMMEKKEATKENVENKIMETDQKLQNRFDRVKAEVQGNAMHIKDEVREMLHP
                     TTSKPESKHNTKEHTPMAVEYSGTGHQMDKTNMDMNDPDVYKHHPSHTSHNAAHKVPS
                     ADMNDPRVYSIPNSAQHSDENLPQGFKNDPPVTPTKKKMAASSSMNDTPKMKSPMTTS
                     KTGAKTTPKTTSKTTSKPTTTSMNSTPMKKEKKGFFSKLKKVFKV"
     gene            <565237..>566160
                     /locus_tag="CAGL0G05852g"
                     /db_xref="GeneID:2888266"
     mRNA            <565237..>566160
                     /locus_tag="CAGL0G05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446616.1"
                     /db_xref="GeneID:2888266"
     CDS             565237..566160
                     /locus_tag="CAGL0G05852g"
                     /inference="similar to AA sequence:UniProtKB:P06773"
                     /note="similar to uniprot|P06773 Saccharomyces cerevisiae
                     YHR144c DCD1 deoxycytidylate deaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446616.1"
                     /db_xref="GeneID:2888266"
                     /db_xref="GOA:Q6FT28"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6FT28"
                     /translation="MLVVVSGAQYNGVERVVDILVDGFGFERLSAVDDHELLLEYVTK
                     NYTRNLVLHCDDLELYLKLEKRPFLIHISIEAPLALRLQLSGLTPEEFINVADLDHFK
                     DDKIRLVERAHLKFKLVDCDLSTLDNRLKENIENQLRVLQSQDSLTLVNPPLRPDWDT
                     YFMKLATLAASRSNCMKRRVGCVIVRECRVIATGYNGTPRHLTNCFHGGCPRCNDGDS
                     KNLHTCLCLHAEENALLEAGRDRVGQNATLYCDTCPCLTCSVKIVQTGITEVVYSQTY
                     RMDDASFKVLREAGIKVRQFSFREEPLLVFV"
     gene            complement(<566616..>566828)
                     /locus_tag="CAGL0G05874g"
                     /db_xref="GeneID:2888396"
     mRNA            complement(<566616..>566828)
                     /locus_tag="CAGL0G05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446617.1"
                     /db_xref="GeneID:2888396"
     CDS             complement(566616..566828)
                     /locus_tag="CAGL0G05874g"
                     /note="highly similar to uniprot|P40422 Saccharomyces
                     cerevisiae YHR143wa RPC10 DNA-directed RNA polymerases I
                     II III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446617.1"
                     /db_xref="GeneID:2888396"
                     /db_xref="GOA:Q6FT27"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:Q6FT27"
                     /translation="MSREGFQIPSNLDVAAAGTSHSKTATVKYICAECSSKLSLSRTD
                     PVRCKDCGHRILLKARTRRMVQFEAR"
     gene            complement(<567337..>568221)
                     /locus_tag="CAGL0G05896g"
                     /db_xref="GeneID:2888397"
     mRNA            complement(<567337..>568221)
                     /locus_tag="CAGL0G05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446618.1"
                     /db_xref="GeneID:2888397"
     CDS             complement(567337..568221)
                     /locus_tag="CAGL0G05896g"
                     /inference="similar to AA sequence:UniProtKB:P38844"
                     /note="similar to uniprot|P38844 Saccharomyces cerevisiae
                     YHR143w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446618.1"
                     /db_xref="GeneID:2888397"
                     /db_xref="GOA:Q6FT26"
                     /db_xref="InterPro:IPR026225"
                     /translation="MQFRAATLLVFIFQFLNIFIEANQQIQKRDDDNVRYITSDGVVY
                     KYAIKTSTLAPASVVVYTRYYTTTIVREITLANNEVTTTTEEITSASVSSASVTPSAS
                     SSSVSETTTSKSESAASVSSSISSNNDEESEIPDQSFLDNDSSSVSSYISSMSPETSS
                     STSSSSTMHNSTVSSFMPSSVDNSGSDFSSSSSSSSSSSSSSSSSSRSSSSMSSSISM
                     PISSSSSSSISSCSSSSSFDFDNKSYSISKSDGTCYVYYEDDEYYSTVYLTKPGQSVD
                     AATTIKSTKTVYKTVSAN"
     gene            complement(<569361..>570299)
                     /locus_tag="CAGL0G05918g"
                     /db_xref="GeneID:2888407"
     mRNA            complement(<569361..>570299)
                     /locus_tag="CAGL0G05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446619.1"
                     /db_xref="GeneID:2888407"
     CDS             complement(569361..570299)
                     /locus_tag="CAGL0G05918g"
                     /note="highly similar to uniprot|P38843 Saccharomyces
                     cerevisiae YHR142w CHS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446619.1"
                     /db_xref="GeneID:2888407"
                     /db_xref="GOA:Q6FT25"
                     /db_xref="InterPro:IPR022057"
                     /translation="MGISNFASICSRTPLPLCSVIKSTTHLVLSNSTKIHDFDPQHLN
                     IGILPKCYARSIDIANTTIFGIGNAFINIAALGVILIILYNIRQKYTAIGRSEYLYFF
                     QLTLLLIIFTLIVNCGVSPPGSNSFPYFVAVQIGLAGACCWTLLINGFLGFNLWEDGT
                     TKSMLLVRGFSLCGFMANFLASILTFRTWIENHEIPNTNTTALFVVVYLWNLINLFIF
                     VICQLFVSFFIVRNLWVTGAVLLGVFFFVAGQILTYGFSSQICEGVKHYLDGLFFGSI
                     CNIFTLMMVYKTWDITTDDDLEFSVSIDKNGDVLYN"
     gene            <571868..>572834
                     /locus_tag="CAGL0G05940g"
                     /db_xref="GeneID:2888402"
     mRNA            join(<571868..571871,572518..>572834)
                     /locus_tag="CAGL0G05940g"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_446620.2"
                     /db_xref="GeneID:2888402"
     CDS             join(571868..571871,572518..572834)
                     /locus_tag="CAGL0G05940g"
                     /note="highly similar to uniprot|P02405 Saccharomyces
                     cerevisiae YNL162w RPL41A or uniprot|P02405 Saccharomyces
                     cerevisiae YHR141c RPL41B"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_446620.2"
                     /db_xref="GeneID:2888402"
                     /db_xref="GOA:Q6FT24"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q6FT24"
                     /translation="MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYD
                     RKQSGFGGQTKPVFHKKAKTTKKVVLRLECVNCKTKAQLTLKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            complement(<573685..>574407)
                     /locus_tag="CAGL0G05962g"
                     /db_xref="GeneID:2888014"
     mRNA            complement(<573685..>574407)
                     /locus_tag="CAGL0G05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446621.1"
                     /db_xref="GeneID:2888014"
     CDS             complement(573685..574407)
                     /locus_tag="CAGL0G05962g"
                     /inference="similar to AA sequence:UniProtKB:P38842"
                     /note="similar to uniprot|P38842 Saccharomyces cerevisiae
                     YHR140w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446621.1"
                     /db_xref="GeneID:2888014"
                     /db_xref="GOA:Q6FT23"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:Q6FT23"
                     /translation="MNGNLSLAINVLCLSTSYWGYKWSTQIQLPPTLEKAGHKQFFTN
                     ISLMATMVSNVASILNWCIQRMVGPSKAREDKPFFANLSELVSRHIILPQALVLETVV
                     PLIYWPLRLFAIKLIMQGVADGELSGPLIPISVDIAIHALPFIFLFSDHYLSGYGARF
                     RLSNTTAWFIIVATAMSYYKFLQLIIDPTTGQTYPYPFLDVPEPYKSVIFVITATIAW
                     IFYALYQRFPPRSLLKETIKMD"
     gene            <576662..>577921
                     /locus_tag="CAGL0G05984g"
                     /db_xref="GeneID:2888328"
     mRNA            <576662..>577921
                     /locus_tag="CAGL0G05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446622.1"
                     /db_xref="GeneID:2888328"
     CDS             576662..577921
                     /locus_tag="CAGL0G05984g"
                     /note="some similarities with uniprot|P13130 Saccharomyces
                     cerevisiae YHR139c SPS100 sporulation-specific wall
                     maturation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446622.1"
                     /db_xref="GeneID:2888328"
                     /db_xref="GOA:Q6FT22"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="UniProtKB/TrEMBL:Q6FT22"
                     /translation="MKFEQFIVAIISVISFVSGFPFRRQIAPPLFTNTTIPHNNGTNG
                     TGGGGGQEGGGGQGGGGGSGGGSGGGSGGGSGGGSGGGSGGGSGGGSGGGSGGGSGGG
                     SGGGSGGGSGGGLITSPGSSYCYPSNGHYPGDTITTGRKIGIFYTGGYLANIQHSDVT
                     VERLFNITNTELNITQLYSVAAAVNKTLGNGEYKGVLIVGNNNSLTGLGYFSSILFNT
                     NKTIVISSNSTLGLPIANQSLSTNRGPILTHNDSAVYSGGLPPYKVPIGVLDTNGTAH
                     YFYRGGLPKFFDRGSGLRLNYTNFTDPGAYNKTRTIPTIRIVNQTNVTDDFIRNVAPN
                     LQGLVVNITGTPFTTTGLQSLRYPVMFVKDQQQLAFVSKWNVPTGIIPGGYLSPAQAQ
                     LFLYVAALNNATSPAAWSQWFGNPDII"
     gene            <578746..>579078
                     /locus_tag="CAGL0G06006g"
                     /db_xref="GeneID:2888329"
     mRNA            <578746..>579078
                     /locus_tag="CAGL0G06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446623.1"
                     /db_xref="GeneID:2888329"
     CDS             578746..579078
                     /locus_tag="CAGL0G06006g"
                     /inference="similar to AA sequence:UniProtKB:P38841"
                     /note="similar to uniprot|P38841 Saccharomyces cerevisiae
                     YHR138c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446623.1"
                     /db_xref="GeneID:2888329"
                     /db_xref="GOA:Q6FT21"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:Q6FT21"
                     /translation="MKLIQYLIIGVTLLVCLVAPVMCHAGSYILSFDESSRALPQNVW
                     EKALGFADELGVKITHEYSLIKGFTLDVPEEVLPKLKKKLADLERDYGVKGHLEEDNL
                     VHAFQEHI"
     gene            complement(<579261..>580874)
                     /locus_tag="CAGL0G06028g"
                     /db_xref="GeneID:2888295"
     mRNA            complement(<579261..>580874)
                     /locus_tag="CAGL0G06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446624.1"
                     /db_xref="GeneID:2888295"
     CDS             complement(579261..580874)
                     /locus_tag="CAGL0G06028g"
                     /inference="similar to AA sequence:UniProtKB:P38840"
                     /note="similar to uniprot|P38840 Saccharomyces cerevisiae
                     YHR137w ARO9 aromatic amino acid aminotransferase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446624.1"
                     /db_xref="GeneID:2888295"
                     /db_xref="GOA:Q6FT20"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FT20"
                     /translation="MASCIACDDTYIVFIYIFLHSSFVPIRILQAMTTMIDLEEKFGQ
                     FLSWRMQNRKLVAFWDDEVLGDDVIELTAGMPNEQFFPIKAMDMTIVNKPFESADDTS
                     KHLHCKMSTYEPKSLPIARSFQYNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLS
                     SGSCDSMFKFFECFCDEKSTVLMEEFTFTPVISHVKATGAECIPLKMNLTKDPSTQGI
                     DVDYLTQLLDNWSSGPYKHLNKPRILYTICTGQNPTGVTIPMENRRKIYELAHKHNFL
                     ILEDDPYGYLSFPSYKPEDPLKNDYLEDGFTVEKYTNEFLVDSFLTIDTDARVIRMET
                     FSKVFAPGLRLGFIVANKYIISNLLEYAEITTRAPSGVSQAVLYNTLETMALYQDGDD
                     KEDPEKKQEALFQGWMHWIMKVAAEYTHRRNITLKALYETDAYKNGLFTVIEPSAGMF
                     VGVKIKWDKAPGEIGNIPEQMKKLDRFLVQNGIKTVLGYRMGVSSELSHDNSDFLRVT
                     IAYAKDDQQLVEASHRIGSGIEQFFKELK"
     gene            <581306..>581530
                     /locus_tag="CAGL0G06050g"
                     /db_xref="GeneID:2888327"
     mRNA            <581306..>581530
                     /locus_tag="CAGL0G06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446625.1"
                     /db_xref="GeneID:2888327"
     CDS             581306..581530
                     /locus_tag="CAGL0G06050g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446625.1"
                     /db_xref="GeneID:2888327"
                     /db_xref="GOA:Q6FT19"
                     /db_xref="UniProtKB/TrEMBL:Q6FT19"
                     /translation="MSDKHRKSFTQVCMEMIRRKKSHEGKQANATLVVDKSKDLAWVT
                     DTTSITSITTSAFESSSDEEDENPYRYALR"
     gene            complement(<581690..>583036)
                     /locus_tag="CAGL0G06072g"
                     /db_xref="GeneID:2888130"
     mRNA            complement(<581690..>583036)
                     /locus_tag="CAGL0G06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446626.1"
                     /db_xref="GeneID:2888130"
     CDS             complement(581690..583036)
                     /locus_tag="CAGL0G06072g"
                     /inference="similar to AA sequence:UniProtKB:P38836"
                     /note="similar to uniprot|P38836 Saccharomyces cerevisiae
                     YHR132c ECM14 involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446626.1"
                     /db_xref="GeneID:2888130"
                     /db_xref="GOA:Q6FT18"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:Q6FT18"
                     /translation="MLLQWVFVVLALAWGPAAAVPSESDFSDYKVVRLYLEDSGYEDT
                     HRLLRGVFGDLQDVDVWTHAQKFVDVRVSKGTEISVDHDVIIADLDSAIKDTYGSNNG
                     SNDDDGDVDGAFNGRDQKVFDAGELVGTEEFFFDQYQPLDKIYSWMERLQESFPDIIN
                     IEVVGRTYEGRELRALHLCANNNQTNPEKKTIVITGGVHAREWVSVSSACWVVAQLVG
                     RYALGDQKEIKYLENLDFLVIPVFNPDGYEYTFTTNRLWRKNRQQTYIPVCKGIDIDH
                     SFGYQWESTHAYPCSEEYSGEEPFEAIEAKSWNDFLSTVKGEYKVYGYLDLHSYSQEI
                     LYPYAFSCDALPRDLENLLELAYGINKAIRYQSGRNYDVVAACKDRGADLTPELGAGS
                     ALDFMYHQRAHWAFQFKLRDTGNHGFLLPPRYIRPVGKEIYAGLNYFCDFLLDPEI"
     gene            <583297..>583713
                     /locus_tag="CAGL0G06094g"
                     /db_xref="GeneID:2888312"
     mRNA            <583297..>583713
                     /locus_tag="CAGL0G06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446627.1"
                     /db_xref="GeneID:2888312"
     CDS             583297..583713
                     /locus_tag="CAGL0G06094g"
                     /note="highly similar to uniprot|Q9P305 Saccharomyces
                     cerevisiae YHR132wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446627.1"
                     /db_xref="GeneID:2888312"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:Q6FT17"
                     /translation="MSNLRNEIKEDSISPTNSELELDKHGVDKNGVDVSRLSEQELKL
                     YKMYGKLPSKKDIFKHRMAGRKYFDSGDYALKKAGVIRSDDVIDENNSSNNLPVTNPS
                     GLRESIIRRRMSSSAGDHVSRQDSISSGPPPRSPNK"
     gene            <584454..>585353
                     /locus_tag="CAGL0G06116g"
                     /db_xref="GeneID:2888313"
     mRNA            <584454..>585353
                     /locus_tag="CAGL0G06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446628.1"
                     /db_xref="GeneID:2888313"
     CDS             584454..585353
                     /locus_tag="CAGL0G06116g"
                     /inference="similar to AA sequence:UniProtKB:P38838"
                     /note="similar to uniprot|P38838 Saccharomyces cerevisiae
                     YHR134w WSS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446628.1"
                     /db_xref="GeneID:2888313"
                     /db_xref="GOA:Q6FT16"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:Q6FT16"
                     /translation="MQHPHIRNIAVLQRKPGKEDALKLLKDIADAVSLLMRENKFKVG
                     TLVEFYPRDRSLLGMNVNHGQKIMLRLRDPLDEFRFLPWESLIGTMLHELTHNLHGPH
                     DQKFYSKLDELSGRQWCIQQLGLKDNFMTSGNRLGGRGFRDGPTPRTTNSRGNKIEKI
                     RNKGVRLGSLSDNLNGSLNTSRMLKPAQMAAMAATRRAEADKKWCVETNQEEKIPDDS
                     SLEIIVLDGDEKEDMGSTGDVGSFTDKSKKQLEHKQALTIIELNDDQDNNDVRKVDEP
                     FQAKKKSTFEGEDVLLIDLTSDE"
     gene            complement(<585585..>587204)
                     /locus_tag="CAGL0G06138g"
                     /db_xref="GeneID:2888387"
     mRNA            complement(<585585..>587204)
                     /locus_tag="CAGL0G06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446629.1"
                     /db_xref="GeneID:2888387"
     CDS             complement(585585..587204)
                     /locus_tag="CAGL0G06138g"
                     /inference="similar to AA sequence:UniProtKB:P23291"
                     /note="similar to uniprot|P23291 Saccharomyces cerevisiae
                     YHR135c YCK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446629.1"
                     /db_xref="GeneID:2888387"
                     /db_xref="GOA:Q6FT15"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FT15"
                     /translation="MSRYQNSPAVTAANTAMAVNNLTNGGYPAMNANAPYNGTPSNRS
                     SSNMTSRDDSTIVGLHYKIGKKIGEGSFGVLFEGTNMINGMPVAIKFEPRKTEAPQLK
                     DEYRTYKIMAGTPNVPQAYYFGQEGLHNILVIDLLGPSLEDLFDWCGRKFSVKTVVQV
                     AVQMITLIEDLHAHDLIYRDIKPDNFLIGRPGQPDENKIHLIDFGMAKQYRDPKTKQH
                     IPYRERKSLSGTARYMSINTHLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNK
                     QKYEKIGEKKRTTNVYDLSNGYPVQFGRYLEIVRSLSFEETPDYQGYRKLLLSVLDDM
                     NDSADGTYDWMKLNGGRGWDLTINKKPNLHGYGHPNPPNDKRRHKNKMTNPLQQLAGQ
                     QQGQYPDQTHHNQIQSHQAGIGGNADNANQMQNKRNLDPTSYEAYQQQLQHKYNQQTQ
                     RQQRQQPPAMQGQRVQDNGGLRNYNNAQAQDLQGNRYRQQQEPMVQPPNNPAQATPNN
                     RQQFQQHTEQVEQDYTTTSSEKGFFQKLGCC"
     gene            <587971..>588246
                     /locus_tag="CAGL0G06160g"
                     /db_xref="GeneID:2888111"
     mRNA            <587971..>588246
                     /locus_tag="CAGL0G06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446630.1"
                     /db_xref="GeneID:2888111"
     CDS             587971..588246
                     /locus_tag="CAGL0G06160g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446630.1"
                     /db_xref="GeneID:2888111"
                     /db_xref="GOA:Q6FT14"
                     /db_xref="UniProtKB/TrEMBL:Q6FT14"
                     /translation="MLSQLQSMKSKLKKKGFHFFREVKGETEITSVDKSLHAQYHKQN
                     PILVYIIFNPWELKAAPATQEWRHFAEFVPYTLSLDSENHIYLTIRA"
     gene            <589050..>591095
                     /locus_tag="CAGL0G06182g"
                     /db_xref="GeneID:2888314"
     mRNA            <589050..>591095
                     /locus_tag="CAGL0G06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446631.1"
                     /db_xref="GeneID:2888314"
     CDS             589050..591095
                     /locus_tag="CAGL0G06182g"
                     /inference="similar to AA sequence:UniProtKB:P38835"
                     /note="similar to uniprot|P38835 Saccharomyces cerevisiae
                     YHR131c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446631.1"
                     /db_xref="GeneID:2888314"
                     /db_xref="GOA:Q6FT13"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FT13"
                     /translation="MDNRDVHYLDKSGDFKSPTSTIASGNSLDDLTSSSTSTRSHTPE
                     EPVTSTYLEIIDGEPASPPDYDEVNYNRHVTFPIWEDLTPCSMTEKPPAYHPTVYNVA
                     IVSVKLEWLSPFEPSPNRSWRTFIMEINSTQINFYALEPEFHRLVKNYYNLKYDDGAK
                     SLAKGILSLGNSKKKNDNKIVDTEPHWKRLNAKLERNYSKYLSDARLYRSFTLQYARM
                     GIPTDYRKSAHALRLRCEAEQFLVAFDNVDDLINWSMYINMGISVALDLDCRQLPNYR
                     VVPRRRRPHHTRRQKRTPLHSLVDNSSSSFFSKEFFLASPRGLYLHGATAMSSPPPRT
                     RSSSSATVQSTVPKRVASQPISRNSSSGRIVSNGNNSSFGKFFDMFKSKRSKQDFKSL
                     QSANVTGLKVTLESKRDQSAKFELGSDLEVMNNSIAEEPVKEFPSDRCEEMLKRHVNM
                     MERELLCYSTQEPEFSEAGREVNNPGSSSHSNRNFAEAEHVDSNEDEDEDDDYTLDDD
                     YEDGQRLDPVVSIYAEEGLVHESESDYYYEQRRLTRSRAASTASNMISHADADDVKWM
                     PPQKILSRRRYVKDSLRCIKGFVEHSSWMGRVVCCPTGPPSFKTNNDLVLLNGKKIDE
                     KTVGNSRNKIVNSSGDKSYWKTKNHFLQLYIIEPTGYIPITALEANEARKKIKTVLC"
     gene            591492..591563
                     /locus_tag="CAGL0G06204r"
                     /db_xref="GeneID:2888076"
     tRNA            591492..591563
                     /locus_tag="CAGL0G06204r"
                     /product="tRNA-Arg"
                     /note="tRNA Arg (TCT) cove score=66.88"
                     /db_xref="GeneID:2888076"
     gene            <592179..>596135
                     /locus_tag="CAGL0G06226g"
                     /db_xref="GeneID:2888077"
     mRNA            <592179..>596135
                     /locus_tag="CAGL0G06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446632.1"
                     /db_xref="GeneID:2888077"
     CDS             592179..596135
                     /locus_tag="CAGL0G06226g"
                     /inference="similar to AA sequence:UniProtKB:P07866"
                     /note="similar to uniprot|P07866 Saccharomyces cerevisiae
                     YAL024c LTE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446632.1"
                     /db_xref="GeneID:2888077"
                     /db_xref="GOA:Q6FT12"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /translation="MDIFSQRDYYPIPSDDVIKYKHMVHKKWNKNEVIQADIPSIIVH
                     LSSPVDSVDYKGFSDFFLFYRNFLTPAELYDYLILRFKWCMREIESYQHQRSGDNQLR
                     IGKVALIRTFVLLRHGILNHFADDFLLNENLRLRLISFFNEDIKSDMKVIVSCLISLK
                     KAWLHAMKLNWDNVLFNEPAFSAYTDWIDYKIKDVSQLDMAQKRNSRFSYHGIQSISN
                     PDMRNRSILSIYKSDNFDHMVQSNSNKISRNRTPSTLLFQKDSSNSEMATVYSNRKGA
                     QKKTIALPNILTSELDRKDVMSNVTRMSHIIQDAKTLRSSDVNKIIPSTPAKKVELIL
                     NTIYSPDCLESENIQESLNQDTSSTQKSFPKGIMSLLARWKKNHKIADPKIRKPVGFT
                     NKREAELDNFVKYVISISSLTNKEEDLKRLNENLDSKFDILSARTIDEVEYLFRLESK
                     LLAQLSTMQKTTRTLSNDEFNDVNVPNNIDSKQISAMDNLDLFRTVNGVARSVISLTN
                     SVNKLNNLSDHSVLDRRRVKSSMPNFYNRERSLSGLSNYAGLQFYDASSEMSAEDDKP
                     QKLVFHDGVDELKNHLTQTFTKPGSISNSSPLKKVLPNLFEHPSVDSLASGDACSYVT
                     YDSQLSQMGTVKKSMKDETSRYSNYEGPVLKKKVAYDNLREFTFEDSKEIIKNDTSSL
                     IDILNSPVTPDLSILPQTPTGKGSVQHKKKEKSESIISPASGRISIAKSHHMSLSPNL
                     TKLKEDDEYVKGDNSLGQAEDELIRLEKNLRDSKLENYNTVVAGNLGAGSGSSTPLGD
                     SPTNVFELPSSINMVESDMDTESFESSFEQRQPTNLREQYFKSIGSPETASPRKVNSN
                     NAYSQVSSQMSPSLANKYLFSPDNESLDIASPVKNVEDLKSRFLKGNNQSASSSQIGA
                     SINTSVTATPKNNDMFGSDFDKNGLKNIMTASEEKLSKDPVELAMMKLEGTFKKNKSG
                     NNTGYSSDLEKEVDILNIANLPEMNANPSDKRKSLMLDRRRQTMFNIGPSIYPSNTND
                     EGYDEESITDDKIWSLIAQYHIDDENLLAKNHANHVPFILMYESKDVAQQFTLIEREI
                     LSEIDWKDLLDIKLLYKGPNLTSWLQLLIQNQEFTGIDLAVARFNLTVDWAISEIVLT
                     TDLKMRRNTIERFIHVAEHCRKLQNFNTMMQIILALNSVVVQKFTEAWRLIEPGDMLL
                     WEDLRKIPALDWNYHALRTMMKTVDPLKGCIPFIVVYLSDLTINSEKNTWIVEKRVVN
                     YSKFSTCVQIVKNFIQKVQWSSFYDIIPIQELLSKCIYISSLSQDEIEHLTAEFAR"
     gene            <596704..>597597
                     /locus_tag="CAGL0G06248g"
                     /db_xref="GeneID:2888129"
     mRNA            <596704..>597597
                     /locus_tag="CAGL0G06248g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_446633.1"
                     /db_xref="GeneID:2888129"
     CDS             596704..597597
                     /locus_tag="CAGL0G06248g"
                     /note="highly similar to uniprot|P10962 Saccharomyces
                     cerevisiae YAL025c MAK16"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_446633.1"
                     /db_xref="GeneID:2888129"
                     /db_xref="GOA:Q6FT11"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q6FT11"
                     /translation="MSDEIVWQVINQQFCAYKVKTDKGQTFCRNEYNVTGLCSRQSCP
                     LANSKYATVKSENGRLYLYIRTVERAHTPAKWWEKIRLSKNYSKALKQIDDHLLYWNK
                     FSIHKCKQRFTKLTQVAITERRLAMREMERHYVGVAPKVKRREENRERKALAAAKIEK
                     SIEKELLDRLKSGAYGDKPMNVDEKIWKKVMGHLKDENDQEEEEDWESEEEEESDEGE
                     VEYVEDDGEAEFVDMEDLEQWLGDGNGDHSDSDDSDEESSDDDENTPKRKKAKLSRRP
                     KIEIEYEEERAHQELPQEAAH"
     gene            <598357..>602343
                     /locus_tag="CAGL0G06270g"
                     /db_xref="GeneID:2888146"
     mRNA            <598357..>602343
                     /locus_tag="CAGL0G06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446634.1"
                     /db_xref="GeneID:2888146"
     CDS             598357..602343
                     /locus_tag="CAGL0G06270g"
                     /note="highly similar to uniprot|P39524 Saccharomyces
                     cerevisiae YAL026c DRS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446634.1"
                     /db_xref="GeneID:2888146"
                     /db_xref="GOA:Q6FT10"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FT10"
                     /translation="MSSRMGKGTRVPTGDTLFDIDFNDGNKIRASENERTTSHGFPEE
                     IIDLDNDSIENDLHDNPFSEYGGEGDWNTNRFDRINNQPHLTQIGNKGNVFTRMGRSI
                     KGIFTFQSNSEPQSFEMSNYNTVSTGEMDDNFQKSRNKFDIKILFNKYLLRKNTSDGQ
                     DSGEPREIHISDRESNNRFGYIDNHISTTKYNAATFLPKFLFQEFSKYANLFFLCTSA
                     IQQVPHVSPTNRYTTIGTLMVVLIVSAIKESVEDLKRASSDNELNNSKAEIYFEAEGD
                     FIQKRWIDIKVGDIIRVNSEEPIPADIIILSSSEPEGLCYIETANLDGETNLKIKQAR
                     TETAKIMDSRELRNIKGVISSEQPNSSLYTYEGTLEMNGTKIPLSPEQMILRGATLRN
                     TGWIFGIVIFTGHETKLMRNATATPIKRTAVEKVINMQIIALFTVLVVLILISSIGNV
                     IMSTADAKHLSYLYLQGTNKAGLFFKDFLTFWILFSNLVPISLFVTVELIKYYQAFMI
                     GSDLDLYYEETDTPTVVKTSSLVEELGQIEYIFSDKTGTLTRNIMEFKSCSIAGRCYA
                     EHIPEDKAATFEDGIEVGYRSFDDLKKQLTTNSDDCKIIDEFLTLLATCHTVIPEFQA
                     DGSIKYQAASPDEGALVEGGALLGYKFLIRKPNSVTILINEEEEREYQLLNICEFNST
                     RKRMSAIFRFPDDSIKLLCKGADSVILERLSETGNFYVDATTRHLEDYATEGLRTLCL
                     ATKDIPEDEYNAWNKKYMDAATTLDHRAEKLDAVAEEIESGLTLIGATAIEDKLQEGV
                     PDTIRTLQEAGIKIWVLTGDKQETAINIGMSCRLLSEDMNLLIISEETKEATRRNMEE
                     KLAALHEHSLSEHDMNTLALVIDGHSLSFALEADLEDYFLAIGKMCKAVICCRVSPLQ
                     KALVVKMVKRKTNSLLLAIGDGANDVSMIQAAHVGVGISGMEGMQAARSADISVGQFR
                     FLKKLLLVHGAWSYQRISVAILYSFYKNTALYMTQFWYVFANAFSGQSIMESWTMSLY
                     NVFFTVLPPFVIGVFDQFVNSRLLERYPQLYKLGQKGQFFSVSIFWGWIVNGFYHSAV
                     VFVGTILFYRYGFALRKHGETADHWSWGIAIYTSSVIIVLGKAALVTNQWTKFTLFAI
                     PGSLFFWLIFFPIYGSIFPYAKISREYFGVVEHTYGSATFWLTLIVLPTFALTRDFIW
                     KYYKRMYAPESYHLIQEMQKYNVSDYRPHVQHFQNAIRKVRQVQRMKKQRGFAFSQAE
                     EGQEKIIRMYDTTQKRGKYGELHDASADPFSDTHKLVPENNEENPFSDAAQNNQSDQN
                     SFGESLLG"
     gene            complement(<602454..>603215)
                     /locus_tag="CAGL0G06292g"
                     /db_xref="GeneID:2888147"
     mRNA            complement(<602454..>603215)
                     /locus_tag="CAGL0G06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446635.1"
                     /db_xref="GeneID:2888147"
     CDS             complement(602454..603215)
                     /locus_tag="CAGL0G06292g"
                     /inference="similar to AA sequence:UniProtKB:P39735"
                     /note="similar to uniprot|P39735 Saccharomyces cerevisiae
                     YAL027w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446635.1"
                     /db_xref="GeneID:2888147"
                     /db_xref="InterPro:IPR021624"
                     /db_xref="UniProtKB/TrEMBL:Q6FT09"
                     /translation="MVQNIAYIKVAKDSILPVRVHINRRQILSTATEESKVQAPLLSN
                     NTIVCLKSPLTKIYLSNTDLKNLVTEMEDDIILILYELSSPAMKQNIFSKIRVGQVYD
                     FDEDTLKKFPQSIQGSLKESNLTSLKRVGKMKYKLTYRKNWDVDIFISNINKLETIRT
                     YLIFKDQYPQWNEYPCLQKQQSLLVMGQKLSESTNQDPIILQEEEELNLNYEQSAEDQ
                     PNNEKPEIAFTYEPQLSLIQCLDLYILKRPKRKRS"
     gene            complement(<603668..>605629)
                     /locus_tag="CAGL0G06314g"
                     /db_xref="GeneID:2888419"
     mRNA            complement(<603668..>605629)
                     /locus_tag="CAGL0G06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446636.1"
                     /db_xref="GeneID:2888419"
     CDS             complement(603668..605629)
                     /locus_tag="CAGL0G06314g"
                     /note="some similarities with uniprot|P39734 Saccharomyces
                     cerevisiae YAL028w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446636.1"
                     /db_xref="GeneID:2888419"
                     /db_xref="GOA:Q6FT08"
                     /db_xref="InterPro:IPR025752"
                     /db_xref="UniProtKB/TrEMBL:Q6FT08"
                     /translation="MDLLIQRMENPNMKHQPKIPFTDINTRIHRNKLAMKSANEEGSG
                     QDSDSGNDEAMQDHLLAKADESKRHVKRANTIGITPKGNLNVHRPRRGTLIISDDEDG
                     VSMHSASFTNMDDINGIDYSKVNTNNNLNSNKKRLDTKKIFEPYVQRSVSDPKRSFKA
                     GSNTDIEPKLGNSKPMIIRQVTASNLAALADGKNRLVEKKMLKRPTIPDYTSVNTGAF
                     SECMFNTELEKQYNNNLSKTTKTEKPTPNRLGDQQEEVGNGGQATLFTADKFIKSPVK
                     SLDNEERPELSNGQNQSKNQNQTQFHKEHKKHRHQKSFSQSYGSNDQKRLVNQFLQSI
                     EKSGNNSALSSNNASAYGSTLSVGKNGVFNIPQHEQMPDLMDYSSNLSLQSLLYHDLA
                     DPSGSKRKYSKVYSNPNMRPGSATPFSYSSASLTSNSDDSRSAIGSYRSGLATSSFFF
                     SNAKLTSKEKIKNSEIINSNANDSNMFLGTNETDYYQQHINSRLTKLESQIKNDLKSV
                     ILKDELELKNNITSFDNLTSDLQNLKSQILGLKNTIANEYLTVLKADFDENNPESFES
                     QLRKTVEENVKHLEFLENKMSECQSQLVDQKETMRKMESLLYLENSLMVSKKNTGLAY
                     KYRYMLYDILTLGFLVLIGYYLKAYFWKV"
     gene            <607817..>612073
                     /locus_tag="CAGL0G06336g"
                     /db_xref="GeneID:2888418"
     mRNA            <607817..>612073
                     /locus_tag="CAGL0G06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446637.1"
                     /db_xref="GeneID:2888418"
     CDS             607817..612073
                     /locus_tag="CAGL0G06336g"
                     /inference="similar to AA sequence:UniProtKB:P32492"
                     /note="similar to uniprot|P32492 Saccharomyces cerevisiae
                     YAL029c MYO4 or uniprot|P19524 Saccharomyces cerevisiae
                     YOR326w MYO2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446637.1"
                     /db_xref="GeneID:2888418"
                     /db_xref="GOA:Q6FT07"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FT07"
                     /translation="MTFEVGTRCWYPSENGWIPCEVSKNEPRDGKYHLQFTLEDGSLI
                     DLDTDSIDYNDSLSNEGSPMPVLRNPHSRESTQDLTTLSYLNEPAVLHAIKLRYMNKE
                     IYTYSGIVLVATNPFAQMEELYSNDMIKKYSRITSREELDPHLFAIAHDAYTTMDSQS
                     RNQTIVVSGESGAGKTVSAKYIMRYFASLDDNNAAVVSEMSDIEKKILATNPIMEAFG
                     NAKTIRNDNSSRFGKYLQIMFDAKKNIIGAQIRTYLLERSRLVFQQQSERNYHIFYQL
                     LAGLPAAIKEELCISNPEQFYYLNQGSDPRIDGVDDAQEFQDTIAALSVIGINDSLQM
                     EVFKILAGLLHIGNIEIKQSSTSSSISPDEPNLKLACELLGLDPYEFSKWLTKKEITT
                     RSEKIVTNLKKEQALVVRDSVSKFIYSLLFDWLVNQINTMLHGAEVSDQVRSFIGVLD
                     IYGFEHFEMNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVREKIEWSFIEFNDNQPC
                     IDLIENRLGILSLLDEESRLPSGTDESWTQKLYQTLDKPPMNQVFSKPKFGQTKFVIS
                     HYADNVEYDVEGFIEKNRDTVSESLMNVLKNSQNDTLISLTKPTEETSTPPPQTASIS
                     RPKLINKKPTLGFMFKKSLGELMEIINNTNVHYIRCVKPNSSKVAWEFDDGMVLSQLR
                     ACGILETIKISCAGFPSRWSFQEFIDRYYMLVDTTLWSDVASSESNAESSIKFCKEIL
                     GATELSHEKCQIGQTKIFFKSGVLAELESLRLKKMKGIAITIQKKIRAYKIRTWYLEI
                     VNCVRDLQNRIRSKLVRLDVEHQLKTKLALMMQATLRSYRVRIRVAKELDDIILLQCK
                     FRTVLAQRYLQELKRNKASIMIQSYIRGYKHKTQYRYFRKNYQAIQALSRSMLARSLM
                     LKLRSESEVTQINGVTYTELHSIVKDIHDSMTSNNQIIKELDEFNGVIDTQKSLTFTD
                     LSAKAEQLNSDAQKIIIKHSNQEKQIKDLKESKGDVDSTLTNIKKVHNNIKSLDKIML
                     EDAHFQTGRTIISGLGIEHSSQYENINDNENNCRPNDYNLLQIFRNNHLIVKEIMKEE
                     FATLEGSFGTISFILGEMIKLKQFLSAKQFISTLFESIHSNVIEESSYDKKLKSGFQW
                     FSVAFTNLSVLRNSEFSLGKETSKSLSKLLADYENDLSKMLRSWILSILNDMFRENDK
                     LFNDFASVEISNVISFKILQQKIKYIQSKMGTSAIEKSLFGKLIETLIQYLNLNVANH
                     VLIKIPSVDFETGIILEKNLDTLLEYCEELKLSNCRNSTRQTSQMSKLLQLSISSVEE
                     LRVVCQYCFALNLTQIHALLAKQKASSDEKPMPYIVVKKVQSWAQETKKDTSKNSDII
                     FRLDSDIVKCEIDTSKEIAIPELHIPEDMTLVKEIETLSQ"
     gene            complement(<612827..>613168)
                     /locus_tag="CAGL0G06358g"
                     /db_xref="GeneID:2888179"
     mRNA            complement(<612827..>613168)
                     /locus_tag="CAGL0G06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446638.1"
                     /db_xref="GeneID:2888179"
     CDS             complement(612827..613168)
                     /locus_tag="CAGL0G06358g"
                     /note="highly similar to uniprot|P31109 Saccharomyces
                     cerevisiae YAL030W SNC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446638.1"
                     /db_xref="GeneID:2888179"
                     /db_xref="GOA:Q6FT06"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:Q6FT06"
                     /translation="MSSSVPYDPYVTPEQDETNEQSQSKAAALKAEIDDTVGIMRDNI
                     NKVAERGERLTSIEDKADNLAISAQGFKRGANRVRKQMWYKDLKMKFCLFVVIICLLV
                     AIVVPIAVHFS"
     gene            <615498..>617417
                     /locus_tag="CAGL0G06380g"
                     /db_xref="GeneID:2888177"
     mRNA            <615498..>617417
                     /locus_tag="CAGL0G06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446639.1"
                     /db_xref="GeneID:2888177"
     CDS             615498..617417
                     /locus_tag="CAGL0G06380g"
                     /inference="similar to AA sequence:UniProtKB:P41913"
                     /note="similar to uniprot|P41913 Saccharomyces cerevisiae
                     YOR355w GDS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446639.1"
                     /db_xref="GeneID:2888177"
                     /db_xref="GOA:Q6FT05"
                     /db_xref="UniProtKB/TrEMBL:Q6FT05"
                     /translation="MALANSRPMQIPNMESDLIHNTTSPVFQPTSLMSPLSTTSDISM
                     NMGMNIPMGMAMGMSIDPNDVNNSPNSINSQLLDHSTNDLMSGINSGNGNGTDMSMSM
                     SMSLGLSPVSLDMGNGIKNKNGNNNLITPQQQEANAKATASNKKKDSSKKDGTNNSKD
                     NNGSSSNAGPNNIMIELSKMIPVTGERPKPTDRSEPLDDDVLYAVFLILWEIDADQQG
                     MTVKQICDHLLTRHPEMSNLSTKLSNLISAKLNAYVKKTEKGEKTMKYALSREWSNSS
                     PRRMLYMYRGILSENYKEHALAASEKLKKQQELMGLSAEKKKAGSIDLSADSPLTDMS
                     SSSETSINSGIHSNGSVDPAAMPFSKDMNNGFTFSPDFNIPYSTSPVSVNLSPAVDEL
                     DGLSPTSTPRKLNISKKMNKNDESTKGNLKTGTKNGTDNQTVSGPASKKQKIKSSSSS
                     ASFQQLGERLTTNGNDKNSSSGGQPSANLSLNAIRHSAQGGSSSGSNYITAAAAAPRL
                     SRSASRGSFKSSSQASASALAAIQKVISTQLPIEFSQASTPSVSRSSSSIGGSAGGKS
                     PTSSTSSDSSGGSNITTPSGDESTPKNIYCTNNFSYEHPANAMWFKIVREGFLTSDID
                     PPESLSLEDLENIMS"
     gene            <618925..>620898
                     /locus_tag="CAGL0G06402g"
                     /db_xref="GeneID:2888178"
     mRNA            <618925..>620898
                     /locus_tag="CAGL0G06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446640.1"
                     /db_xref="GeneID:2888178"
     CDS             618925..620898
                     /locus_tag="CAGL0G06402g"
                     /inference="similar to AA sequence:UniProtKB:Q08822"
                     /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
                     YOR356w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446640.1"
                     /db_xref="GeneID:2888178"
                     /db_xref="GOA:Q6FT04"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="UniProtKB/TrEMBL:Q6FT04"
                     /translation="MLGLGVKNNSVLRRQGTRYVHQILKHQNKGNRNALKAITLGSHN
                     RLARTCNVQLSKRFSTTRATSASEEVAFKNLSQEQRDILTQERAVDNVDVCIVGGGPS
                     GLATAIKLKQLDNEHGSGNLRVVVLEKASDMGLHIVSGAILEPKVWRELFPESEFYNE
                     DGSGIPLPPDIATPVTKGQLKYLLNGSIGLPMPEPPAMVNEGNYIVSLNRVVSYLAEK
                     AEEIGVEIYPGISVSEVIYDDSGNNVIGVASKDLGISKRGLPKDTFERGMEFHARTTV
                     FAEGCRGSLTGEVIDKYNLRHGRENQTYGLGIKEVWEVSSEKFQKGFASHTMGYPLSN
                     SVYGGGFMYHFGDGLVAVGLVVGLDYKNPYVSPYKEFQKMKHHPFYANVLEGGKCISY
                     AARALNEGGLQAIPKLHFPGGVLVGASAGFMNVPKIKGTHTAMKSGLLAAESIFQSLK
                     DRTPIEEVESLADEEVVDLVDYEKAVKSSWITEELSIVRNIRPSFTSKLGGLGGMMYS
                     GLDSYILRGHVPWTFKFHKSDASVTGDARDYKPINYPKPDGKLSFDIMTSVSRTGTYH
                     DEDERSHLRVPNQDLTAYATKSYPKFKGVEERFCPAGVYEFIEDPSSPIGVKFKINSQ
                     NCIHCKTCDIKSPIEEIKWVVPEGGDGPKYTLS"
     gene            complement(<621136..>621630)
                     /locus_tag="CAGL0G06424g"
                     /db_xref="GeneID:2888176"
     mRNA            complement(<621136..>621630)
                     /locus_tag="CAGL0G06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446641.1"
                     /db_xref="GeneID:2888176"
     CDS             complement(621136..621630)
                     /locus_tag="CAGL0G06424g"
                     /note="highly similar to uniprot|Q08826 Saccharomyces
                     cerevisiae YOR357c GRD19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446641.1"
                     /db_xref="GeneID:2888176"
                     /db_xref="GOA:Q6FT03"
                     /db_xref="InterPro:IPR001683"
                     /translation="MSGKREFKSFGSTEETMFSQHHKIPSTSEMYAEPENFLEIEVRN
                     PKTHVPNGVDQRGMYTDYEIICRTNLPNFHKRASRVRRRYSDFEFFRKCLLKEISMLN
                     NPRVVVPHLPGKIYLSNRFSDEVIEERRQGLNRWMQIVAGHPLLQSGSKTLIRFIEDD
                     KFVG"
     gene            <622068..>622394
                     /locus_tag="CAGL0G06446g"
                     /db_xref="GeneID:2888175"
     mRNA            <622068..>622394
                     /locus_tag="CAGL0G06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446642.1"
                     /db_xref="GeneID:2888175"
     CDS             622068..622394
                     /locus_tag="CAGL0G06446g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446642.1"
                     /db_xref="GeneID:2888175"
                     /db_xref="GOA:Q6FT02"
                     /db_xref="UniProtKB/TrEMBL:Q6FT02"
                     /translation="MLILTTTWNHIARQDSCNHLSNRCMKCVISFYTLEDMLAIVNIL
                     DYTWYANAGVLRYAYQRTDSDVKPRLDSLYHPSPPHFGLEDKHTNIQTYKQHLSYTPP
                     PRHQTR"
     gene            <622994..>624763
                     /locus_tag="CAGL0G06468g"
                     /db_xref="GeneID:2888222"
     mRNA            <622994..>624763
                     /locus_tag="CAGL0G06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446643.1"
                     /db_xref="GeneID:2888222"
     CDS             622994..624763
                     /locus_tag="CAGL0G06468g"
                     /inference="similar to AA sequence:UniProtKB:P53932"
                     /note="similar to uniprot|P53932 Saccharomyces cerevisiae
                     YNL095c and similar to uniprot|Q99252 Saccharomyces
                     cerevisiae YOR092w ECM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446643.1"
                     /db_xref="GeneID:2888222"
                     /db_xref="GOA:Q6FT01"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q6FT01"
                     /translation="MTVSLGQAIYVAVKPIFKIYLIIGVGFGLARYGILSVEATRIVS
                     DIVLTVLIPCLAFSKIVPYIEGQDIKQVGIICLSSVLVFGTGLFMAFLVRTFLPVPKR
                     WRGGILAGGMFPNISDLPIAYLQSMDNGFIFTEEEGNKGVASVIIFMTMFMICVFNLG
                     GFRLIESDFHYNDIENADQESTSSSHDDDEALSKKRVGDTSTIPVVSNNNSNYELKSR
                     TKMSSNIENDVNITSSSSANTDDINSLHSQGTRSTEASIPSTFSYTTEAQDLGSAQPR
                     HYSRELSRTDNSILSYRNSTNRRNTDGITRVRSLDLRDGPPQDMNDIIKEYSNVDQFG
                     HIRENPYYKSPEPHADGQSEEPEYGLGRILTSDATVTTKDIRKSGNFLPEKLRKFSVV
                     PLIVFFLKNCLRPASIAVFISLVVAFIPWVKALFVTTEHTPKIHQGPDGQPVLSFLID
                     FTSYVGSAAVPFGLMLLGATLGRLKLGKLYPGFWKSAVVLVILRQCVMPIFGVLWCDR
                     LVKAGWLNWESDKMLLFVIAINWGLPSMTTIIYFTASYTPLDCKDPIQMECVSFFLML
                     QYPLLIVSLPFLVTYFLKVQIKV"
     gene            <625968..>627198
                     /locus_tag="CAGL0G06490g"
                     /db_xref="GeneID:2888104"
     mRNA            join(<625968..626108,626773..>627198)
                     /locus_tag="CAGL0G06490g"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_446644.1"
                     /db_xref="GeneID:2888104"
     CDS             join(625968..626108,626773..627198)
                     /locus_tag="CAGL0G06490g"
                     /note="highly similar to uniprot|P26786 Saccharomyces
                     cerevisiae YOR096w RP30 or uniprot|P48164 Saccharomyces
                     cerevisiae YNL096c RPS7B"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_446644.1"
                     /db_xref="GeneID:2888104"
                     /db_xref="GOA:Q6FT00"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:Q6FT00"
                     /translation="MSAQAKILSQAPTELELQFAQAFIDLENSSPELKAELRPLQFRS
                     VREIDVAAGKKALAVFVPVPSLTGYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPS
                     RKSRQTQKRPRSRTLSAVHDKILEDLVFPTEIVGKRVRYLVGGNKIQKVLLDSKDIQQ
                     IDYKLESFQAVYNKLTGKQIVFEIPETH"
     gene            complement(627757..627875)
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0G06512r"
                     /db_xref="GeneID:2888223"
     tRNA            complement(join(627757..627801,627837..627875))
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0G06512r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2888223"
     gene            <628181..>629131
                     /locus_tag="CAGL0G06556g"
                     /db_xref="GeneID:2888221"
     mRNA            <628181..>629131
                     /locus_tag="CAGL0G06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446645.1"
                     /db_xref="GeneID:2888221"
     CDS             628181..629131
                     /locus_tag="CAGL0G06556g"
                     /inference="similar to AA sequence:UniProtKB:P50947"
                     /note="similar to uniprot|P50947 Saccharomyces cerevisiae
                     YNL097c PHO23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446645.1"
                     /db_xref="GeneID:2888221"
                     /db_xref="GOA:Q6FSZ9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ9"
                     /translation="MSSPANLFPGLNDIVDVLEELPLEISRYFTLLHEIDAKCVLAGP
                     ALDDKIKGFLENDPTEKQDEIAQKDKLQSLVSINQFLEELMPSFEEKMHVSSIMLESL
                     QRLTSRMELAYEVAIKNEEIPYSLRLGVDNHPAMHLHHELMQKVDHKANSKSSQAQKS
                     ESRREAMAANRRTDPQQHQSTNNNNNSANEKSNSVPAHSDNANTNNRKRANNDKNSAN
                     GNGHSNNDNKKRKRKVTTTTTPLGSHPKSSGNIRSPRPKTNEYGEPLYCYCNQVAYGE
                     MVGCDGEDCELEWFHLPCIGFETIPKGKWYCEDCKKKLAQ"
     gene            <629658..>630311
                     /locus_tag="CAGL0G06578g"
                     /db_xref="GeneID:2888220"
     mRNA            <629658..>630311
                     /locus_tag="CAGL0G06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446646.1"
                     /db_xref="GeneID:2888220"
     CDS             629658..630311
                     /locus_tag="CAGL0G06578g"
                     /note="highly similar to uniprot|P50946 Saccharomyces
                     cerevisiae YNL099c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446646.1"
                     /db_xref="GeneID:2888220"
                     /db_xref="GOA:Q6FSZ8"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /translation="MDSPTLEDRENSIEDCDDDDDNIYINEETEEGHEKVLVTHAPQE
                     RIVPPLNFCPVERYLYRSGQPSPVNFPFLLNLNLKTIVWLANEEPQDSLLEFCDTHKI
                     NLQFAAINPDAGEDDNPWDGLTEHSIINVLQTIVTKENYPLLVCCGMGRHRTGTVIGC
                     LRRIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTALVEIDKKNAPDWLLTSLE"
     gene            complement(<630714..>631430)
                     /locus_tag="CAGL0G06600g"
                     /db_xref="GeneID:2887984"
     mRNA            complement(<630714..>631430)
                     /locus_tag="CAGL0G06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446647.1"
                     /db_xref="GeneID:2887984"
     CDS             complement(630714..631430)
                     /locus_tag="CAGL0G06600g"
                     /inference="similar to AA sequence:UniProtKB:P50945"
                     /note="similar to uniprot|P50945 Saccharomyces cerevisiae
                     YNL100w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446647.1"
                     /db_xref="GeneID:2887984"
                     /db_xref="GOA:Q6FSZ7"
                     /translation="MVNFYGDSIGEKVEDGDKVRTERLFTESKEIPTVKVSDLPSGYK
                     VLQIPEVTERIGEYRNKFLKYYERTYVKISEYKARKKNELDDRVQYLKKNIFVDKYEN
                     EELLAPISLLGLGAFFTGRILTNPTNWGYGALLIKGQPTFFGMFMSSVPARIILPIFL
                     AGYTFNKFLPVTSSKFVETCERDVLPKNVTKAIKDSKRQLYTEGLVNTRKTISQAVYR
                     NCEDAVHRVRMSIAEQLDKW"
     gene            complement(<631859..>634060)
                     /locus_tag="CAGL0G06622g"
                     /db_xref="GeneID:2887985"
     mRNA            complement(<631859..>634060)
                     /locus_tag="CAGL0G06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446648.1"
                     /db_xref="GeneID:2887985"
     CDS             complement(631859..634060)
                     /locus_tag="CAGL0G06622g"
                     /inference="similar to AA sequence:UniProtKB:P50944"
                     /note="similar to uniprot|P50944 Saccharomyces cerevisiae
                     YNL101w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446648.1"
                     /db_xref="GeneID:2887985"
                     /db_xref="GOA:Q6FSZ6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ6"
                     /translation="MGSSEEHKGLLHPEYTTVGPREIRQSQRRDNDSTSNYSGSFRRG
                     SMSMALTPTAAKNINIPVSSSMDNRHVMVDIGSPDFKTLHPQKEKQIVNSLRKNYLNT
                     YMTGSISSSYTERRRPSSVSQAGRLGNVNTGPSVRPKDDSELRTGTPDLSYDPNLSTA
                     GGDITRDIYKVATKAMPTPVKRMQSTDDVMSVASSQRRQSTASSLNVPGGFRREFIVT
                     KKRKEKLLNKSNDNVDSSTTPNNSSPSINEALTDDEEDDKMPFLTKNFLEFLYMYGHF
                     AGESFEDDFYSVDGMPYALDESSHLLSQTTKAKGPPKGTTSTRKVFFLLLKSFIGTGV
                     LFLPNAFNNGGLFFSIFMLAFFGLYSYLCYYLLISSKIAAQVRSFGGIGLKLYGPTMK
                     YLILFSLVITQLGFSSVYVIFTARNLKAIGEHVFKLPNVSITFLMISQLLLFIPLSFV
                     RKISKLSLPSLFANVFILVGLVIVVFFSMKHLFYDLSGSPADGVIFGINNSRWTLFIG
                     TAIFSFEGIGLVIPVQDSMRKPEKFPLVLGLVIICTTVVFIIVATIGYLAYGSEVDTV
                     ILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPAIRIIESGLFKQYDRWVNRSDREGH
                     ATEHNTSSGKSSWKVKWMKNAVRSSIVILVVAIACVGADNLDKFLSIIGSFACIPLVY
                     MYPPMLHLKSTSLPRSNGKIMSRRVIIDIVLIIFGGISMVYTSYQSIFVTD"
     gene            complement(<634475..>634825)
                     /locus_tag="CAGL0G06644g"
                     /db_xref="GeneID:2888053"
     mRNA            complement(<634475..>634825)
                     /locus_tag="CAGL0G06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446649.1"
                     /db_xref="GeneID:2888053"
     CDS             complement(634475..634825)
                     /locus_tag="CAGL0G06644g"
                     /note="weakly similar to CA5601|IPF556 Candida albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446649.1"
                     /db_xref="GeneID:2888053"
                     /db_xref="GOA:Q6FSZ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ5"
                     /translation="MPNFTGALCNYTISTVVPQTTDCSLPALLLPFSLPRRPSGGPRT
                     TRARIRPTLHSGGTIATASSLLLEAKKANSTDRSPGTPQENTAAPCGIITKRLNSFAS
                     VNFLANYTQRHPQE"
     gene            complement(<635311..>639675)
                     /locus_tag="CAGL0G06666g"
                     /db_xref="GeneID:2888004"
     mRNA            complement(<635311..>639675)
                     /locus_tag="CAGL0G06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446650.1"
                     /db_xref="GeneID:2888004"
     CDS             complement(635311..639675)
                     /locus_tag="CAGL0G06666g"
                     /note="highly similar to uniprot|P13382 Saccharomyces
                     cerevisiae YNL102w CDC17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446650.1"
                     /db_xref="GeneID:2888004"
                     /db_xref="GOA:Q6FSZ4"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR024647"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ4"
                     /translation="MSASNDKLAKLKKLQALRKGKNANDEDDEDNYDKIYDEIDEKEY
                     RNRKRQELLRDDFVVDDDGLGYVDRGVEEEFNSEEDYSSNDELDNSTSKGNKKQQPKK
                     QIGDMLKAHHSKVVLSGKQLDSKKKQIKLDDFDDILNEFDNEEDEKPILTHRKNASLL
                     SSSPTVKTAMKRSLNDFDSSDNENRRIKNKRVDMNSSPLKNQIKNSIPSESLGGGDTA
                     VNSLETSPTRHVQDSSLLNAVKSEFEQDSSTNIDSDDSDEDNVIVTKRKMRTATAVRK
                     VNLDSKSALSSSPYVTTPGTPITENKKSIGSSVASYSMSGPLNFATQKFTKDQIIDPQ
                     TGTFKMYWFDFTEVNNTLVLFGKIKLLTGEHVSAMIQIDGMCRELYFLPREGRKPEEI
                     HEEIIPLLMDKYGLPNIRAKPEHMKYAFELPGIPHESDYLKVLLPFNTPKSSRDTIPP
                     DLSSETFHHVFGGNTNIFESFVVQNKIMGPCWLEIKGGDFSALQNASHTSIEVLINRP
                     QDIKPIDIKEMPELHCTSISIQTVMNPKQNKQEIVSITLGTYKNLKLDSPIPENLDPT
                     DIVTLVRPPHGSSFPPGLATLAKQKLGGQVRLFNNEKTLLACFCAMMKVMDPDVLIGH
                     RLEGVYLDVLVHRLHEFNIPTFSTIGRRVRKVWPDKFGKVNSGLTHLFIREMVAGRLI
                     CDIGNEMGQSLTPKCQNWDLAEMYQVTCQVDHKPLEINYQNTQYQDDVNLLTMALQEN
                     VTNCKIAAEVSFRIQILSLTKQLTNLAGNAWSQTLGGTRAGRNEYILLHEFARNGYIV
                     PDKETQKMRNQRLRAQDGSDEPEGSSKKSKYQGGLVFDPEKGLHTNYVLVMDFNSLYP
                     SIIQEFNICFTTVDRDVENIDELPEVPSADKAQGVLPRLLANLVERRREVKKIMKTET
                     DPHKRLQCDIRQQALKLTANSMYGCLGYVNSRFYARPLAMLVTNKGREILMNTRQLAE
                     SMNLIVVYGDTDSVMIDTNCDNYHDAIKIGNNFKTLVNERYRLLEIDIDNVFKKLLLH
                     AKKKYAALNVSINKEGKEETVLEVKGLDMKRREFCPLSRDISIHVLNTILSDKDPETA
                     LQEVYYYLEDMREKIEKDEIRVDKYKINTKLSKDPSAYPGGKNMPAVQVALRMRKTGR
                     MVKAGTVITYVITKPAEVENGEASGAQSVAERAYALNEVMMKGSNLRPDPEFYLEKQI
                     YAPVERLLERIDSFDSVRLISALGLDSKKYLRRGGIDGHGSNSNELEPLETTISDMER
                     FKDSSNLILNCPNCKKEFPYGGIVASNYYQHCYNGLQCKSCDYLFSPLQMTCQLERAI
                     RSHISLYYAGWLQCDDPTCGNVTRQLSVFGKRCLNDGCTGVMHYRYTDKQLYNQLLFF
                     DSLFDCDKNKKRELKPLYLEGDQDYPSEKLSDTSINALTEQNRDLLELNHSIVQKYLS
                     DCGRRYVDMATIFEFMMN"
     gene            complement(<640320..>642332)
                     /locus_tag="CAGL0G06688g"
                     /db_xref="GeneID:2888144"
     mRNA            complement(<640320..>642332)
                     /locus_tag="CAGL0G06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446651.1"
                     /db_xref="GeneID:2888144"
     CDS             complement(640320..642332)
                     /locus_tag="CAGL0G06688g"
                     /note="weakly similar to uniprot|P32389 Saccharomyces
                     cerevisiae YNL103w MET4 transcriptional activator of
                     sulfur metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446651.1"
                     /db_xref="GeneID:2888144"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ3"
                     /translation="MSSNGVSPGTEYVNFFGKDDKPKDKSADDSGDAHAREEDATPSI
                     LLEQLAYVDNFFPSLDHDFAADSWMVHDYNGAAGGSGVDGAMSVADMGLDEQLSAELS
                     VFADDAFIFPDEDKSNRNNNNSGDDGDDESNNNNSNTNNNNNINNNIINNINNNSNSN
                     ENDRLDEDDEISLDGGSGRRQRNPHFLTQRRNNFLMSQYDQARGRFSANRRKENNNNN
                     QNPFGDEPTSPVRRSSDDHGEFTNVNIGTSPNNDMDPQHSPPQDNDPYMRGMRSNTGD
                     SPRDTQNPANLVRNHRPSISSPLNNVIANSSQWNSGNHHTPAVSSRQFTQAQTAPTAN
                     QHTDIELPDYSAIPTSTLVSLLPRVKVPPGAYNTLLGLGFTSDQIDAMSALIAYNEQQ
                     KKKTGQLIDHNNISNEESLKTLLDLFNKGHIISKKPQSVNTSGNDELNNYNDHGGISS
                     QSQSPQPAKNRPNKKNNIKINEKALEKQEADSAEFLESILRMHSSQQTHKLRKPQSSD
                     DTNHMETISRTKSDTQVHADSEQENKEYKELTRTHSINNNLNKDTSQHKRIRSSSISD
                     FQESASDAPSKKRSIDHKQESSKSQENSKRKVKEKELETSIQELSELAVTLQQKIHTL
                     EMENKLLKNLVLSSGDLNMAGLDNSFDSESISKSPKMDPKVAKVKR"
     gene            complement(<642819..>643070)
                     /locus_tag="CAGL0G06710g"
                     /db_xref="GeneID:2888145"
     mRNA            complement(<642819..>643070)
                     /locus_tag="CAGL0G06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446652.1"
                     /db_xref="GeneID:2888145"
     CDS             complement(642819..643070)
                     /locus_tag="CAGL0G06710g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446652.1"
                     /db_xref="GeneID:2888145"
                     /db_xref="GOA:Q6FSZ2"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ2"
                     /translation="MRFPLPLESQLSPFDYHQVRDKFGFKTPLFALTHFESQTMSSLS
                     GMRGLEENGISTGIAKGYKSTPHVRSWGFLSFLHGVISC"
     gene            <643340..>645166
                     /locus_tag="CAGL0G06732g"
                     /db_xref="GeneID:2888233"
     mRNA            <643340..>645166
                     /locus_tag="CAGL0G06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446653.1"
                     /db_xref="GeneID:2888233"
     CDS             643340..645166
                     /locus_tag="CAGL0G06732g"
                     /note="highly similar to uniprot|P06208 Saccharomyces
                     cerevisiae YNL104c LEU4 2-isopropylmalalate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446653.1"
                     /db_xref="GeneID:2888233"
                     /db_xref="GOA:Q6FSZ1"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ1"
                     /translation="MRATVIRLSRAAKSIPPVKLAYKNMLKDPSIKYKPFSIAPKLTD
                     RKWPDNTITKAPRWLSTDLRDGNQSLPDPMSIEQKKEYFHKLVEIGFKEIEVSFPSAS
                     QTDFDFTRYAVENAPDDVTIQCLVQSREHLIRRTVESLTGAKRATIHTYLATSDMFRE
                     IVFNMSKEDAIAKAVEATKLVRSLTKDDPSQQATRWSYEFSPECFSDTPVEFAVEICE
                     AVKAAWEPTEDNPIIFNLPATVEVASPNIYADQIEYFCTHITEREKVCVSTHTHNDRG
                     CGVAATELGIMAGADRVEGCVFGNGERTGNVDLVTVALNMYTQGVSPNLDFSDIRSVI
                     EVVERCNKLPVPARAPYGGDLVVCAFSGSHQDAIKKGFSVQQKKRDQGDIQWRIPYLP
                     LDPKDIGRDYEAVIRVNSQSGKGGAAWVVLRALGLDMPRTMQIEFSTSVQEHADSLGR
                     ELKAEEIVNLFKESYNYNNEIFQHISLVDYNVEKFGAERRILNGQVEINGEVVDIKGT
                     GNGPISSLVDALSNLLNIKLGVSNYSEHSLGSGSSTQAASFINLTYRRDEDNEKAYQW
                     GVGVSEDVGDASVKAIFATLNSVIQKGDISIPKSKKAASGSA"
     gene            complement(<645915..>646889)
                     /locus_tag="CAGL0G06754g"
                     /db_xref="GeneID:2888234"
     mRNA            complement(<645915..>646889)
                     /locus_tag="CAGL0G06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446654.1"
                     /db_xref="GeneID:2888234"
     CDS             complement(645915..646889)
                     /locus_tag="CAGL0G06754g"
                     /note="highly similar to uniprot|P25342 Saccharomyces
                     cerevisiae YCR002c CDC10 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446654.1"
                     /db_xref="GeneID:2888234"
                     /db_xref="GOA:Q6FSZ0"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSZ0"
                     /translation="MSTIPEALLPSNYVGFDTITSQIEHRLLKRGFQFNIMVVGHSGL
                     GKSTLINTLFSSHLIDPATGEDISKQPITKTTEMKVSSHTLIEDRVRLNINIIDTPGF
                     GDNINNNKVWEPIVKYIKEQYSQYLRKELTAQRDRYIPDTRVHAILYFLQPNGKGLTA
                     LDVATLKRLTEIANVIPVIAKADTLTIDERTKFKKIIQSEFEKYNFRIYPYDSDDLTE
                     DELVLNKSIRSVIPFAVVGSEKEIEVNGETFRGRKSRWGAINVEDINQCDFVYLREYL
                     IRTHLQDLIETTSFVHYEGFRSRQLIALKENANNRASSQMGGNQPYQR"
     gene            <647706..>648254
                     /locus_tag="CAGL0G06776g"
                     /db_xref="GeneID:2888235"
     mRNA            <647706..>648254
                     /locus_tag="CAGL0G06776g"
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /transcript_id="XM_446655.1"
                     /db_xref="GeneID:2888235"
     CDS             647706..648254
                     /locus_tag="CAGL0G06776g"
                     /inference="similar to AA sequence:UniProtKB:P25348"
                     /note="similar to uniprot|P25348 Saccharomyces cerevisiae
                     YCR003w MRPL32"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /protein_id="XP_446655.1"
                     /db_xref="GeneID:2888235"
                     /db_xref="GOA:Q6FSY9"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY9"
                     /translation="MSMLARLSSGYIFAGAGVGSQAVVTPVTLGLAGVSQAIPALLGK
                     LLGDTEAKEETGFFDNGILLAAPKKKVSHQKKRQRLLAPGKKHVNMMNHLNRCPSCGH
                     YKRANTICMHCFENVRFLWKSYTQEQRQEPIQEQNLTDLDKRVLYPGKMDTVYEEKLK
                     DKDSYLVRRMRTLPKEDPKVES"
     gene            <648943..>649215
                     /locus_tag="CAGL0G06798g"
                     /db_xref="GeneID:2888236"
     mRNA            <648943..>649215
                     /locus_tag="CAGL0G06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446656.1"
                     /db_xref="GeneID:2888236"
     CDS             648943..649215
                     /locus_tag="CAGL0G06798g"
                     /inference="similar to AA sequence:UniProtKB:Q3E772"
                     /note="similar to uniprot|Q3E772 Saccharomyces cerevisiae
                     YGR169C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446656.1"
                     /db_xref="GeneID:2888236"
                     /db_xref="GOA:Q6FSY8"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY8"
                     /translation="MGKRFSESAAKVAQGRARKRQQEWEKNRAQKEQLEAMEAKKWEE
                     GAREGTSKKALLEEKRQQKLAAKKERDALLKAEEEAIGRGGKLRNL"
     gene            complement(<649676..>650668)
                     /locus_tag="CAGL0G06820g"
                     /db_xref="GeneID:2888237"
     mRNA            complement(<649676..>650668)
                     /locus_tag="CAGL0G06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446657.1"
                     /db_xref="GeneID:2888237"
     CDS             complement(649676..650668)
                     /locus_tag="CAGL0G06820g"
                     /inference="similar to AA sequence:UniProtKB:P47065"
                     /note="similar to uniprot|P47065 Saccharomyces cerevisiae
                     YJL023c PET130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446657.1"
                     /db_xref="GeneID:2888237"
                     /db_xref="GOA:Q6FSY7"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY7"
                     /translation="MQVGKFSNRLNEKFLIKRICNKKTLDAFNAFHIVDEYTEPVRIE
                     PNKDGGYEVLDWKLAGNNTFLEQDIPKSSIDRMPIRIAASKLKGVVSPVAKYHSNTRL
                     LSGESNMYKCDYFRLQYYPPDHFLSSFRKSRPAITCKPVTDLFINGKLQQSNSKTSIN
                     ETQMKQLSSKFQNVIMNTKSKIARDYAVRRNHLRLDIKQWFIHCWCNLHGPEAIDEQI
                     KVAKNGQENVTNLQYIDDHLNSKPGIAKDGYYMYNCTVFPDDTNKVEYREKVRESIKI
                     IADKTWVDIYASSKKNSHKGLNWAHNINSRVNISVLNQYLSSAEVPYKIIKSKL"
     gene            complement(<651033..>654152)
                     /locus_tag="CAGL0G06842g"
                     /db_xref="GeneID:2888180"
     mRNA            complement(<651033..>654152)
                     /locus_tag="CAGL0G06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446658.1"
                     /db_xref="GeneID:2888180"
     CDS             complement(651033..654152)
                     /locus_tag="CAGL0G06842g"
                     /note="weakly similar to uniprot|P47068 Saccharomyces
                     cerevisiae YJL020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446658.1"
                     /db_xref="GeneID:2888180"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY6"
                     /translation="MSQIPFKVVASFPYQSEYEDDLNFEKGQVITVTNIEDDEWYYGE
                     YVDGTGASHEGIFPKSFVVEGDEALKSADPIGDKDGVESKNDIKEPRKYEKADMQLHS
                     EDKSAKPVSMPSVPSVPVSSDEAPKKEMPKPGKIPIPAAVDPSQFHDADTPRSEDINK
                     EDLPKMSLKERIALLQEQQRLQAERDAEMMKRATEKQHQEASQSPENMDGKDEQNSKA
                     ELDDHGAHLEKTRTESTENDNQNDDHQESVTENQADAKSHHEEGISNMPSEEPEISGM
                     TDESQPVHEETSKNGEHAETEVEEDSEEARRAALRNRMAKLAGAGRFGGPVGFNPFGM
                     PAPMPTADKESTARSESNIDRKESSEMENIPQAVPVMPFADPSKNPLLKKLTEEKLEP
                     KEKITDAGEEQAKTLDPMMASSDSSKKEHIYHELAGEKNTVDKDGASVGDDAYHSANE
                     MKGYESSAEENADDLSSKVKGVAGPEMGTDSLSDAHGITTNKEDPIIEKGLSDSSDSS
                     EEDRESTIPGPPPVSAAAEASMPPIPVIPPGREQLHEHHTKGNSEEVAPPPPPAHPQV
                     NAPNDMTNDVDMIETKPIHPPSAGNAPMAKAPPVPPNPPIPGTMPAPPVPQVPPMPPV
                     SGSVQSPGEHMKSAPPPPPMMSERSVEPQGDRSIPPVPMSGIPPPPSDHSGPHGAPPP
                     PPPPTHTAHPPPPPPTHAAHPPPPPPTAGHDGQAPPPLPPLSHPPMGHVPRDEGTETR
                     EHTSNNPFSSKSSSNNVPPLPNAPAPEPSMKSSSNALREVKSTTTTELTDTTRMLSVP
                     FDSNTTWWLEKKIPHNLIDPKVKFTYEVDDHEIKKRLGEKWIIRDFYILFETLSQIVL
                     TITFNAKNPQETVTSTQKYIAPPHFDSSKLDAYASKYNNMIVQKAHSLINSSSQDFGA
                     SVLEDVYKSIIPVIGGRTFGIPLVNYKAQTQLETESVKKVLPGDIMVIRKGVFEHHKK
                     IGKKEVVSVGQERSHIAVVTDYDFTKDKFRVIDLQNGKVSQSSYKPHNMTTGRLKIFR
                     VVGRDYIGW"
     gene            <654936..>656915
                     /locus_tag="CAGL0G06864g"
                     /db_xref="GeneID:2888181"
     mRNA            <654936..>656915
                     /locus_tag="CAGL0G06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446659.1"
                     /db_xref="GeneID:2888181"
     CDS             654936..656915
                     /locus_tag="CAGL0G06864g"
                     /inference="similar to AA sequence:UniProtKB:P47069"
                     /note="similar to uniprot|P47069 Saccharomyces cerevisiae
                     YJL019w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446659.1"
                     /db_xref="GeneID:2888181"
                     /db_xref="GOA:Q6FSY5"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY5"
                     /translation="MTVEESGVKDVYKEMLMRKVERNEVPQAEEYSRFKESILDGKDY
                     GDEDEDSDGDYDAGETGSADIAFREDDDELTESDSDDDIDVGNESFVLRDKFSSSDEL
                     AQEDVDEDSYSYDMQGQELDSEVDGDDEELLYWDQQRKFNVVTRIILVVCSALFVYCI
                     MTGNLTSTSNNVVLSPSTSANLQKQINHLYSEFSQSEQKHVQELDRTLKVVVAQFEKN
                     IKKLIPKNIKNLQTQVENLNERFNKILNMGSSPNQNQITVTNITQWQQSILSTLNITL
                     PTKIPVVVNNSSQMLIIPEMHKYISDILNDIVHASEPFINVNNNGTGVKNSLGYDLNK
                     YVKEVLSNEFQYVDKKFFLQELNRNLQLNKHEILEEVAGRLSHIEDKYGANANRRQLV
                     PEQYSTILLKNLVKEIYNTNHYRWEDDLDFATAAQGARLVKHLTSSTYNYKNGNGITP
                     LELLSDSSLSRGSTYWQCVDSKSCSWTIRFNNPIYLTRLSYFHGRFTNNLHMMTSAPK
                     SIAVYVKLAKSNPAPLEKTLKDLASENVGKDNTFKKDSSYILISNYEYDIHDRRIRQD
                     FPLPDWYIQLKPLIRSIAFVVNQNNGNSEFTSLRKYVINGVTASDLKIIDSNEFTINR
                     DQIPEFSEHHAQIHPKPPSPKTNNIKAFGQDELDI"
     gene            <657896..>659986
                     /locus_tag="CAGL0G06886g"
                     /db_xref="GeneID:2888431"
     mRNA            <657896..>659986
                     /locus_tag="CAGL0G06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446660.1"
                     /db_xref="GeneID:2888431"
     CDS             657896..659986
                     /locus_tag="CAGL0G06886g"
                     /note="some similarities with uniprot|P47071 Saccharomyces
                     cerevisiae YJL016w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446660.1"
                     /db_xref="GeneID:2888431"
                     /db_xref="GOA:Q6FSY4"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY4"
                     /translation="MKFSLSSFKNKSSSSSDASSSDPSDNSVPQAPPSRKLSERLSFP
                     STSEIGSQIKSRRKSSHHKIDLDFMKIPPKALEALKPLTALLASQETKRYFYWSYDPQ
                     YDDMWTVTTADSTEKVSIIEIKGTSFTIETQETSRVLDVDLTGGVILRVESDETGSQL
                     FFNDGEVTLSNRSIHNVNILYRTALLAIFERFSILKALTGALIAQIGLRMSDINLILN
                     SHFSFKDWCDVYLEEQGGWVRLWCHVDGVEKKGKPPSQNQSNGTEKKKSSLNVFGKNN
                     NSDQAGTATKSSKKGGYKIKFYKDNKSLNSKNMVCFISSESNEIQDLFFYGTNENDAL
                     NRNDYGESFLDSNLNMIKIIGEVSFSNTANSPYQEPNATFSKSGSSGFLNGQLRQLSR
                     SSRNMSVSSEASSNEDSQLTSPKMRTGFFTSPKLGGNTSPVVGKHQRTASTASKKSSK
                     SLPQNFAIKKRSLLIRPVEHEGVKQLETLIRFIVPLMNCLGMYGRPHHFSTDKADPNS
                     LMYGLPRLPIIDYFARKETRQLLQQGPQDQSLMLESETSAVAMKWLTQELKNFSKQNS
                     NRENTLTFTKITDIYPTITTQSKTQSQSQIDANAPVEEQAMQQNLPSEPENGQYEHFQ
                     DTSEFQPANNLPTNGMSYDNNYVQDQYVQDQMVQDHMQAEAEQMQAGIDMGLDFDMAM
                     ITESIRNTNVEDYK"
     gene            <660580..>662196
                     /locus_tag="CAGL0G06908g"
                     /db_xref="GeneID:2888432"
     mRNA            <660580..>662196
                     /locus_tag="CAGL0G06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446661.1"
                     /db_xref="GeneID:2888432"
     CDS             660580..662196
                     /locus_tag="CAGL0G06908g"
                     /note="highly similar to uniprot|P39077 Saccharomyces
                     cerevisiae YJL014w CCT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446661.1"
                     /db_xref="GeneID:2888432"
                     /db_xref="GOA:Q6FSY3"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012719"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY3"
                     /translation="MQAPVVFMNTSQERTIGRQAQISNITAAKAVADVIRTCLGPKAM
                     LKMLLDPMGGLTVTNDGHAILREIDVAHPAAKSMIELSRTQDEEVGDGTTSVIILAGE
                     ILAQCAPYLIEKNIHPVIIIQALKKALADALDVINEVSKPVDINNESAMKKLIQASIG
                     TKYVNHWSEKMCELALKAVQIVRVDLGVTNSDDPSNRYEIDTKRYVRIEKIPGGDVLE
                     SKVLNGVLLNKDVVHPKMSRRIENPRVVLLDCPLEYKKGESQTNIEIQKEEDWNRILQ
                     IEEEQVQLMCEQILAVKPNLVITEKGVSDLAQHFLLKGGCSVLRRVKKTDNNRIARVT
                     GATIVNRVEDLKESDVGTQCGIFKVELIGDEYFTFLDEAKDPKACTIMLRGGSKDILN
                     EIDRNLQDAMAVARNVMLSPSLSPGGGATEMAVSVRLAEKAKQLEGIQQWPYQAVADA
                     MECIPRTLIQNAGGNPIRTLSQLRAKHAQGNLTFGIDGDTGKVVDMVDYGIWEPEVIK
                     QQSMKTAIESACLLLRVDDIVSGIRSPQEQ"
     gene            complement(<662371..>663513)
                     /locus_tag="CAGL0G06930g"
                     /db_xref="GeneID:2888430"
     mRNA            complement(<662371..>663513)
                     /locus_tag="CAGL0G06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446662.1"
                     /db_xref="GeneID:2888430"
     CDS             complement(662371..663513)
                     /locus_tag="CAGL0G06930g"
                     /inference="similar to AA sequence:UniProtKB:P47074"
                     /note="similar to uniprot|P47074 Saccharomyces cerevisiae
                     YJL013c MAD3 spindle-assembly checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446662.1"
                     /db_xref="GeneID:2888430"
                     /db_xref="GOA:Q6FSY2"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY2"
                     /translation="MPAQKVTRFEDIEVEKENIAPLRHGRSAHRLVSALSQNDDEIKR
                     IRASFESSLLVKIEDHDDPLVLYLDYIDWINHAFPQGGSSRSSGMLDVIERCITYFKD
                     SERYRDDERYVKIWLWYMELFSDKYKSDCKDLFIFMLRNRIGSKVPLMYEELSSLLYE
                     LKEYKYAISVINLGLKECKYGNKSLVDKRQLLLEKLGDDAKVIDDSVEMLDGAERVIL
                     GKKQSELREKAKSNKTSDRETKMSSSIYTDSQDPEVHDEPLSCLRNWDIFEILHSRNK
                     ENRILAEPLILNELDRTFSGDQLKGGKKMILFQDNLGRSEPVYKLIKNNSGKLEKIDY
                     NTNLLIYEGREICLEEILTMMKSNTQNNKRRREYDDSKNLHIKKQR"
     gene            complement(<663828..>665981)
                     /locus_tag="CAGL0G06952g"
                     /db_xref="GeneID:2888086"
     mRNA            complement(<663828..>665981)
                     /locus_tag="CAGL0G06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446663.1"
                     /db_xref="GeneID:2888086"
     CDS             complement(663828..665981)
                     /locus_tag="CAGL0G06952g"
                     /inference="similar to AA sequence:UniProtKB:P47075"
                     /note="similar to uniprot|P47075 Saccharomyces cerevisiae
                     YJL012c VTC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446663.1"
                     /db_xref="GeneID:2888086"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY1"
                     /translation="MKFGEHLQRSLIRQYSYYYIAYDDLKNDLETQLRKNNGEWSQEL
                     ETEFLESLETELDKVYSFCRVKQSELSRRVKEVQEQVSKTVRLIDSNNPPSELDFEIL
                     EEELSDVIADVHDLAKFSRLNYTGFQKIIKKHDKKTGFILKPIFQVRLDAKPFFKENY
                     DELVVKISQMYDFVRTSGKPIKGDSAAGGKQQNFVRQTTKYWVHPDNITELKLIILKH
                     LPVLVFNTNKEFEKEDSAITSIYYDNEDLDLYYGRLRKDEGAEAHRLRWYGGMSSDTI
                     FVERKTHREDWTGEKSVKARFALKEKYVNDFMKGKYTVEQAFAKMRKEGKKSLKEIES
                     LEALATEVQYVMLKKKLRPVVRSFYNRTAFQLPGDARVRISLDTELTMVREDNFDGID
                     RTKGNWRRTDIGVDWSFKQVADKDICRFPYAVLEVKLQTQFGQEPPEWVRELVRSHLV
                     EPVPKFSKFIHGVATLLNDKVESIPFWLPQMDVDIRKPALPSHINITRPGQENEDDDD
                     YDEDDEDDAALVAAMTENDRNAMDTEEMVGYGAVPSETEGHENHSPNRAYYQRQIRNS
                     SNSISRKYYQILSTIDHYLNGDQISKIPKGTVFDTQIKAPPGKTICVPVRVEPKVYFA
                     TERTFLSWMSIAIILSGVSTSLLNYGTKTTMVASIGFFLTALITLVYTYIIYNMRVIY
                     IREKWAVDYEDKIGPPLICGCLILSMIFSFYCNMI"
     gene            complement(<666279..>666740)
                     /locus_tag="CAGL0G06974g"
                     /db_xref="GeneID:2888087"
     mRNA            complement(<666279..>666740)
                     /locus_tag="CAGL0G06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446664.1"
                     /db_xref="GeneID:2888087"
     CDS             complement(666279..666740)
                     /locus_tag="CAGL0G06974g"
                     /inference="similar to AA sequence:UniProtKB:P47076"
                     /note="similar to uniprot|P47076 Saccharomyces cerevisiae
                     YJL011c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446664.1"
                     /db_xref="GeneID:2888087"
                     /db_xref="GOA:Q6FSY0"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:Q6FSY0"
                     /translation="MKVLETRDAFLSDYEVLQHLSKMERQYHWDDESIAEMSTKKRHM
                     HRKRPYNNPALQRITRDVIDYLKMNKYDVAQEEEEDVKKMSPLCNLNDDKFTELVMRL
                     NQYELFQAEKLQIVNQLPVQMVHLYAIVEECDTRFTQEQIDALLQLVAEYV"
     gene            complement(<667115..>667930)
                     /locus_tag="CAGL0G06996g"
                     /db_xref="GeneID:2888088"
     mRNA            complement(<667115..>667930)
                     /locus_tag="CAGL0G06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446665.1"
                     /db_xref="GeneID:2888088"
     CDS             complement(667115..667930)
                     /locus_tag="CAGL0G06996g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446665.1"
                     /db_xref="GeneID:2888088"
                     /db_xref="GOA:Q6FSX9"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX9"
                     /translation="MSLRYNESLVHGDDKLPQIRASDVTCALGDIDLGSDPLVELKKW
                     VVGVLSKVVGATEVESRTEVLPVVRTVISARSNGSDATAVFEERYNSVRSQGMRTLSI
                     RSKALSLSPATKDLAGLPVISYAPLAKILCSEDTIELLDEVFKDRVRDQEFLYFTDTS
                     SPNNSFNNLGPLQTKDGTQTTLPYTHKRTVSKGNTTIGTLFTAMQGPCYRHNPMRNNK
                     RWRNREHRHINRIKQFFNRHFNFGQLKEVNLSEEQLPCEHEFKKSVPLRYSFL"
     gene            <668453..>669628
                     /locus_tag="CAGL0G07018g"
                     /db_xref="GeneID:2888089"
     mRNA            <668453..>669628
                     /locus_tag="CAGL0G07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446666.1"
                     /db_xref="GeneID:2888089"
     CDS             668453..669628
                     /locus_tag="CAGL0G07018g"
                     /inference="similar to AA sequence:UniProtKB:Q03730"
                     /note="similar to uniprot|Q03730 Saccharomyces cerevisiae
                     YML018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446666.1"
                     /db_xref="GeneID:2888089"
                     /db_xref="GOA:Q6FSX8"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX8"
                     /translation="MFESGLRRWTVGLFLLGVVIVLWVLSSFLINYIFEDGTYRKPFF
                     ITYINTASFIFYLIPTFKNIVYNYKVTGKPYIHEELLIEEEANETVTNYTADNEQCRR
                     ANSIDEASNPLLEAQNIVRDAQLDRLSLPETIRLSAEFCVLWFAANFVTNASLGYTSV
                     ASQTILSSTSSFFTLFIGAAFRVETIDRVKVIGSLISFIGILLVTKSDVHIPQNTHMP
                     HTHALDEKKRDKTFEIFFGNMLALSGALFYGLYSTLLKRKVKDESRINMKIFFGFVGL
                     FTLILLWPTLLLLDKFNWETFVIPRDPLVITIILVNCLITFVSDFCWASAMLLTSPLT
                     VTLGLSITIPLAMFGDFLFRHKTVPFLYFCGAILILGSFFVINKNSEKNERNEEAIA"
     gene            complement(<669967..>670962)
                     /locus_tag="CAGL0G07040g"
                     /db_xref="GeneID:2888090"
     mRNA            complement(<669967..>670962)
                     /locus_tag="CAGL0G07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446667.1"
                     /db_xref="GeneID:2888090"
     CDS             complement(669967..670962)
                     /locus_tag="CAGL0G07040g"
                     /inference="similar to AA sequence:UniProtKB:Q03723"
                     /note="similar to uniprot|Q03723 Saccharomyces cerevisiae
                     YML019w OST6 N-oligosaccharyltransferase complex subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446667.1"
                     /db_xref="GeneID:2888090"
                     /db_xref="GOA:Q6FSX7"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX7"
                     /translation="MRMHAIALLISLIVGVFSITTEELDRLKDEDGIIAVTDANYAQI
                     SKGLEDYYNVLFITMRSTNDEGVALCKICLDFEDNYRNVVRLFQSQFPDKKVYFFSSD
                     VQETRQIVRDMDLKNVPHAVVYPPKKDGEVYSWAKTPFYKYELVDKEVSNPLHFGSFL
                     GKIMEVEITIPQEFDVQEFLTYFVICTAIFVVLKRVVLPIVGNKGLLFSIVLAFGILL
                     PSIAGFKFTQINGIPFIARDGKGNIMFFSGGTGWQFGIEVVTVSAMYVAMSIVVTLLV
                     YWKKLCKGNDNANVLGSLFCACLMFFLVHTTLAAIRLNSPSIHLNSSAYMSLLNY"
     gene            complement(<671395..>673014)
                     /locus_tag="CAGL0G07062g"
                     /db_xref="GeneID:2888028"
     mRNA            complement(<671395..>673014)
                     /locus_tag="CAGL0G07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446668.1"
                     /db_xref="GeneID:2888028"
     CDS             complement(671395..673014)
                     /locus_tag="CAGL0G07062g"
                     /inference="similar to AA sequence:UniProtKB:Q03722"
                     /note="similar to uniprot|Q03722 Saccharomyces cerevisiae
                     YML020w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446668.1"
                     /db_xref="GeneID:2888028"
                     /db_xref="GOA:Q6FSX6"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX6"
                     /translation="MASDNERDSVRLRSDSEAISGEEEQTKGWSFWSRGNKSVPNNEG
                     GDGTLGIDNLVSTLASNVYIPFKGAENDGVNVMETTTNKSKHDQAATEENLDELAQKP
                     NIVTPQFEILPEKSKWNDMKAKLRDYAVRWHVMDEEKERRPILKRTSPQRHFDLFSEN
                     GKSPIKVLIVGVHGFFPTKLIRPFIGEPTGTSAKFVLEAEAIVMRYFESHNQQVEISK
                     IALEKEGKIFERVDYFFDVMSELAHEINEADIIYFVSHSQGSPVTIILLAKLLECGII
                     NIDNSKFFNGPADYKFTSSKKIISILCMAGINNGPFYGADQTLFVRAYQTIEKDSLRE
                     LFEFQKFDSLQSKQFIESLRTLIKNNAKITFVGSINDQLVPLYSSTCLFAHHPNIFRA
                     TFVDKGSQTPDFITRIVKIAGSLINLGYDDHGIIKEISGSLAGPLTGGGHSTIYREVQ
                     VYELGIRFALETTDDFIDLAVDYTPYQLCDLGANTYHLPWCMRGLLYETDRHLNKDEI
                     NLLFQEFENWEPATKQLKDIKYRLNGIRYKL"
     gene            <673267..>674301
                     /locus_tag="CAGL0G07084g"
                     /db_xref="GeneID:2888029"
     mRNA            <673267..>674301
                     /locus_tag="CAGL0G07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446669.1"
                     /db_xref="GeneID:2888029"
     CDS             673267..674301
                     /locus_tag="CAGL0G07084g"
                     /inference="similar to AA sequence:UniProtKB:P12887"
                     /note="similar to uniprot|P12887 Saccharomyces cerevisiae
                     YML021c UNG1 uracil-DNA glycosylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446669.1"
                     /db_xref="GeneID:2888029"
                     /db_xref="GOA:Q6FSX5"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX5"
                     /translation="MLPTAVRFTVRAMSTKRKQVTIEEFFSKQKKSKVSTVKKEEPKL
                     PKEASIEGDTVVETETEDSAVVKEESIGVSDAKKKFQESLSSLLKETLKLEIDTIEDS
                     WFAQLSSEFKQPYFIKLKQFVNKEQATQTIFPPANDIYSWTRLTPFDKVRVVIIGQDP
                     YHNFNQAHGLAFSVRAPTPAPPSLKNIYKELQNNYPDFKSDNKIGDLTPWAKQGVLLL
                     NTALTVRAHNAASHSKQGWETFTRRALEALVHDREKDGKSLVFLCWGSNAIKIAESLL
                     SSTHNKKNIKMFKSVHPSPLSASRGFFGNNHFKQINDWLYNERHEKMIDWSVVPSCSL
                     KEVTDANAKL"
     gene            complement(<674681..>675253)
                     /locus_tag="CAGL0G07106g"
                     /db_xref="GeneID:2888030"
     mRNA            complement(<674681..>675253)
                     /locus_tag="CAGL0G07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446670.1"
                     /db_xref="GeneID:2888030"
     CDS             complement(674681..675253)
                     /locus_tag="CAGL0G07106g"
                     /note="highly similar to uniprot|P49435 Saccharomyces
                     cerevisiae YML022w APT1 adenine phosphoribosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446670.1"
                     /db_xref="GeneID:2888030"
                     /db_xref="GOA:Q6FSX4"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX4"
                     /translation="MSIESYAKDLKAALHQYPNFPSEGILFEDFLPIFREPQLFQKLV
                     DAFKMHLEETFTEKKVDYIVGLESRGFLFGPSLALAMGIGFVPVRKAGKLPGECVKAV
                     YEKEYGSDEFEMQKHAIPAGANVVIVDDIIATGGSAGAAEELIKKIGANVLEYDFVME
                     LDFLKGRDKLNAPVFTLLSSQKEALQKPSA"
     gene            <675689..>677353
                     /locus_tag="CAGL0G07128g"
                     /db_xref="GeneID:2888264"
     mRNA            <675689..>677353
                     /locus_tag="CAGL0G07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446671.1"
                     /db_xref="GeneID:2888264"
     CDS             675689..677353
                     /locus_tag="CAGL0G07128g"
                     /inference="similar to AA sequence:UniProtKB:Q03718"
                     /note="similar to uniprot|Q03718 Saccharomyces cerevisiae
                     YML023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446671.1"
                     /db_xref="GeneID:2888264"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX3"
                     /translation="MSGVSVSVEHVVGNQIGKGLPHYFVELGDKDITSFETQNSLYRA
                     EDYDHLLFCLEERWQDGDSAFDPLFVPSFDIIIVLFTLITVSDHYKATVLTRNEPYNV
                     NRVSYSKRAIKILRKYLRILQQFDTTRYGTYKLELLRCQMFLAIETVNPHFKYLQNCR
                     SVKNSTNENVYYKPDAMPENIIRRGIVNPYRSFISCVETKNPIFGNIPVNFKLSQRGG
                     LSNAILWTLANSIQEDDLLFHDAYEIWIPLFDIFISILEIRQAYFLENEIVKKISKEL
                     RIQKLMESPICQFLSFVDSINFNPLFCEYVFVNCDYTLINRDAALTIQPVYKGETQPT
                     EVYYQRVKYTKQFKAKVSMRIRRRFISLCFNILGSVPTGLHLPKPRIHKKRLLVEMSR
                     TLSTFQNIVEFEEFFTFDYEEFMFHLIERTLYELFKQDRRTIVTERPSLISGKDDLKT
                     FFNEILALFKAGAFTPDVRINGLPPHEIIDNAGHVKNEKLRLQKIDVCICTILRNVLQ
                     GQAKPLLVDCKKLLIKVSKRINIANEKRLEIDTAFPQLKPFIDSFI"
     gene            complement(677502..677574)
                     /locus_tag="CAGL0G07150r"
                     /db_xref="GeneID:2888263"
     tRNA            complement(677502..677574)
                     /locus_tag="CAGL0G07150r"
                     /product="tRNA-Lys"
                     /note="tRNA Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:2888263"
     mobile_element  complement(677640..684206)
                     /note="gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /mobile_element_type="retrotransposon"
     repeat_region   complement(677640..678603)
                     /note="LTR of gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /rpt_type=long_terminal_repeat
     gene            complement(<678730..>683243)
                     /locus_tag="CAGL0G07183g1"
                     /old_locus_tag="CAGL0G07183g2"
                     /db_xref="GeneID:9487993"
     mRNA            complement(join(<678730..682425,682425..>683243))
                     /locus_tag="CAGL0G07183g1"
                     /old_locus_tag="CAGL0G07183g2"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_022600350.1"
                     /db_xref="GeneID:9487993"
     CDS             complement(join(678730..682425,682425..683243))
                     /locus_tag="CAGL0G07183g1"
                     /old_locus_tag="CAGL0G07183g2"
                     /artificial_location="low-quality sequence region"
                     /note="encodes gag, pol, protease, reverse
                     transcriptase,RNaseH and integrase of gb|AY673967 Candida
                     glabrata Tcg3 LTR retrotransposon (Ty3/gypsy superfamily)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_022456058.1"
                     /db_xref="GeneID:9487993"
                     /db_xref="GOA:B4UN02"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:B4UN02"
                     /translation="MVAPASNRNTRPAEEPERTSRPAEEPERTTRPSETPDSDYDSSL
                     DLYPPDSDLLEEESKLRHYLKDEVEHLTKKIARSNARRKEWLTDMRGAVRKFRTLPDK
                     VLINNIRRATDDDIKYDLTKIREDLPSRITIKTFLKAIDNHYERSSKETVRHVNLIDR
                     PKFITAASLRRARDAFENICDEENMTCAIYATKHYLPPRIERQIDDLHWPSPSTILDE
                     LDNEIEKRKAKEKYFKSNKYKNKFNKRRYNPKRFNNNRRNNNSSGGGFSSNKNTKKLT
                     NPSQQRYTNFYINSLSVVEDGPHISPSQQIAILKHQLLQYDYENKQPINRFEIPIKFC
                     LNKQKTHTCLLDTGASTNLIRSDILAGFSNIKYETITPIKLTVATGEHRYLKHKVQLS
                     FTLSGQQHQQHFYVVPTKLKPSIILGAPFINNNPQLFIKILQQGNDSRSTTKATIAET
                     TRGLDHDLRNPINEKYLLWVTTSDVSTTELPKELQDRYADLIVDDLPPTSTTTTVKHE
                     IELVPGTAPIAKRAYRLSPVKRAELEQQIKELISSGRISPSDSPFAAPVLFVKKKDGS
                     SRLCVDYRGLNNATVKSKFPLPLIEDVLDSLHGAKIFSKLDLISGYHQVSVNEPDRYK
                     TSFITHEGQYQWNVMPFGLTNAPATFQRLMNAVLRPYISKFCVVYLDDILIYSKTREE
                     HLHHISQVLDKLRKHSLYPKKSKCHFMLTQVQFLGHVINANGISTDPEKINAIKQWPI
                     LRNYKDAQRFLGLANYYRRFIKNFSKMASPLYEFAAKKNTKWTTECHNAFISLKDALI
                     SAPILIAFDPKSPYQLTMTVDASDNCIGATLEYKDGRKPKGVIAYLSHKLHSYETRWH
                     IRDKELYAIVFALKKWTHYVQGSHVIIYTDHKTNVNLNRLALLSPRLARWAEVLANYD
                     FEIKYIPGPRNHADILSRPPGEPEITDSTDNDLIEIDSDHTDVNNKQGNSPETQHLAK
                     VFFDPRPIKDLKNVTIETINAEVLKDPYYENIAQYIRDPNRPIPSKYFELVRRFRYFG
                     DILVYQDKQDYVVYRVCIPKTLVHEIIREHHDTPLFGHRGADTTYKHLLKGFYWPNML
                     DSIKQYIKRCPECRKGKHPTTHPYGPLHSHPIPNQRWSEISIDFIDAFKTSGDNKYDR
                     ILTIVDNFTKMAHFIPCRKKDFTAEMLTDIFIQNIIKLHGRPLRILSDNDVLYTATAW
                     TAVMNRLQIHRDYTTVASSSSNSFAERTNRTIEEILNTLVAHSPTKWSTYLPLAEFAY
                     NNSYQATIDTTPFFANQGYHPLAINYYMPMQGDNAPYKLTDHPTIDEHQEAQEALYLK
                     IKQKIADQNAAKALKNNVNYQTHAYQPGDQVVVHQSVYKPPKRDEYNQLKQISKKPHY
                     VWYGPFTIKAKKTDQTYLVRTHNRLDGNLKEFHIRHMRPYYKKLLPKRNVPPIDTAKA
                     DSVAHESTNVINVDWKHNDWRMAAQWAHCEPWDYSIYDQKDKPLLSHLEQRMDMFDTT
                     ISLKQALARL"
     mRNA            complement(<682419..>683243)
                     /locus_tag="CAGL0G07183g1"
                     /old_locus_tag="CAGL0G07183g2"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446673.1"
                     /db_xref="GeneID:9487993"
     CDS             complement(682419..683243)
                     /locus_tag="CAGL0G07183g1"
                     /old_locus_tag="CAGL0G07183g2"
                     /note="encodes gag of gb|AY673967 Candida glabrata Tcg3
                     LTR retrotransposon (Ty3/gypsy superfamily)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446673.1"
                     /db_xref="GeneID:9487993"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX1"
                     /translation="MVAPASNRNTRPAEEPERTSRPAEEPERTTRPSETPDSDYDSSL
                     DLYPPDSDLLEEESKLRHYLKDEVEHLTKKIARSNARRKEWLTDMRGAVRKFRTLPDK
                     VLINNIRRATDDDIKYDLTKIREDLPSRITIKTFLKAIDNHYERSSKETVRHVNLIDR
                     PKFITAASLRRARDAFENICDEENMTCAIYATKHYLPPRIERQIDDLHWPSPSTILDE
                     LDNEIEKRKAKEKYFKSNKYKNKFNKRRYNPKRFNNNRRNNNSSGGGFSSNKNTKN"
     repeat_region   complement(683243..684206)
                     /note="LTR of gb|AY673967 Candida glabrata Tcg3 LTR
                     retrotransposon (Ty3/gypsy superfamily)"
                     /rpt_type=long_terminal_repeat
     gene            <684868..>685831
                     /locus_tag="CAGL0G07205g"
                     /db_xref="GeneID:2888172"
     mRNA            join(<684868..684888,684995..>685831)
                     /locus_tag="CAGL0G07205g"
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /transcript_id="XM_446674.1"
                     /db_xref="GeneID:2888172"
     CDS             join(684868..684888,684995..685831)
                     /locus_tag="CAGL0G07205g"
                     /inference="similar to AA sequence:UniProtKB:P51998"
                     /note="similar to uniprot|P51998 Saccharomyces cerevisiae
                     YML025c YML6"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL6"
                     /protein_id="XP_446674.1"
                     /db_xref="GeneID:2888172"
                     /db_xref="GOA:Q6FSX0"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013005"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="UniProtKB/TrEMBL:Q6FSX0"
                     /translation="MSRSALKSVDRLRLVINTSRNFSSEAAVLPNAAPRPKYTLATVR
                     SFPSLEPNSFIPVSANVLSLPLRRDILWQAVVYENDKRRVGASNPPGRSDKGFSRKKL
                     LPQKGSGKARVGDANSPIRHNGGRALARTAPNDYSTELNKKVYSTAFFTALSHQYKLG
                     NLFVIGKEGEIAKNDVEILDIDLGQKPVPSDKIKPNKMAELENEYCEMYFKKFLAENN
                     LFKQRLLFVTNEPREKLLHASDKYKDKIDIIQKEHLEVNDILRAGKIYIELEALKGIS
                     AKYMSYLEN"
     gene            <686787..>687748
                     /locus_tag="CAGL0G07227g"
                     /db_xref="GeneID:2888173"
     mRNA            join(<686787..686836,687355..>687748)
                     /locus_tag="CAGL0G07227g"
                     /product="40S ribosomal protein S18"
                     /transcript_id="XM_446675.1"
                     /db_xref="GeneID:2888173"
     CDS             join(686787..686836,687355..687748)
                     /locus_tag="CAGL0G07227g"
                     /note="highly similar to uniprot|P35271 Saccharomyces
                     cerevisiae YML026c RPS18EB and highly similar to
                     uniprot|P35271 Saccharomyces cerevisiae YDR450w RPS18EA"
                     /codon_start=1
                     /product="40S ribosomal protein S18"
                     /protein_id="XP_446675.1"
                     /db_xref="GeneID:2888173"
                     /db_xref="GOA:Q6FSW9"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW9"
                     /translation="MSSLVVAEQGSFQHILRLLNTNVDGNIKIVYALTTIKGVGRRYA
                     NLVCKKADVDLNKRAGELTQEELERVVQIMQNPTQYKIPAWFLNRQRDIADGKDYHTL
                     ANQVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA"
     gene            complement(<688189..>689226)
                     /locus_tag="CAGL0G07249g"
                     /db_xref="GeneID:2888174"
     mRNA            complement(<688189..>689226)
                     /locus_tag="CAGL0G07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446676.1"
                     /db_xref="GeneID:2888174"
     CDS             complement(688189..689226)
                     /locus_tag="CAGL0G07249g"
                     /inference="similar to AA sequence:UniProtKB:P34161"
                     /note="similar to uniprot|P34161 Saccharomyces cerevisiae
                     YML027w YOX1 homoeodomain protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446676.1"
                     /db_xref="GeneID:2888174"
                     /db_xref="GOA:Q6FSW8"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW8"
                     /translation="MLPALNTVIHEEKSPFLTSNFQCDNQGVIRLPPILSQHVARPKS
                     VESCVRYTAIASAMHTPHANYLATPAPKPRLVTVQHTVPSTPAATPVSATPLATKPKS
                     KKLDNILTPISAVKAAISTPSSDDKKRAFAFITHSQETFPTKEPKIDNAQLARRKRRR
                     TSSQELNILQAEFQRCSTPDKQTRINLAQRCNMTEKAVQVWFQNKRQAMKRHKVIADN
                     RSRSNGSTTSTTPLASRTPSEDFNISTDTSSCDDSESVPQLALPLSTSSPKKAPLSPR
                     PKSPTKKRSQALTFHLDASNKTLTPVKTSPNRRVNRLINNENLTSPSKSKKVTKVKKE
                     PLKSLDVNVKH"
     gene            complement(<689815..>690402)
                     /locus_tag="CAGL0G07271g"
                     /db_xref="GeneID:2888106"
     mRNA            complement(<689815..>690402)
                     /locus_tag="CAGL0G07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446677.1"
                     /db_xref="GeneID:2888106"
     CDS             complement(689815..690402)
                     /locus_tag="CAGL0G07271g"
                     /note="highly similar to uniprot|P34760 Saccharomyces
                     cerevisiae YML028w TSA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446677.1"
                     /db_xref="GeneID:2888106"
                     /db_xref="GOA:Q6FSW7"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW7"
                     /translation="MVAQVQKPAPTFKKTAVIDGVFDEVSLDKYKGKYVVLAFVPLAF
                     TFVCPTEIVAFSEAAKRFEALDAQVLFASTDSEYSLLAWTNVPRQDGGLGPVDIPLLA
                     DTNHTLSRDYGVLIEEEGIALRGLFIIDPKGIVRHITINDLPVGRNVEEALRLVEGFQ
                     WTDKNGTVLPCNWTPGAATIKPTVEDSKEYFKNVK"
     gene            complement(<690620..>693448)
                     /locus_tag="CAGL0G07293g"
                     /db_xref="GeneID:2888107"
     mRNA            complement(<690620..>693448)
                     /locus_tag="CAGL0G07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446678.1"
                     /db_xref="GeneID:2888107"
     CDS             complement(690620..693448)
                     /locus_tag="CAGL0G07293g"
                     /note="weakly similar to uniprot|Q03714 Saccharomyces
                     cerevisiae YML029w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446678.1"
                     /db_xref="GeneID:2888107"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW6"
                     /translation="MDLLVGKPWKLRVYHGDRSLNVNVFPETKVSRLVQYLHLVLGAV
                     EPVEPVDECGLKYKDTVLPLYFSLKEALRTYSYADASLDVPSFIRLEFVHTLERGGYA
                     HRSGEDIKLAYSPEYFGKFVTVGLEVNTLSLDKIATTIVERVDLKQMGIMNVLAEEVV
                     KKLVRYEEDEDKNMCGLMEKHSTHNLLAFLIKGNHIPFKFLHDLDPHCYDSLTLLDLL
                     GVDILPSDAAKITIMFNCAHEQRQLKNNEDETEEEDEGDTLEFISDSVLSIRSMKFDE
                     NTTVRDVKEFVCSVYTHTLSLSVEDIKLVYKGNLLKENGSKIMSCIEYGSEASGTYKL
                     HVQINQEFNEPAGPGFWSELFSNPNLFDYVQSSTRLNTPALTRTPTSENLATPSLQRL
                     NSNLRSVSPFEAMANEPELEFFDEEGRKLVPLEGELYWKCLLVEEDKEVFVNCKYLNE
                     RDVKLEIDGKEFEMSSFDYDYDNNSKELVNLSKDFIARLEKSLGIKIKKNSITVGRDG
                     SAISSSNIELGHENVNSVGQRVRRQNRDDRASRTSVRPDTFKQRMVRYFGKFIGLGLL
                     VFRTLYLVGYNALIPVFILYEFSPLVPSKYSYLIVLLLVARAVWNTHEIWVMWAAYLH
                     LNEVNEEQLKAIEEHVEMRRVSRQYFSSVGVKGWDHLEKSVKRLIIEPAELQSIRQEL
                     YTTAGLISESNSESSQETEVQEENADGQGEVVPPVIPVEEQLKYMREIFIRLSKDESE
                     ANVELLEKMYVLLNATLERYKARRTRLVRNPPLKKMWDDLLVLLWRDVKHVNPSPSFT
                     TTVVDKVGRIIDFVEHQQVLDTCLEHVVPNPSRDSVFVAIPKNLVLFILLFFPYVKEK
                     TLSILQRREQLVQRPQAPQAPQAPQAPQAPQPSQEEQPHDPEEHPASHTADQEQQQGQ
                     PQGHEEHTVVDTADQHDHEEQVQVREEE"
     gene            complement(<693722..>694198)
                     /locus_tag="CAGL0G07315g"
                     /db_xref="GeneID:2888108"
     mRNA            complement(<693722..>694198)
                     /locus_tag="CAGL0G07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446679.1"
                     /db_xref="GeneID:2888108"
     CDS             complement(693722..694198)
                     /locus_tag="CAGL0G07315g"
                     /note="highly similar to uniprot|Q03713 Saccharomyces
                     cerevisiae YML030w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446679.1"
                     /db_xref="GeneID:2888108"
                     /db_xref="GOA:Q6FSW5"
                     /db_xref="InterPro:IPR007667"
                     /translation="MSRLPSSFDVEDADVEELSFADKIVYHCKQQPLVPIGTLLTTGA
                     VILAAQNMRIGNRKKTQFYFRWRVGLQAATLAALVAGSFIYGKDKYDQKKKEDQMKEK
                     AKLREQLWIKELERRDAEAQDRKKKAEAARLKTKENEAAIQKLEQELKELEAKASK"
     gene            <694466..>696322
                     /locus_tag="CAGL0G07337g"
                     /db_xref="GeneID:2888109"
     mRNA            <694466..>696322
                     /locus_tag="CAGL0G07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446680.1"
                     /db_xref="GeneID:2888109"
     CDS             694466..696322
                     /locus_tag="CAGL0G07337g"
                     /note="highly similar to uniprot|Q04121 Saccharomyces
                     cerevisiae YDR456w NHX1 NA+-H+ antiporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446680.1"
                     /db_xref="GeneID:2888109"
                     /db_xref="GOA:Q6FSW4"
                     /db_xref="InterPro:IPR004709"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR018422"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW4"
                     /translation="MKHYKLYLLLAGVYAETVVGPLDEDLPSMEPVADPELSPVTEEM
                     FSSWALFILLFLLISALWSSYYLSRRRIRAVHETVLSIFYGMVVGLIIRMSPGHYIQD
                     TVTFNSSYFFNVLLPPIILNSGYELNQVNFFSNIVSILTFAIPGTLISAVVLGTILFI
                     WTSLGLEGVNISFLDALSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAI
                     SIVMFETCQKFHGQPAKFSSLFAGAGLFLMTFSVSLLIGVLIGMLVALILKHTHIRRY
                     PQIESCLILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRTQVTVKYIFQ
                     LLARLSENFIFIYLGLALFTEVELVYKPLLIIVTAISICVARWCAVFPLSNFVNWIYR
                     VRTLHSIRPSVGESIAVPDEIPYNYQVMTFWAGLRGAVGVALAMGLQGEFKFTLLATV
                     LVVVVLTVVIFGGTTAGMLEVMNIKTGCVDNGDPEEDEFDIENVGEDPLDDEPLQFNA
                     NSRNLMRPYTDLPTPVGNVRDFDENDFPSMSATPDRMSEQAASSQRPSGERTNLKDAI
                     GNMLRTDSQWFQNFDEQVLKPVFLDSTSSPMTNRDEGLNSNRDSPRFMSSRK"
     gene            complement(<696455..>698290)
                     /locus_tag="CAGL0G07359g"
                     /db_xref="GeneID:2888224"
     mRNA            complement(<696455..>698290)
                     /locus_tag="CAGL0G07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446681.1"
                     /db_xref="GeneID:2888224"
     CDS             complement(696455..698290)
                     /locus_tag="CAGL0G07359g"
                     /inference="similar to AA sequence:UniProtKB:P32500"
                     /note="similar to uniprot|P32500 Saccharomyces cerevisiae
                     YML031w NDC1 nuclear envelope protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446681.1"
                     /db_xref="GeneID:2888224"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW3"
                     /translation="MEAPVLNSRYSYHAIFTDICKTRFNHLVTRLFVTSSTLEILVFS
                     VLTKGDSSLIESLFLFTPKFVVLNIASLLIIVARKNYMHVQSFGYRNDITYVLGQVFS
                     LKSLIFLAVYTMASVLVGLVLGGSVNISPAESIYSRLLTWCVLPFFYTVQHILFDRDR
                     LSFSFDSQFQPPQEYITSKLGTIAVRSGILSTAFLLLHPFVFGFTSSTWFLNISTVLK
                     LTFLSFIVFLNFEFINLGFDSHMSIGCLHKGKPISTLSSTPIETLIDGLRSKKPFTKL
                     TAFQELSYRATAMSVSLRDPIYHTRYRNQNLWNIILKECIDVIEQSNTSVIKFLETLQ
                     NKPNKSKRPERSFTNSINDHARDELFGNVPESMAQPSSLNYGITSQSFRESDHNNKLP
                     LKMENILIQNKRTSNKKSRINQTDDFVFDHVHRYDEPIITHEPSIVKFIRGINLYIRG
                     KLSSVFFPSGTKSKDEKLDLASIFDVFLSSKKRQADILVPLASCNGCAVVALMGFLVK
                     SHAEDQKGVVVASVGEVLKVLERSVGVLGRFADWDPKSSLTATLFNKEVEQGPDAVSV
                     LYNLCISAFLEIVLKYNALLNEVYLDDDVLRLSRWVLDICNTESM"
     gene            <698805..>700322
                     /locus_tag="CAGL0G07381g"
                     /db_xref="GeneID:2888225"
     mRNA            <698805..>700322
                     /locus_tag="CAGL0G07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446682.1"
                     /db_xref="GeneID:2888225"
     CDS             698805..700322
                     /locus_tag="CAGL0G07381g"
                     /inference="similar to AA sequence:UniProtKB:P06778"
                     /note="similar to uniprot|P06778 Saccharomyces cerevisiae
                     YML032c RAD52 recombination and DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446682.1"
                     /db_xref="GeneID:2888225"
                     /db_xref="GOA:Q6FSW2"
                     /db_xref="InterPro:IPR004585"
                     /db_xref="InterPro:IPR007232"
                     /translation="MVKEEEKDKVHFNHDDIQQKLDKKLGPEYISKRIGFGSSRVAYI
                     EGWRAINLANQIFGYNGWSTEVKNIIVDFLDERQGKFSIGCTAIVRVSLADGTYREDI
                     GYGAVENERRKPAAFERAKKSAVTDALKRCLRGFGNALGNCLYDKEFLSRIDKVKFDP
                     PDFDEGNLFRPSDEISEYSRSNTIDNDNPAVKRQKLNNQNSIPDTNKVKYNGSAPAPA
                     ITYNNAPKKPVQSEERYAPNGSRGKENAQNKSENEDLLDDSFMFSDDLQDDELISLMN
                     KNSSDPDRRFNNAPKENTGDITFVTARAADSYQSTENVPENLKFDPKYVPHSMKLTID
                     QNTSKHIPLSVLKEKGVTATSREAIYSRFAAKGKQIPNPIDDSTDSRLAENDKSNEND
                     DTETSHSTEIEKSAISSVNNGTNISGSTESSVTTVPSHNSTSQTTNIEAKVDKADSQV
                     SEKQSQKGIKYAPQVPVVHPNTSAAIPLNQNKPLRREVGRPKINNVGPKKPSPTP"
     gene            complement(<700555..>703104)
                     /locus_tag="CAGL0G07403g"
                     /db_xref="GeneID:2888226"
     mRNA            complement(join(<700555..701123,701253..>703104))
                     /locus_tag="CAGL0G07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446683.1"
                     /db_xref="GeneID:2888226"
     CDS             complement(join(700555..701123,701253..703104))
                     /locus_tag="CAGL0G07403g"
                     /inference="similar to AA sequence:UniProtKB:Q03707"
                     /note="similar to uniprot|Q03707 Saccharomyces cerevisiae
                     YML034w SRC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446683.1"
                     /db_xref="GeneID:2888226"
                     /db_xref="GOA:Q6FSW1"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW1"
                     /translation="MVTNILVPGFKPESLTVAKLRRVLTEHGVEYPANAKKAELAKLF
                     KKHIKPKIPEMRKKEKGVRASSDGISRITSKKKTMKEIRKAQAKQKVVPEPKESSESA
                     SDSESDTESSSSTASDSSSASSSSSSSSSSSNSSSSYEMEQDDTVETENEFQTARSKR
                     KAEQEVEELEKVEKKPEEPVHLDFSYKKQKGNELDHLKSIKVSDKMASLINNAISDME
                     KEKDKENKDVSMHDGNDSEPSSSSNLISDQGAPKESDAQPHTSGTDMYNAFIKEDTPS
                     DTAPEVEEQTTQVKNENSSTEDFGNEAQPLDNSNDISLTSKTTVQNPFADTSNSSIQE
                     INISRPQVDNSFSNTINSDNVFIGKLKSENSFLFDDHEEVAEEPEVKTIQIEEVESVD
                     DEASESDLVKESTEEIMNPPPKKSSFVCKALKLLLKLILLIVAGALIAIIINLAVWYR
                     EQSIMVGYCGQEREGRSEYFEKLNLPYRDEVESFLEPYKPECQECPEHGLCYPNLELR
                     CKPGYRLQNSLYSLNGLIPIGASCEKDDERERMISEIVAKALELLRIKNAQVECGESS
                     DDIESGITEEIVYQIFEESKKDWISEEQFNELWSSVIKQLEKEPEITMRQVTNRHREQ
                     IKPRYKSKTNDNQRQKESIPERRERENFILRSSSKKYISLGCHFENELHQTIMKYRKI
                     ILIVLGFIISIAVIRYRIKTYFEQKKKIANYTNEVIELLKDKKATDKGDAFISSVHLR
                     DYILDGKGSTKTKNKLWEEILKKLNQNTNIKSSLMEVHGDMMKCLEWVGPTDVKRKIK
                     PDGINENQ"
     gene            <704144..>706420
                     /locus_tag="CAGL0G07425g"
                     /db_xref="GeneID:2888227"
     mRNA            <704144..>706420
                     /locus_tag="CAGL0G07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446684.1"
                     /db_xref="GeneID:2888227"
     CDS             704144..706420
                     /locus_tag="CAGL0G07425g"
                     /note="highly similar to uniprot|P15274 Saccharomyces
                     cerevisiae YML035c AMD1 AMP deaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446684.1"
                     /db_xref="GeneID:2888227"
                     /db_xref="GOA:Q6FSW0"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="UniProtKB/TrEMBL:Q6FSW0"
                     /translation="MFMDDRKDKDGLSVDEPQVSRDEESGGSDAHFSYHEGRKIFENS
                     SKHVAVDQEDLSSSGFLPQPHHPTMMGANGNGQGQGKKNRTLSSNARHTLPDAPLSKA
                     EIVNKITDDSVRDKTPLYKMGMLSDDASQQILEDPSPELVDLYTKVQECRDLRTKYQS
                     LSLQYNSQNPKNSQDWEIYPPPPKPSYNAETKTVIAVTNKPDAEVFDFNECEIPGEDT
                     EWDFGTNDDDSYYVHKPGKEDEILANIPSLRDYYKDLEKMVGISSDGPAKSFAFRRLQ
                     YLEARWNLYYLLNEYQETSVSKRNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKYKL
                     RHCKDEKVIFRDGKVLTLDEVFRSLNLSGYDLSIDTLDMHAHKDTFHRFDKFNLKYNP
                     IGESRLREIFLKTNNYINGSYLAEITQQVLSDLENSKYQNCEYRISVYGRSLDEWDKL
                     ASWVIDNKVISHNVRWLIQIPRLYDIYKKTDTVKTFQDICTNIFQPLFEVTKNPKSHP
                     KLHVFLQRVIGFDSVDDESKVDRRFHRKYPKPSLWDSPQNPPYSYYLYYLYSNMASLN
                     QWRAKRGFNTLVLRPHCGEAGDPEHLVSAYLLSQSISHGILLRKVPFVQYLYFLDQVG
                     IAMSPLSNNALFLTYDKNPFPHYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIY
                     KLSNVDMCELARNSVLQSGWEAQIKKHWIGKDYELPGVEGNDVGKTNVPNIRINYRYD
                     TLATELELVNHFANFNKD"
     gene            complement(<706598..>707764)
                     /locus_tag="CAGL0G07447g"
                     /db_xref="GeneID:2888228"
     mRNA            complement(<706598..>707764)
                     /locus_tag="CAGL0G07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446685.1"
                     /db_xref="GeneID:2888228"
     CDS             complement(706598..707764)
                     /locus_tag="CAGL0G07447g"
                     /note="some similarities with uniprot|Q12467 Saccharomyces
                     cerevisiae YPL168w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446685.1"
                     /db_xref="GeneID:2888228"
                     /db_xref="GOA:Q6FSV9"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV9"
                     /translation="MSKLIPLTLANSRAVNLSVRWTSTINRSTKTNGSRDPQSTAAKG
                     KSVNEFIQKVLKLKDIKSVAPESALYSVLSDIGAKHGLKDIKNKKTFANLQLLLLQKR
                     ISDGEISECLTKLDNHKEITNIVSPIHPNAKQPIKKKVIHVNLKPSTAKPNHNLDDDT
                     ISSGLARKSADQSKVAGKSTKGDIDIKALENYLDLIELREKQKQNMQNMTKRAYKWDE
                     VTSNVGVSPGKMIFGSDINTTTKSNIKIRRMTNKIATVTGFLNKSKKRYKPILIYDLS
                     SKETTNKLLGKNFNLFNVNHTDLFGIINAAHFPPEEILGLISKFEDDGWKLIGNIHDK
                     EYCVVFQGDESKLIVDNKPNILIPTALMLVGFGSLYYYYVNYYDEEQSKVEEDN"
     gene            complement(<708261..>710267)
                     /locus_tag="CAGL0G07469g"
                     /db_xref="GeneID:2888115"
     mRNA            complement(<708261..>710267)
                     /locus_tag="CAGL0G07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446686.1"
                     /db_xref="GeneID:2888115"
     CDS             complement(708261..710267)
                     /locus_tag="CAGL0G07469g"
                     /inference="similar to AA sequence:UniProtKB:P14906"
                     /note="similar to uniprot|P14906 Saccharomyces cerevisiae
                     YOR254c SEC63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446686.1"
                     /db_xref="GeneID:2888115"
                     /db_xref="GOA:Q6FSV8"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV8"
                     /translation="MALSYEYDEGSETWPFFLLTLLLMVLVPMTIRQLYKLTKSTDAV
                     SELGENKELQDKYTELNKELESSSVRKFREQWATKLMDPGNGLFSFTNLMLFIGWVSV
                     ALLIQRIAANTETITQSMAQMFDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKE
                     LSAEERTAMEEMYVQISKAHEALTDPIVRENYLKYGHPDGPQSTTHGIAIPSFMVSGS
                     ASPLLVIFYVSLLGVVLPYLVGKWWTRTQSYTRKNIHVNTASYLVDRLVNYKPSEIVT
                     VNLIVQWISHAQEFKNFYPNLNSKDFEKLLQDHIHRRDSGSEEKNQIKYRIVSKCHSI
                     LHGLLDIAAGFRNLDVAISTLDTFKCIVQALPNTNNGEILQLPNVDKEVFEKAAAKEN
                     VHTLGKLFTFEDKKIGEILGIEDKQLLQQTLSVASNIPFLKLIRADFVVPGEPAVTPS
                     STPYISLKVLVRSAKQKLIPTEKFPAEMLEEKTDFESLRDPFASMLEQPLVPQTLSPH
                     FPVERKSSWVAFLCFQKDLKILQTPVNIDRLSFKNLSKHLDKREIKELGKDFNAEDWE
                     IGTIKIPLSQPAPPKPETVYFRIVLKNTDYFGPDLDFTMTMNVQDEAHVSKPTIEEEL
                     EKDIAQEYDSSDEDEDESDVDDEDESDSDYTDIDTDTEAESDSD"
     gene            <711001..>712326
                     /locus_tag="CAGL0G07491g"
                     /db_xref="GeneID:2888116"
     mRNA            <711001..>712326
                     /locus_tag="CAGL0G07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446687.1"
                     /db_xref="GeneID:2888116"
     CDS             711001..712326
                     /locus_tag="CAGL0G07491g"
                     /inference="similar to AA sequence:UniProtKB:P46985"
                     /note="similar to uniprot|P46985 Saccharomyces cerevisiae
                     YJL183w MNN11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446687.1"
                     /db_xref="GeneID:2888116"
                     /db_xref="GOA:Q6FSV7"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV7"
                     /translation="MSLKPRSLTAKKRRPSQNHGELMALGIGNPLDVVRKYLGLGVSD
                     MDLNDGRYVSKKKRNRYTVMPMLVFFVVVMYLLVSTFMPNGMRAPVTYPPEHGAYQNE
                     VISSSPLIFPHVEHAPVLKEIGIRGLFILRMEMDGTKRFVIKPEDKPFSDEEKKKTTD
                     QVLLVKKSFLDHGKLIFPKKNESPEFVVVTLVDFDNFDRDTIVKIVQNRVDYAQRHKY
                     GIYVRWAQEFVTEMSIQEVAPSYQLMKASIMRAAIHAFPYAKYFLFLDQTSLIMNSEI
                     PLQKLILHQPTVEANKQVLPILQHYNGRNVPAKLAQQPDLVFPQHDNGVLDLSAFIVA
                     NSLHGKMFLDYLNDPLVRDYHWDDIYTQYGHVLNWHPELLDRTLLVKRKTLASPVEDP
                     TNLNIKDNKIDGGDSGYSTGDFIASLAKCKERISCTSDLDVMYKFSHMG"
     gene            complement(<712588..>713559)
                     /locus_tag="CAGL0G07513g"
                     /db_xref="GeneID:2888428"
     mRNA            complement(<712588..>713559)
                     /locus_tag="CAGL0G07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446688.1"
                     /db_xref="GeneID:2888428"
     CDS             complement(712588..713559)
                     /locus_tag="CAGL0G07513g"
                     /inference="similar to AA sequence:UniProtKB:P22135"
                     /note="similar to uniprot|P22135 Saccharomyces cerevisiae
                     YJL180c ATP12 F1F0-ATPase complex assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446688.1"
                     /db_xref="GeneID:2888428"
                     /db_xref="GOA:Q6FSV6"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV6"
                     /translation="MLKVYRRLSYWRLHIGRTRFYHASSRASPLGVDSSIENNLKTET
                     NKLSKTGQKFWDQVGLDFGGDKITVQLDSKPLRTPLGNNLAIDHDRKVLGLMLKKEWS
                     NLQEVASKKFSLPLTSLVSRCIDLETTSNADCDPEAVAKIGGDTTVIKNQLLRYMDTD
                     TLLVFSPAKEFEGALREEQDKLYLPIIKKIEEFLGQYSSSDKQLTLQILDADVHGLRG
                     NVQSQEVKDAAMNYMDSLSPWDLAVFEKTVLTTKSFICGILLMESMTKKSTHKELVKS
                     LDEIIRLATLETIFQVERWGEVEDTHDVDKRDIHRKISSAAIVAFKN"
     gene            <713742..>714068
                     /locus_tag="CAGL0G07529g"
                     /db_xref="GeneID:9487996"
     mRNA            <713742..>714068
                     /locus_tag="CAGL0G07529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999500.1"
                     /db_xref="GeneID:9487996"
     CDS             713742..714068
                     /locus_tag="CAGL0G07529g"
                     /note="highly similar to uniprot|P46988 Saccharomyces
                     cerevisiae YJL179w PFD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999546.1"
                     /db_xref="GeneID:9487996"
                     /db_xref="GOA:B4UN03"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:B4UN03"
                     /translation="MSTQAQEMATTLRMNKGQLEIVEQQLSQLERQQKFAQATAKELE
                     SYPTETVWRSCGRAFVLQDKDSYIKDLGTDEKTLEEQAKALRIKKNYLDVSIEKTVAG
                     LKSMMK"
     gene            <714360..>714971
                     /locus_tag="CAGL0G07535g"
                     /db_xref="GeneID:2888429"
     mRNA            <714360..>714971
                     /locus_tag="CAGL0G07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446689.1"
                     /db_xref="GeneID:2888429"
     CDS             714360..714971
                     /locus_tag="CAGL0G07535g"
                     /note="highly similar to uniprot|Q08746 Saccharomyces
                     cerevisiae YOR294w RRS1 regulator of ribosome synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446689.1"
                     /db_xref="GeneID:2888429"
                     /db_xref="GOA:Q6FSV5"
                     /db_xref="InterPro:IPR007023"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV5"
                     /translation="MSEYKNLPVTVEKPIPVTYDLGNLSVFDTNVIDRNDVDSSNAKR
                     EEVIKSVTRDNVQLLINQLLSLPIKKTTEHTGGNSGQGATVALLQLPEPSSELPREKP
                     LPKPKALTKWQKFAAKKGIKPKERAGKMVFDEATGKWAPKWGYNGINKKLDDQWLVEV
                     DDDTKGTENELIDPRSLNRAERKRLVKKNERQQKKNLKNAMGQ"
     gene            <715354..>716079
                     /locus_tag="CAGL0G07557g"
                     /db_xref="GeneID:2888427"
     mRNA            <715354..>716079
                     /locus_tag="CAGL0G07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446690.1"
                     /db_xref="GeneID:2888427"
     CDS             715354..716079
                     /locus_tag="CAGL0G07557g"
                     /inference="similar to AA sequence:UniProtKB:Q08747"
                     /note="similar to uniprot|Q08747 Saccharomyces cerevisiae
                     YOR295w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446690.1"
                     /db_xref="GeneID:2888427"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="InterPro:IPR019835"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV4"
                     /translation="MAPQYISEEYESMIDAVLTYCDEEVSLNSLRAQLNEVFSLNIKS
                     FDLNLRTLVDKKLEAFKNVTEKPKVKDISTDKVMTENRRYINVIKQTLKEAELKKEGI
                     TVTKVQKPKLKLKVTNSKKSMIHIKMTVTPELQAVIGTHYQSRTEIVRNLWKYIKEHN
                     LQNPDDKRQIISDAMLEPVLGKTSDIFMMHRALKHHILGPAPIEAEVIRTDQESTPSL
                     ASESSEQEHADSTDTSDSVYYST"
     gene            <716580..>720413
                     /locus_tag="CAGL0G07579g"
                     /db_xref="GeneID:2888339"
     mRNA            <716580..>720413
                     /locus_tag="CAGL0G07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446691.1"
                     /db_xref="GeneID:2888339"
     CDS             716580..720413
                     /locus_tag="CAGL0G07579g"
                     /inference="similar to AA sequence:UniProtKB:Q08748"
                     /note="similar to uniprot|Q08748 Saccharomyces cerevisiae
                     YOR296w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446691.1"
                     /db_xref="GeneID:2888339"
                     /db_xref="GOA:Q6FSV3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR008528"
                     /db_xref="InterPro:IPR014770"
                     /db_xref="InterPro:IPR014772"
                     /db_xref="InterPro:IPR019558"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV3"
                     /translation="MSRNSSNQYSIYSEVNSADDESILKETYHYTLIVILLEYMAEPR
                     FHVNSTGAPQPLRDEMNQKSKSGEFLLREQSSIGSYQNSSSAKDYLLVALTERLSLIT
                     RNQIKVTDPNFKRCLLKFYNDYFLDPNMKIKLKQTSNIEDIVAYFSQSANKELNKVLL
                     DNFSLELYRQVASFLELLINCTPEKYMADFKPKLEAMKSTFEPNRYRPLTKRYSLDMN
                     SNVPITAQRQPSWNLDDISHIGYFMKLFAMDKMKIQYDVNDILKHLSLSSYKNELLEL
                     RVKVKNSSFSLSVSDFPTEREYRNWQNYIFGETTQLIDKFSSEQISNINAPTPCIPSN
                     RKAIISKLFELIIQSEYKNDEKVLALSKESTFFIFKCAKYWLSDFPSTIASLFFAAMN
                     KVLFTNDMLNVEFVEKSIMMVSNLFLRSRETKELTTWNNYDRILWVKTLRVICSKTFK
                     SISILLSKLFDPNLPSFSPYLSFYFTIKYTDRYTEDYLKSTSFEKKWAESLRNNINRA
                     CQTYYQSLVSTLPRDETLEIQHIQDIAEKIYKMIEKLQKKYPKPMFEDVNIAFVVADF
                     LINAFLVDLETMLRFVKHYHKIASKSIAPVDGLECYKAIVDLREIYVQIKPNELFPIN
                     LESMFGQFLQALNDDIKKRIMHVVKSSIKAEKWVRMNDATYYSTSIVDIFRLVNEAVQ
                     IFTKFDWEDQYEIAYLTTNILSEFTEGLKYYCSKLQNLAENDLQMDVINLITVTPEST
                     PLSSGIEKLDKKGKTWSFHQMKRALKSKPSIMVPAPYEYTVRTCVILNNLDAMLGMIT
                     RLDELVKPQELSKYLSEAKAKPNRSTENSNNINHIFTIRVLNTMEVHADTNDGFSNLR
                     VTLNDSNRKSELGSTRIIEDSLNPIWDEEFELRISNKEKAYIDFLVWHHSDAKNTKMV
                     ELCAKGHVVLDPKRFSDNGLPSEMSIAMSPKGHLNIHVTLETEKMDPLFCIGNAYRTA
                     LRSKEKLLNMIVTKFSTVVAHIISKNTLKFVKAEKKNYVGKDAEEVVYDAIVPLFDYL
                     NSNLSILASELPKELLFEVILKAWDVILLRADSMLLPSLSSISSSGLVNSARKSIWRN
                     SISSNPTISGFGKPLTEEDISIVFKWLDALCIDFFHNEGAGPSIENLKNVKYTSMLNI
                     PKFYGTSVPELKKLILQLEKSYDQYLDHIYNQDHATIQLIRTQTMGVSRHATIMGSST
                     KATREQLKDIIKEEEHDPLKISADKMDVILRILLAKGEFHFVYKNLERRKKLLKKMEN
                     KRMARNAAMGKKAIQ"
     gene            complement(<720895..>722157)
                     /locus_tag="CAGL0G07601g"
                     /db_xref="GeneID:2888340"
     mRNA            complement(<720895..>722157)
                     /locus_tag="CAGL0G07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446692.1"
                     /db_xref="GeneID:2888340"
     CDS             complement(720895..722157)
                     /locus_tag="CAGL0G07601g"
                     /note="highly similar to uniprot|P38355 Saccharomyces
                     cerevisiae YBR287w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446692.1"
                     /db_xref="GeneID:2888340"
                     /db_xref="GOA:Q6FSV2"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV2"
                     /translation="MATPETFSFGQIAYQVFESVMQVVIISFAGFWSARSGLLPKKAQ
                     KAISALNVDLFTPALIFSKLARSLSMAKILEIAIIPLFFGLTTFISFFSGRLISRVLK
                     LDRDETNFVVANSIFGNSNSLPVSLTLSLAYTLPNLVWDQIPNDNRDNVASRGILYLL
                     IFQQFGQMLRWSWGYNKLMRWSGENTQHMPPSQVQAHLESRSSLATSALAQTGASSEA
                     TSMNYVPSTFSQKIVDNSRGIVNKILSYLNPPLWSMIASVIVAAIPPLQHELFQDDGF
                     INNTLAEAVTQLGSVSIPLILIVLGSNLYPSEETFRRTHNYKKLIVGSIIGRMILPSM
                     FLLPIIAAAVKYINVSILDDPIFLVVGFLLTVSPPAIQLTQITQLNEFFEAEMADILF
                     WGYVVLSLPVSIIVVSAAIYVLQWAQPV"
     gene            complement(<722781..>724472)
                     /locus_tag="CAGL0G07623g"
                     /db_xref="GeneID:2888341"
     mRNA            complement(<722781..>724472)
                     /locus_tag="CAGL0G07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446693.1"
                     /db_xref="GeneID:2888341"
     CDS             complement(722781..724472)
                     /locus_tag="CAGL0G07623g"
                     /inference="similar to AA sequence:UniProtKB:P37302"
                     /note="similar to uniprot|P37302 Saccharomyces cerevisiae
                     YBR286w APE3 vacuolar aminopeptidase Y"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446693.1"
                     /db_xref="GeneID:2888341"
                     /db_xref="GOA:Q6FSV1"
                     /db_xref="InterPro:IPR003137"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="InterPro:IPR029514"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV1"
                     /translation="MKFSTIAVTAALVAYSNASVLPFYGEQQAFDLSALKETKETDWD
                     SIISGVKDALSQGHSEQDAAEVYEDDDEDVSPCKKSFWSFLWKPHVPYLLKPIVESDK
                     LQDKIELDDLNKTAHDLLKIAKKSKKKFGHPTRVIGSPGHGKTIDYILDAFDDMKDYY
                     DVSVQEFDALAGKIRSYNLTDAKTGKTFKNTTAFALSPPVKPFVGRVIEIPNLGCHEK
                     DFAAVHRKGSKHKHDIALIERGECPFGVKSDLAGKYGFHAVVIYDNEPLSLDGLKGTL
                     GAPTNHTVSTIGVTYVTGKEIIAKLAFDPDYSLYFAMDSYVGKIKTKNIIADTKHGDE
                     NNIVGLGAHSDSVEEGPGLNDDGSGTISLLTVAKQLTHFKINNKVRFAWWAAEEEGLL
                     GSNYYANSLSKEENLKLRVFMDYDMMASPNYEYEVYDANNTVNPPGSQELRDLYINYY
                     KDQGLNYTLIPFDGRSDYVGFIENGIPAGGIATGAEKKNVFNGGVLDKCYHQLCDDIS
                     NLAWDAFLVNTKLIAHSVATYANSFEGFPERIGSNKTISALQAPSFPYRGSNLII"
     gene            complement(<725259..>725540)
                     /locus_tag="CAGL0G07645g"
                     /db_xref="GeneID:2888342"
     mRNA            complement(<725259..>725540)
                     /locus_tag="CAGL0G07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446694.1"
                     /db_xref="GeneID:2888342"
     CDS             complement(725259..725540)
                     /locus_tag="CAGL0G07645g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446694.1"
                     /db_xref="GeneID:2888342"
                     /db_xref="GOA:Q6FSV0"
                     /db_xref="UniProtKB/TrEMBL:Q6FSV0"
                     /translation="MFQIFSRFDILFIPATTRFPPLVCLNGMHIPKLGQSALSQGMTT
                     VNHNLNYRHGNNELGSQIQAIGTLKDIHDLVAITGQHAPAPPQPLLASI"
     gene            <728351..>729127
                     /locus_tag="CAGL0G07667g"
                     /db_xref="GeneID:2888343"
     mRNA            <728351..>729127
                     /locus_tag="CAGL0G07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446695.1"
                     /db_xref="GeneID:2888343"
     CDS             728351..729127
                     /locus_tag="CAGL0G07667g"
                     /inference="similar to AA sequence:UniProtKB:P47032"
                     /note="similar to uniprot|P47032 Saccharomyces cerevisiae
                     YJL079c PRY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446695.1"
                     /db_xref="GeneID:2888343"
                     /db_xref="GOA:Q6FSU9"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU9"
                     /translation="MKLSIPLLSLAATSVLAAPAVVTVTEVAHEHDVKTVRGVVYVQG
                     GETKTSYTTLDDSTPTSVAEPVQENQVQNNAQAPAPSSSSSPTPAPAPAASPSSSSPA
                     AASPSPSPSPAQDSNLSDFAKSMLNEHNIKRALHQDTNPLTWSDELAQYAQNYANNYD
                     CSGNLVHSGGPYGENLAIGYSPVGSVDAWYDEIKDYNYANPGFSESTGHFTQVVWKSS
                     TKVGCAVKSCGGVWGDYVICSYDPAGNFLGEFAQNVAPLK"
     gene            complement(<729919..>730566)
                     /locus_tag="CAGL0G07689g"
                     /db_xref="GeneID:2888150"
     mRNA            complement(<729919..>730566)
                     /locus_tag="CAGL0G07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446696.1"
                     /db_xref="GeneID:2888150"
     CDS             complement(729919..730566)
                     /locus_tag="CAGL0G07689g"
                     /note="highly similar to uniprot|P36018 Saccharomyces
                     cerevisiae YKR014c YPT52 GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446696.1"
                     /db_xref="GeneID:2888150"
                     /db_xref="GOA:Q6FSU8"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU8"
                     /translation="MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQT
                     VKIKDGNEDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDVTQPDSLSKAQSWV
                     QELQNKVGDEELVIYLVGNKVDIVEADESARKIETEEGAEYAQAQKLLFKEVSAKTGA
                     GVKDIFQEIGEQLYSTKKASLKNKDQSRRTDSVSSNTVDIQTQRPSTNDTSSCCS"
     gene            <732457..>734019
                     /locus_tag="CAGL0G07711g"
                     /db_xref="GeneID:2888151"
     mRNA            <732457..>734019
                     /locus_tag="CAGL0G07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446697.1"
                     /db_xref="GeneID:2888151"
     CDS             732457..734019
                     /locus_tag="CAGL0G07711g"
                     /inference="similar to AA sequence:UniProtKB:P36112"
                     /note="similar to uniprot|P36112 Saccharomyces cerevisiae
                     YKR016w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446697.1"
                     /db_xref="GeneID:2888151"
                     /db_xref="GOA:Q6FSU7"
                     /db_xref="InterPro:IPR019133"
                     /translation="MLRTKITGSSHVLRTAFKRYSSTIDSGAVEVVKPKKTSFTRRLF
                     RLGLAVTAFYAGGVAVSQYDDDLGTLFTEKVPGAEKLVDSYVTYRYDPTISKMLSTEY
                     LLNLFKGENTEVKPSTSSRLVPIHDAIKELHLELLELDSENNSEPEMQKIINSLNSTI
                     NMINEQKLRIGGKKSRSIEENYKQLIEDILHLDKNLKETVSKSINEKTEEVVKKVREQ
                     YKRKLAVSEVELQDKYKNEFIHLKEEMEKHYQDILNQKLEANKQHLEAKHANEIALLS
                     ITQVSEFNKIIKEKVDSERNGRLAKIEDLDKKAENLTEALKHVNKVVTRNEAVKQIAQ
                     QIEIIRSKLNSHDLNSISLHDDLTRLRTLTDIAVPGPKPCCKHKDLTPSLFRVALDEL
                     ESVAGSSESKILSEEQIYNRWNLLESDFKTASLLPPNAGMLGHFTAKLFSLFLFTKRG
                     SALPDATDLDSVFARINENLRHSKLDKAVADVVTLKGWTHVLCDDWLKNARRKLEVEK
                     LVDVLDSELKSL"
     gene            complement(<734157..>735797)
                     /locus_tag="CAGL0G07733g"
                     /db_xref="GeneID:2888152"
     mRNA            complement(<734157..>735797)
                     /locus_tag="CAGL0G07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446698.1"
                     /db_xref="GeneID:2888152"
     CDS             complement(734157..735797)
                     /locus_tag="CAGL0G07733g"
                     /note="highly similar to uniprot|P36113 Saccharomyces
                     cerevisiae YKR017c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446698.1"
                     /db_xref="GeneID:2888152"
                     /db_xref="GOA:Q6FSU6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU6"
                     /translation="MTEEEVNFIYDDDEDEDDTMIMYENNGGVGINSTQDDLVSISKS
                     KSLVSQSSEFDIDEDYSGDDLEYDELLSVPITHENKKSLNNGSVPNLQYECLTTQDIF
                     QKMLNRVHHIQPILAIPTEDILTLLQHFDWNEERLLEAWTDRMDELLLEVGIHMDENK
                     SSKCREIILKEDFLCLICCESKSTETFSMECGHEYCVDCYRHYIKDKLHGGSVITCMN
                     CSLALRHDDIDRIMGNDFSAKLMESSIKSFVQKHNRNYKWCPFADCKCIIYLKDMSSL
                     PEYTRLHYSPFVLCTSDHRFCFNCGFEVHAPGDCKITNAWVRKAKKESENLNWVLSHT
                     KECPECSVNIEKSGGCNHMVCSSCKYEFCWICEKAWAPHGKNFFQCTMYKNDDSRNKS
                     TDENAKNLKKYTFYYRVFNEHEVSAKLDWRLGQTIGHKVRDLQEKIGISWIEGQFLTE
                     ALKTLSEGRTALKWSFALAYYADPSHNLTKIFVDNQGLLSKAVEDLSELLQIKNADSI
                     MKKKLDFYNKAGYVENRTLALLQCGRDLLCKGICKVTE"
     gene            <736112..>738169
                     /locus_tag="CAGL0G07755g"
                     /db_xref="GeneID:2888422"
     mRNA            <736112..>738169
                     /locus_tag="CAGL0G07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446699.1"
                     /db_xref="GeneID:2888422"
     CDS             736112..738169
                     /locus_tag="CAGL0G07755g"
                     /inference="similar to AA sequence:UniProtKB:P53038"
                     /note="similar to uniprot|P53038 Saccharomyces cerevisiae
                     YGR099w TEL2 involved in controlling telomere length and
                     position effect"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446699.1"
                     /db_xref="GeneID:2888422"
                     /db_xref="InterPro:IPR019337"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU5"
                     /translation="MGNGLEEYKKLTTQLEVDELVTTLDTVFQEKDSLTNIDVILTVI
                     KYVVSHHQVMPKSVILKLNWFFAHSLIGFSQLIKFGSDIDAKQSEQLIYIEYVTQFLK
                     SSTTYLQNYLIECTENRTKELILKRTFTGSTVFNFVKGKLNPLEYIELLNNQLVFALD
                     KLDSRSGDFHKYLGNHIASLCDFHNIFAPDVILSKTFLIKQERLETLSLFMKKTSEYT
                     RYKIGIKYLLPYLDKVCSDTNAQLVHHILGTLGIGKLILVQDIFRLNSFTLQKTILAI
                     LDSKKIDSVMDFLLMKFHSIEYESDNNTCQLIVTILKNHLNDSGKIKVCHSDQFLNAI
                     TKRLSDQDKIIRERSMYIAKIASNHKIDYESDFTIDIGKSIAHENYEVPESDWSLILN
                     SVNSNVNTNSSDTNISTSTHALEALNLDDSDDEEDEEGDQLKYVFLKDLTAALENKSQ
                     RGLTNILKNTVKLVRQKKLFRSEVAYYAGAMIRNIVILNNDLDEKQFEELRVNALVSI
                     LVVVPEKIDELLKMLFTAELSLQQRLSLLLSVSMSARELRGYDDKQILKPQFDFPTSM
                     LPWDRRQENNRIEEIDDNGSDNTSGGKVLWKSSKLTKNTEEINNRFREYASKFFYPLA
                     NGWLNGIDLGTFDKLFKTYYLSTLKTVYNCAYLVHDFEDMTTTMDTILQDAVNNNIPL
                     ELQ"
     gene            <738885..>741752
                     /locus_tag="CAGL0G07777g"
                     /db_xref="GeneID:2888421"
     mRNA            <738885..>741752
                     /locus_tag="CAGL0G07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446700.1"
                     /db_xref="GeneID:2888421"
     CDS             738885..741752
                     /locus_tag="CAGL0G07777g"
                     /note="highly similar to uniprot|P53258 Saccharomyces
                     cerevisiae YGR100w MIC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446700.1"
                     /db_xref="GeneID:2888421"
                     /db_xref="GOA:Q6FSU4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU4"
                     /translation="MSFFDSIKSKIVDSFIPLLSRDEKFRQEFKLPDGETIIDDLNAD
                     VAFAHVHSKMAKYDRQKLNSGDTGSAVQYAFPGKIMMTEHYLVFKDGYDGESCVMVLN
                     ISAIKRVERSTSNAYSFVLLVTLYSGSQILIQFVSLRHRSENFCERLKKNLRSNIPNA
                     KRLKSFLDTCYSEYLIYKNVLRVEDIKPPRAGLGQQYKYPGSPSIQREKAKLRLWFEY
                     FKDNGTNLSLVRNHTFKKLIRVGVPNRLRGEIWEYCSGSIYLRYQNPDEYQKLLTENA
                     GKTSQAIDEIEKDLKRSLPEYSAYQTTEGIQRLRNVLTAYSWKNPDVGYCQAMNIVVA
                     GLLIYMSEEQAFWCLNNICDLYVPGYYSKTMYGTLLDQKVFEAFVEDRMPNLWDYIVE
                     HDIQLSIISLPWFLSLFFTSMPIEYAVRIMDLFFCNGPRTLFQVALAVLKLNGEEILS
                     ADDDGMFIAIIKNYFQNLGKSAHPNSKEPKIREITNFQELLVTAFKEFDVITESQIAQ
                     ERHKHQKDVFQNIETFVKRTQIRHMPKTYNLSDKNLGNIYDLYYQSVETHKISLGTGS
                     SNMDLESFVQFIKKVCNWAKDSQSDLDPSFRQQKSEFLKRLFNRWDSAKVGELTLNDV
                     VEGLDHLLSRDMLESINYFFSLYDKDGDGQLDKDEVLQLSEGLLLLTDPWKNGSFVDL
                     LTKKKIEDDIAEKLVQENGEKVITMDEISLPSGVTIDEEKYKAEQSERYLKAASNFLQ
                     RAFEYAKSIELDSAVNLIDLSDDESEGSDEDVKIKKKKKFEAIMANPALDPSHPKVLD
                     LATFRMIILADETYELFFSETLRDSIRIDEGNESNNYRTKALRNMFDGILADGKRVAE
                     QVRRRVDSVATRSSISSNDGPTSQLSATNEMLPSADDRADDVDDFTQETGEEQHELLN
                     ETLLDIDDDMKSSNNNQQDKRISEMPKLDSKNADLVEFEAD"
     gene            <742117..>743142
                     /locus_tag="CAGL0G07799g"
                     /db_xref="GeneID:2888378"
     mRNA            <742117..>743142
                     /locus_tag="CAGL0G07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446701.1"
                     /db_xref="GeneID:2888378"
     CDS             742117..743142
                     /locus_tag="CAGL0G07799g"
                     /inference="similar to AA sequence:UniProtKB:P53259"
                     /note="similar to uniprot|P53259 Saccharomyces cerevisiae
                     YGR101w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446701.1"
                     /db_xref="GeneID:2888378"
                     /db_xref="GOA:Q6FSU3"
                     /db_xref="InterPro:IPR002610"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:Q6FSU3"
                     /translation="MFLSVGLRSNPVKLSFFRFSSIKCSKPLGSALTIRSLSNKCISS
                     SPIHSQLSNIISKRNFSNGKFSLRGSWESIFKDNGSDRYTRLNRFQQFQRNSGNSNSL
                     GVITAFGVGAMAVIYFISPYLFNIVPPFTYFKHNPKDLVYAILGTNLLVFGMWRIPQC
                     WRFLQKYMLLQKDHMASKWAIVGSAFSHQEFWHLGMNMLALWSFGTSLASILGTANFF
                     SLYMNSAIAGSLFSLWYPRIAKLMMIGPSLGASGALFGVFGSFAYLFPQAKILLFVFP
                     IPGGAWVAFLGSVAWNLAGCVLRWGSFDYAAHLGGSLMGIAYGWYISTLMKKRRERRI
                     KSVSKWV"
     gene            complement(<743387..>743908)
                     /locus_tag="CAGL0G07821g"
                     /db_xref="GeneID:2888379"
     mRNA            complement(<743387..>743908)
                     /locus_tag="CAGL0G07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446702.1"
                     /db_xref="GeneID:2888379"
     CDS             complement(743387..743908)
                     /locus_tag="CAGL0G07821g"
                     /inference="similar to AA sequence:UniProtKB:P53260"
                     /note="similar to uniprot|P53260 Saccharomyces cerevisiae
                     YGR102c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446702.1"
                     /db_xref="GeneID:2888379"
                     /db_xref="GOA:Q6FSU2"
                     /db_xref="InterPro:IPR027499"
                     /translation="MSRFMIRAVFFRRYTAATVGKPFRNVAEVKQYLAKQTWSIDEIL
                     HGEDTGKAAKQGVPTEEEVRKLLALCAFPVEDADLQNSKRILVKQLSFINKLHETSVD
                     DQDKNLDENYARLLPRQNKALTYDDLLKKIDGIKQDEATGEPTGSWDSTGLAKMRKDN
                     YFIVRQGLLKNRK"
     gene            <744599..>746395
                     /locus_tag="CAGL0G07843g"
                     /db_xref="GeneID:2888380"
     mRNA            <744599..>746395
                     /locus_tag="CAGL0G07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446703.1"
                     /db_xref="GeneID:2888380"
     CDS             744599..746395
                     /locus_tag="CAGL0G07843g"
                     /note="highly similar to uniprot|P53261 Saccharomyces
                     cerevisiae YGR103w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446703.1"
                     /db_xref="GeneID:2888380"
                     /db_xref="GOA:Q6FSU1"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR010613"
                     /translation="MRVKKRNVRGNAKNFITRSQAVRKLQISLADFRRLCIFKGIYPR
                     EPKNKKKANKGSTAPTTFYYAKDIQYLMHEPVLAKFREHKTFARKLTRALGRGEVSSA
                     KKLEENRSTYKLDHIIKERYPSFPDAVRDIDDALNMLFLFANLPATNQISSRVIRDAQ
                     VICNQWLAYVAKERLIRKVFVSIKGIYYQANVKGEEVRWVIPFKFPENIPSDIDFRIM
                     MTFLEFYSTLLHFVLFKLYTDSGLVYPPKIDVEQDKILSGINAYILESQEETSVLNAE
                     VPSDAPDKEAQSIDTKTLAQAMKADSKDKDDNSNDEAPENVEDVELDEFEDHNKNKGD
                     ILAQPSKFSSPTATLFEDFVFYVGREVPIEAIEFLILSCGGKVISEAAMDQIEGNTEF
                     DLSKVTHQIVDRPVLKHKVAGRTYIQPQWVFDCINKGELLSANLYLPGVSLPPHLSPW
                     GDALGYDPTKEVESEDESSDSSEESDSEIENEEEDTKPAAITNEDDDEDVEELAAQKE
                     LELEASGIAYSKAKDEGLHDDVASKKKRKVTDEDEEEKKLKMIMMSNKQRKLYKKMKY
                     SNQQKEDKIEELKKKKKQLAKKEKTLKKVEKK"
     gene            complement(<746594..>747394)
                     /locus_tag="CAGL0G07865g"
                     /db_xref="GeneID:2888381"
     mRNA            complement(<746594..>747394)
                     /locus_tag="CAGL0G07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446704.1"
                     /db_xref="GeneID:2888381"
     CDS             complement(746594..747394)
                     /locus_tag="CAGL0G07865g"
                     /inference="similar to AA sequence:UniProtKB:P32585"
                     /note="similar to uniprot|P32585 Saccharomyces cerevisiae
                     YGR104c SRB5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446704.1"
                     /db_xref="GeneID:2888381"
                     /db_xref="GOA:Q6FSU0"
                     /db_xref="InterPro:IPR019095"
                     /translation="MVQRLSLMATIADDDFPLFKTSINILTGSPAVVYANLMVVWKPN
                     PNYEVDNLNSKNELVEPTRMTTATSIPLELILNDPVSKNNGVDSDEILNTMKEQEFPI
                     KQEQLFDMINNPSNNTINWTLTTADIPAAGSNRKVSMQAIQEATIVHQAGNNPTLANV
                     MAELGYSFDYMYVTVGVRFVHKRDVIIHCHKVWDIAEDNIIQVTKGGYVVHTFVTVNR
                     ATDIERLNLAEANLLSLQRDLSGYLDFKVPDRKSMDSRTNLTQKDITL"
     gene            <747754..>747990
                     /locus_tag="CAGL0G07881g"
                     /db_xref="GeneID:9487997"
     mRNA            <747754..>747990
                     /locus_tag="CAGL0G07881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999501.1"
                     /db_xref="GeneID:9487997"
     CDS             747754..747990
                     /locus_tag="CAGL0G07881g"
                     /note="highly similar to uniprot|P41806 Saccharomyces
                     cerevisiae YGR105w VMA21 vacuolar ATPase assembly integral
                     membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999547.1"
                     /db_xref="GeneID:9487997"
                     /db_xref="GOA:B4UN04"
                     /db_xref="InterPro:IPR019013"
                     /translation="MAVDVPKSVIKKLVFFTVAMVVLPLLTFFTLQHLTSNTIISGGL
                     AALMANVVLVGYIIAAFTEDTTEYAPEGKESKKE"
     gene            complement(<748236..>748964)
                     /locus_tag="CAGL0G07887g"
                     /db_xref="GeneID:2888382"
     mRNA            complement(<748236..>748964)
                     /locus_tag="CAGL0G07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446705.1"
                     /db_xref="GeneID:2888382"
     CDS             complement(748236..748964)
                     /locus_tag="CAGL0G07887g"
                     /inference="similar to AA sequence:UniProtKB:P53262"
                     /note="similar to uniprot|P53262 Saccharomyces cerevisiae
                     YGR106c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446705.1"
                     /db_xref="GeneID:2888382"
                     /db_xref="GOA:Q6FST9"
                     /db_xref="UniProtKB/TrEMBL:Q6FST9"
                     /translation="MMIKQLFVSLFLLFSYAVASNKFFLTFSDSELNTDSLSVAASES
                     NTPLLIIKVLNIDVLRNLFTSLKNEEVGKYTFWRLIEEDIGQVDSYVIDSNYDQVKSE
                     ANKYTLEFQENLDNYEKVSEIIQQNILNLETKSQTLPLLALELTSDNKKVRRDRIIDE
                     IEEILEEYDILDFFDDNESDDKNNEGKTPSEESRIWTEGLLMCLIVSGILLIILIISL
                     SWLSDLSISYGALERPNNMAKKTN"
     gene            complement(<749305..>750276)
                     /locus_tag="CAGL0G07909g"
                     /db_xref="GeneID:2888321"
     mRNA            complement(<749305..>750276)
                     /locus_tag="CAGL0G07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446706.1"
                     /db_xref="GeneID:2888321"
     CDS             complement(749305..750276)
                     /locus_tag="CAGL0G07909g"
                     /note="highly similar to uniprot|P53731 Saccharomyces
                     cerevisiae YNR035c ARC35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446706.1"
                     /db_xref="GeneID:2888321"
                     /db_xref="GOA:Q6FST8"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="UniProtKB/TrEMBL:Q6FST8"
                     /translation="MLHLQPANLLIQKTLFEALDANAKGTPLTLDRIISDFDYTTFHV
                     SNTPDNKSILLLSVRTKAWQSILQGGDLLTFLQGKYANTQGVSVANAVEPGFDYTLQI
                     DIGSLNEEAIKRCSILKTLVLSFPFHQAFEEFHQLNNQPIPEGSVVESQNVHVIKYRD
                     DENIFVKAASDRVTVIFETIFQDETDKILGKVFLQEFVDARKRNRGIQSAPQVLFSHE
                     PPLEIQSVAQNQNTQGKHDSRRFITFVLFPRHFQTEELQFTSVSQLTLFRNYFHYHIK
                     CSKAYMHSRMRYRVDTFVKVLNRAKVDEEDDNEDSNRRTITGRKMVY"
     gene            complement(<750667..>751125)
                     /locus_tag="CAGL0G07931g"
                     /db_xref="GeneID:2888322"
     mRNA            complement(<750667..>751125)
                     /locus_tag="CAGL0G07931g"
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /transcript_id="XM_446707.1"
                     /db_xref="GeneID:2888322"
     CDS             complement(750667..751125)
                     /locus_tag="CAGL0G07931g"
                     /note="highly similar to uniprot|P53732 Saccharomyces
                     cerevisiae YNR036c"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /protein_id="XP_446707.1"
                     /db_xref="GeneID:2888322"
                     /db_xref="GOA:Q6FST7"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FST7"
                     /translation="MSLSAGRSSTGMGFTKVRQFSSSSSVLATLNQIKRGAGPPKKKR
                     ISMAPDLERCPIRKGVVLRVMVLKPKKPNSAQRKACRVRLTNGKVVSAYIPGEGHDAQ
                     EHSVVYVRGGRCQDLPGVKYHVVRGAGDLSGVVNRITSRSKYGVKKPTKE"
     gene            complement(<751633..>751908)
                     /locus_tag="CAGL0G07953g"
                     /db_xref="GeneID:2888323"
     mRNA            complement(<751633..>751908)
                     /locus_tag="CAGL0G07953g"
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /transcript_id="XM_446708.1"
                     /db_xref="GeneID:2888323"
     CDS             complement(751633..751908)
                     /locus_tag="CAGL0G07953g"
                     /note="highly similar to uniprot|P53733 Saccharomyces
                     cerevisiae YNR037c RSM19"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /protein_id="XP_446708.1"
                     /db_xref="GeneID:2888323"
                     /db_xref="GOA:Q6FST6"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:Q6FST6"
                     /translation="MHPTVRLLARSAWKGPNIVPLPIKEAMNKGVPIRTNARAATILP
                     QFVGLKFEIHNGKDYVPIEISEDMIGRKLGEFAPTRKRFSYTQTKNK"
     gene            <752176..>754131
                     /locus_tag="CAGL0G07975g"
                     /db_xref="GeneID:2888250"
     mRNA            <752176..>754131
                     /locus_tag="CAGL0G07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446709.1"
                     /db_xref="GeneID:2888250"
     CDS             752176..754131
                     /locus_tag="CAGL0G07975g"
                     /inference="similar to AA sequence:UniProtKB:P53734"
                     /note="similar to uniprot|P53734 Saccharomyces cerevisiae
                     YNR038w DBP6 RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446709.1"
                     /db_xref="GeneID:2888250"
                     /db_xref="GOA:Q6FST5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /translation="MFAARFDPTKVVREEPKIIPQKRAIPDDVESSDSDQDIEDGVEV
                     GAVSKEQSGTDVTTTRAVDGKSESDSESESESESDSDDEMNFDMGGSSSSSDDDEVSS
                     KDADVDDDGKHTSVLSRFKKTLSIQDKISALEEANTQDILEDGEAHDLAQIPQPAVVR
                     DKKLQVKDISEMKNTAFRDTRKVHYDNSMTKSFEEYSDDLTPKLLNNIEKYFSKSTFP
                     IQTAMLDQYLKLINFTLKTSKKNFTRRIGDILVNASTGSGKTLAYSIPIIQTLSSRTV
                     NKLRVLIILPTKLLINQVFQTMSQLAEGTSLVITVSKLENSFNEEHKRLLKTEPDIFI
                     TTPGRLVDHLTNSSISLRNLKFLVLDEADRLLNQSFQNWIPEVMSKFKSDKFDQMPGS
                     IIKMVFSATLTTNTEKLNDLQLYNPTLFATDSVKLYNLPPTLQEYQLQIPSAKSVYKP
                     LYLLKLLEQLSGGKTLVFVRSNESSLKLEVLLKSLIKGHMTTLQIVVHSINSNNSKAE
                     NRRLVTDFTKESLPNQTNVLITTDLMSRGIDIENIANVINYDVPISSQQYVHRCGRTA
                     RANKDGKAYNMLVGKGEAQFWKDSIDEDISRDVSGCKPISYNDSYNKVHGDENARTSE
                     PTRDLFTSIDSETSDKYNEILKNLTQK"
     gene            complement(<754263..>756230)
                     /locus_tag="CAGL0G07997g"
                     /db_xref="GeneID:2888248"
     mRNA            complement(<754263..>756230)
                     /locus_tag="CAGL0G07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446710.1"
                     /db_xref="GeneID:2888248"
     CDS             complement(754263..756230)
                     /locus_tag="CAGL0G07997g"
                     /inference="similar to AA sequence:UniProtKB:P53735"
                     /note="similar to uniprot|P53735 Saccharomyces cerevisiae
                     YNR039c ZRG17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446710.1"
                     /db_xref="GeneID:2888248"
                     /db_xref="GOA:Q6FST4"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="UniProtKB/TrEMBL:Q6FST4"
                     /translation="MSNSEHSTSNGVDPLSTPVMNPIREEASSQFSDQLYKTPYGEAA
                     DDISLSDSASKAGNSINNNTEALGTSTGPGRSRIKARSLLMSPTFARPNSMYSQRDGN
                     NSSSSLIYNPTFTFGGNNTTTTNEQAFHPGNNVTKTPVQGESRRNSLKYIPGTKLAPP
                     TSRNRSPVRPSSPEHNHLKVGPPGKRSSMMLDSPFNFSSAPIKPQLPNGSHQTPPSSS
                     SRASFRKGHRYKHSSVSMNFFQEPEVKIPLNISKSLPIPDSEDLIKNLPWPKAHIQLI
                     ISLSQFILCIAVFYLGRKNNWTNFITFSHFIAYDIIGALVTILVENLSQFQVWSTGTI
                     TFPFGLNRVDVLLSFGLAVSLCFVGLDLVFHIIEESIVLLVETRDHSSDTHSDIEQSI
                     PHSHHGSSEPFTLVGSDYSTWYLTLLVSIALSTLSLYKIYYSNTNSKLKTKNPLITIS
                     YGFYLMVYPVLANQFYNFSDYIATIAIAFFILLHGLKIAEWTGVILLMGLSTTSLPPL
                     ALIDKDEENSTASTQETVSERISSLRRNRSNTLNAFQEIDDKTSGSRIKKMFGILHEH
                     KTVIEHDASKFKSAIFEKLENLPEYKAKCKLEYQDLIVTKVNFNLYVVLMKVNMRGAS
                     NDEELHFRLAFDKCIKSILPGSETTIEIERL"
     gene            complement(<756917..>757867)
                     /locus_tag="CAGL0G08019g"
                     /db_xref="GeneID:2888249"
     mRNA            complement(<756917..>757867)
                     /locus_tag="CAGL0G08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446711.1"
                     /db_xref="GeneID:2888249"
     CDS             complement(756917..757867)
                     /locus_tag="CAGL0G08019g"
                     /inference="similar to AA sequence:UniProtKB:Q03193"
                     /note="similar to uniprot|Q03193 Saccharomyces cerevisiae
                     YDR090c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446711.1"
                     /db_xref="GeneID:2888249"
                     /db_xref="GOA:Q6FST3"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FST3"
                     /translation="MISEGAATTLATIATVCWCVQLIPQIIYNWRRKDCTGLPPLMMF
                     LWVVSGIPFAIYFCVSKGNVVLQIQPHLFMFFCGISFVQSCYYPPCSLAVRKIVAIVV
                     GIIVVDIGMEVGFILWLRPLYSRGITWPDLIFGIIATVLLAIGLLPPYFELAKRNGRV
                     VGINFIFLFIDSLGAWLSIISVVVGNMDTMGIILYSVIAGLELGIFLSHFIWCCRFKW
                     FGNHDPEETDAVSEEKSVKDTQYDEKDGSLSKNKMGHDAMFSKTEEVNETDEPRDDVS
                     SFDYDLERRPSHMERFSQKVHAVHGVVMQRPEQVYHNVEL"
     gene            complement(<758811..>760634)
                     /locus_tag="CAGL0G08041g"
                     /db_xref="GeneID:2888238"
     mRNA            complement(<758811..>760634)
                     /locus_tag="CAGL0G08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446712.1"
                     /db_xref="GeneID:2888238"
     CDS             complement(758811..760634)
                     /locus_tag="CAGL0G08041g"
                     /note="highly similar to uniprot|Q03195 Saccharomyces
                     cerevisiae YDR091c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446712.1"
                     /db_xref="GeneID:2888238"
                     /db_xref="GOA:Q6FST2"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FST2"
                     /translation="MSDKGSRIAVVNADRCKPKKCRQECKRSCPVVKTGKLCIEVTPT
                     SKIAFISEVLCIGCGICVKKCPFDAITIINLPTNLESHVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRFDDPPEWQEIIKYFRGSELQNYFTKML
                     EDDIKAIIKPQYVDNLPRAIKGPVQKVGELLKLRMEKPQDTVKQYIKTLQLDHLLNRE
                     IGLLSGGELQRFAIAMSCVQDADVYMFDEPSSYLDVKQRLNAALIIRSLLEPSKYVIA
                     VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPSSVREGINIFLDGHIPSENMRFRTEAL
                     QFRIADSAADIIVDATRAYSYPDMKRTQGDFTLNVQSGEFSDSEILVMMGENGTGKTT
                     LIKLLAGAIPADDGTSVPKLNVSMKPQTIAPKFPGTVRQLFFKKIRAQFLNPQFQTDV
                     VKPLKIDDIIDQEVKHLSGGELQRVAIVLSLGIPADIYLIDEPSAYLDSEQRIICSKV
                     IRRFILHNKKTAFIVEHDFIMATYLADKVIVFDGTPSQNTTATAPESLLTGCNRFLKN
                     LNVTFRRDPNSFRPRINKLDSQMDKEQKLSGNYFFLDSNGV"
     gene            <761662..>762111
                     /locus_tag="CAGL0G08063g"
                     /db_xref="GeneID:2888239"
     mRNA            <761662..>762111
                     /locus_tag="CAGL0G08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446713.1"
                     /db_xref="GeneID:2888239"
     CDS             761662..762111
                     /locus_tag="CAGL0G08063g"
                     /note="highly similar to uniprot|P52490 Saccharomyces
                     cerevisiae YDR092w UBC13 E2 ubiquitin-conjugating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446713.1"
                     /db_xref="GeneID:2888239"
                     /db_xref="GOA:Q6FST1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6FST1"
                     /translation="MASLPKRIIKETERLVSDPVPGITAEPHEDNLRYFDVTIEGPSQ
                     SPYEKGIFKLELYLPEDYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIR
                     TVLLSIQALLASPNPNDPLANDVAEDWIKDEAKAKQTAKEWTAQYAK"
     gene            <763185..>767921
                     /locus_tag="CAGL0G08085g"
                     /db_xref="GeneID:2888240"
     mRNA            <763185..>767921
                     /locus_tag="CAGL0G08085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446714.1"
                     /db_xref="GeneID:2888240"
     CDS             763185..767921
                     /locus_tag="CAGL0G08085g"
                     /note="highly similar to uniprot|Q12675 Saccharomyces
                     cerevisiae YDR093w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446714.1"
                     /db_xref="GeneID:2888240"
                     /db_xref="GOA:Q6FST0"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /db_xref="UniProtKB/TrEMBL:Q6FST0"
                     /translation="MPSRSPFEDGVGGKEPISSPFDDSNRFQDVEMVPMEEDVKDTNT
                     TVYDEFGDGPYKEEDDMDDDYSMEPTPIVGRSDNGQFNDDNRVLMFGPDDLERRAQPG
                     KNRESKSGDQIKRLRWGTQRRRKSFKRYDIGRSKTLKWAKKNIQDPLEELIGNENEAT
                     DETGMRNKADELRNIYFNQPLPQDMLDEDNKPLANYPRNKIRTTKYTPLTFLPKNILL
                     QFHNFANIYFLILIILGAFQIFGVTNPGFSAVPLIVIIIITAIKDGIEDSRRTVLDLE
                     VNNTKTHVLTGIENYNVSADDISLWRRFKKANSRIIASFVQVCRETLTKKGRLEKAQR
                     KRQMANHKKNLNRKFRNSLNSYRSNRMSRDVRPSMDFRPSTDINGYQQNEDTLINKTL
                     PTDMEWRFSKDYWKNVKVGDIVRIHNNEEIPADIILLSTSDSDGACYVETKNLDGETN
                     LKVRQSMKCTSDIRSSIDIARTRFWIESEGPHANLYSYQGNFRWNSLEDNQLKNEPVN
                     INNLLLRGCTLRNTKWAMGVVAFTGDDTKIMLNAGVTPTKKSRISKELNLSVLFNFAL
                     LFVLCFIAGLYNGIYHNKHPRSRDFFDFGTGTGGSATSGFVSFWVAVILYQSLVPISL
                     YISVEIIKTAQAIFIYLDVMMYNEKLDYPCTPKSWNISDDLGQIEYIFSDKTGTLTQN
                     VMEFKKCTINGVSYGRAYTEALAGLRKRQGVDVAHESKIEKEGIKRDREEMINKLQNL
                     AKNSQFYEDEVTFVSKEFVDDLTGGSGSVQQKSCQHFMLALALCHSVLTEPSKEDPAK
                     LEIKAQSPDEAALVTTARDMGFSFLKKTKEGMVLEVQGIEKEFQILNILEFNSSRKRM
                     SCIVKIPGDDANGKPKALLICKGADSVIYSRLDKTGLNEESLLEKTALHLEQYATEGL
                     RTLCLAQRELSWEEYERWNKKYDIAAAAVVDREEELEKVSDEIERHLILLGGTAIEDR
                     LQDGVPDSIALLGEAGIKLWVLTGDKVETAINIGFSCNLLNNDMELLVIKTTGPDVED
                     LGATPKDIVDTLISQYLHDKFGMAGSEEELKKAKAEHDIPRGEFAVIIDGEALKYALS
                     TEDMKRKFLLLCKNCKSVLCCRVSPAQKAAVVKLVKNTLDVMTLAIGDGSNDVAMIQS
                     ANIGVGIAGEEGRQAVMSSDYAIGQFRYLTRLLLVHGKWCYKRLAEMIPQFFYKNMIF
                     TLALFWFGIYNDYDGSYLFEYTYLTFYNLAFTSIPVILLGIFDQDVSDTISLVFPQLY
                     RVGILRKEWSQTKFLWYMLDGLYQSVIAFFFPYLLYRRHMIVTSNGLGLDHRYYVGVP
                     VTAIACISCNLYILIQQKHWDVFCSFFVGVSIMIFFTWTGIWSSASRSNEFYHGAARV
                     FGTPTFWAVLFVGIMFCLLPRFTLDVFKRYFYPKDIDIIREMWSRGDFDSFPKKYDPT
                     DPEVHKIAMSDIRVFSGAESKEFNSNSNTSSSSSEDILSEEIPLELGKGMNDSGKKSE
                     YESGVGDEILKYYLGKDSNRNTILTDNQKRLSTYSRASNRTSLDRTREDMLATNQLDT
                     RFSVERARASLELPGITHAENLLNSN"
     gene            <768772..>770649
                     /locus_tag="CAGL0G08107g"
                     /db_xref="GeneID:2888241"
     mRNA            <768772..>770649
                     /locus_tag="CAGL0G08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446715.1"
                     /db_xref="GeneID:2888241"
     CDS             768772..770649
                     /locus_tag="CAGL0G08107g"
                     /note="weakly similar to uniprot|Q03833 Saccharomyces
                     cerevisiae YDR096w GIS1 DNA damage-responsive repressor of
                     PHR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446715.1"
                     /db_xref="GeneID:2888241"
                     /db_xref="GOA:Q6FSS9"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS9"
                     /translation="MENFNTLEDEFLEQSLHHHDNFEDMIKNNIQIYEKSPVMKVRLL
                     DSYIFDKFGEIYDTEFITTVFQHVIGEDVPNIVEVPKEIDYHFWIDMMDQGKRSKKKC
                     STSGILDFGMSLSVAENFSFVEIPAVTKKLENIFWEHQYAYTSYYSSLILDKTVPQNE
                     INKELYDLEYILSSERPDCKEKIKLCCFGTQIPWRIDTVNQYHLIFNLFGTPIQWYIV
                     EGCNRDSLISYLKKLEPKGSETCNAFYIHKKYCFGPDFLERANIPYKTMVQESGKLFI
                     SKPGTCFFVFHYGYSIVMEKTIKCDQTIFTAQHVFPALCTCGKFDQTNTVFDQILSSN
                     SDIYGHFNENLNQQFHMSQDNGLEHYWLSSENNKYWTSQVKTLLNKSSNSENFETNSP
                     ETRLCVSTPPTDMTKSLTPHDIKLANSIPEFIKRQLETMKPIYKEKVTDDKEVIYWLA
                     SDLDYYHNSECEDMVLFSTKPKRKCVKRGKYPNKSRKPLKFKIRYFQTKIQTNTKSTF
                     PVAKKLRLLPQPSGFSLLVPEETFLSDDESSKNVESLGQIFNSKIRYSDGFKYFYCEI
                     CDHNFPSSYHLIRHRNSVHSAEKPYNCPICSKGFKRKDHVSQHLKKKTPCRQKHYSLS
                     I"
     gene            complement(<770779..>774429)
                     /locus_tag="CAGL0G08129g"
                     /db_xref="GeneID:2888242"
     mRNA            complement(<770779..>774429)
                     /locus_tag="CAGL0G08129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446716.1"
                     /db_xref="GeneID:2888242"
     CDS             complement(770779..774429)
                     /locus_tag="CAGL0G08129g"
                     /inference="similar to AA sequence:UniProtKB:Q03834"
                     /note="similar to uniprot|Q03834 Saccharomyces cerevisiae
                     YDR097c MSH6 DNA mismatch repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446716.1"
                     /db_xref="GeneID:2888242"
                     /db_xref="GOA:Q6FSS8"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR017261"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS8"
                     /translation="MTMPTTPKANKKKVGNTGSSQKKLKQSTLLSFFSKQTSPSVSKS
                     KTKVFPSPKSRESEKEDQKSLFVTDEDTKENVSEVAQPEPATEISKASPVASVAVEKT
                     PIKDDNIKVKEESTEQNDDDTKDTQTVGRVRKRVVSYAEESDSEDDITVKKRKRTPVS
                     DDEDSDFKADAVSDADNDDDYKSDKSAVSSIGGFDDSDDDDILALTTNKYKKPKAAAP
                     KKVVQRITPPAAKPKFTMATTGPKNNTFNKQNEERYQWLVDERDAQKRPKDDPEYDPR
                     TLYIPSSAWNKFTPFEKQYWEIKSKMWDCIVFFKKGKFFELYEKDAFLANALFDWKLA
                     GGGRANMQLAGIPEMSFEHWASQFIQLGYKVAKVDQRESMLAKEMREGSKGIVKRELQ
                     CVLTSGTLVDGDMIHSDLATYCLAVREEPSNFYDITQPSSATYTKIFGVAFIDTSTGE
                     VQMTEFLDDEECSRLDTLMSQVRPKEVIIEKHNLCNLANKIVKFCAAPNALFNYIKPV
                     EEFYDFEKTHNELLANEEAYFGTADGWPSVLKNYYDSNKKVGFSAFGGLLYYLKWLKL
                     DESLISMKNFTEYNFVKSQNTMVLDGISLQNLEIFSNSFDGSDKGTLFKLFNNSITPM
                     GKRMMRKWLMNPLLLKEDIEKRQDSVELLMNNHELRTKIESVFTGLPDLERLLSRIHA
                     GSLKVKDFDKVITAFENILQMTKEIESNELHGALKSYFIQIPKQLENEVQHWESAFDR
                     RKAVEEGVIIPEVGVEPDFDKSLEKLEGLENELNLLLKSYMKLLKTSNLQYKDSGKEI
                     YTIEVPVSATKYVPANWVQMGANKNTKRYYSDEVRVLARSVAEARELHKTLENDLNFR
                     LCRKFDTQYSTVWMPTVTCLANIDCLLGLVRTSESLGTPSCRPVICDEVDPSTKCKKQ
                     GFVDFKSLRHPCFNLDSRVNKDFIPNDVTLGNKSPNIGLLTGANAAGKSTVLRMTCIA
                     VIMAQLGCYVPAESASLTPIDRIMTRLGANDNIMQGKSTFFVELSETKRILDLATNRS
                     LLVLDELGRGGSSNDGFSIAESVLHHVATHIQSLGFFATHYGSLGLSFRSHPQIKPMK
                     MSILVDEATRNVTFLYKLVDGQSEGSFGMHVASMCGIAKSIVDNAQSAADNLEHTSRL
                     IKERKEALQGHADPGSMVPLGLQSDFTRLAFGDGLNNKSVGTGEGVLVYDNNVKSNVL
                     RILFNMIDRLED"
     gene            complement(<775053..>775835)
                     /locus_tag="CAGL0G08151g"
                     /db_xref="GeneID:2888199"
     mRNA            complement(<775053..>775835)
                     /locus_tag="CAGL0G08151g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446717.1"
                     /db_xref="GeneID:2888199"
     CDS             complement(775053..775835)
                     /locus_tag="CAGL0G08151g"
                     /note="highly similar to uniprot|Q03835 Saccharomyces
                     cerevisiae YDR098c GRX3 glutaredoxin protection against
                     oxidative and osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446717.1"
                     /db_xref="GeneID:2888199"
                     /db_xref="GOA:Q6FSS7"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS7"
                     /translation="MEGGRREIEGRRHFLKRNMVAEITNQDQFTELTTQNVQDKLIAI
                     YFHTSWAEPCKAISELYRAISEDESNKDVSFLAVDADEQAEIAELFEISAVPYFVLIR
                     NGTILKELSGANPKEFLAALEECRRAGTESKSKESNGAVEDDEDSEDSEEETEEEMNM
                     RLTKLVNAAPVMLFMKGNPSEPKCGFSRQIVGILREHQIRFGFFDILRDDTVRTNLKK
                     FSDWPTFPQLYINGEFQGGLDIIKESLEEDPDFFQHTIRVNN"
     gene            <776549..>777007
                     /locus_tag="CAGL0G08173g"
                     /db_xref="GeneID:2888200"
     mRNA            <776549..>777007
                     /locus_tag="CAGL0G08173g"
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /transcript_id="XM_446718.1"
                     /db_xref="GeneID:2888200"
     CDS             776549..777007
                     /locus_tag="CAGL0G08173g"
                     /note="highly similar to uniprot|P61864 Saccharomyces
                     cerevisiae YLR167w UBI3 Fusion protein that is cleaved to
                     yield a ribosomal protein of the small (40S) subunit and
                     ubiquitin"
                     /codon_start=1
                     /product="ubiquitin-40S ribosomal protein S31 fusion
                     protein"
                     /protein_id="XP_446718.1"
                     /db_xref="GeneID:2888200"
                     /db_xref="GOA:Q6FSS6"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR002906"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS6"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGGKKRKKKVYTTPKKIKHKHKKVKLAV
                     LSYYKVDGEGTVTKLRKECSNPTCGAGVFLADHKTRLYCGKCHSVYKVDA"
     gene            complement(<777496..>778170)
                     /locus_tag="CAGL0G08195g"
                     /db_xref="GeneID:2888208"
     mRNA            complement(<777496..>778170)
                     /locus_tag="CAGL0G08195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446719.1"
                     /db_xref="GeneID:2888208"
     CDS             complement(777496..778170)
                     /locus_tag="CAGL0G08195g"
                     /inference="similar to AA sequence:UniProtKB:P35200"
                     /note="similar to uniprot|P35200 Saccharomyces cerevisiae
                     YLR168c MSF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446719.1"
                     /db_xref="GeneID:2888208"
                     /db_xref="GOA:Q6FSS5"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS5"
                     /translation="MRLFQNTCEFAYPWDQVTAANWNKYPNEVSTHVVAVDVLRRELS
                     ASGRQLVTERLITVKQSVPRWVLLVVGASKQSYVREVSTVDLDTRTLTMRSCNLTFWN
                     IMKVYETVKYMPDAVNPDKTVFKQEAQISVCGTLGRFCNKVEEWSVQRFGENAKKGKM
                     GFDLVLKVFNEHWNQINSDIENVFNETVEDVRSTAGNLIKETERTYSNILGTNQEIFS
                     EAFNKK"
     gene            complement(<778823..>779803)
                     /locus_tag="CAGL0G08217g"
                     /db_xref="GeneID:2888209"
     mRNA            complement(<778823..>779803)
                     /locus_tag="CAGL0G08217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446720.1"
                     /db_xref="GeneID:2888209"
     CDS             complement(778823..779803)
                     /locus_tag="CAGL0G08217g"
                     /inference="similar to AA sequence:UniProtKB:Q06551"
                     /note="similar to uniprot|Q06551 Saccharomyces cerevisiae
                     YLR246w ERF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446720.1"
                     /db_xref="GeneID:2888209"
                     /db_xref="GOA:Q6FSS4"
                     /db_xref="InterPro:IPR001594"
                     /translation="MKGNPSTHEVIGTMSTRRFYRWLITIDGDTEINYRNYEELPSRS
                     NYIFFFGGRLRAVKTARPFSLVVLFLILSPMVLFSVFEAHRLWHTRYGYKALVVLFYY
                     AWAWSLLSFTKTATSDPGVLPRNIHMHKDTPQEYFNNVTLPYGAGGSAGNASVTLKYC
                     HTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLACALLI
                     ANCALHLHRALHEGIRVSHRPLPVAVLLCVYAAVLCVYPVILLGYHVAMSGTQQTTRE
                     YLRSIGFRNPVMHRIRRRRDNPYAEHGFLRNMLDLMAEPRGPRSCNYRYR"
     gene            <779962..>780405
                     /locus_tag="CAGL0G08228g"
                     /db_xref="GeneID:2888207"
     mRNA            <779962..>780405
                     /locus_tag="CAGL0G08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446721.2"
                     /db_xref="GeneID:2888207"
     CDS             779962..780405
                     /locus_tag="CAGL0G08228g"
                     /note="weakly similar to uniprot|Q06549 Saccharomyces
                     cerevisiae YLR245c CDD1 cytidine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446721.2"
                     /db_xref="GeneID:2888207"
                     /db_xref="GOA:Q6FSS3"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR006262"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS3"
                     /translation="MEDSELELLRQGCLAAKDVSYSPYSRYRVGCCILVRDGERVIKV
                     TGANVENASYGGTICAERVAITKAMTTVETRDPSQWVALGIMGDSLQDCISPCGICRQ
                     VIREFVNPKTGQVPIVMFNGDGSNYKKVSLEEILPMSFGPESLAL"
     gene            <780689..>781840
                     /locus_tag="CAGL0G08250g"
                     /db_xref="GeneID:2888201"
     mRNA            <780689..>781840
                     /locus_tag="CAGL0G08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446722.1"
                     /db_xref="GeneID:2888201"
     CDS             780689..781840
                     /locus_tag="CAGL0G08250g"
                     /note="highly similar to uniprot|Q01662 Saccharomyces
                     cerevisiae YLR244c MAP1 methionine aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446722.1"
                     /db_xref="GeneID:2888201"
                     /db_xref="GOA:Q6FSS2"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS2"
                     /translation="MTETETETGAKRYCAGLQCGKETSSELKCPVCLKAGIDAYFCDE
                     SCFKDNYKSHKATHFKEGEDGTLSQDAYDPFPKFKYTGGVRPQYPLTPKRHVPEHIPK
                     PDWAENGLPITEQRNDRMNKILIYKKDEIKKIRKACMMGREILDIAAAAIRPGITTDE
                     LDAIVHEETIKRDAYPSPLNYYNFPKSLCTSVNEIICHGIPDKRPLKEGDIVNLDVSL
                     FYQGFHADLNETYYVGENIEKDAINVVETARECLKTAIKQCKPGTTFQELGDYIEKHA
                     KENKCSVVRTYCGHGVGAYFHCSPNIPHYAKNRTPGVMKPGMVFTIEPMINEGTWRDI
                     TWPDDWTSSTQDGKRSAQFEHTLLVTENGVEILTARNKKSPGGPRQRIK"
     gene            <782344..>783993
                     /locus_tag="CAGL0G08272g"
                     /db_xref="GeneID:2888202"
     mRNA            <782344..>783993
                     /locus_tag="CAGL0G08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446723.1"
                     /db_xref="GeneID:2888202"
     CDS             782344..783993
                     /locus_tag="CAGL0G08272g"
                     /note="highly similar to uniprot|P39079 Saccharomyces
                     cerevisiae YDR188w CCT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446723.1"
                     /db_xref="GeneID:2888202"
                     /db_xref="GOA:Q6FSS1"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012722"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FSS1"
                     /translation="MSLQLLNPKAESLRRDAALKVNVTSAEGLQSVLETNLGPKGTLK
                     MLVDGAGNIKLTKDGKILLTEMQIQSPTAVMIARAAAAQDEITGDGTTTVVCLVGELL
                     KQAYRFIQEGVHPRIITDGFEIARTKALEFLDEYKIEDKVVNDGNVDREFLLQVARSS
                     LSTKVTPELTEVLTPIVTDAVLSVASKDTLNLDLYMVEIMQMQHLSPKDTTFIKGLVL
                     DHGARHPDMPMRVENAHVLILNVSLEYEKTEVNSGFFYSSAEQRDKLAASERKFVDEK
                     LKKIIDLKNEVCGLDNKQGFVIINQKGIDPMSLDVLAKHNILALRRAKRRNMERLQLV
                     TGGEAQNSVDDLSPSILGYSGLVYQETIGEEKFTYVTENKDPKSCTILIKGSTNYALN
                     QTKDAVRDGLRAVANVIKDKCVVPGAGAFFIAASKHLKSSNYSKLGVKGKTKTGIEAF
                     SEALLVVPKTLVKNSGFDPLDVLALCEDELEDAKESEEKRYVGVDLKIGDSCDPTIDG
                     VWDSYRVIRNAINGATGIASNLLLCDELLRAGRSTLKEGPQ"
     gene            complement(<784203..>785018)
                     /locus_tag="CAGL0G08294g"
                     /db_xref="GeneID:2888203"
     mRNA            complement(<784203..>785018)
                     /locus_tag="CAGL0G08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446724.1"
                     /db_xref="GeneID:2888203"
     CDS             complement(784203..785018)
                     /locus_tag="CAGL0G08294g"
                     /note="highly similar to uniprot|Q06543 Saccharomyces
                     cerevisiae YLR243w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446724.1"
                     /db_xref="GeneID:2888203"
                     /db_xref="GOA:Q6FSS0"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSRVGLLVLGPAGAGKSTFCNSIISHMQTIGRRAHIVNLDPAAE
                     PSKYEFTIDIRDLISLDDVMEELDLGPNGALIYCFEYLMKNLDWLDEEIGDYNDEYLI
                     FDCPGQIELYTHIPVLPNIVRHLQGQLNFNLCATYLLEAPFVIDSSKFFSGALSAMSA
                     MILLELPHINVLSKLDMIKDEYGKKKLKRFLNPDAMLLANEADQNLNPKFHHLNQCIA
                     NLVDDFGMVQFLPLEANNPESVATILSYVDDVTQWAEAQEQKEPKDQIDIEDL"
     gene            <785329..>786255
                     /locus_tag="CAGL0G08316g"
                     /db_xref="GeneID:2888204"
     mRNA            <785329..>786255
                     /locus_tag="CAGL0G08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446725.1"
                     /db_xref="GeneID:2888204"
     CDS             785329..786255
                     /locus_tag="CAGL0G08316g"
                     /inference="similar to AA sequence:UniProtKB:Q06541"
                     /note="similar to uniprot|Q06541 Saccharomyces cerevisiae
                     YLR242c ARV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446725.1"
                     /db_xref="GeneID:2888204"
                     /db_xref="GOA:Q6FSR9"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR9"
                     /translation="MICIECSAPTETLYTEYSNKYVQLTECKNCHSEVDPYVEIDNVL
                     LFIDLLLLKPGAYRHLVYNSMVVSLESFKEHYKDQRRRLPYHKSTPRLKVSIKNIFNW
                     FKKYDTIIRLWVLLVVFEVYLTWVEEEEIYHTRERVPFNSVTLQLLMIYVNKWNALQQ
                     YMFFLAYCVLDNVLFHMFTLRLVKSWMPWGKTTNYSSQIVSYTILLSQGVKIFPILML
                     IWPYDNIISMSINKWIANLYLIESMKIVTNSSYGSIMQLLVIVFLLRFTILNILVLAL
                     LSMITGDNLINNVLVVLSQTYFGLRTFVSELL"
     gene            complement(<786394..>788778)
                     /locus_tag="CAGL0G08338g"
                     /db_xref="GeneID:2888205"
     mRNA            complement(<786394..>788778)
                     /locus_tag="CAGL0G08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446726.1"
                     /db_xref="GeneID:2888205"
     CDS             complement(786394..788778)
                     /locus_tag="CAGL0G08338g"
                     /note="highly similar to uniprot|Q06538 Saccharomyces
                     cerevisiae YLR241w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446726.1"
                     /db_xref="GeneID:2888205"
                     /db_xref="GOA:Q6FSR8"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR8"
                     /translation="MERGSLKFPSGMAFQNISFGNGESPDFRRPSAMVVTTQLGIASA
                     LGLFAFLAFCILLKRFPRLYASRKYQDQNQRLPSWDESKLFGWIPVLFRIDDDQVLEY
                     AGLDAYVFLGFFKLCIKLLSIYCFFSICIISPMRYHFTGRYDGDDDNNNILIDNAVTK
                     AGISLLKRYIQTSNSKRDHNSGSSNPEMFGLYLWMYVLFTYFFTMIAINMLMRQTKVV
                     VNTRQNYLGKQNTVTDRTIRLSGIPIELRDVNALKNRIEKLNIGQVSSITICREWGPL
                     NKLFHYRDLVLKQLELKYSECPHHIANYETYRESYRLTRNEEQHSNITTSTSNDIESQ
                     DIPNNSTTYSQLAIGDRPTMKLGLMGIFGKEVDAIEHLEQQLKFIDKEILDARNRHYP
                     ATPTAFVTMDSVANAQMAAQAVLDPRVHYFITRLAPAPHDIQWDNVCLSRKERLTKIW
                     TVTVFIGLCSLFLIIPVSYLATLLNMKTILRFWPSLGYWLKKHKWAENIVTGLLPTYL
                     FTLLNVIIPYFYEYLTSCQGLVSHSEEEVSLVSKNFFYIFVNLFLVFTLAGTASNYWG
                     YLSDTTKIAYQLATSVKEFSLFYVDLIILQGIGMFPFKLLLVGSLIGFPLIKIQAKTP
                     RQRKELYNPPIFNFGLQLPQPILVLIITMIYSVMSTKILVSGLAYFVIGFYVYKYQLI
                     FATDHLPHSTGKVWPLIYRRIILGLLLFQLTMTGTLAGFDSGLVLSSWLIPLPFITLT
                     FWWDFETNYLPLSHYIALSSIREHERENSLVESSEEESYVYPYLVTELEKPMVG"
     gene            complement(<789119..>791788)
                     /locus_tag="CAGL0G08360g"
                     /db_xref="GeneID:2888117"
     mRNA            complement(<789119..>791788)
                     /locus_tag="CAGL0G08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446727.1"
                     /db_xref="GeneID:2888117"
     CDS             complement(789119..791788)
                     /locus_tag="CAGL0G08360g"
                     /inference="similar to AA sequence:UniProtKB:P22543"
                     /note="similar to uniprot|P22543 Saccharomyces cerevisiae
                     YLR240w VPS34 phosphatidylinositol 3-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446727.1"
                     /db_xref="GeneID:2888117"
                     /db_xref="GOA:Q6FSR7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR008290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR7"
                     /translation="MSGKSVSFYVSENIDVPLQIKILSLKGKKRQLRASEKLIDPQLS
                     LTMSNVKIFSDMLVSVQVYDELTLGDVTVPVFAPYVPFRYGRNWDQWVTLPVSVRHLT
                     PACKLRIVLWEFNGQRRIPFKTITTPIFKDLDFTLKRGIEAIKFTKQGKPSIETVKTL
                     ETINKYFYGDYAKKEWIDELVLKKLYKEYEKIDLPLDTFMLTIQFPVIELPIIYTEKP
                     REDIQKNIPTLSNFDAASAFSVDHSTSNNTAVTSVDPKLKIPMGNKYNSTLKFYDPDQ
                     FNNDPIEEKFRKLERASKHNTSDKHVKPDAKKRDYLKKIIDYPPGKRLSAHEKGSIWK
                     YRYYLQNNKKALTKLLQSTNLKDETERTEVLEMMDGWAEIDIDDALGLLGHKYRNLAV
                     RTYAVNRLKKASDKELELYLLQLVQAVCFENLNTFSDTSNSKFTVVDFSSSSQMMKTR
                     NTQRSESQNIMNSHIENNNPKFIHSIHSEDDSQIEELPVVISPLAEFLIRRALVNKRL
                     GNYFYWYITSESYDQPFLNQILESFLSRLNSNDRNEIEKQVKLLTLLRNCCEEIKSLK
                     DTVSKKKELLQTLLSTKVRPYLKKRLVKLPLDPDIVLNDVMIDQCNVFKSSLSPLMIT
                     FHTENGGVYPLMYKVGDDLRQDQLVVQIISLMNELLKNENVDLKLLPYTILATGLEEG
                     AIQFIPNLTMADILNKYHGILPFFRAHHPDKDEELGVKSWVIDNFVKSCAGYCVITYL
                     LGVGDRHLDNLLITEGGQFFHADFGYILGQDPKPFPPLMKLPPQIIEAFGGTDSSNYN
                     KFRSYCFVAYSILRRNAGLILNLFELMKTSNIPDIRVDPEGSIMKVKERFNLDLTEEE
                     ATIHFQTLINDSVNALLPIVIDHLHNLAQYWRA"
     gene            <792588..>793943
                     /locus_tag="CAGL0G08382g"
                     /db_xref="GeneID:2888118"
     mRNA            <792588..>793943
                     /locus_tag="CAGL0G08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446728.1"
                     /db_xref="GeneID:2888118"
     CDS             792588..793943
                     /locus_tag="CAGL0G08382g"
                     /inference="similar to AA sequence:UniProtKB:P42073"
                     /note="similar to uniprot|P42073 Saccharomyces cerevisiae
                     YDR195w REF2 RNA 3 -end formation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446728.1"
                     /db_xref="GeneID:2888118"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR6"
                     /translation="MSMETATQVNVDHALPISKIEQIKADLRDYYGVKELSEEQSESI
                     NQHINILDAALMQFMSDNHTLEKKHADTQDVNLNLYHGLKRMYNDLLHELGRVKEEKT
                     NTETTDRNNPLEYMADELPYQQTAQRKAYIDSLIMKDDYDEQLKREGTKFLDVMAQLS
                     VLDSSIEENTKSYGMLVRKLGFTLQDLDERIRNGSKALETDDKIDKPIDENNEDDSKA
                     ESKEDAKKKISFSKYLKKDETTKRSRNDELNEESEQNKKLKVDDDNGYDNNENINNGL
                     RPILKKRENNKSKSKSSGIKFQTESALVTIYGDGLPQDGLTVSPEELKKILKPFKPGQ
                     PREFPLVDNLPNVIKVPKLDLRFDENVNSSDISELKGGPVPCGTRTPLTCRINFNRYS
                     ADLEKPAREPVNLDDGDSSKPIIARAFGQNKLLLRKDRGGLPYRRVPDVVRNNYPIRP
                     R"
     gene            <794384..>795355
                     /locus_tag="CAGL0G08404g"
                     /db_xref="GeneID:2888119"
     mRNA            <794384..>795355
                     /locus_tag="CAGL0G08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446729.1"
                     /db_xref="GeneID:2888119"
     CDS             794384..795355
                     /locus_tag="CAGL0G08404g"
                     /inference="similar to AA sequence:UniProtKB:Q06005"
                     /note="similar to uniprot|Q06005 Saccharomyces cerevisiae
                     YLR239c lipoic acid ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446729.1"
                     /db_xref="GeneID:2888119"
                     /db_xref="GOA:Q6FSR5"
                     /db_xref="InterPro:IPR000544"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR020605"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR5"
                     /translation="MALFKRLCQSSGRPFYRYSSTCCPSTTTIKPIEASANTLRHLQF
                     TPILPFEDGLQIQEKFVKAQLDIKDMQSKIRKKLEALKKEYEGSTINEHEQKILDQIM
                     AMKPNPLLLTFEFQPTYTGGKRIKKSITEEQIKKYEDFVPTTQKGNPRPKYVQVERGG
                     QITFHGPGQLVAYVILDLRTFEKFPAKCLVSSIEKATMNTLKNLEIDETGKQLNLKTK
                     TTENTGVWTEDDKKIASIGIHVRRSITSHGVAINVNTDLSYMKSFEMCGLQNSSPTSL
                     VDQTGYNNIDVQQVAIQFAKEFAKILGIQKVERIQITEEDVNAMQSN"
     gene            complement(<795459..>796931)
                     /locus_tag="CAGL0G08426g"
                     /db_xref="GeneID:2888113"
     mRNA            complement(<795459..>796931)
                     /locus_tag="CAGL0G08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446730.1"
                     /db_xref="GeneID:2888113"
     CDS             complement(795459..796931)
                     /locus_tag="CAGL0G08426g"
                     /inference="similar to AA sequence:UniProtKB:Q06001"
                     /note="similar to uniprot|Q06001 Saccharomyces cerevisiae
                     YLR238w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446730.1"
                     /db_xref="GeneID:2888113"
                     /db_xref="GOA:Q6FSR4"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR4"
                     /translation="MSRTVDSPRPVAVAPTAVLQDSKKHSRRDRHSRNNVGTKTATQA
                     NNKNRHVAEVTARINKSTQSQPIKDRVNKGKADTIRKPLLFRRKYQYTLVLRSLNNTF
                     ETKYLVIPFQPDGLKLGRPVANTPNVATSGNAHGNIGASKTSKINTSSQVLPDNGNFD
                     SRVLSRNHALLSCDYCSGKIFIKDLKSSNGTFLNGKRINQADVELKVGDTVDLGTDID
                     SKLEHRKISAVVEDIYFHPLILDRQPISDSFRSKVIIDDNNLQQCAFESFVDHSHGLL
                     DLEDTILRTDIDILNGIFINNSIGTSHKLIDTIRVMAAGISFKSRDIMKLKSIENFIL
                     NYTNDIDYKNKLLVEKNDKYLISLQADVKKELSSVLMQFMKEDEARTLELQEEHSHIQ
                     KQKTEERETYEAEIKAVKEVLEDCKTRLEVEKYKNGKTQQKLNIDPDDGLENIASDCN
                     LGEEANTKKFTNTFLKSWTFWTIGLVSVGVLTVAYRFSSQ"
     gene            complement(<797481..>799223)
                     /locus_tag="CAGL0G08448g"
                     /db_xref="GeneID:2888112"
     mRNA            complement(<797481..>799223)
                     /locus_tag="CAGL0G08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446731.1"
                     /db_xref="GeneID:2888112"
     CDS             complement(797481..799223)
                     /locus_tag="CAGL0G08448g"
                     /note="highly similar to uniprot|Q05998 Saccharomyces
                     cerevisiae YLR237w THI7 thiamin transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446731.1"
                     /db_xref="GeneID:2888112"
                     /db_xref="GOA:Q6FSR3"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR3"
                     /translation="MRGLKFLTYLEIPVEKRQTLSFLKNPDLVPIPKEHQTWGFWSNF
                     AYWGIISFSVGTWISASSALTVGLSYAATIGTFIIGDVVTIAFTLANCYPGWDWKVGY
                     TLAQRFTFGIYGSAFGVVIRVLMSIVNYGSNAWLGGLCINLILSSWSHHYLHLENTLS
                     HKVAMTTQQLIGFVIFHIVCAFCYIMKPYQINKLLILSCTGTCFAMTGMVIYLCKENH
                     GVGQLFTSSKTTATGSARAWAWVYMISYWFGSVSPGSVNQSDYSRFGSSLTGIYLGTI
                     AGLLIPTTLVPVYGAIGASTCEELYGQQLWMPMDIINYWLNNGYSSGARAAAFFCGLF
                     FTLSQISYTISNAGFASGMDLAGLLPKYINIRRGAIFTAMLSVAVQPWNFYNSSSTFL
                     TVVSSFGVVMTPIISVMICDNLVIRKRNYSVVQAFTLKGEYYFNKGFNWRAFVSWVVG
                     MTPGLPGIAWQVNNNYFHNKGIVNFYYGDSFFAFAISFSLYWILCLIFPFKIEILHDD
                     KDYYGAFDDDTAIKKGMVPYSELTEAEKQEYVISKASDVAKNTEGHESDSEISNAYVE
                     EIIEKKSTNDKSEN"
     gene            complement(<800333..>802285)
                     /locus_tag="CAGL0G08470g"
                     /db_xref="GeneID:2888121"
     mRNA            complement(<800333..>802285)
                     /locus_tag="CAGL0G08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446732.1"
                     /db_xref="GeneID:2888121"
     CDS             complement(800333..802285)
                     /locus_tag="CAGL0G08470g"
                     /note="highly similar to uniprot|P13099 Saccharomyces
                     cerevisiae YLR234w TOP3 DNA topoisomerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446732.1"
                     /db_xref="GeneID:2888121"
                     /db_xref="GOA:Q6FSR2"
                     /db_xref="InterPro:IPR000380"
                     /db_xref="InterPro:IPR003601"
                     /db_xref="InterPro:IPR003602"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013497"
                     /db_xref="InterPro:IPR013824"
                     /db_xref="InterPro:IPR013826"
                     /db_xref="InterPro:IPR023405"
                     /db_xref="InterPro:IPR023406"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR2"
                     /translation="MKVLCVAEKNSIAKAVSGILGGGRLSVRDSGYTYIKNYDFNYSG
                     FSFAGGNDVQVTMTSVAGHLTGVDFAHEQYGWGNCRIEQLFDAPLNEVMDKNQQKIAA
                     NIRREAKFADVLMIWTDCDREGEYIGWEVYMEAQKSNRRLNDNQVYRAVFSHLERSHI
                     LQAAHRPHRLDMRSVNAVRTRIEIDLRAGVTFTRLLTETMRNKVASSQSEGPSRNNRR
                     DMPVISYGTCQFPTLGFVVDRFERIRHFIPEEFWYIQLNIKGEEGESKPIQFQWDRGR
                     LFDRFSVLSIYEMCLEQDGDSARVSDIKSKPTSKYKPLPLTTVELQKNCARFLRINAK
                     QSLDAAEKLYQRGFISYPRTETNVFPSTMDLKSLVEKQAQLDQPAQGRSDWAEYAANL
                     LNGSGSNGNRFMFPRSGNRDDKAHPPIHPIVSVGRDVTSLNPTEKRVYEYICRHFLAS
                     CSEDAKGQQTTISLDWSGERFYANGLMVTERNFLDVYPWARWETTRQLPRLEINQQCK
                     ILKAEMKNGSTSPPKPMTESELIVLMDANGIGTDATIAEHIEKIQMRSYVQSQKVGKE
                     TYLQPTILGRALVHGFEAIGLEDSFAKPFQRREMEEMLRQICDGATDRPRVVSDILSK
                     FRRYWNKTNGSKNTLLEVYDRTLRNQ"
     gene            <802604..>804190
                     /locus_tag="CAGL0G08492g"
                     /db_xref="GeneID:2888122"
     mRNA            <802604..>804190
                     /locus_tag="CAGL0G08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446733.1"
                     /db_xref="GeneID:2888122"
     CDS             802604..804190
                     /locus_tag="CAGL0G08492g"
                     /note="some similarities with uniprot|P17214 Saccharomyces
                     cerevisiae YLR233c EST1 telomere elongation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446733.1"
                     /db_xref="GeneID:2888122"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR1"
                     /translation="MKGLKSGALIDANDDIERRLLEFKASFRALLDDRNYAFVDRQHI
                     CGLIRKLNDVRVYVIHYIQSYSSNNLTVSQSKLGTVTLNDVIYLSWKHIYYYILCRLL
                     RILATLKRKKRSLNLSTQYKKCFKGFKVLISDILSALKEILLTVLTLADPNAIFSPTI
                     IKQLLSILNVESLPTKTTISASARISLPIIQSVNQLLLHIGDTQVKSSFILGKSLGFD
                     IPNTYYLSSLITPYEGTCRQKIADYFWETKMYDNFIIKLIESMIVPTRNTRPTQIMFL
                     EYFKRYTRSSFATFINYCIKIINKGDIEQSMSLETEGILQFFQNPSQILDQALLMIYF
                     FHICPLLASHGNFEYEYDNIKKLSYKNLDDRHKAILQLIFEILESHVLTQMPNNEDLQ
                     ISDLVLLRLILVWIKTNRPILFFAHRRRPFIHQMASIQQKYAVQYQISNANKIIHRPK
                     RLYLFKEDIDYRGLICFGSELTDFNDELIQSCEDVADRIMGFVDQQDKLSEEDELKLR
                     YLAICSSINKFNGQTTNTIS"
     gene            804376..804519
                     /gene="tRNA-Ile (TAT)"
                     /locus_tag="CAGL0G08514r"
                     /db_xref="GeneID:2888123"
     tRNA            join(804376..804413,804483..804519)
                     /gene="tRNA-Ile (TAT)"
                     /locus_tag="CAGL0G08514r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2888123"
     gene            complement(<804969..>805652)
                     /locus_tag="CAGL0G08558g"
                     /db_xref="GeneID:2888124"
     mRNA            complement(<804969..>805652)
                     /locus_tag="CAGL0G08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446734.1"
                     /db_xref="GeneID:2888124"
     CDS             complement(804969..805652)
                     /locus_tag="CAGL0G08558g"
                     /note="highly similar to uniprot|Q00245 Saccharomyces
                     cerevisiae YIL118w RHO3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446734.1"
                     /db_xref="GeneID:2888124"
                     /db_xref="GOA:Q6FSR0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSR0"
                     /translation="MAFLCGSSSSQSSGSKKPVERKIVILGDGACGKTSLLNVFTRGY
                     FPEVYEPTVFENYIHDIFVDNRHITLSLWDTAGQEEFDRLRSLSYSDTHTIMLCFSID
                     SRDSLENVKNKWVGEITDHCEGVNLVLVALKCDLRNNENNVITPNNIQNNRNNNNNNN
                     LITYEEGLAMAKQIGALRYLECSAKLNKGVNEAFTEAARVALTAKNATDNINSNSSSN
                     EKDSFCTIC"
     gene            <808355..>811147
                     /locus_tag="CAGL0G08602g"
                     /db_xref="GeneID:2888126"
     mRNA            <808355..>811147
                     /locus_tag="CAGL0G08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446736.1"
                     /db_xref="GeneID:2888126"
     CDS             808355..811147
                     /locus_tag="CAGL0G08602g"
                     /note="some similarities with uniprot|P23250 Saccharomyces
                     cerevisiae YIL119c RPI1 negative regulator of ras-cAMP
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446736.1"
                     /db_xref="GeneID:2888126"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ8"
                     /translation="MDLLNSKFGISVDDKKSSDGESKNNNETSSNSSANTAQLDEPID
                     IGVEVGGLDVNIDSSSSDTTSKKIKDLIENDADRSSGRRTKDITNQQRKSGRHQHDSN
                     EANERRIDNNTNNNNSVNNGNDNGNTSGRTQNSRGTDSLVLENSSRNNTISNERSSIS
                     NVGAGHDNINASQGDINGNVTTGIMNSQSRGISQLNSGNDLSSNINDNNNNNSNNNSS
                     NININNPNNSNSNNNNHNTAMNTAVSSSSNNSSSKNSGSTSSQSHMGLMSSVSSTSND
                     SSSSGEMMMKARMESDIRQNKEQDQNQNENVHVKKDPNDLKGIRPIRKKWKDYEDIAF
                     VKTILENAELLTYVEYFKPMKNFWIRIAQILNEKYGYVRNFRQCHDRFKVLYAKALRL
                     DDSLSSDHNHANSTSSMGNSTFSFLNDASTSGTPQRLGTSITDALSRQTPQNISQSIP
                     PMSGNNLNQNTNLFTSNIASAPNYYGSVYDHKARYHQDDGLRSLPLPLKHLLIKLRKT
                     ITFYNGNIIFKKATEIKDNNQINLNINRIPDYDGESKTDTLNTNNSKIAKGTSGKSNY
                     LSPTIGDEPNEMPDQRTSSLGDLQLQNSSSSSGNTGATPANYNFNGSNPTPSQFNMGL
                     PNLLQQNPNPMAYAPVSNGSQLQFSSTSSSNTTGSQSQVSSFYPPQFGYSANANSNIN
                     VQTKIPNQIPLATNTQVAMPPFPQQSQKMPIFGENNRAGNDNQLQTTKPPADNEKSNM
                     DNMYQSMYTVISTLREQIDQLRNQISDLNSRYEEQSKMLSTLYAIIQQPLMPPSSETS
                     SSSSTSFSSTFLDQQLQNSQNNQNNMMFSNQQQNSNPNMGTNNQQTSKRQPAQQNQQG
                     SELPLPKQSINTNTSPQQYNQPTSIQQPHYQMTQNKHQSGRKLPNLPQPKLPQSLPQL
                     GNSTVLPQPQNFNDKP"
     gene            complement(<811931..>813682)
                     /locus_tag="CAGL0G08624g"
                     /db_xref="GeneID:2888131"
     mRNA            complement(<811931..>813682)
                     /locus_tag="CAGL0G08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446737.1"
                     /db_xref="GeneID:2888131"
     CDS             complement(811931..813682)
                     /locus_tag="CAGL0G08624g"
                     /inference="similar to AA sequence:UniProtKB:P40474"
                     /note="similar to uniprot|P40474 Saccharomyces cerevisiae
                     YIL121w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446737.1"
                     /db_xref="GeneID:2888131"
                     /db_xref="GOA:Q6FSQ7"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ7"
                     /translation="MMEDQQSLHSFISDYDQRSHAVEKYDGPDLSEVDSEDNDKMIKT
                     NEDEAVKEPIYRTRSNQTEPDIANAPPYSRFDAKYKMALVLQCAYTGLFSTMAGAIYY
                     PVLSVIEKQFHITEELVNITVVVYFIFQGIAPTLMGGLADSLGRRPVVLFAVTVYFGA
                     CIGLACAQTYAQIVVLRCLQAAGISPVIAINSGIIGDVTTRAERGGYVGYISGFQVLG
                     SAFGALIGAGLSSRWGWRSIFWFLAIGSGVCLVFSIIMLPETKRTIVGNGSVTPRNYL
                     NRAPLLMFPLIRRKLHLDDPEYETLEPRTQLSLLAPLSILKVKEISILLVTAGIQFAT
                     WSTHQTALSTVLSKNYHLSVAKIGLCYLPTGICTLISIVTSGRYLNWSYRRRFAKHKV
                     WLKEQEEILVKENGYSREEVQNIINNDPKYVFNLVQTRLHAAFVTLLLSSSGFVAFGW
                     CIDVKAPLASVLVMSGFASLFSNCILTFSTTLIVDIFPSKTSTATGCLNLFRCLLSAL
                     FIGCLSKMATSMTYGGVFTFLGALTALSACPLFYLLKNGREITLKRKRKEDASRAFAL
                     SVANEKAEAEGKAEESR"
     gene            complement(<814956..>816533)
                     /locus_tag="CAGL0G08646g"
                     /db_xref="GeneID:2888132"
     mRNA            complement(<814956..>816533)
                     /locus_tag="CAGL0G08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446738.1"
                     /db_xref="GeneID:2888132"
     CDS             complement(814956..816533)
                     /locus_tag="CAGL0G08646g"
                     /note="some similarities with uniprot|P40473 Saccharomyces
                     cerevisiae YIL122w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446738.1"
                     /db_xref="GeneID:2888132"
                     /db_xref="GOA:Q6FSQ6"
                     /translation="MEKDHLVEEEKKDKVESEKPEEGVTVPKVESNDDIHQTDTPKVD
                     STTSEGKLKDPVAVERPSINSTNTSSSGGFGNTVNDLSQPSTRPVTTAETSTNSNLPW
                     DGNQANRNLNSQSYDLRVHLLKSLGIEDISRIDIADNKLLERFFSLHIEREQKEIEKL
                     KTKNLEKLELIVDKFVSNEKFTNDTLNKLLELISSKSIDSHDLLGSSSIQLKRTEHSP
                     NRLMSPRGHKRYKSEIPTVPETQYSHINYNIHGQPVNMVYHQAYQQVTPQTYYVPQGN
                     QAWHQGSYTQGNRATFQPPSLANSNINNSEDVKLQEGVKVEPSGRARQRSSTSLGASL
                     STSNSTSNLSNTMKAATANEGKDTGSNDGHHTGSYGASNASNVMPSQVNNPNYMTYGS
                     VRGGPYVMVQQPPGQQMATQYIPAGNQGFYQSVVPNQGHMNGMVASSQGYQANTPQPA
                     TSDNMVMLGNQYRGNETLHQDATPSLSSSTSQKRQGHRRTQSANVVLSTGRSPNRMNM
                     QRQVNFLIHTPKHPPPT"
     gene            complement(<820669..>822078)
                     /locus_tag="CAGL0G08668g"
                     /db_xref="GeneID:2888196"
     mRNA            complement(<820669..>822078)
                     /locus_tag="CAGL0G08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446739.1"
                     /db_xref="GeneID:2888196"
     CDS             complement(820669..822078)
                     /locus_tag="CAGL0G08668g"
                     /inference="similar to AA sequence:UniProtKB:P53616"
                     /note="similar to uniprot|P53616 Saccharomyces cerevisiae
                     YNL066w SUN4 or uniprot|P40472 Saccharomyces cerevisiae
                     YIL123w SIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446739.1"
                     /db_xref="GeneID:2888196"
                     /db_xref="GOA:Q6FSQ5"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ5"
                     /translation="MRLPTAKSCALGFTLATSLVEALPQFDRYKEHSKKDVSHQHQRK
                     RAVTVEYVYATVTVAHDAEQQNNAANDLLKEDEVQGNVAAAGSPAQEAVQPTTTDYAQ
                     GQTSTLQPETPPSSSSQYNANQEQQQQQNQPNDQQAAAQPAGNDQQSNAYSSEVPAAP
                     QSAQVPTSPSSTPSNAATSNSGSSSNTNSGSSSAGTGSIYGDLASFSGPNQPFQDGTI
                     PCSQFPSGQGVIALDWLNQGGWSGIENSDTSTGGPCQEGSYCSYACQPGMSKTQWPSN
                     QPADGRSVGGLLCKNGFLYKSNPSANYLCEWGVNAAYVESHISQGVAICRTDYPGTEN
                     MVIPTFVEAGSTLPLTVVDQDTYYQWQGKKTSAQYYVNNAGVSVDQGCIWGTPGSGVG
                     NWAPLNFGAGSTNGITYLSLIPNPNNRSPLNFNVKIVASDDSSVVNGQCSYENGVYSG
                     GADGCTVAVTSGSAKFVLY"
     gene            complement(<822798..>823682)
                     /locus_tag="CAGL0G08690g"
                     /db_xref="GeneID:2888197"
     mRNA            complement(<822798..>823682)
                     /locus_tag="CAGL0G08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446740.1"
                     /db_xref="GeneID:2888197"
     CDS             complement(822798..823682)
                     /locus_tag="CAGL0G08690g"
                     /inference="similar to AA sequence:UniProtKB:P40471"
                     /note="similar to uniprot|P40471 Saccharomyces cerevisiae
                     YIL124w AYR1 1-Acyldihydroxyacetone-phosphate reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446740.1"
                     /db_xref="GeneID:2888197"
                     /db_xref="GOA:Q6FSQ4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ4"
                     /translation="MSQTQRRKVAVVTGASSGIGYEVTKELARKGFKVFACARRTAPI
                     EPLVNSFGKELIVPHHLDISELDEVLKFKEFLASELPEQKLDILYNNAGQSCTFPALD
                     VSNDVMEQCFKVNVFGHINMTRELAQYLINAKGTVIFTGSIAGFSTLPFGSIYAATKA
                     AIHEYARTLHLELKPFGVRVINAITGGVLTDIADKRDLPEGSIYKFPQGIDAFRTRQT
                     MAKDNHPMPADVYAKKVVEDLLSSRDPVDIYRGRFATIMSFVHILVPYWLLEWGLARK
                     FKLDKVAVAIQEKYNKTE"
     gene            complement(<824549..>827584)
                     /locus_tag="CAGL0G08712g"
                     /db_xref="GeneID:2888195"
     mRNA            complement(<824549..>827584)
                     /locus_tag="CAGL0G08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446741.1"
                     /db_xref="GeneID:2888195"
     CDS             complement(824549..827584)
                     /locus_tag="CAGL0G08712g"
                     /note="highly similar to uniprot|P20967 Saccharomyces
                     cerevisiae YIL125w KGD1 2-oxoglutarate dehydrogenase
                     complex E1 component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446741.1"
                     /db_xref="GeneID:2888195"
                     /db_xref="GOA:Q6FSQ3"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ3"
                     /translation="MLRTKAWSSSWRLANRKVLQQRTVLNTVRATAVRTYASQDNFVN
                     TTNAAYIDEMYQAWQQDPSSVHASWNAYFKNMKDLKIPASQAFQAPPILLGSPQGTHE
                     APLSTLSGSNIDENVSVHLKVQLLCRAYQVRGHLKAHIDPLGISFGSNKNATIPKELT
                     LDYYGFTERDLDREINLGPGILPRFARDGKKSMTLREIIEHMEKLYCTSYGIEYTHIP
                     SKEKCEWLRERIEIPTPYQYTVDQKRQILDRLTWATSFESFLSTKFPNEKRFGLEGLE
                     AVVPGIKTLIDRSVEMGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFQGTTKKDVE
                     GSGDVKYHLGMNYQRPTTSGKYVNLSLVANPSHLEAQDPVVLGRTRSILHAKNDLETK
                     SKALAVLLHGDAAFAGQGVVYETMGFVNLPEYSTGGTIHIITNNQIGFTTDPRFSRST
                     PYPSDLAKAIDAPIFHVNANDVEAVTYIFGLAAEWRQTFHTDAIIDVVGWRKHGHNET
                     DQPSFTQPLMYKQIAKTPSVIDVYTDKLLKEGSFSKSDIEEHKKWVWGMFEEAFEKAK
                     DYVPTPREWLTAAWEDFKSPKELATEILPHEPTKVSEDILKNIGKTISSWPENFEVHR
                     NLKRILNQRGKSVETGEGIDWATGEALAYGSLVLEGHNVRVSGEDVERGTFSQRHSVL
                     HDQASEATYTPLKNLSDKQADFTIANSSLSEYGVMGFEYGYSLTSPENLIVWEAQFGD
                     FANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQMANEDPR
                     YFPSPEKLQRQHQDCNYQVVYPTTPANLFHILRRQQHRQFRKPLVLFFSKQLLRHPLA
                     RSNLSEFTEGSFQWIIEDVEHGKAIGTKEETKKLVLMSGQVYTALHKKREQLGDKTTA
                     FLKIEELHPFPFAQLRDTLNSYPNLEEIVWCQEEPLNMGSWNYVAPRLQTVLKETEQY
                     KDNVVRYCGRSPSGAVAAGNKKLHLAEEEAFLKDVFNES"
     gene            complement(<828730..>829305)
                     /locus_tag="CAGL0G08734g"
                     /db_xref="GeneID:2888092"
     mRNA            complement(<828730..>829305)
                     /locus_tag="CAGL0G08734g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_446742.1"
                     /db_xref="GeneID:2888092"
     CDS             complement(828730..829305)
                     /locus_tag="CAGL0G08734g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae YGL147c RPL9A or uniprot|P51401 Saccharomyces
                     cerevisiae YNL067w RPL9B"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_446742.1"
                     /db_xref="GeneID:2888092"
                     /db_xref="GOA:Q6FSQ2"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002359"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ2"
                     /translation="MKYIQTEQSIAVPEGVTVSIKSRVVKVTGPRGTLVKSLKHIDVT
                     FTKVSEKLIKVTVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKLRYVYAHFPINVN
                     TIDKDGKKFIEIRNFLGDKKVRLVPVRDGVDVEFSTAQKDELVLSGNSVEDVSQNAAD
                     VQQICRVRNKDIRKFLDGIYVSHKGFIEEDL"
     gene            complement(<829778..>833842)
                     /locus_tag="CAGL0G08756g"
                     /db_xref="GeneID:2888093"
     mRNA            complement(<829778..>833842)
                     /locus_tag="CAGL0G08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446743.1"
                     /db_xref="GeneID:2888093"
     CDS             complement(829778..833842)
                     /locus_tag="CAGL0G08756g"
                     /note="highly similar to uniprot|P32597 Saccharomyces
                     cerevisiae YIL126w STH1 subunit of the RSC complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446743.1"
                     /db_xref="GeneID:2888093"
                     /db_xref="GOA:Q6FSQ1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:Q6FSQ1"
                     /translation="MSETLSMPMAVDSVVPKEEDLVPSEELKLRIPKPRSSEELEQLI
                     FRYRAIITRPDSNKVEIDAIEDVFAQITQEQDEFNARLKELQDLRDSLSKYDSEKLRK
                     QVLALQLLERDLQLPEDLLKDEETVSANHPTDTNLIKQIKLAYNLDENAELLGMKDSF
                     TLVTLKNQLGNRETEEIISTRIAKRIFELERLPGNLATYSLNDCLDFISKNDAPSKID
                     EHKLKAIIELKSLKLLTKQKSIRQKLINTVASQAHHSIPFLRDSPFTMAAQRSVQVRS
                     KVIVPQTARIAEELERQHLLDKRKKERNLHLQKVNTTLSLIRERQENEWSRSDRCAQF
                     GRICMSLHGQIERDEQKRIERTAKQRLQALKSNDEEAYLRLLDQTKDTRITQLLRQTN
                     SFLDSLAQAVRVQQNETKILKGEEITPINDEDREKIDYYEVAHRIKEKIEKQPSILVG
                     GTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLYEVKQEPGPYLVI
                     VPLSTITNWTLEFEKWAPSLTTIIYKGTPNQRHALQHKIRSGNFDVLLTTYEYIIKDK
                     ALLSKHEWSHMIIDEGHRMKNANSKLSFTITKYYRTRNRLILTGTPLQNNLPELWALL
                     NFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLVIRRLHKVLRPFLLRRLK
                     KEVEKDLPDKVEKVVKCKLSGLQQQLYQQMLKHNALFVGAGTEGATKGGIKGLNNKIM
                     QLRKICNHPFVFDEVEAVVNPSRGNSDLLYRVAGKFELLDRILPKFKATGHRVLIFFQ
                     MTQVMDIMEDFLRMRDLKYMRLDGSTKAEDRNDMLKEFNVENSEYFCFLLSTRAGGLG
                     LNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDSVEEVILERAMQ
                     KLDIDGKVIQAGKFDNKSTAEEQEEFLRRLLENESNRDDDDKAELDDDELNDILARSD
                     DEKILFDKMDKERIEMEKKHAKELGLNAPQTRLIETDELPSVFTEDIEKHLKPEPVAL
                     GRMRNTKRVFYDDGLTEEQFLEAVEDENSTLEDVIKRKREARERRTRNRAKKLDSENI
                     EEEPVEGTPKMEENGAVTETVENGGDTELNDSQPDQTQAKGRRGRRRRGALDDVKVSE
                     QLPEEPVHDGTTSEPLKASPRKGRKRTIKIVESEKPKNLVEIIEGPDKKKPKLKIKLK
                     LKQNDDQSIPEENDTETNKTDKASSKKVSAKIKVKTPKQPINETKKLVDTLVDDMRSQ
                     LDESDEHPLTSIFETLPSKREYPDYYKLIKKPLSIDVIQKNARKGVYKSLDDVKEDIQ
                     TMFDNARFYNEEGSWVYNDAEKLNEFTNTWFSKH"
     gene            <834413..>835021
                     /locus_tag="CAGL0G08778g"
                     /db_xref="GeneID:2888094"
     mRNA            <834413..>835021
                     /locus_tag="CAGL0G08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446744.1"
                     /db_xref="GeneID:2888094"
     CDS             834413..835021
                     /locus_tag="CAGL0G08778g"
                     /inference="similar to AA sequence:UniProtKB:P40470"
                     /note="similar to uniprot|P40470 Saccharomyces cerevisiae
                     YIL127c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446744.1"
                     /db_xref="GeneID:2888094"
                     /db_xref="GOA:Q6FSQ0"
                     /translation="MVSKNSKMQATLAVNSVLASLLPGAAAITGSNKKVSKPRVAKAQ
                     LIDMNLKKRLELQEKDVYLEKRKEKRARKSTLRKRREEEFEMEQKAKLQILNKHREQG
                     TLTQKEKAYLDELAKRNTKKLKSWDLEDDVKEDFLEIQAQILNDTKESSKRRSSKKKN
                     KNKGFKQTLSSSSKVQDHRYPGLTPGLAPVGLSDEEESSDDE"
     gene            complement(<835307..>838369)
                     /locus_tag="CAGL0G08800g"
                     /db_xref="GeneID:2888095"
     mRNA            complement(<835307..>838369)
                     /locus_tag="CAGL0G08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446745.1"
                     /db_xref="GeneID:2888095"
     CDS             complement(835307..838369)
                     /locus_tag="CAGL0G08800g"
                     /inference="similar to AA sequence:UniProtKB:P40469"
                     /note="similar to uniprot|P40469 Saccharomyces cerevisiae
                     YIL128w MET18 involved in NER repair and RNA polymerase II
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446745.1"
                     /db_xref="GeneID:2888095"
                     /db_xref="GOA:Q6FSP9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP9"
                     /translation="MDTDLLTFMANAGVNDERAQASAVQLSEKVKNKTLRLLDIIVSL
                     KDYIVSEDGGERKKSLQCLNGIIAHLPKDGLSKNEIAVLFQFFQSKIDDTELMREVLT
                     ALELLSSFNFFVVQQAKETLQTLQDKYVPTNFLAAVRYVAFNILVTLYGRFEDQLKEN
                     ESLAHLFIATYIHVATGEKDPRNLLSSFKLNETITKHLSQYTVKYGEQLFDVLFCYFP
                     ITFKPPKNDPYKITNADLKTALRSAISATPLFAEDAFGNLIDKLTATSPAVKNDTLLT
                     MAACIESYGGENCLKHWLPLWNGLKFEIMQNNDDGDDTMLDPVSNLSIKGEIKSNYRA
                     ALDVLKALGVVLEQFDQKAFQKYFDHILDELKNNFKYQKDLKQSCNILASIASGNEYN
                     FNYAIAGSFPLFVESSSETTKLKYLLMNLSFFFNAYMEVYGVLSKESLNSEICQNKMQ
                     EYKDELLMIIGMALTSSSKLEVTVRTLSVIKFTQMAKMKGFLKREEISLIVQYITDTI
                     LTDSNKNIYYACLEGLKSISELYEDIVYEVALTRMLNLLPEALDEASIAHDETLILAE
                     TLLKIILDFTTSRHILVKESILSLTKKLCKTSASIARRSSDYCFLILSTIYSLYDNNY
                     FLLKEGDGALLKHEIENDLYAVLADGVNVKDDDLNLSLISNIFYFMHLCNGTTGAATE
                     VEKASQYFIEQHSITKQPNRLSMTYSKIIQALTKEIQFPQADQILSEVKSLLSGFDST
                     MTEFEKLGYFEILLALSNKWLDDDYILSILNWEDRSYCNLEVMIWLSKGLIAKNSKYS
                     DDILQNFIAMLSDHVIGTKVSKLFEVFVIDFTSFKKYKGIAWNNNIKLLYKQRTFSGI
                     FLKLVSLYQTSNNMDIKCNYLTALSLILKHTPSELVSPFMKDLLPMLLQALDMPNSEV
                     RLSALETLKDSTEQHHQLVAEHIQSLVPSLLSLVKVDEYNTVMIRLSALQLLQLLTEH
                     LPINYCLNYKQDIINGLLEPLSDKKRVVRKQCIDTRQAYFELGQVPFE"
     gene            <839448..>846449
                     /locus_tag="CAGL0G08822g"
                     /db_xref="GeneID:2888096"
     mRNA            <839448..>846449
                     /locus_tag="CAGL0G08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446746.1"
                     /db_xref="GeneID:2888096"
     CDS             839448..846449
                     /locus_tag="CAGL0G08822g"
                     /inference="similar to AA sequence:UniProtKB:P40468"
                     /note="similar to uniprot|P40468 Saccharomyces cerevisiae
                     YIL129c TAO3 Transcriptional Activator of OCH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446746.1"
                     /db_xref="GeneID:2888096"
                     /db_xref="GOA:Q6FSP8"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP8"
                     /translation="MNTAFTFPPQNSEIQESDDTGYMEQTIIPSSNQVQTNTPIMDAT
                     TDNSIGNLQEDYTEDSQVPLDDDPMTLQQKLLNMQEALPTTMNPLHINTGTANNITAT
                     QEIPVIAIPSPSEIPANSLRNQLRQSSLKNEIFSNRSEAPKIGETNIRQVASLKSKTG
                     NAKEASVNIDTSEPISLSPTDSNARAKSDMYVATLRQQMATDWKSPSEYALHILFTKF
                     IRHAEQKLDLCLQQPLVIEPPIVEILGEGIDPTFDKVIESLGHVAKNKPKPVIDAMMF
                     WRKTKSEAAINANHDLERLLKDYEVEQNKLSRNQPLRSTSQRKGTDLLKRKNTNSTNV
                     STGSSFNFSHKRNKSSKSSLGSKLTESSHLQNIEIAIESSRDSVLQAERKSLASIYIL
                     CRVLIEIVKQSSEEDKYLNDLEDIVFTQLKTTDPLSISTSIMKSSNWNSFAELLGYMS
                     EKRFISVSDKFIADLEKLPPQIPPEMEPSIHLLILGMRYVRLKNYPLERFEESADFMK
                     SLSKFYSKSSNISISLAYTEVINQLLLPLAGHITAEVNHPVWVEAMSSLLETASKLQN
                     DNKYWANGFKLTVSILCVSPPELFSNRWVTLMEANASKIRTKIFSEKVIFAVALSRLV
                     WVYLYRCPETLNNTMRTLEKLLRMYLNTKKKENWLTPDFELLNPLADALVSVGYAHPN
                     FIMEHAVLSLFRQSFNGLTLDDVNFEKLMLALNTYRGILATNTRPGFPENDCRTYATN
                     LDNIQFDVTKESLSQNHKEVCSYIHKLFTLLDARIGSEVWSPENQHTKSSSSFGPFTF
                     NFSNDNYAINTKNTEVCLFATVIEVIPGCLSVSSEIPYRSTIEILSRNAVHANSTISD
                     SCRRAFRALASKRSPYTLITWFAKYSFDFDERMQSNYNMSYLVSMEYYKLLELYVELL
                     ECWLQAFQSSNKEKDKKGIGLDGIRLMAEDEGIAGDYDSVYEEKKKLEWKNTITVIEE
                     VEGNGLFFLCSFEAHVRALGVKILKIISKFDEAMIAKTVKLSSNSHVRTVSNHFAADS
                     GTRLIDILNNCNATTILNANSSSLSAVEKTRFAKLTLKHKKGVLIRLAESDYGVDAAL
                     WQRAFPPLLSHIFKQCPVTMALCRSIVCIRLVQLHELILKVANNPDYRPEGVLSETVI
                     NQWRLYLIAACTSLTSTSDQKLHIPVPNSVQHGRKKSQQIFTVQHQKIKSVKSIFKMV
                     LPLLNAQHAMVRDAIIVGLSSMNINIYRTYIESIDEFLTNWKEQSSKNAIRIEMFHIL
                     TILSQFMYDPIILDDRWILERIAEYLRQAKKFLEMDSVQNSFAFQSLRSHFATLLLNF
                     YKAAHRLSYFDKLFPFQGRTSSFNYLKEWCGYGEFSYIAEERYNLMVKKADNTRDKTA
                     ILTGIEFQRKKLEKTVLEAMVALCEDPIVKCIDDVPGLPVVISFDTVGLLSWIGSLFN
                     SGNDTIRGLGVEALENLLENNQDNAKLFKEVANQCVSYHNDPSVSFLYYTTLCKAVLK
                     LENLILEEDELVSLGLYGLVSDNEMIRTYAADLLSVVETKLHNSSYIKVFEERLSNSS
                     KTVFKSTAQEISSIFADLLSQELCLRIFSTLVRILELFQFEIKRDILVLMVPWVNKFT
                     LKSLDEIDTYMVLNNLFYITVDLNDTFPKEVEQLWISLGKGNAFQNTHVALEYIMTCS
                     ISYCNPIFVEYASDVVLYLANVPGGLGLVDSLLQNLKPKLIVPTHSELPTLPSNNNKY
                     VFVGDVVSRLNYHGKSVIFSKTQITIVFLVNLLNSPLDALKDELPSLLHISVCLLDHY
                     IPVVKKSASRLLCNLIFLFSPTHEKTDLTVEILRSDDQLWSYDHLVRDKKGARSPKMM
                     DQLIKNLLDIFSSIESVQENWQKVSLKWATACSVRHIACRSFQMFRSLLSSLDQEMFR
                     DILHRLSNTVSDSNTDIQGFAMQILMTLNAITAELDPTELIGFPQLFWSITACLSSIH
                     EQEFVEVLSCFSKFLSKIDLDSPDTVQCLVATFPSNWEGKFDGLQQIIMNGLRSSTSL
                     EITWKFLDKLNLLKDSRIIANTDTRLLFALIANFPRFLQAMDTKQYDQIESAASSLIV
                     LSEAYEQPSLSRLINSLIKDKFRSKRDFMSQVVSFISRNFFPDYSAPTLVFLLGLLLN
                     KVSWVKVQTLEILKYVFPLLDMSRPEFLGVGADLISPLLRLLLTEYEAKALEVLDCVP
                     NVLGSKMDKDVLRTTMGNKNSKNSTNLTTTLFGIPEESGWSIPMPSITAATTRHNVHA
                     VYMSCLPESMGDTDAHEIDNDIDVITEFHVDAEYGLGRMETNDSISVVEEKDPSLSHM
                     WMQLDNLDNFFAQDNVASTTNDLSVWR"
     gene            complement(<846590..>849133)
                     /locus_tag="CAGL0G08844g"
                     /db_xref="GeneID:2888357"
     mRNA            complement(<846590..>849133)
                     /locus_tag="CAGL0G08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446747.1"
                     /db_xref="GeneID:2888357"
     CDS             complement(846590..849133)
                     /locus_tag="CAGL0G08844g"
                     /inference="similar to AA sequence:UniProtKB:P40467"
                     /note="similar to uniprot|P40467 Saccharomyces cerevisiae
                     YIL130w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446747.1"
                     /db_xref="GeneID:2888357"
                     /db_xref="GOA:Q6FSP7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP7"
                     /translation="MNLTVPHRQEGKRRKVTRACDDCRKKKVKCDGNQPCIHCTVYSY
                     ECTYNHPLKRLQSRSGSGSVSTLRGLSNSNSNSNSSIVSLASLNQSMQGLGTGSGVSK
                     VQKNLSSRKYNTKNAKLQAELDVYKTIFEALFPNAPNIKDIDVPTFLQIFQNFKSSAP
                     TFLDDVMKEYNLIASENTISPAGTEGSPDDINRSETNSVCSVRDCETPVMDAKENSKT
                     SHSSSIPPVVGREIKIILPPKPIALEFVKNTWEHCCVLLRFYHRPTFIKQMDELYETD
                     PHNYSHEQMRFLPLCYSTMAVGALFSKSIIHDDLNHDHTDEILSNNKFLQDEGYKYFI
                     AARKLLDITNARDLNSMQTILMMFIFLQCSARLSTCYTYIGLAMRSVLREGFHRNLPD
                     NSIHTPLEIEMRKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLPDEALTEQG
                     INYDQNPYSLSSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMW
                     LEELPRELVPNAHDIHPQYERANKLLHLAFLHVQLILYRPFIHYISKNVIKTEEDELS
                     YLRANNSIKVSRTVVHLAQDMLKNNLLTGSYWYACYTIFYSVAGLLFYIHEAEKPNTN
                     NTDEYYEILKDANVGREVLIKLKDSSMAAERTYHLLNKLFEKLNSKTIIMTSLYSSPE
                     KRSTNLVDSSMANAKSVEETFNSYLSSQNPTDMFPQFQDKSTNGPLETSMHNHIQKST
                     FAPNEGDMINPNALGMDNNISYENNNFNDLASFFNLEPDKRMKNELDVLEDNLTNPKS
                     LNQNSIYTEERLPENEGVRVKSEPGEGIHGVFDQLDAHLFGKYLPTNNA"
     gene            <850923..>852752
                     /locus_tag="CAGL0G08866g"
                     /db_xref="GeneID:2888358"
     mRNA            <850923..>852752
                     /locus_tag="CAGL0G08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446748.1"
                     /db_xref="GeneID:2888358"
     CDS             850923..852752
                     /locus_tag="CAGL0G08866g"
                     /note="some similarities with uniprot|P40466 Saccharomyces
                     cerevisiae YIL131c FKH1 forkhead protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446748.1"
                     /db_xref="GeneID:2888358"
                     /db_xref="GOA:Q6FSP6"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP6"
                     /translation="MDEGLDLSLIPSTLRDDLLRTIISSLYEPEKTAVARQYDNQTLT
                     AEDNKPHSNHKAKLVGRSWTFRLKSDSVTIGRNTDTFNNTFNWSTRAGLDIDLGPSKT
                     VSRNHAKINFDERNGKWVFTSLGRNGAKINGKRVKPTDAESSVSVSISNGALIEVGGV
                     DMMFLVSDMYPKYTQKTLDVIATRLFKHYKLESEPINVVENPFTWGIIRYSKYYNSRV
                     RDELKIKEGTVPVQKLKLEIELEKIRESNKKKETQESNVDRSLPLQEEGSGDHSSHTD
                     KEKLPKDSNIIPKQETVHDNDVTKTKGNAVTDTEMHVSQETDNFQSSIIEPPKEISKT
                     SFYTKYDVSKSDTPVSDEISGNSKNLKNIRSLDETGTTTNIDGETAVNSKRQHDNDIP
                     DERTIKQPKFDVSRLQKELNSNSKALGDKNEANASVNPDVSFADKAVKDVKLITDRRI
                     LSDNRNGTAKPKDSYATLITKAILSSPSGERTLSEILKYISDEYPYFKTSTLDWPNSV
                     RHNLSVNKKFEKISKRANAIGKGNNWRISLDYQQEFLQKWKKGTLKFMKKTDAVDRQL
                     LLYISKHGDLPRRQAPDDSPKRITIQSMSEAPGSKKLERTTKL"
     gene            <852991..>853635
                     /locus_tag="CAGL0G08888g"
                     /db_xref="GeneID:2888359"
     mRNA            <852991..>853635
                     /locus_tag="CAGL0G08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446749.1"
                     /db_xref="GeneID:2888359"
     CDS             852991..853635
                     /locus_tag="CAGL0G08888g"
                     /inference="similar to AA sequence:UniProtKB:P40465"
                     /note="similar to uniprot|P40465 Saccharomyces cerevisiae
                     YIL132c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446749.1"
                     /db_xref="GeneID:2888359"
                     /db_xref="GOA:Q6FSP5"
                     /translation="MPPKRYDDLSLLTLWPVAPDIDLAQYIYQFLTSEVGTQTEKEVY
                     FTDSINSFPIHQLQELVNESNQSIYENIKINTALDLHELSSIIKKNTESLILKKIQNK
                     KTNDLKPFQILSVINGLDVMFRSTLVSFTNEQAHLMLRDVMLRLRQVCNEYDCSPLTF
                     KIILLFNRSDVMELLPKQRHSAAHQQKKMKYNNAMEGNSVGEFVGKYYCDEVAQ"
     gene            complement(<853693..>854562)
                     /locus_tag="CAGL0G08910g"
                     /db_xref="GeneID:2888360"
     mRNA            complement(<853693..>854562)
                     /locus_tag="CAGL0G08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446750.1"
                     /db_xref="GeneID:2888360"
     CDS             complement(853693..854562)
                     /locus_tag="CAGL0G08910g"
                     /inference="similar to AA sequence:UniProtKB:P40464"
                     /note="similar to uniprot|P40464 Saccharomyces cerevisiae
                     YIL134w FLX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446750.1"
                     /db_xref="GeneID:2888360"
                     /db_xref="GOA:Q6FSP4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP4"
                     /translation="MSDRYTPLQKEVISGLTAGSVTTLIVHPLDLFKVRLQLLITSTT
                     KKGYRNLWSEIVGSDLSLTRELYRGLTVNLVGNTIAWGLYFASYRVAKDYLINYNHRI
                     RNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMMSKANSDLTSMKVLRDLIKNDG
                     VQGLWKGLVPALVGVSQGALHFTCYDTLKHKLVLKNRDSDEITNLETIAVTSVSKMLS
                     TSAVYPFQLLKSNLQSFQASENDFKLLPLSKMIYSRSGLLGFYKGLSANLLRSVPSTC
                     ITFCIYENFKSFL"
     gene            <855763..>856866
                     /locus_tag="CAGL0G08932g"
                     /db_xref="GeneID:2888080"
     mRNA            <855763..>856866
                     /locus_tag="CAGL0G08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446751.1"
                     /db_xref="GeneID:2888080"
     CDS             855763..856866
                     /locus_tag="CAGL0G08932g"
                     /inference="similar to AA sequence:UniProtKB:Q08144"
                     /note="similar to uniprot|Q08144 Saccharomyces cerevisiae
                     YOL018c TLG2 member of the syntaxin family of t-SNAREs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446751.1"
                     /db_xref="GeneID:2888080"
                     /db_xref="GOA:Q6FSP3"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP3"
                     /translation="MFRDRTNLYLSYRRTFPHNVRLSSTYRDDSDKATTEFDIDNEAY
                     PMIEMGVHSKGKNTLPPVFIDIARDIDDYLDKVREHTAKLHKLYQKNSLPGFEDKTHD
                     EKLIEDISFKVIQLFQKCYNIMKKLKGIYDDQTVDGRRLNRGELMILDNVQKSYADKI
                     QIESNKFRALQNNYLKFLNKDDLKPISNNTLKSSSANETALLEEDTIGGIGAREQQEI
                     EEYSRQTLQRRQATSSDNYLHVRDEEITQLAQGVLEVSTIFREMQSLIIDQGTIIDRI
                     DYNLENTVIELKSAQNELNKATTYQKRTQKCKIILLLTLCVIALIFFILLKPRGGSTR
                     VVHEVEQVPVPVHPEINDFENDKRYIEDNIQLI"
     gene            complement(<857016..>858788)
                     /locus_tag="CAGL0G08954g"
                     /db_xref="GeneID:2888081"
     mRNA            complement(<857016..>858788)
                     /locus_tag="CAGL0G08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446752.1"
                     /db_xref="GeneID:2888081"
     CDS             complement(857016..858788)
                     /locus_tag="CAGL0G08954g"
                     /note="some similarities with uniprot|Q08157 Saccharomyces
                     cerevisiae YOL019w TOS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446752.1"
                     /db_xref="GeneID:2888081"
                     /db_xref="GOA:Q6FSP2"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP2"
                     /translation="MAERKRTVMFLVVGLLAFISMAFFIIASVTAPAFHQIGLAKSNG
                     FTYGTLGYCQDGCSRASASYHPETLDDDENTKWFLPQSSRAKLSRILIVAPVAAGLNF
                     FTFASALVLFALPDINIGALFFVNLTLSVLTFFASALVCVVDIIQFYPHVTWCAWILV
                     PAAVFALMNIPLFILAHVSQAKEPLYDEDSEKPLTRLVADEFDGIEDDIDLRKYNNDL
                     DEKLGFHYMQNAVNNSTATVLPDPEKVRTNGSSSQYNTSASSYSEKYEDRLLENELAD
                     ETRDELGHEAFSAIDSQGGRLKHSRNSQQFSVHTSSHTPSLDSSVYSQQNLENLRKSA
                     TPFIVNNGDQPQILQDILKQDQIQGSKYNGQNYPALHKQPQQLTVQGIDDNRSDITSV
                     SRRGVDPEHIKYYDNGNHLNAKESLRQPNLHPGQQKAVPYPVSNYSMDRNTNQHPNMN
                     GRPNGPPAPMTQIGPGMRAPNNMAPSVGRQPMPHPMHQQMHPMQRGMPQQMPHPMQRG
                     MPQQMPQQMPHLPHPMQHPMQHPMQHPMQHPMQYPMHPPVQQTMPYQPRTTAGFQPAY
                     KKRFRNRNNIPTSSLAADDMLNFR"
     gene            complement(859573..859660)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0G08976r"
                     /db_xref="GeneID:2888082"
     tRNA            complement(join(859573..859609,859621..859660))
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0G08976r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2888082"
     gene            <860266..>861351
                     /locus_tag="CAGL0G09020g"
                     /db_xref="GeneID:2888083"
     mRNA            <860266..>861351
                     /locus_tag="CAGL0G09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446753.1"
                     /db_xref="GeneID:2888083"
     CDS             860266..861351
                     /locus_tag="CAGL0G09020g"
                     /note="highly similar to uniprot|P06245 Saccharomyces
                     cerevisiae YPL203w TPK2 cAMP-dependent protein kinase 2
                     catalytic chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446753.1"
                     /db_xref="GeneID:2888083"
                     /db_xref="GOA:Q6FSP1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP1"
                     /translation="MEYSSQHHSTHMQQQQHQQQHQHNTHGTSQQSTLLAQRSTVSKG
                     KYSLQDFHIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTNDERRM
                     LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTL
                     ALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAKEVETVTWTLCGTPDYIAPEVI
                     ATKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILHGKVVYPQFFNSDVIDL
                     LSKLLTADLTRRIGNLQKGAQDIKSHPWFAEVVWEKLLAKDIETPYEPPITAGVGDTS
                     LFDQYPEEQLDYGVQGSDPYASYFTDF"
     gene            complement(<861773..>863086)
                     /locus_tag="CAGL0G09042g"
                     /db_xref="GeneID:2888084"
     mRNA            complement(<861773..>863086)
                     /locus_tag="CAGL0G09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446754.1"
                     /db_xref="GeneID:2888084"
     CDS             complement(861773..863086)
                     /locus_tag="CAGL0G09042g"
                     /note="some similarities with uniprot|Q08957 Saccharomyces
                     cerevisiae YPL202c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446754.1"
                     /db_xref="GeneID:2888084"
                     /db_xref="GOA:Q6FSP0"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:Q6FSP0"
                     /translation="MNRKNTLRGSAKNRPTTTPDNLENALMVNENQLIHIDPVPDFQE
                     KIDVKVWLQEMFFPMGIDIVIERSDKTKIIFKCKPSDYRSHEPKDLRQKEPVDDKRHI
                     CPFRVRCTFSTQLKKWKIVIINNSHSHPLKFNPHSDEYAKFKRNLRDREMTETLKKFE
                     ELEYKAKSNLPMENLLSGNSIISCDCGLTKEIKTINNVYLPLNATQLQDEIDVSKILE
                     CQNKKQKNKQKVMKKRKSEKNELANIKKEEPSCSSALIHDKGFEITQDDLIQCGINDI
                     NDYDCDKYYTELLNKESYADASYCNIADFSNMNEIDFTGMFNKSKPAQPSLTKGDDLF
                     SSIANDNFFSYEENIKDTTLVEPELLMAPVQDINENNIDDIFKMSTNTSSTPISPSTD
                     PSTDIDQKIPDPLEFENVNYLDKYVDLSTVMINDPAKETYDSLFS"
     gene            complement(<864422..>865891)
                     /locus_tag="CAGL0G09064g"
                     /db_xref="GeneID:2888040"
     mRNA            complement(<864422..>865891)
                     /locus_tag="CAGL0G09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446755.1"
                     /db_xref="GeneID:2888040"
     CDS             complement(864422..865891)
                     /locus_tag="CAGL0G09064g"
                     /note="some similarities with uniprot|Q08956 Saccharomyces
                     cerevisiae YPL201c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446755.1"
                     /db_xref="GeneID:2888040"
                     /db_xref="GOA:Q6FSN9"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN9"
                     /translation="MGLPITLYQEDMNSLHLPQKRNLDQFIRERFPSVAYPTASELRS
                     LRRGNTSVRPLTQVIRQEVYAYFMNNNVNERIFASIEDNTANHRRQNMYDWDSAGIDR
                     WTIDIDPETVEINDVPNLNGYRCNQNYDNSLWMYFNESNNFEQFYLYDTKENRYVKGC
                     LERSLVEHNDTLCCVDAKSGMNNYQFLLGFTSGKVVLVTSTLLGDDGLNAWCESEVVY
                     QSRTSSHPIRNNSRYNGIVTVNASLLPSYVLSFNIKEGLILSELTDHSNYKIDIPYNN
                     QDFSDVDSSQFSAVVNFPQFVLSNGVQIWNYENVLQINASLFPVDHEVKFWLKPEEKI
                     KYIKPMPKQEHLFVVTTERGVSIPINPANNHVPRGRAVRSSNADPSYSEVTNVIPVFT
                     LADYNENQYQLETFNSEQYLMTTQQHLYGTSLTIYQYSNASKDWFSLGFVDIRAKFNI
                     RKIKALSILESHDDQNPNQKPKLLIHANDGTIRHFKICI"
     gene            <867382..>867894
                     /locus_tag="CAGL0G09086g"
                     /db_xref="GeneID:2888041"
     mRNA            <867382..>867894
                     /locus_tag="CAGL0G09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446756.1"
                     /db_xref="GeneID:2888041"
     CDS             867382..867894
                     /locus_tag="CAGL0G09086g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446756.1"
                     /db_xref="GeneID:2888041"
                     /db_xref="GOA:Q6FSN8"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN8"
                     /translation="MWISLFIKQCMYENALHSYSYNLKELLQSFMTSLAICRQDYLIA
                     KYEREMKESLLQLLEIISALNFMIQQTKRYENVTESEFALQIAHRFIETEQINTIKFI
                     ASGKKHRFFGWLAVEKCWDPPDSGSALSLLKKIFLQPENQDKVKIYWLMPFISIIFLT
                     LLLCSRYDQL"
     gene            complement(<868327..>869367)
                     /locus_tag="CAGL0G09108g"
                     /db_xref="GeneID:2888042"
     mRNA            complement(<868327..>869367)
                     /locus_tag="CAGL0G09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446757.1"
                     /db_xref="GeneID:2888042"
     CDS             complement(868327..869367)
                     /locus_tag="CAGL0G09108g"
                     /note="some similarities with uniprot|Q08954 Saccharomyces
                     cerevisiae YPL199c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446757.1"
                     /db_xref="GeneID:2888042"
                     /db_xref="GOA:Q6FSN7"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN7"
                     /translation="MATDMFIKQHNLGYNHAIDPEYQQLRAQAIKSNSVKQHLAAKSL
                     EAIKKGDKHSAKKLITESCIQAERSDRFNLKAAEYAFDQNNANILSNEIDLHGLFAKE
                     AVQVLKKRLVLAAEAGEKKLRVITGKGIHSPGMVCKLQVETLMICHDLNLNFDLDSSN
                     SGVIIINIDRSNFSTSKLDMKDFPFNMTLLKKNMQMQESVSIVESSESTSIPQTTCLK
                     ATTPSKVFLEQRTTETINKPTINGSESYSNDNKLNLVRDLTTHHIPKETSECLSNTST
                     QSSGNAVSEVSSHSNKSTSYQETKVPSYDRTPQYELMPSSIKESNIVFNLFFSCISFS
                     RKEIEITTQNKQ"
     gene            <871813..>873148
                     /locus_tag="CAGL0G09130g"
                     /db_xref="GeneID:2888043"
     mRNA            join(<871813..871823,872425..>873148)
                     /locus_tag="CAGL0G09130g"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_446758.1"
                     /db_xref="GeneID:2888043"
     CDS             join(871813..871823,872425..873148)
                     /locus_tag="CAGL0G09130g"
                     /note="highly similar to uniprot|Q12213 Saccharomyces
                     cerevisiae YPL198w RPL6B or uniprot|P05737 Saccharomyces
                     cerevisiae YGL076c RPL6A"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_446758.1"
                     /db_xref="GeneID:2888043"
                     /db_xref="GOA:Q6FSN6"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /translation="MAAEKILKPESQLKKAKYDEKKSEEFLKARAARRVANKQKRAAI
                     LERNAAHQKEYEAAERAVIDAKREAKASGSYYVEAQPKLVFVVRIKGINKIPPKPRKV
                     LQLLRLTQINSGTFVKVTKATSELLKLIEPYVAYGYPSYSTVRQLVYKRGHGKINKQR
                     IALSDNAIVEANLGKFGILSIDDLIHEIVTVGPHFKQANNFLWPFKLSNPSGGWGVPR
                     KFKHFIQGGAFGNREQFINKLVKAMN"
     gene            <873865..>874680
                     /locus_tag="CAGL0G09152g"
                     /db_xref="GeneID:2888044"
     mRNA            <873865..>874680
                     /locus_tag="CAGL0G09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446759.1"
                     /db_xref="GeneID:2888044"
     CDS             873865..874680
                     /locus_tag="CAGL0G09152g"
                     /inference="similar to AA sequence:UniProtKB:Q08952"
                     /note="similar to uniprot|Q08952 Saccharomyces cerevisiae
                     YPL196w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446759.1"
                     /db_xref="GeneID:2888044"
                     /db_xref="GOA:Q6FSN5"
                     /db_xref="InterPro:IPR006571"
                     /translation="MFNVKGALNRLRTTWSNSEESDRDPRHLKSSDDLSNYTGSRMSY
                     EETLPPVTLLGYSPKTKNRLLHPEMCDELRPLMPTRIQLYTEWTLLYSLEQHGASLHS
                     LYDKLREDASTPRRVGYVLVIKDRKDGIFGAYSNEPFHPHEHMRYSGNGECFLWKMES
                     VPNKILRAKIREDKDEDLIDVNDDEDKINNSGTVNESWKLCAYPYTGANDFMIYCTSK
                     FLSLGAGEGHYGLWCDDGLMKGVTNPTQTYGNDVLSREGRKFTIMGLEVWRVG"
     gene            <875195..>877957
                     /locus_tag="CAGL0G09174g"
                     /db_xref="GeneID:2888045"
     mRNA            <875195..>877957
                     /locus_tag="CAGL0G09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446760.1"
                     /db_xref="GeneID:2888045"
     CDS             875195..877957
                     /locus_tag="CAGL0G09174g"
                     /inference="similar to AA sequence:UniProtKB:Q08951"
                     /note="similar to uniprot|Q08951 Saccharomyces cerevisiae
                     YPL195w YKS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446760.1"
                     /db_xref="GeneID:2888045"
                     /db_xref="GOA:Q6FSN4"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN4"
                     /translation="MTSLYAPSSEDVKQRLRPFGFFFEKSLKDLIKGIRNNNETPEKL
                     EQYFTEVLSECRNETTSPDMILKTNAVLKLAYLEMYGFDMSWANFQVLEVMSSNKLQQ
                     KRVGYLAASQCFHEDTDVLMLATNLLRKDLKYSGTNDTVKVGIALSGLSSMITPALAA
                     DIVDDLFTMLSSSKAYIRKKAVTALFKVFLEYPQALRDNFDKFARMIEDEDLSVISAT
                     VSVICELSKKKPEPFVILSPLLYDLLTTIDNNWIIIRLLKLFKNLSQVEEKLRPKLLP
                     KILELMDSTSATSVLYESINCIVRGNMLENDDYSTARACLEPLHRFCESTDPNLRYIS
                     CTLFYRIGKINPYFLVEYSELIIKLLTDVDISIRSKALELLEGIINEDNIRLITTILM
                     RQFVDEETVSVSSGSSLLNSIIEVKIVIPEAYKVKIIKTILKACAADNYKNIPDFEWY
                     NAVLKDLTIVSQDMANKKLGETIGENLRDILVRVPDVRDITISNIIDILFIPDIEQQL
                     GSVLRESIWCIGEFASYIENSDDLIRLLVQRGKFYSSELKPILIQSVVKIFASWVKSN
                     NSTTISEEILTEILHLLIAFLQDCCNSGDFDVQERAFEFLELLKICDESRSLTEEKIT
                     PLMSQVLPGLFSDYELNPIAVGSQKLIEIEPSIDLQTPFLSDMDWTILKQQYSLSESE
                     SINSDNTSLQESDHEVDNESGEYISETDRHQVHEGSFSEGIVENNNEGNPFYLGKSGD
                     IGIKSNTGADDLDTSSGHIPIAVGITMESESKMKKAKKKKKKVTILSDEVVGQPQNAI
                     PIKVKRPMNIETSKSKINLKKQTKLDLFDFDKGTEESHMELNPNEYGDDEVGQEELEK
                     LREKFGSHSIENSAAIGNDDEVVTIKKKKKKKKKTRQKDDNLDKKKDKKESSTQIISE
                     DSENVL"
     gene            <878291..>880024
                     /locus_tag="CAGL0G09196g"
                     /db_xref="GeneID:2888046"
     mRNA            <878291..>880024
                     /locus_tag="CAGL0G09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446761.1"
                     /db_xref="GeneID:2888046"
     CDS             878291..880024
                     /locus_tag="CAGL0G09196g"
                     /inference="similar to AA sequence:UniProtKB:Q08949"
                     /note="similar to uniprot|Q08949 Saccharomyces cerevisiae
                     YPL194w DDC1 DNA damage checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446761.1"
                     /db_xref="GeneID:2888046"
                     /db_xref="GOA:Q6FSN3"
                     /db_xref="InterPro:IPR007268"
                     /db_xref="InterPro:IPR026217"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN3"
                     /translation="MSISLKVKAFDVSIRDTERQTLWFRAVYYLSTISEEICLTISDS
                     FIIASAVNSAYTSSCKVTFERKFFDSFEYNPHEIVFGESGLQVAKDAIGESKKLYSLL
                     INGKHLTTISKVSSDSGPVNEFKIAIDNTISCPEALANRLLVSIEMESLVQKEYSPQF
                     TPTQYNPILVDLKYKRKFLDVFGTTETRSTSNSPIDPKLREICRNIEQELSKELFTDA
                     ITSENRDRNAMMEEINYICCNQSLLRNFVDNCNTSLTDEIQLQLDTRRLILTAFTKAI
                     YGKGNDILKSAISMSNTIALTTLEHCSIFWVEDKEMSGRKPMAKTIVFKSKEFKNFVA
                     MNTSSRQHDYSTGCINIWFCNPGDPILMEHKKGNVKFELLQVTDSYSQDNLPKVIAEG
                     INTNSESPNKYSVSPLRMSAIKSTSNMNIKKEPRNTPLSKVYNMSSGYKDMSDGKPSP
                     TRRLFVADDDMSEGELQSENQSVIERNSKETAFNVIPVHGFSNSHLDKDVGIALNERT
                     EATRNATIIGWGSNTDMSEVTTNNANSGIDLFKKEKRKIYEQEGSQSKKAKGESQFGP
                     TQTELPKGLLD"
     gene            <880312..>881451
                     /locus_tag="CAGL0G09218g"
                     /db_xref="GeneID:2888047"
     mRNA            <880312..>881451
                     /locus_tag="CAGL0G09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446762.1"
                     /db_xref="GeneID:2888047"
     CDS             880312..881451
                     /locus_tag="CAGL0G09218g"
                     /inference="similar to AA sequence:UniProtKB:Q08932"
                     /note="similar to uniprot|Q08932 Saccharomyces cerevisiae
                     YPL193w RSA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446762.1"
                     /db_xref="GeneID:2888047"
                     /db_xref="GOA:Q6FSN2"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN2"
                     /translation="MNYDDEDDDSYDPYNALPKPTFSGVIGDDTAHVNKKPRIQENYA
                     PIQNISNTYAYNTGNMMMTGYPYPPVYQQPQGVYMATNNQWDNRYPMTWQQYMPAQSN
                     SISMHTPDINYTNYHTPQPVAPYISENSRGFLERQDPDKTSTSNSIVKSEDLVRGKNT
                     SEIPDKHKPVKLANNKDRDKTGNKDDDDDELSIPKSEEGAKVLIPGTSISLETEEDIK
                     KWKDERRKMWLLRISNNKKEHMEKMGYKDEDLKKETNVLKESRKDKNFIKNIQSQISR
                     ANPNVNLNTRLVQRGMAEENAKLLDFIVELGECGFLEYELTEEEKEKLFGGYSNNFSN
                     NRKNYHGRRNNNNSNEKREYNGASRYNNGKNSTVVQDVSGKQENN"
     gene            complement(<881448..>881783)
                     /locus_tag="CAGL0G09229g"
                     /db_xref="GeneID:2888048"
     mRNA            complement(<881448..>881783)
                     /locus_tag="CAGL0G09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446763.1"
                     /db_xref="GeneID:2888048"
     CDS             complement(881448..881783)
                     /locus_tag="CAGL0G09229g"
                     /note="some similarities with uniprot|Q08931 Saccharomyces
                     cerevisiae YPL192c PRM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446763.1"
                     /db_xref="GeneID:2888048"
                     /db_xref="GOA:Q6FSN1"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN1"
                     /translation="MPGQNEAVTEKPTKTYGKRKSKVPHRKNIKVISNANSILNNRMG
                     ISKQTGSNNRKVKFLLPSITKKKFQKNKTDKRIRPQKSRYFEGMLVGSFLGAAITSMI
                     SKIISENIS"
     gene            complement(<882028..>883119)
                     /locus_tag="CAGL0G09251g"
                     /db_xref="GeneID:2888049"
     mRNA            complement(<882028..>883119)
                     /locus_tag="CAGL0G09251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446764.1"
                     /db_xref="GeneID:2888049"
     CDS             complement(882028..883119)
                     /locus_tag="CAGL0G09251g"
                     /inference="similar to AA sequence:UniProtKB:Q08930"
                     /note="similar to uniprot|Q08930 Saccharomyces cerevisiae
                     YPL191c or uniprot|P53155 Saccharomyces cerevisiae
                     YGL082w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446764.1"
                     /db_xref="GeneID:2888049"
                     /db_xref="GOA:Q6FSN0"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:Q6FSN0"
                     /translation="MNFATKRIRVDGNDRSILMQNENGPCALVALTNVLLLSSHHEHS
                     ELLELVQPKKVDLDQLLTVLADIAIATNPKDEELSVLLSLLPQLHTGLNINPRFDGTF
                     EDTKELSVFKLFDIDIIHGWISSDDKVQKYTYEESQQLLTQAVDIRDRETPGSGNPQD
                     DNILAEANLIEQFLNDSSTQLTPNGLNNINTTMKEGNYAVLFRNDHFATITKHNGNTY
                     ALVTDLGFRSCNNIVWEYMGSIDGSNDIFFDGIFEETELNDTAYTTMEATERKERVEQ
                     VDKDAQLAQQLQLEENEAIQEADKKQLPKKSTIPKTKTDKRGTNHHQTPSNATYKHTH
                     SHHSRKNNKKHNSMNANASNKKSSDCVVS"
     gene            <885374..>887011
                     /locus_tag="CAGL0G09273g"
                     /db_xref="GeneID:2888050"
     mRNA            <885374..>887011
                     /locus_tag="CAGL0G09273g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446765.1"
                     /db_xref="GeneID:2888050"
     CDS             885374..887011
                     /locus_tag="CAGL0G09273g"
                     /inference="similar to AA sequence:UniProtKB:P46950"
                     /note="similar to uniprot|P46950 Saccharomyces cerevisiae
                     YGR197c SNG1 or uniprot|P47090 Saccharomyces cerevisiae
                     YJR015w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446765.1"
                     /db_xref="GeneID:2888050"
                     /db_xref="GOA:Q6FSM9"
                     /db_xref="InterPro:IPR022703"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM9"
                     /translation="MVSEADTEAQYNGSDRLRPAAFEASASDALSRVMTETYSMEVRQ
                     GQEEAENQAAAHNSEKQEVVFSSRDSNSSNSSSHQKGSYSDTQGSHTAGFFHKCVHLL
                     KNILNPKLESHKSVLAFQFCFTNVLLATVCLSIICIYWGAAYRTEHYLFKVNILSVIQ
                     DQDYNNIQSMASTLPALIDQTPGTWHLYNRSSFVEKYGIENTSEAVDKKITDLIFEEK
                     YWMSLNVKTGATEALYNSLTDNTAPAFNSSAYFECMFESGRDPTNLKSAILPIMQQLQ
                     AAYVQYYTSTYLPSMLRNVSATINSIGDVNPLSLANSGNFEFNYIDYRPFFDRVLLAP
                     LQVGLIFTLILTVVQLSLYGPMHAKMVRVFKPKHFLLYRYGLSWSTYFILSLFFCTVS
                     AIYQIDFTLAFGRGGFVIYWITTFYVMLAIGATNENVISLIVAYCPQYMPIWLISWII
                     LNISPSFYPMVLNNQFYRYGYAMPLHNAVDIYRVIFLDLSRNKLGRNYGILTAWVAVT
                     HIIFPFVMKIAGTKMKSNAMKQAQATIAAYEAKKNQS"
     gene            <887666..>889969
                     /locus_tag="CAGL0G09295g"
                     /db_xref="GeneID:2888051"
     mRNA            <887666..>889969
                     /locus_tag="CAGL0G09295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446766.1"
                     /db_xref="GeneID:2888051"
     CDS             887666..889969
                     /locus_tag="CAGL0G09295g"
                     /inference="similar to AA sequence:UniProtKB:P46949"
                     /note="similar to uniprot|P46949 Saccharomyces cerevisiae
                     YGR196c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446766.1"
                     /db_xref="GeneID:2888051"
                     /db_xref="GOA:Q6FSM8"
                     /db_xref="InterPro:IPR026248"
                     /translation="MDESQVERKKSYRWVSASQATYDGAGWDSSSESETETRSQPKLG
                     KLDESLPSLPKLNYDNTDVSQYKEEDDEDTDNRTEKAGEIGAGTLHSNSEIQNDVIVE
                     DDPVIKQTPDMIDKDTLLTSPTAHKESSPSPNGSRHTFSRRPLPNRAVNEHLDDLMLE
                     ISKELTPKPEQEAVFGNHSPRKDIDSDLPNGKEDQKLNGSRLGLLNESIDNESDMPSV
                     DETRSKDVDENGEKDREDRFDYYDDDSEFSIDSEIKQAQKASLEELQSEFDSDPQTSN
                     IAKSLEGMNLEHDAEEESVKTNRDSNVSDLQKDQREINESNIENSDNDSLELPLTESS
                     SDELESADHGDALSFTESIQYDQSDGDSEPNQGDDASLVSNRVQQNNVNTDAESADDI
                     AKDKMDDHASGMDFEEDEVLNSTLTDGDVHVHKSGYFKKLVAEELGDKKLDDGKSLNN
                     VASTQTASTEDKVASDTEDVQESKADNDDTKNDAHVSSNRSSVTSEEWRPDTDALRDG
                     FMQKTGDNPPPGFVRDEKGELVDLTPASMKPRVVSTYSEIESTWNAFPSEDADDLETI
                     RDTKTLYDNSTLYNVPGIMTNNDALPPLPEDASLYRDSNQSDAVGSQDRARAASVTRK
                     VSKEGVNIAQPTSQEINKLSEQNTMPTRDLNKIISSNSTHAIKLENLRDYRNTLDNFD
                     SGLQTWIAYTLKSSSKTDRDFIFQEYKSNSHVREAYANADDLSRKNTVINTVTNVNQN
                     VNHLRKKVLQHSLKPKTLFSSISKKKL"
     gene            complement(<890158..>890898)
                     /locus_tag="CAGL0G09317g"
                     /db_xref="GeneID:2888052"
     mRNA            complement(<890158..>890898)
                     /locus_tag="CAGL0G09317g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446767.1"
                     /db_xref="GeneID:2888052"
     CDS             complement(890158..890898)
                     /locus_tag="CAGL0G09317g"
                     /note="highly similar to uniprot|P46948 Saccharomyces
                     cerevisiae YGR195w SKI6 3-5 exoribonuclease required for 3
                     end formation of 5.8S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446767.1"
                     /db_xref="GeneID:2888052"
                     /db_xref="GOA:Q6FSM7"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM7"
                     /translation="MSRVEIYSPEGLRLDGRRWNELRRFESAINTHPHAADGSSYLEQ
                     GNNKVITLVKGPKEPTLKSQMDIQKAILKVTVNITKFSKFERSKSSHKNERRVLEMQT
                     ALVRTFEKNVMLHVYPRTLIDIEIHVLQQDGGIMGTLLNGISLALIDAGIAMYDYVSG
                     ISVGLYDTTPLLDINSLEENAMSAVTLGVVGKSEKLSLLQIEDKIPLDRIENVLAIGI
                     AGAHRIRDLMEQEIRAHAEKRVANASKQ"
     gene            <891248..>892996
                     /locus_tag="CAGL0G09339g"
                     /db_xref="GeneID:2888034"
     mRNA            <891248..>892996
                     /locus_tag="CAGL0G09339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446768.1"
                     /db_xref="GeneID:2888034"
     CDS             891248..892996
                     /locus_tag="CAGL0G09339g"
                     /inference="similar to AA sequence:UniProtKB:P42826"
                     /note="similar to uniprot|P42826 Saccharomyces cerevisiae
                     YGR194c XKS1 xylulokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446768.1"
                     /db_xref="GeneID:2888034"
                     /db_xref="GOA:Q6FSM6"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM6"
                     /translation="MQGEGYYLGLDLSTQQLKCLAIDGDMQIKHTEVVDFDRDLPHYN
                     THKGVYSHGDVVECPVGMWLEAIDLVFEKYKGAGFDLSQVKAISGSCQQHGSVYWKTG
                     AGDLLKHLNDANGNLVDQLYPDGFSRKTAPNWQDHSTGKQCTQIEKKAGGPEKLAEIT
                     GSRAHFRFTGPQIMKIAENEEDNYKNTETISLVSSFLTSILCAKLVPIEEADACGMNI
                     YDIKAKRYDDSLLDVISGKFGKEDLLKKLSGSVTKCNSPQLMGNIANYFVSKYGFDSE
                     CAIYPFTGDNLATICSLPLEKNDILVSLGTSTTILMVTDQYHPSPNYHLFTHPAIANC
                     YMAMICYCNGSLAREKVRDSLNENQSTSWTNFDEAVLDESLDTSGELAVYFPLGEIVP
                     SVDAITKRVLYDPKNCEIVKYVDKFDNNRHDAKIIVESQALSARVRVAPLLSGTVDES
                     NDEKSETMVHFDYDSMKFSEYSSKRPNRVYFVGGASKNDAIVKKFSEVLGAKNGNFRL
                     ETPNSCALGGCFKALWSDLWKKKKIDEKVTFDSFLNRYFPTDELEEIKVDDITKKWEA
                     YKDKIIPLSKLEEELK"
     gene            <893614..>894903
                     /locus_tag="CAGL0G09361g"
                     /db_xref="GeneID:2888035"
     mRNA            <893614..>894903
                     /locus_tag="CAGL0G09361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446769.1"
                     /db_xref="GeneID:2888035"
     CDS             893614..894903
                     /locus_tag="CAGL0G09361g"
                     /inference="similar to AA sequence:UniProtKB:P16451"
                     /note="similar to uniprot|P16451 Saccharomyces cerevisiae
                     YGR193c PDX1 pyruvate dehydrogenase complex protein X"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446769.1"
                     /db_xref="GeneID:2888035"
                     /db_xref="GOA:Q6FSM5"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM5"
                     /translation="MLSARVLLNRSQLLCKRQCLTGVSVGLSRCFSSTRMSLDVSPFL
                     MPAMSPTMEKGGIVSWKFKENDSFNAGDVLLEVETDKAQIDVEAQDDGKLAKIIRGDG
                     SKDVLVGDVIAFTADPEDDLSTLKIPEVTESMKQVSSGSGKEDQKPAKSEEPAPLQRK
                     EGKNVSESKTAKSSGDVLTTADASQTLLPSVVMALADNGISKEDALANIKASGANGRI
                     LKGDVLAYAGKIQQDSVVKVAEYVNRNQKLDLSNIERIVLEVNSEEGGDGQAQAQAQA
                     QAQGQGQDSGKTGKLAKPAQVEPIRIQEEILLEVRRGVDFTRFERAVREYIDDIYQYT
                     HEQPLENTMSERYDSLFEDLVTVDPRSARFDVEYSLLETTDGSEDIFDLLGPGEVKEG
                     KQVYSLEVSVTVNDKYDDAVEKADRFMECLRQLQFDV"
     gene            <896159..>897157
                     /locus_tag="CAGL0G09383g"
                     /db_xref="GeneID:2888036"
     mRNA            <896159..>897157
                     /locus_tag="CAGL0G09383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446770.1"
                     /db_xref="GeneID:2888036"
     CDS             896159..897157
                     /locus_tag="CAGL0G09383g"
                     /note="highly similar to uniprot|P00359 Saccharomyces
                     cerevisiae YGR192c TDH3 glyceraldehyde-3-phosphate
                     dehydrogenase 3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446770.1"
                     /db_xref="GeneID:2888036"
                     /db_xref="GOA:Q6FSM4"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /translation="MVRIAINGFGRIGRLVLRVALSRSNIEVVAVNDPFITTDYAAYM
                     FKYDSTHGRYAGEVTHDDKHIIIDGKKIAVHQERDPANLPWGSENIDIAIDSTGVFKE
                     LDTAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYTSDLKIVSNASCTTNCLAPLAK
                     VIDEAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKV
                     LPQLQGKLTGMAFRVPTVDVSVVDLTVKLQKETTYDEIKKVIKQASEGKLKGVLGYTE
                     DAVVSSDFLGDSRSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKN"
     gene            897513..897621
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0G09405r"
                     /db_xref="GeneID:2888037"
     tRNA            join(897513..897549,897585..897621)
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0G09405r"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:2888037"
     gene            <898735..>900093
                     /locus_tag="CAGL0G09449g"
                     /db_xref="GeneID:2888038"
     mRNA            <898735..>900093
                     /locus_tag="CAGL0G09449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446771.1"
                     /db_xref="GeneID:2888038"
     CDS             898735..900093
                     /locus_tag="CAGL0G09449g"
                     /inference="similar to AA sequence:UniProtKB:P53301"
                     /note="similar to uniprot|P53301 Saccharomyces cerevisiae
                     YGR189c CRH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446771.1"
                     /db_xref="GeneID:2888038"
                     /db_xref="GOA:Q6FSM3"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM3"
                     /translation="MLYNYKRSLAVGILASVVAADSCDPLKQTNCPADKALATSFSEN
                     FTSESKWFTAEDNPGKIEYTSDGLAMSLTKRFDNPSLKSNFYIMYGKTEVIFKAGDGR
                     GIVSSFFLQSDDLDEIDLEWIGSDDTQFQSNYFSKGNTATYDRGEFHGVNQPQKEFHN
                     YTIDWTMEQLTWYLDGQVVRVLPNTTSQGYPQTPMYIKMGIWAGGDPSNAPGTIEWAG
                     GETDYSLAPFTMYIKSLVVTDYSTGKEYTYGDQSGSWQSIKAVDGEINGRYQQAQEDF
                     AKLVAGQAIESSQSSSVSPTSSSSSSASSSTSSSTSSSTSSSASSSASSSSSSSISSS
                     SSASSSAQSSSSPIASSVSSIKSVSSSAISSSKSSQTAESKSSTSSSVKPTTQSSKTD
                     TIMDNVTHSASTSNVAKSTVSTVAKSTESSTHSVQQSNFGVNTQVSVVSVILGFIFSI
                     VI"
     gene            complement(900264..900336)
                     /locus_tag="CAGL0G09471r"
                     /db_xref="GeneID:2888039"
     tRNA            complement(900264..900336)
                     /locus_tag="CAGL0G09471r"
                     /product="tRNA-Lys"
                     /note="tRNA Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:2888039"
     gene            complement(<902228..>906454)
                     /locus_tag="CAGL0G09493g"
                     /db_xref="GeneID:2888388"
     mRNA            complement(<902228..>906454)
                     /locus_tag="CAGL0G09493g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446772.1"
                     /db_xref="GeneID:2888388"
     CDS             complement(902228..906454)
                     /locus_tag="CAGL0G09493g"
                     /inference="similar to AA sequence:UniProtKB:Q08562"
                     /note="similar to uniprot|Q08562 Saccharomyces cerevisiae
                     YOR191w RIS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446772.1"
                     /db_xref="GeneID:2888388"
                     /db_xref="GOA:Q6FSM2"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM2"
                     /translation="MPKVTTIDLTLDDSEVEDYDALGELPNDNLTTSTQNNNHNSSSD
                     DDPSDNNDPDVDRNSRIIKTIKPPRFTSGNDSTAEESFEDQPLSFSRSPELDRETMKK
                     ERMKRFFSNREHDKVIKESPRSPLNRVSDQIKERSRTPPHIENWSLGTMRLKGLNDDM
                     NLRKRTNFGVATPTSINDTTSDSSDSPHMYNSDSSDRKRTKLMKTNDIKIDQDADIII
                     LSDDDDDEGHDRREMKNENDSHDTKQEQNSDVVPLLDLVKNGDTEVIEGYHTKPELSL
                     EELQHNYKMLARHYHKKEAEIKNTVGNLQNTQIILQRKLGIRQKKLNDAEKRWKLLLR
                     SASRQDGASNAQQMLINEAINVVNKLKVDRDSTQMKLDNVVQKLDDTNNKWSSLQKHR
                     VEQLEKAKTEIQMKTRDKSNEKYIEERKKFYVEREILNEMFEKGSLSKDMHTQLLREL
                     EQKINSLSVEQFDDTNDTSNSNLKSVPTDLFKKSIDTARELLLKNTTRSVITKNQLNQ
                     YLNTVLIYKQNFESGKYCDRPMRRACADATQALFHNGVKMPLVFERLQDYGIKYTVPN
                     IINPDRRVQYFKSIEVAMDLIQKSDRSMDVKWRLLEMLKQLERFRIDIDEGKPPTTSD
                     KENIGRNVIQLKQQGLKMEKLYENLKIYGVPITESELMNMNAIGENGMQNYMGTDGSL
                     YENSYNNMQSISNIHSGQDQEQIRALLENLKETEDEIEGEALTPEGMTVNLLRHQRLG
                     LQWLLNAETSKRKGGLLADDMGLGKTVQAIALMLANRSSNESKKTNLIVAPVSVLRVW
                     KGEIETKIKESSDFNSAIYGGVNGIKFRSWDKLSNFDVILVSYQTLANELKKHWPERL
                     KTDSKQLPPVPDIKAMNSLKTKNEYWSPFYSDDSTFYRIILDEGQNIKNMKTQAAKAC
                     CTVNSVYRWILSGTPIQNNMEELYSLIRFLRIPPYNRHERFQQDIGRPFSNLKQNYDS
                     ESRKQAIKKVRVLLRAIMLRRSKTDKIDGVPILELPPKNVNAQETTFKDDELEFYKAL
                     EHKNKQLAKKLLESKVQGNYSSVLTLLLRLRQACCHPELVILGEKKAEAATVVNGKNF
                     NNDWLRLYYVIKKMKSEAVEIVKSASDSMTCLWCLEQIEPESAFVLSGCGHLICNDCI
                     NPFSEDAAGSSNARSGPKGSTYLPCKECQKVTNDKDFVSLKLFNQVILEGFTREKLYE
                     EFNLEMDKQKDRKKNAYTTDYNTLEPSTKMNQCMDVINKVFEKSDSEKIIIFSQFTTF
                     LDLLEHILATRLKISCLKYTGDMNAKVRSEIISRFYSEEDKRVLLISMKAGNSGLTLT
                     CANHVVIVDPFWNPYVEEQAQDRCYRISQTREVTVHRLFIKNSVEDRILELQKLKRDM
                     VDAAMDAKKIKDINKLGTRELGFLFGLNSL"
     gene            complement(<907330..>908601)
                     /locus_tag="CAGL0G09515g"
                     /db_xref="GeneID:2888389"
     mRNA            complement(<907330..>908601)
                     /locus_tag="CAGL0G09515g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446773.1"
                     /db_xref="GeneID:2888389"
     CDS             complement(907330..908601)
                     /locus_tag="CAGL0G09515g"
                     /inference="similar to AA sequence:UniProtKB:P23776"
                     /note="similar to uniprot|P23776 Saccharomyces cerevisiae
                     YLR300w EXG1 exo-beta-1 3-glucanase (I/II)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446773.1"
                     /db_xref="GeneID:2888389"
                     /db_xref="GOA:Q6FSM1"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM1"
                     /translation="MLSIICFFITLAFAAPLQKRLFNYDENIIRGVNIGGWLVLEPYI
                     TPSLFEQFRTNPYNDDGIPVDEYHFCQQLGYDAAQQQLINHWSNFYQESDFQDIANKG
                     FNLVRIPVGYWAFKTMQGDPYVTGVQEQYLDNAIEWASKYGLKVWVDLHGAAGSQNGF
                     DNSGQRDALNFPNDDYNVQVTTDVINYLLNKYSQDEYLETVIGVELINEPLGPAIDMN
                     KLKFNYYKPAYDYLRDTVQKPQNIIMHDAFQPYNYWDDFLTLDQGAWGVTVDHHHYQV
                     FSGGELQRDINAHVSVACGWGSGVLNEAHWTVAGEWSAALTDCTKWLNGVGIGARYDG
                     SFWKNGVGSSYIGSCANNEDINSWTEDRKQNTRRYIEAQLDAFELRGGWIFWCYKTET
                     SIEWDASRLIEYGLFPQPMESRWYPNQCGFS"
     gene            complement(<910246..>910503)
                     /locus_tag="CAGL0G09537g"
                     /db_xref="GeneID:2888390"
     mRNA            complement(<910246..>910503)
                     /locus_tag="CAGL0G09537g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446774.1"
                     /db_xref="GeneID:2888390"
     CDS             complement(910246..910503)
                     /locus_tag="CAGL0G09537g"
                     /note="weakly similar to uniprot|Q08561 Saccharomyces
                     cerevisiae YOR189w IES4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446774.1"
                     /db_xref="GeneID:2888390"
                     /db_xref="GOA:Q6FSM0"
                     /db_xref="UniProtKB/TrEMBL:Q6FSM0"
                     /translation="MSNESTIEPDTPPADDRMKSRDTADKDGGETHNGKKDYGKVKHW
                     VEVEQGIPVKSFTSYTLNLSGWVREDQKKEVKDERKDTSDK"
     gene            complement(<910788..>914414)
                     /locus_tag="CAGL0G09559g"
                     /db_xref="GeneID:2888391"
     mRNA            complement(<910788..>914414)
                     /locus_tag="CAGL0G09559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446775.1"
                     /db_xref="GeneID:2888391"
     CDS             complement(910788..914414)
                     /locus_tag="CAGL0G09559g"
                     /inference="similar to AA sequence:UniProtKB:P21339"
                     /note="similar to uniprot|P21339 Saccharomyces cerevisiae
                     YOR188w MSB1 morphogenesis-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446775.1"
                     /db_xref="GeneID:2888391"
                     /db_xref="GOA:Q6FSL9"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL9"
                     /translation="MNEVSKPLPQVPPVMDSEQPKRDKSTEIPSRKRPIKRQDDDDDE
                     EFEFFHKFSRGNVRGVIHLITAELKERGTDVEYLMIPLRPEQTNEKLLSFLNQIFPLG
                     NGQPVNEKKQIRVVNKTDVWTLFQALKYIWCRLPDSEVVGWKAYKEFKIREKEKDYPR
                     KSFLEIMPQCLASPNHASIVYDFFDLIVTISSNSKKNKMSARKISKMCAIWAFNDNKS
                     SSTDYDFDSSSPQTVNNSIQNGFDQWIPGSDAMFHLLLAFLRSFVPKDVENAKLPRTL
                     KNLLFTNEYPPQDSTAFNSETILTIPLVTLHTDEFSRKPWQLLERCNEMLDFSDHEAF
                     EAREDYALLKSLFKKKNNVEGISRKMSQESRRLMKVLSTKHSTFQAGWAPRKALANDL
                     GLKSKISVNRLDIDDYFIWTWLSTLSYEETSDKRKIFGRSLILEFEFDGFKKWVVFQE
                     SDLVLEHMLNEQKKKSTIKNKKAQETTQSDNTKDNEHVSQDIRNITPPYEKFQKEVLN
                     NSVNPSNGPSNGYHTVIDLDARKDKNNMKHKIQKWNPLNNLRKKSGGNAEAKELQGER
                     KKVKNNQNYDSAPLTDLSDPLDYKLPDIEPDNEGFSIEFPDIIPDTAINTRTENGHQS
                     DHVKVENLEALPTNHNDKSYPAPPLSKFNVRKKPSMPQLVKEPVNLPVEGPMEELSGM
                     VEQMMVLDYANQNHDSQDDILKNVSKFEQYKKNDLQSVDSLVVNSLKISTGTSESLVD
                     SLELPRSKNSTDDNLTSQNPRMNLTGHYSEQEVIRGPGDRSGIDKYQGSNGIERAANH
                     NRLQENSSREKVHTYGNTILPPPQQVQTRKSPSPSPIYNNPANSSPKNANAYLPSKQI
                     SNNKPNPSLDAEYNKNIRIDPVSIPQERHDRNKMMSPQHQSGGFSASPIKQSSGNGMD
                     PYSQNTHYEKPVVNLQQQKVSQGQDGAPKVYVAPQQPGVGSGNPSRSSLDVRSAPNPA
                     LGPSPMKQSKSYSNLPIDKPQYRQNQYPAIPNNSGPAVYDNQPPQQQQYTIPQNPPPT
                     NEYPQQYNEHLMSPQRQNVRMPVSVPSPVNPPQMGYNDGYGQMMPPQPDAYNYGGMMA
                     HSPSQYGQFMPPPQQQQQQFSPHQSPQQHMQSPYGRGHGKAAAMGGMPPPQHHYGNKR
                     QSNFVPSAMPGQMGPPGGYMPAMGVPVAHGMGAGNKLHGVNMNKKREQKKLYNDIRSG
                     NFGI"
     gene            complement(<915515..>916813)
                     /locus_tag="CAGL0G09581g"
                     /db_xref="GeneID:2888271"
     mRNA            complement(<915515..>916813)
                     /locus_tag="CAGL0G09581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446776.1"
                     /db_xref="GeneID:2888271"
     CDS             complement(915515..916813)
                     /locus_tag="CAGL0G09581g"
                     /note="highly similar to uniprot|P02992 Saccharomyces
                     cerevisiae YOR187w TUF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446776.1"
                     /db_xref="GeneID:2888271"
                     /db_xref="GOA:Q6FSL8"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL8"
                     /translation="MTVLVPRLLPTAMKLRPLWSQASRTFATSMRLNAAAFDRSKPHV
                     NIGTIGHVDHGKTTLTAAITKTLAKNGGADFLDYSSIDKAPEERARGITISTAHVEYE
                     TAKRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQ
                     RIVVFVNKVDTIDDPEMLELVEMEMRELLNEYGFDGDNAPIIMGSALCALEGRQPEIG
                     EQAIMKLLDAVDEYIPTPERDLNKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEV
                     EIVGHNTTPLKTTVTGIEMFRKELDQAMAGDNAGILLRGIRRDQLKRGMVMAKPGTVK
                     AHTKILASLYILSKEEGGRHSGFGENYRPQMFIRTADVTVVMKFPESVEDHSMQVMPG
                     DNVEMVCELVHPTPMEVGQRFNIREGGKTVGTGLITRIIE"
     gene            complement(<917738..>918130)
                     /locus_tag="CAGL0G09603g"
                     /db_xref="GeneID:2888272"
     mRNA            complement(<917738..>918130)
                     /locus_tag="CAGL0G09603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446777.1"
                     /db_xref="GeneID:2888272"
     CDS             complement(917738..918130)
                     /locus_tag="CAGL0G09603g"
                     /note="weakly similar to uniprot|Q08560 Saccharomyces
                     cerevisiae YOR186w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446777.1"
                     /db_xref="GeneID:2888272"
                     /db_xref="GOA:Q6FSL7"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL7"
                     /translation="MLCGERHEYNTSIFDSLRELVSNGLNFLLDESLVEETLLQQQDD
                     LGTLIIPPMDDGPDNLFFVGLIWFIIGLLCALVLATITIILVSRSSSDQSVRNKACED
                     LEALDLDSSDDDELIEQEKLVYELMQAS"
     gene            <918731..>919138
                     /locus_tag="CAGL0G09625g"
                     /db_xref="GeneID:2888273"
     mRNA            <918731..>919138
                     /locus_tag="CAGL0G09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446778.1"
                     /db_xref="GeneID:2888273"
     CDS             918731..919138
                     /locus_tag="CAGL0G09625g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446778.1"
                     /db_xref="GeneID:2888273"
                     /db_xref="GOA:Q6FSL6"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL6"
                     /translation="MRVIEEGVLKIKGPWLEQWNRRGEVQDGLESGETGVEGRQERLS
                     SAVKTSAAGRAADWAGSLASAAITSLHRLVKIPHREGCSAHLHCAIRVLPSVQKHSTG
                     LLFLYRFQSTIVKIGMSGFPQPYKKQNFLLLLV"
     gene            complement(<919350..>919676)
                     /locus_tag="CAGL0G09647g"
                     /db_xref="GeneID:2888274"
     mRNA            complement(<919350..>919676)
                     /locus_tag="CAGL0G09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446779.1"
                     /db_xref="GeneID:2888274"
     CDS             complement(919350..919676)
                     /locus_tag="CAGL0G09647g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446779.1"
                     /db_xref="GeneID:2888274"
                     /db_xref="GOA:Q6FSL5"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL5"
                     /translation="MCVCVYSADIQRRRLWRRWCFGTYVSMACPPYSPSSRNDVVVRR
                     SRTPVLSGRLAGTKSPEIRDSELCEQHEDLGTSQSFPSRVLLETFHLLEHQEKIPLLC
                     YPYGCM"
     gene            <920241..>921407
                     /locus_tag="CAGL0G09669g"
                     /db_xref="GeneID:2888275"
     mRNA            <920241..>921407
                     /locus_tag="CAGL0G09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446780.1"
                     /db_xref="GeneID:2888275"
     CDS             920241..921407
                     /locus_tag="CAGL0G09669g"
                     /note="highly similar to uniprot|P32502 Saccharomyces
                     cerevisiae YLR291c GCD7 translation initiation factor
                     eIF2b"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446780.1"
                     /db_xref="GeneID:2888275"
                     /db_xref="GOA:Q6FSL4"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL4"
                     /translation="MSATALSAHHAAQATDINVTVDAFIAKLKRRQIEDSYEIALETL
                     QILMRFLSASRWSNVKEMIELIRQLGNRLEKAHPTAFSCGNVIRRILAVLRDEIEEES
                     KDTGNDTQNMKNQAAEPLISSMFNLLQKPKEDDSSAKNQQNNKKQQRSTIKTDYRQVA
                     IQGIKDLIDEIVNIDEGIQQIAIDLIHDHEILLTPTPESKTVLKFLIRAKERGNRSFT
                     VLVTEGFPNNTQKAHLFAKKLAEHNIETMVIPDSAVFALMSRVGKVIIGTKAVFVNGG
                     TMSSTSGVSSVCECAREFKTPVFAVAGLFKLSPLYPFDVEKFVEFGGSQKVLPRMDPN
                     NRLDTINPMTDYVPPENIDIYITNIGGFAPSFIYRIVWDNYKQIDVHLDTKSEK"
     gene            complement(<922035..>923222)
                     /locus_tag="CAGL0G09691g"
                     /db_xref="GeneID:2888259"
     mRNA            complement(<922035..>923222)
                     /locus_tag="CAGL0G09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446781.1"
                     /db_xref="GeneID:2888259"
     CDS             complement(922035..923222)
                     /locus_tag="CAGL0G09691g"
                     /note="highly similar to uniprot|P33330 Saccharomyces
                     cerevisiae YOR184w SER1 phosphoserine transaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446781.1"
                     /db_xref="GeneID:2888259"
                     /db_xref="GOA:Q6FSL3"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR003248"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR022278"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL3"
                     /translation="MLDREEPHHFGAGPAQLPTPVLQQAAKDLINYNGIGLGIGEISH
                     RSKDATKVIDDAKKHLIELMDIPDTHEVFFLQGGGTTGFSSLATNLEAAYIAKTGEVA
                     PGGYLVTGSWSQKAYEEAKRLHVPAQVIFNSKDFNDNKKFGDIPEESQWSDRVKGNKY
                     AYVYLCENETVHGVEWQSLPKCLTEDPNIEIVADLSSDILSRKIDVSKYGVIMAGAQK
                     NIGLAGLTLYIIKKEILKNIESMDTDKLAEMHIPITPIAFDYPTVAKNNSAYNTIPIF
                     TLHIMDLVFKHLITKGGVKAQEEENIKKAEILYNALESYPDFYNLPVAPKSRSRMNVV
                     FTLKKDNLDEKFLKEAAQDKLTGLKGHRSVGGFRASLYNALTLESVELLVKFVKKFAE
                     ENK"
     gene            <924479..>925258
                     /locus_tag="CAGL0G09713g"
                     /db_xref="GeneID:2888260"
     mRNA            join(<924479..924481,925070..>925258)
                     /locus_tag="CAGL0G09713g"
                     /product="40S ribosomal protein S30"
                     /transcript_id="XM_446782.1"
                     /db_xref="GeneID:2888260"
     CDS             join(924479..924481,925070..925258)
                     /locus_tag="CAGL0G09713g"
                     /note="highly similar to uniprot|Q12087 Saccharomyces
                     cerevisiae YOR182c RPS30B and highly similar to
                     uniprot|Q12087 Saccharomyces cerevisiae YLR287ca RPS30A"
                     /codon_start=1
                     /product="40S ribosomal protein S30"
                     /protein_id="XP_446782.1"
                     /db_xref="GeneID:2888260"
                     /db_xref="GOA:Q6FSL2"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL2"
                     /translation="MAKVHGSLARAGKVKSQTPKVEKSEKPKKPKGRAYKRLLYTRRF
                     VNVTLTNGKRRMNPGPSSQ"
     gene            complement(<925599..>927521)
                     /locus_tag="CAGL0G09735g"
                     /db_xref="GeneID:2888261"
     mRNA            complement(<925599..>927521)
                     /locus_tag="CAGL0G09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446783.1"
                     /db_xref="GeneID:2888261"
     CDS             complement(925599..927521)
                     /locus_tag="CAGL0G09735g"
                     /inference="similar to AA sequence:UniProtKB:Q12446"
                     /note="similar to uniprot|Q12446 Saccharomyces cerevisiae
                     YOR181w LAS17 component of actin cortical patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446783.1"
                     /db_xref="GeneID:2888261"
                     /db_xref="GOA:Q6FSL1"
                     /db_xref="InterPro:IPR000697"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR028297"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL1"
                     /translation="MGLLSSADKEIIKRALPKSSNKIIDVTVARLYIAYPDPNEWQYT
                     GLSGAIALVDDLVGNTFFLKLVDINGHRGVLWDQELYVNFEYNQDRTFFHTFEMESCY
                     AGLLFVDLSEAAHFHKRVEKRQKYASKKTLNNKNAVAMAVKVTKENASKVTHGPRGEA
                     LIDNQRQRYTMDKVEQLPNTRKKAPPPPPPSAEPAPESTPDLTQSETTTTFNSPSPAP
                     QTETPQPAENTETQTSPQQHQKHKVPPLPDFMQGQPSGAPPPAPPSFPQAPGQPQPQS
                     NNPFPIPVPQPPQSTSAQAGNFPFPVPQEPARNFSSPSQFNQPYQPGQPAFGQQNRAV
                     PPPPPNAQRPVPQLPPGNRPVPSTGSRPPPPPSRRGPAPPPPPHRNFSAPSGQQSMQT
                     GAVQHSTRRGPVPPPPPRGARPIPPPPQSNNFGSVPATQSQQPTPVYQQPQQPQFNAQ
                     QVSQQQAYQPPPPPLPTNQQAYQQQQPPPPPPVSSQPAFQQGQQAQAPPPPPPLPVQN
                     TSSVSPSNGAPAAPPPPPAFLSGTPGQSQPPAPGGQINEATGDPGRDALLASIRGAGG
                     IGALRKVDKSQLDKPSVLLQEARGEPVQTSQPTGGAGAPPGGPGGSLADALAAALNQR
                     KNKVGAGDDYDNGDDW"
     gene            <930351..>934622
                     /locus_tag="CAGL0G09757g"
                     /db_xref="GeneID:2888262"
     mRNA            <930351..>934622
                     /locus_tag="CAGL0G09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446784.1"
                     /db_xref="GeneID:2888262"
     CDS             930351..934622
                     /locus_tag="CAGL0G09757g"
                     /note="some similarities with uniprot|Q05854 Saccharomyces
                     cerevisiae YLR278c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446784.1"
                     /db_xref="GeneID:2888262"
                     /db_xref="GOA:Q6FSL0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FSL0"
                     /translation="MGRPKKAVSEENIERFQRELELAGDKLDVLLKDKKGRSRSCLLC
                     RRRKQRCDHKLPSCTACLKAAVKCVQPARYFTSSNNSSASSPNTPQSKPDKIAKPKAK
                     STKKAKNSTVKGSEQSQHPHEYASKLQNVIDSQNFPVPNSHVANSMYRRNMPMQNNSH
                     MMNMPYNGANDSIHMHLQQSPIVHQIHSPYINKEHHTDSNNSMTYASNPNSPLPNTST
                     TLQHFQHVYSNGNGSMNNIHTSNNMLPKQTSLPPLSTPLMKQEYNNFSMQRSPSNEQY
                     VASCPESESSRINLPVSLTKVAKKNESKKKKNKNETNQDKDEYTLFLEKKLKYLEKII
                     DTQPNSPAYLKKIKQYKKISHLLGDIGNLEDIEKKLKKENNAAGSPQAGNNSLGQPSS
                     AISTPTASIATPNSGILPLPPVQGNHSNVYPIRSPYTSNGTPVDSTNKDTIPALSSDS
                     LDSVDFSKCIFGKYNLKEFLSYDPAFEFDEQLSRSFLDTFFTRLQFKYPLLDEDEIYT
                     FHENYLKNQIYSYSETNFHFACGRMWMVFTISACLPMTTGKYKGQPPVRYFSTAIRHI
                     TRCGNKLTPVQELELSTLLVLYIVRTDSDSMLLYEIIKDVMNICKNKLQLHKWHANDQ
                     FASKKLRLFWCVYLLERMICVAVGKPYTIHENEIEVPFFDENSFFTHSTFNTSSPRRS
                     GVHFINQSLKLRRIESHFVEVLKILPATERRTNNKSEIEKQLPVVKRAFHELELWRAG
                     CLSNELRNFENETLKLYYYRSVRLLIQPFLEVLRPEDRLFRECQASAGQICQLYKIFH
                     QKTVTGHSTPAVHTVFVAGVTLIYCMWLARNYDDEKRRKLGDISKHTRPLVSASLFST
                     MDDLRACSVCLYVMTERSHFAKIFRDTFDQLMNATVGNLIERCGPDSAELIYMKQNKK
                     KGNTGKGNQITDVCGNSDEPRNKSNMSKEDSKNQTKSKADLDDEISSTSSDMMISKNG
                     MPPAVDRTFGKRQASEHVGFVENSQVDLDNAEKEKLKMQKGVLEKTTVPKGLSHLLIE
                     ENEMLMEENNKCNEEKSQSLLSKNSPEPTHLIRNTESVKSMDSSGTSSPVINEYIVQK
                     PINATSFDWNLFKQQAFLQQHLAQQNLQAYLSSLKYENDGLESNSASEQAGHSTSFTG
                     QLGFNPSTDNRFNMNNGARNQNGFPTLINSPSASLGANSPPLTTETYPPHANVSSSKK
                     EERDPNLHYSSSVNNQSPLHSVTSAHTPNNQTSQPGNPTSYSSANPNNNILNVSSNTA
                     NNKTNGMILFSNGTHDMINNISTWTNDSVVEFMNTEDDGLNSKSTGEMSQTKTTSVQK
                     PNEFTSGNANTGGQNTISRSGTPAWSMANGYMSGITFSSGTDARNDTSNGSNPTSNNN
                     GNNSNIDGYNMNIFSSMGSLLHNGAPSVDADGNNDGTEIYSEMLF"
     gene            <935346..>935969
                     /locus_tag="CAGL0G09779g"
                     /db_xref="GeneID:2888290"
     mRNA            <935346..>935969
                     /locus_tag="CAGL0G09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446785.1"
                     /db_xref="GeneID:2888290"
     CDS             935346..935969
                     /locus_tag="CAGL0G09779g"
                     /note="weakly similar to uniprot|Q06224 Saccharomyces
                     cerevisiae YLR277c BRR5 component of pre-mRNA
                     polyadenylation factor PF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446785.1"
                     /db_xref="GeneID:2888290"
                     /db_xref="GOA:Q6FSK9"
                     /db_xref="InterPro:IPR021718"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK9"
                     /translation="MSKQNTLILRITEKGVNIDTLIHDVVKPRLMEIFESRNTSDLKD
                     SLLYKRTIEMDEDDNRILYIGNEVIIDYREYQSSTHSYLLKLKWLQEIQPSNTPNRLD
                     LFIIECIVSIIIANCDSSSISQDTNVVKDENERLRVIQELMEEQFGADGYKEQERTKA
                     IVKVGDKTGHVDLVNLKVIECDSSLLKGRLEGVLRVAEQLSRPLIGS"
     gene            <937230..>939389
                     /locus_tag="CAGL0G09801g"
                     /db_xref="GeneID:2888291"
     mRNA            <937230..>939389
                     /locus_tag="CAGL0G09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446786.1"
                     /db_xref="GeneID:2888291"
     CDS             937230..939389
                     /locus_tag="CAGL0G09801g"
                     /inference="similar to AA sequence:UniProtKB:P24482"
                     /note="similar to uniprot|P24482 Saccharomyces cerevisiae
                     YPR175w DPB2 DNA-directed DNA polymerase epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446786.1"
                     /db_xref="GeneID:2888291"
                     /db_xref="GOA:Q6FSK8"
                     /db_xref="InterPro:IPR007185"
                     /translation="MFTSGKVLPTKIQPPLLRPMAYRVLSKKYGLSIKSDGLAALSDF
                     IGSTFGMDWKRNPDTIKFLEVFATVWKQQERGLFVDSTGVKDVINELKEREKATLQES
                     QNMASIPPKTKTYNNGGGKTTTIDRFLTKRPSPSDNDEGPLDQSIDDIPVSQATQIDE
                     EELPMAQEISDQISSPARDQTPEEEFDNRILNWRDYFRIINTTDQKKFSYNPVKRQIF
                     YQPPKDQLKSVLKIPNAQAKTDLFRTRYFLTRDRLLRNESFQSSHDTFNPLSSMIQLK
                     NNINNNNQDDTPTGLSITQIKNLLGRDGQNFLILGVLKMNPKGQWSLEDASGSIDIDI
                     SQTLPSPGLFYIPGAIVLAEGIYYTVGHTFAVTSMTFPPGERRDKTLDHIGNLDLLGI
                     HGTEKSSYIPRLDNEIKIRLHLLEQDLTHQKFVLLGGDLFLDDQHVMDGLKKVFTKLD
                     QEAPTVIVLFGSFSSFPVHAAMSSKNISSTTEYKNNFDSLAEMLSQFENIINHTHVVL
                     IPGPHDPWVSLCSLGANGSLPQSSIPTHFSKRMNKICKNITWASNPTRIAYLSQEIVL
                     FRDNFLELCKRHQILFPVVESKRAEDLAELEEQMANNSIDDTTILVDRIISEKQQLPA
                     KVLESRKVVKTLLDQGHLSPFVDSIRPISWDMDHTLTLYPIPSTLILADMSSAAYDLT
                     YNGCKTINPGKFIHKRQARYIQFQPYLKSVSQEEVFF"
     gene            complement(<939502..>940464)
                     /locus_tag="CAGL0G09823g"
                     /db_xref="GeneID:2888292"
     mRNA            complement(<939502..>940464)
                     /locus_tag="CAGL0G09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446787.1"
                     /db_xref="GeneID:2888292"
     CDS             complement(939502..940464)
                     /locus_tag="CAGL0G09823g"
                     /note="highly similar to uniprot|P20133 Saccharomyces
                     cerevisiae YPR176c BET2 geranylgeranyltransferase type II
                     beta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446787.1"
                     /db_xref="GeneID:2888292"
                     /db_xref="GOA:Q6FSK7"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK7"
                     /translation="MVELLKQKHIEYIESLDKRKEDYEYWLSEHLRLNGVYWGLTALC
                     ILDSKKSFDKDEVVKFVLSCWDARTGGFAPFPRHDAHLLTTLSGLQILVTYDSLDILT
                     SEQKDKCYEFIVSNQLPDGSFQGDRFGEVDSRFVYTALSSLSILGRLSEEIVEPAVQF
                     IVRCYNFDGGFCMSPGAESHAAQAFCCLGALAIVGRLNVFTDSQIEEIGWWLCERQIP
                     EGGLNGRPSKLPDVCYSWWVLSSLAIIGKLDWIDYDKLREFILDSQDQIKGGISDRPD
                     NEVDVYHTLFGLAGLSLMGFDSLIEINPVYCMPQTVVNKIKNYR"
     gene            <940598..>942100
                     /locus_tag="CAGL0G09845g"
                     /db_xref="GeneID:2888293"
     mRNA            <940598..>942100
                     /locus_tag="CAGL0G09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446788.1"
                     /db_xref="GeneID:2888293"
     CDS             940598..942100
                     /locus_tag="CAGL0G09845g"
                     /inference="similar to AA sequence:UniProtKB:P20053"
                     /note="similar to uniprot|P20053 Saccharomyces cerevisiae
                     YPR178w PRP4 U4/U6 snRNP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446788.1"
                     /db_xref="GeneID:2888293"
                     /db_xref="GOA:Q6FSK6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK6"
                     /translation="MSCNTSSDICGSNYYSQLNLNSHKTKDIETWYIKLDMSNIRDIK
                     VDLEFKDPNTGESAATILQKYQFQRNELVNVIPTAPDDVIDALEYIGESGTIDKEDDY
                     GRRLRLAELLMEDELKRQLFQQWRDKRYKKEITQFTEDEDDEEFYTPASKDLISARQY
                     ILKNSIARANKRIAAQKTISQTYSIQNVLNKRRAANKYWCSFDLLATQVVSTRPISTV
                     TFCNNGNYVASGSWNGEVSIIDSNTLEVTQTLQNHDGKVGGIAWTSNDSVLITGGEDH
                     LITVSNRSDGEFITSNSIGGHEGRITDLQVHPSGKFIGTSSFDSTWRLWDIEKQKQLL
                     LQEGHSKELYCLAFQADGALVSTAGTDKTAIIWDLRSGKAVSQLQGHAKTIYCMDWSI
                     DGHTLATGGGDGVITIWDLRKSDKLTKITEHKSIVTSLKFDKANDHNLISSGYDRSIF
                     VYSKDNYLKVSSLIGHADKVLTFDIDKNNKNLISGGWDRSVKHWSTVSTD"
     gene            complement(<942215..>944149)
                     /locus_tag="CAGL0G09867g"
                     /db_xref="GeneID:2888294"
     mRNA            complement(<942215..>944149)
                     /locus_tag="CAGL0G09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446789.1"
                     /db_xref="GeneID:2888294"
     CDS             complement(942215..944149)
                     /locus_tag="CAGL0G09867g"
                     /inference="similar to AA sequence:UniProtKB:Q06623"
                     /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
                     YPR179c PLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446789.1"
                     /db_xref="GeneID:2888294"
                     /db_xref="GOA:Q6FSK5"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK5"
                     /translation="MDLLKILDTKPVPSIVDARTLGVSGNTSGNYWLPTTMSLYQKEL
                     TDQIVSLHYSDILRYFETTDYKEDVILESMKTLCHNSELVATHPFLLIDHMMPKSLGT
                     RDIPGHLAENSGKFQVIRDLINLIQEYETNTAIVCRPGRTMDLVEALLYGHKVNIRRY
                     DGQSIKQNKKSRNHSCTCHIFPSAGWDKSKFPLKTGNQFDMLLAVDISVDTTTEEMKS
                     ILRHERDQRTLEKQAPIVKLITINSVEHGMLYFGKLYDKNSNDYLEALTAAVVVLRDR
                     VGTLPPDLRPVYSQKLVYLLDWLENPSIIWPLPDVYPIKRYNSMDVERSLLTEVHFNQ
                     IDTALENAFANSKKRGRSKSDKNNDDNGRKQSFYQLKRVKNDYSTNPLKQGMTQLTGI
                     TTADETSNSNYHLSSGILTHKLIQSIDQIYIDIDEQKEELGYYSDHSELHKNRIKFFD
                     EELIKVKDMYDTSKSKIQMNLSQVNDQDHIQKELYEKLEKLNAEIDSISKKINSEGGK
                     KAEILVLLNTHKELMENVRYEEKNIESYNTERQYMEQELERANNAYDENEKETIKITD
                     ELKNKKHQFRTDYSNTEPEEQKINIRINDIKQSIVEEAGVLHKLEGRLEQVLKSLHNM
                     PPSRVRTSTVVNGNKRSKKS"
     gene            <944660..>945670
                     /locus_tag="CAGL0G09889g"
                     /db_xref="GeneID:2888138"
     mRNA            <944660..>945670
                     /locus_tag="CAGL0G09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446790.1"
                     /db_xref="GeneID:2888138"
     CDS             944660..945670
                     /locus_tag="CAGL0G09889g"
                     /inference="similar to AA sequence:UniProtKB:Q06624"
                     /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
                     YPR180w AOS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446790.1"
                     /db_xref="GeneID:2888138"
                     /db_xref="GOA:Q6FSK4"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK4"
                     /translation="MEKLSEDEIALYDRQIRLWGLAAQTNMRIAKVLLVNIGSIGTEV
                     AKNIVLSGIGHLTVLDSHIVNETDLGSQFFLTANDVGKKRVEAVSDRLQDMNPRVNLV
                     FDSADLKSKTDDFYKQFNIIIGTELDFFQRESLNSKCRALNIPLYLTGSNGMFAYIFV
                     DLISFDAVDEKIHGNTSGVKLGSISERREIIKIDEREDDDRVMDIITTRNTYLPLSSI
                     LKSATLNGLLTNKQKKRATNILPLTFTQLKLTNPTNTEQFKEELLKTCKQLGLEFTTI
                     KDDYLEQFIKQQGVEFTPVASVIGGAVAQDVINILGKRQSPLNNFIVFDGITLDMPIF
                     EF"
     gene            complement(<945816..>948077)
                     /locus_tag="CAGL0G09911g"
                     /db_xref="GeneID:2888139"
     mRNA            complement(<945816..>948077)
                     /locus_tag="CAGL0G09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446791.1"
                     /db_xref="GeneID:2888139"
     CDS             complement(945816..948077)
                     /locus_tag="CAGL0G09911g"
                     /note="highly similar to uniprot|P15303 Saccharomyces
                     cerevisiae YPR181c SEC23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446791.1"
                     /db_xref="GeneID:2888139"
                     /db_xref="GOA:Q6FSK3"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MDFDTNEDLNGVRFAWNVFPSSKTDAMQNVVPLGCMYTPLKEIE
                     GLNVVDYNPVVCAGPHCKAILNPYCMIDPRSNSWTCSICKSRNHLPTQYHNLSQENIP
                     IELQQTTVEYLTTKPVQVPPIFLFVVDITTEPDNLQALKESITASLSLLPANALIGLI
                     TYGKVVQLHDFSNDTIARCNVFKGDKDYQLEPLVEMLTGQKMTGSIPNTQVTPFSLNR
                     FFLPLEQIEFRFIQVLESLSQDEWSVKPGERPLRATGSALNIASLLLQGCYKNNAARI
                     IVFSSGPDTINPGLIVDLELKNPIRSHHDIDSGNAVHYKKAMKYYNTLADRISENGHT
                     VDLFSGCYDQIGMSEMRKLTDRTGGVLLLTDSFSTAIFKQSYLRLFAKDEDDYMKMSF
                     SAKFQVKSSKELKVQGLIGHASAVKKTSATNISDTTIGIGGTSTWTMGSLLPQHTYAV
                     FFDIASNGPTPVTGDNQQLAYIQFITNYQHSSGTIRTRVTTVANQLQSFGSPLIAASF
                     DQEAAAVLISRIAVHKAETEEGPDVIKWIDRTLIKLCQKYADYNKNDPSSFRLAGNFS
                     LFPQFMYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSMESEPE
                     PVLLDSLSVKADTILLLDTFFYILIYHGETIAQWRKAGYQDDPQYADFKELLEEPKLE
                     AAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQNMNSAGATIVLTDDISLQNF
                     MLHLQQSVVNTQK"
     gene            <948657..>948917
                     /locus_tag="CAGL0G09933g"
                     /db_xref="GeneID:2888140"
     mRNA            <948657..>948917
                     /locus_tag="CAGL0G09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446792.1"
                     /db_xref="GeneID:2888140"
     CDS             948657..948917
                     /locus_tag="CAGL0G09933g"
                     /inference="similar to AA sequence:UniProtKB:P54999"
                     /note="similar to uniprot|P54999 Saccharomyces cerevisiae
                     YPR182w SMX3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446792.1"
                     /db_xref="GeneID:2888140"
                     /db_xref="GOA:Q6FSK2"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK2"
                     /translation="MSDFTPINPKPFLKDLVDKPIVVTLKFNKTQYRGVLVSTDNYFN
                     LQLRDAQEYVAGELKGTLGELFIRCNNVLYIGEDLSKEDTNA"
     gene            <949620..>950417
                     /locus_tag="CAGL0G09955g"
                     /db_xref="GeneID:2888141"
     mRNA            <949620..>950417
                     /locus_tag="CAGL0G09955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446793.1"
                     /db_xref="GeneID:2888141"
     CDS             949620..950417
                     /locus_tag="CAGL0G09955g"
                     /note="highly similar to uniprot|P14020 Saccharomyces
                     cerevisiae YPR183w DPM1 dolichyl-phosphate
                     beta-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446793.1"
                     /db_xref="GeneID:2888141"
                     /db_xref="GOA:Q6FSK1"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK1"
                     /translation="MSIENSVIVPAYHEKLNIKPLTTRLFAALGNEGSKITELIFVDD
                     NSQDGSVEEVEALHKQGYNVRIIVRTDERGLSSAVLKGFHEAKGEYLICMDADLQHPP
                     ESVPSLFDSLRKHPFVLGTRYAPGVGIDKDWPLHRRVISSTARMMARPLTTASDPMSG
                     FFGLQKKYLTKANPQDINSQGFKIALELLAKLPLPANEPIGEIPFSFGVRVEGESKLS
                     GKVIIQYLEQLKELYVFKYGANTLIAVFAIAVLLALYILLKLRSLLF"
     gene            <951295..>955881
                     /locus_tag="CAGL0G09977g"
                     /db_xref="GeneID:2888155"
     mRNA            <951295..>955881
                     /locus_tag="CAGL0G09977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446794.1"
                     /db_xref="GeneID:2888155"
     CDS             951295..955881
                     /locus_tag="CAGL0G09977g"
                     /inference="similar to AA sequence:UniProtKB:Q06625"
                     /note="similar to uniprot|Q06625 Saccharomyces cerevisiae
                     YPR184w GDB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446794.1"
                     /db_xref="GeneID:2888155"
                     /db_xref="GOA:Q6FSK0"
                     /db_xref="InterPro:IPR006421"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR010401"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029436"
                     /db_xref="UniProtKB/TrEMBL:Q6FSK0"
                     /translation="MSAHRTLLLRLSDSGEPVTSCSYGQGVLTLPSLPLPQGKKLGDM
                     PVYTVKLAIPAGSPVTRDGLIWTNCPPDFSTQFDREKFYKKIIKTSFHEDDHIDLDIY
                     VPGTYCFYLSFKNDKDELETTRKFYFVVLPILSVNDKFIPLNSIAMQSVVSKWMGPTI
                     KDWEKVFARVASKKYNMIHFTPLQHRGESNSPYSIYDQLEFDPTVFKSEKEVADMVER
                     LRTEHNILSLTDIVFNHTANNSQWLLDHPEAGYNHKTSPHLISAIELDKKLLDFSEQM
                     EALGYPVDLKTVDDLIKVMDGIKEHVIGELKLWEFYVVDVKQTVSELREKWGNSKSWS
                     DDNIPSKDDSTNLAQFVRDNATEPGFGSLGERGSNKINIDKFAAILKKLHSEDYNNGI
                     EELATKILNDINLPFYKEYDDDINEVLEQLFNRIKYLRIDDHGPKQGPITKKLPLSEP
                     YFTRFKAKDGEEYALANNGWIWDGNPLVDFASSQSKAYLRREVIVWGDCVKLRYGKGP
                     SDSPYLWERMSKYVEMNARIFNGFRIDNCHSTPLHVGQYFLDVARRVNPNLYVVAELF
                     SGSEAMDCLFVERLGISSLIREAMQAWSEEELSRLVHRHGGRPIGSYKFVPLDDFPYP
                     ADVKIDEEYCAYNPDDHSVKCVSEIMIPKTLTATPPHALFMDCTHDNETPNQKRTVED
                     TLPNAALVAFCSSAIGSVYGYDEVFPQLLDLVQEKRTYSCAENTGISKVKTLLNNMRE
                     EIASEAVDIEDSEMHVHHDGQYITFHRTNAKNGKGWYLVARTKFHSSGDQMLPRIKLS
                     QTKATFKAAFSLERTGDAPISDEIIEGIPTKLRELTGFDIGFDENTKETSILLPQDFP
                     QGSIVIFETQQLGIDDSLDHFIRSGAIKATEKLSLESINYVLYRAEQEEYDYSEGRSG
                     AYDIPDYGKPVYCGLQGWVSILRKIIFYNDLAHPLSNNLRNGHWAVDYVVNRLDLYKD
                     KEGVAEVQEWLRSRMERIKQLPSYLVPSFFALVVGIMYGCCRLRAMQLMSDNVGKSTV
                     FVQSLAMTSIQMVSAMKSTSILPDQNIAAMAAGLPHFSTNYMRCWGRDVFISLRGLLL
                     TTGRYEEAKEHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFVQAIQDYVTIVPG
                     GVSLLQEKVTRRFPLDDEYIPYDDPKAFSYSSTIEEIIYEILNRHAGGIKYREANAGP
                     NLDRVMKDEGFNVEVNVDWETGLIHGGSQFNCGTWMDKMGESEKANSVGVPGTPRDGA
                     AVEINGLLKSCLRFVLQLSKDGKFKYTEVTKPDGSKISLSSWNDLLQENFERCFYVPK
                     NKEDDNKFEIDATIINRRGIYKDLYRSGKPYEDYQFRPNFTIAMVVAPELFTPDYAAG
                     AIELADQVLRGPVGMRTLDPSDYNYRPYYNNGEDSDDFATSKGRNYHQGPEWVWCYGY
                     FIRAYHYFNFLTNPKCQVEGSAKKLKPSSYLYRKLYSRLLKHREWIENSPWAGLAELT
                     NKDGEVCNDSSPTQAWSTGCLLDLFYDLWISYEE"
     gene            <956817..>958799
                     /locus_tag="CAGL0G09999g"
                     /db_xref="GeneID:2888156"
     mRNA            <956817..>958799
                     /locus_tag="CAGL0G09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446795.1"
                     /db_xref="GeneID:2888156"
     CDS             956817..958799
                     /locus_tag="CAGL0G09999g"
                     /inference="similar to AA sequence:UniProtKB:Q06628"
                     /note="similar to uniprot|Q06628 Saccharomyces cerevisiae
                     YPR185w APG13 protein required for the autophagic process"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446795.1"
                     /db_xref="GeneID:2888156"
                     /db_xref="GOA:Q6FSJ9"
                     /db_xref="InterPro:IPR018731"
                     /translation="MSNGNDNQVIELIQNFFLKSAGLVTTVESNRYSLDDTSIEFDDE
                     WFDMNIDVLHDLPPIIDKWTNFDGTQELPPLVIETFLDLHLLPSSYTVRLRDDESHLW
                     AVSKGNKKSEIVLERWLIELDKESTSFKNHVQSGSGVSPEKLDQQLRLLFRYLFTLLQ
                     LLPSNDLMMALNNQSESHNTPIPVDIKTRILDGSQPILSKGRIGLSRPIISSYSNIIN
                     NSNIPAHLEQKKITPVWTKYGLLRISVSYRRDCQFIFQDLNEDNSPNTQITNQPAKTN
                     EISISLSPRSKNDLNQISHPSWQKKFISSSKQFQPFIVGSVGSANTPNQNSSRNPSNS
                     SVVGPHYHPQHRLSIGSSTSVSTQPNYEGTSVGSTSKFASSFNNLRRHSSVRYHESTE
                     KLAKTDKNNYEDTDDLMEFVRLIEAKPELQPKKGLSGLQDKNLSGSILRYQKLRPSND
                     MLSEDLALSVSIDPIHGSQRRNSNSHSHSPVASFSPSGHFSSINSKLSQPHLAVRGSS
                     STVNSRRNSVDKVLASALSPIYGGDIPEYHTKSHNPVFNEVDDEEEGNDDLLVNKIPI
                     NINKHKMSTSPRSIDSISNSLTRNRTPFRQPYQYSQPTTIATQAYAKMHRPTVRSSDA
                     ISEINSRKGDNFHQLINDNDEDDLVFFMSDMNLPRE"
     gene            complement(<959154..>960338)
                     /locus_tag="CAGL0G10021g"
                     /db_xref="GeneID:2888157"
     mRNA            complement(<959154..>960338)
                     /locus_tag="CAGL0G10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446796.1"
                     /db_xref="GeneID:2888157"
     CDS             complement(959154..960338)
                     /locus_tag="CAGL0G10021g"
                     /inference="similar to AA sequence:UniProtKB:P39933"
                     /note="similar to uniprot|P39933 Saccharomyces cerevisiae
                     YPR186c TFC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446796.1"
                     /db_xref="GeneID:2888157"
                     /db_xref="GOA:Q6FSJ8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FSJ8"
                     /translation="MEANDVFDSQVPLSRSSSVGSMSSVASGSSVRSKTYLCEYDNCD
                     KAFTRPSLLTEHQNTVHLGRKPWKCNQCESSFTKKIHLERHLYTHTDERPFYCSFCGK
                     GLITRQQLKRHEVTHTKSFNCEYEGCNESFYKHPQLRAHILAVHLQSLKCHECNKSFQ
                     RPYRLKNHIAKHHNPDVVNAYQCTFSVCSKSFKTWSALRLHVKNDHPKLKCPICSKPC
                     VGEDGLNMHMKIHDENLVSRNWKCHICNDQSFAKKLELLDHYSNSHSEEIPAYLLEQK
                     VVPYVETNVTGKTECEKSPTKKYVKATDMLAIRTETNLNRFFDGGKDAMTLLLNTVGR
                     KFRCPYSKCYRSFKTEEKYNIHIEKHRIHEQKLKELETSGQLQMADIEPDRQSTALEK
                     EE"
     gene            <960704..>961432
                     /locus_tag="CAGL0G10043g"
                     /db_xref="GeneID:2888158"
     mRNA            join(<960704..960723,960973..>961432)
                     /locus_tag="CAGL0G10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446797.1"
                     /db_xref="GeneID:2888158"
     CDS             join(960704..960723,960973..961432)
                     /locus_tag="CAGL0G10043g"
                     /note="highly similar to uniprot|P20435 Saccharomyces
                     cerevisiae YPR187w RPO26 DNA-directed RNA polymerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446797.1"
                     /db_xref="GeneID:2888158"
                     /db_xref="GOA:Q6FSJ7"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="InterPro:IPR028363"
                     /db_xref="UniProtKB/TrEMBL:Q6FSJ7"
                     /translation="MSDYEEAFNDGAENFEDFDVEHFSDEDQYEDNVKTEANGGEQMK
                     DEEGRTIVTGGMGPEDYKNVETHRRKTLKEKAIPKEDRTTTPYMTKYERARILGTRAL
                     QISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELVVDLQ"
     gene            complement(<961895..>962374)
                     /locus_tag="CAGL0G10065g"
                     /db_xref="GeneID:2888159"
     mRNA            complement(<961895..>962374)
                     /locus_tag="CAGL0G10065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446798.1"
                     /db_xref="GeneID:2888159"
     CDS             complement(961895..962374)
                     /locus_tag="CAGL0G10065g"
                     /inference="similar to AA sequence:UniProtKB:Q06580"
                     /note="similar to uniprot|Q06580 Saccharomyces cerevisiae
                     YPR188c MLC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446798.1"
                     /db_xref="GeneID:2888159"
                     /db_xref="GOA:Q6FSJ6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FSJ6"
                     /translation="MENSNSLHFDRLTQRQINKLKDAFQLIDEDGDGNIGRSDMVKML
                     ASLGQKVTTDDVGKMFKELRDENDAYISFPEFLALMSESICEFPQEDELKECFGIISQ
                     NKDLDLPTDKLIKLLEEAGFKNPEEEFKRILATFSANQQLDGSRNFKSNQFIDSLND"
     gene            <962823..>967058
                     /locus_tag="CAGL0G10087g"
                     /db_xref="GeneID:2887997"
     mRNA            <962823..>967058
                     /locus_tag="CAGL0G10087g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446799.1"
                     /db_xref="GeneID:2887997"
     CDS             962823..967058
                     /locus_tag="CAGL0G10087g"
                     /inference="similar to AA sequence:UniProtKB:P17883"
                     /note="similar to uniprot|P17883 Saccharomyces cerevisiae
                     YPR189w SKI3 antiviral protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446799.1"
                     /db_xref="GeneID:2887997"
                     /db_xref="GOA:Q6FSJ5"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FSJ5"
                     /translation="MSNVKQLLKEAKVELGRGDFEEARNLSLKVLKLDPDNYFAHVFL
                     GKCFSMIPNSLYDSVEHYKKAIDINSQSLLAWKGLFLLFKDVTGIFPNVVSYDEYFTL
                     CAKYADVLAEQGESQIELIDDIKKMRRDYQESEEQYLRHLVPGKDLSEKLGRYLLSSS
                     YALDKLIKLLNKKEQDRIAQIVSKERLKFSTSDPSFQIKINSLAWEVYADSEVDQMYN
                     QLVNIVDDDEKRAKLEEEWLKYRLRVLRSMPASMKPLYFEKVKTTIEDMVLVNHDSLD
                     AWKLYFEWQDYSELDKIELKYILQFFKKFPNEPLAVILYSWASSKYSQYDKVQIQKVM
                     TDETQADAKSEIGSATESSSAEESDEEGLKQEDVKALMDTPEEYVGLVEEDILLAMTE
                     NIKKAKTSILAHRIIVYYHLLSREYETALPTVKAGISLIAYNVKDLGYPFFNSKREFT
                     IALGTVYTYVDTPKNHEAALSLFDKVLLEQPSNTEAKLGKGFIYMERENWTEAYELLL
                     AVSSKYADRWDVLSEIGWCRVMLGQCEQAILDFKEVLKNIHGMDLRTQEFRALNYWRL
                     AETYLNIQESEHVSEGFENVKLAYKILIQSIKALDGYAPSYCSLGKIYSNYYGDFSRA
                     FRCHYRAFELDAGDIISAEYLARTYADATNWTLALEVSERLVKSEKSKKALRKVSWPY
                     RILGVAYLEKQQDAESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERAL
                     DLDEHHSYALYYKAVCHSQLGEYEESLKLMYNLVGENPKTIPFKVSCATLISEYSKDL
                     YSQGYLLKSISESQKAILLIDDINNNGGLQSQEVWIALFTCINNYLLVQSEIDEMPIE
                     LLLNIFQNVNIKKVASVDAIDRLSLNDIIDNTSSSSIEIASKLLILCAKYALYLTGED
                     ISQATVGSSLWGNLGLAELNAYSLFDETEYRESAIMCFKKSIQFQSNYVESWFGLAVS
                     TMDFNYRVSQHCFIKAMSLSPRDPTIIFAYAMLSLRCNDIDLATQLINKAQTISPAES
                     SPWLGLALLNEKKNGSSNSVSLFSHAFVLSNGRSPSIQLLFAKSVLNSQIGSGIMDGD
                     LSSIEQLTSVASALEQYFKKVPNNPFALQCALLCFERLHDFNGTDEICKKLLNILEER
                     YEKTEDENELLHFALFKSHVARIELESGKYQSCLENADISQDLLNEYSYAYLTKAKLS
                     NYLCLGLGNFFLNNLDKTFEYFQTLLGESKESGTIICLVSKILYEIGMEDSKEIALQE
                     LNEYLDENAGELKILLILTAMALIDDQECELKSLLKSLSGLPNSKWLLDKERSIPWLV
                     NVIEKRIAQAEKSTMDKRSVFYFPNDNRVWGSLSKRIQHRIVCAGQNKVSTKQFSNLT
                     AEIRSVSYLQRSIFLSPSNCKAIKTLESCFVNM"
     gene            complement(<967161..>969161)
                     /locus_tag="CAGL0G10109g"
                     /db_xref="GeneID:2887998"
     mRNA            complement(<967161..>969161)
                     /locus_tag="CAGL0G10109g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446800.1"
                     /db_xref="GeneID:2887998"
     CDS             complement(967161..969161)
                     /locus_tag="CAGL0G10109g"
                     /inference="similar to AA sequence:UniProtKB:P32349"
                     /note="similar to uniprot|P32349 Saccharomyces cerevisiae
                     YPR190c RPC82 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446800.1"
                     /db_xref="GeneID:2887998"
                     /db_xref="GOA:Q6FSJ4"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR013197"
                     /translation="MDILSDIKASVKGAPAPQQNPAAIKSENGNVDVSVSNEIHQQTA
                     ASTEELMSVSSLEQRTLHAEKFLYTEVIKSYLGERASTVISLLISLGRLTVREIYEKL
                     NFTMSIDSIRRTLVSLTQLRCVRYLEEPKRGSAKYNTYYYYNKDGVYLLLYSGLIIND
                     ISSRFSEQKRPIVAEIIQNILSLGSLSLNDYLENVTYNIPKHEMSGLFVELCEMGFLV
                     RLTKFDYTPIKDLWNLLYEKEYNQLPRNSTQSDLKKRTEAKNKAKTEFHNLMEASTDL
                     SKLIKLDPSTSLRTVIPTATLTINIKRFLKSRRSLQLTNYARSRVGPVSAQLYKLALK
                     LTENKAPYFNDILSETGLLQDLDELTAMSDEMELLEEKSPGVTFTANDILKIVPKNYK
                     IENSLVYEKKSGKRSQNQEKSANTKRLKTEDGFVIPSLPTDNNHSNEKEIDDAEVEDG
                     INEGDEMDADSVSIINSHLKILASSPVPFLKETQPNVYYIPYSNLIPELKSSIYDHII
                     VSTLGPPSLRIRRCIKENKLVSEKVINGTALMKEKDIRTTIGSLIKYNAVEIQEVPRT
                     VDRSASRAVFLFRCNESHSYNFMKQNLAWNLANLLYKKEKIEDENKTLLMKANRDDVK
                     GKERELLLPSELNQLKMVNERELNIFTRSFRLMSLWEVFEFF"
     gene            <970915..>972009
                     /locus_tag="CAGL0G10131g"
                     /db_xref="GeneID:2887999"
     mRNA            <970915..>972009
                     /locus_tag="CAGL0G10131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446801.1"
                     /db_xref="GeneID:2887999"
     CDS             970915..972009
                     /locus_tag="CAGL0G10131g"
                     /inference="similar to AA sequence:UniProtKB:P07257"
                     /note="similar to uniprot|P07257 Saccharomyces cerevisiae
                     YPR191w QCR2 ubiquinol-cytochrome-c reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446801.1"
                     /db_xref="GeneID:2887999"
                     /db_xref="GOA:Q6FSJ3"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /translation="MLSRGQLLRSSARHYSIVTKDLPGNLSVLRVKVHAGSRYANKDG
                     IAHLLSRFNFQNTNTKSALRLVRESELLGGCTKSTVDREYITLEARFLKENLPYYVNA
                     LSNVLYKTSFRPHELPESVIPAAKYDLAVADSNPIFQAEDLLYNISFRNGLGNPVLYD
                     SVEKVSIDDLKEFSSKVYTKENIEIEGVGINEADLKKFVTESLFNSLPQGSNLASSAK
                     SEIFTGKESRLRRIGESVASVGIPVASKDFGKFQALEAYLSSELFPLTDLLSEVKFTK
                     YPDVGFLTFSVKNGDATVVSENIKKVVGELKKSQDISKATELAKLKLGTETSSPVDIK
                     FDGVKDFKLDDKFNFAAVGDVSKLPFRDQL"
     gene            <973396..>973782
                     /locus_tag="CAGL0G10153g"
                     /db_xref="GeneID:2888000"
     mRNA            <973396..>973782
                     /locus_tag="CAGL0G10153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446802.1"
                     /db_xref="GeneID:2888000"
     CDS             973396..973782
                     /locus_tag="CAGL0G10153g"
                     /note="highly similar to uniprot|P00128 Saccharomyces
                     cerevisiae YDR529c QCR7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446802.1"
                     /db_xref="GeneID:2888000"
                     /db_xref="GOA:Q6FSJ2"
                     /db_xref="InterPro:IPR003197"
                     /translation="MPQSFTSIAKIGDFILKTPLLSKICVPVSKQYIKYSGYRKLGLR
                     FDDLIAEENPIMQTALKRLPEGESYARNYRIIRAHQSELTKHLLPRNEWVKAQDDVPY
                     LLPYILEAEAAAKEKEDLDNLELSKK"
     gene            <977483..>979216
                     /locus_tag="CAGL0G10175g"
                     /db_xref="GeneID:2888101"
     mRNA            <977483..>979216
                     /locus_tag="CAGL0G10175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446803.1"
                     /db_xref="GeneID:2888101"
     CDS             977483..979216
                     /locus_tag="CAGL0G10175g"
                     /note="some similarities with uniprot|P47179 Saccharomyces
                     cerevisiae YJR151c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446803.1"
                     /db_xref="GeneID:2888101"
                     /db_xref="GOA:Q6FSJ1"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FSJ1"
                     /translation="MKLSNALAAVALAVSGVNAIEPTTTLAPTDFRVNMIELQAYLAD
                     IKGHMMQYLSFQGANPNQPYPSQMLGAVMFGNTGPLSEIAPETITMMITGVPWYSERL
                     VGAIAARLADAGIVTAWPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSSPSPSPSPSPS
                     PSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPSPKSPSPSPSSSSSSSSMPSSSSSS
                     SSMPSSSSSSSSMPSSSSSSSSMPSSSSSSSSMPSSSSSMTPSQKASIIPSSAAPSSS
                     SSIVTTSSISSADASPVLPSSVVSSSSTEPSSANPRSISSVSNSTTIISMSSQTGSLN
                     NISSTVFGNTTVSMPSPTTVVVTNTVGEVITEVITYCPETDHHGNVGTSTSSYIIGTS
                     RVSQDTMTTKIVEDNITKTAIVYCETTTDSKGQASTKTVTVCPECTSINSKSGSKSTE
                     TVTATTKPVVNVSNGVTSTTFITEYVTVKSGIPTTSSTPGGKSDVQQAKIATTTTTLT
                     SKQQQDSSIKIQSQSGTVKPQVEQQVSASAAKQQHSSVVVSQYAGSAASLNGLGSIGT
                     LVTLLVLMLIN"
     gene            <988766..>991744
                     /locus_tag="CAGL0G10219g"
                     /db_xref="GeneID:2888103"
     mRNA            <988766..>991744
                     /locus_tag="CAGL0G10219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446805.1"
                     /db_xref="GeneID:2888103"
     CDS             988766..991744
                     /locus_tag="CAGL0G10219g"
                     /note="some similarities with uniprot|P38894 Saccharomyces
                     cerevisiae YHR211w FLO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446805.1"
                     /db_xref="GeneID:2888103"
                     /db_xref="GOA:Q6FSI9"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI9"
                     /translation="MKGIFICLWILLLRHTLSADTGISNDNNIHIFTNDDPKYEHTGD
                     IGSPTIAWYMVDGPNLKEITYNGNVQLDSYFLLKATEGNTGYQFNYHGGSFEVGGGQG
                     IFNELASGPTIVNMQGDSFNGKGTSNYTAGVREGSTIYMDFTNYYTQDSYIENFQSVT
                     YSATTNATIDKYILINTDVYILGPVLLSPTYYDSPVLHKSNIWLDSPDIADISGSNFQ
                     FGGEGNSGLYIKDSAATKDKEIKLSDSFLDSNNTIAFDTPIQSLNWLHTGLFPGRSGI
                     LVVHTTKNTYNISFRALGHHYCLTDKNFKITKTDVNHNGTSIEMFQVTYDPTSNVQCP
                     PPYTVTQEYNIIPTNCFVEDIWVISFIGTTSISYIEETMITICKKEDYTTTIDKGNGD
                     FETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDFETDLVSHITTK
                     DSNGNPTTIVTTIPLTKPSGEADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTT
                     IPLTKPSGEADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLTKPSGEADY
                     TTTIDKGNGDFETDLVSHITTKDSNGKPTTIITTVTLVEEPVYTAVFVSDGHTITAVV
                     SHVTTTNDIGQTVTTTVTVISYDQVGEGVYTSAPAYSQPPVTTTTVSADTTTATVVIS
                     YFPSIGVDGVTRTGTTTVSTVSVGGEADYTTTVDRGNGSIETDVISHITTTDSNGNPT
                     TITTTITNAPAPSISKANIGSDYTTTVVSNGHTFTEVVSHSTGTDEHGHTIVSTVTQT
                     VGVQSHGSTVSSAAPASTVSGAESNAPGTAGVGGIVNSQKPQSQNVAGQGSGNEKPTQ
                     AAGTAGGSRSGSGSGSGSGSVHQSAGNIVPSGSPSVQSAKGTASPVSGIHGSQTPHSV
                     PSQAQQQGQGQGQGQAPSSRQQAATTVLLSSGSSVDNIGSGFSSTQTASVLQGKGASI
                     RVASSSIVFSMIVVIVFGMI"
CONTIG      join(CR380953.1:1..992211)
//
DBGET integrated database retrieval system