GenomeNet

Database: RefSeq
Entry: NC_006031
LinkDB: NC_006031
Original site: NC_006031 
LOCUS       NC_006031            1050361 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome H complete sequence.
ACCESSION   NC_006031
VERSION     NC_006031.1
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1050361)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1050361)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380954.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1050361
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="H"
     gene            complement(<2611..>3711)
                     /locus_tag="CAGL0H00110g"
                     /db_xref="GeneID:2888690"
     mRNA            complement(<2611..>3711)
                     /locus_tag="CAGL0H00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446806.1"
                     /db_xref="GeneID:2888690"
     CDS             complement(2611..3711)
                     /locus_tag="CAGL0H00110g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446806.1"
                     /db_xref="GeneID:2888690"
                     /db_xref="GOA:Q6FSI8"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI8"
                     /translation="MVTRSQLLYLNVTTSNDIGQTVTNTVTVMSYDQVGDGVYTSAPG
                     YSQAPVTTTTVSADTATATVVISHFPSIGVDGVTRTGTTTLSTVSVGGETGYTTSVDR
                     GNGSIETDVISHITTTDSNGNPTTITTTITNAQSASNSKANVGSDYTTTVVSDGHTLT
                     EIVSHSTGTDEHGHTIVSTVTETLGVQSHGNTVSSTVPVSTVSGAGSNASGAAGVGGI
                     VNSQKPQSQNVADQGSGNEKPTQASAQPVVVALALALALALGQFTNRQAVMYHLDPHL
                     FRVQRVLCLQSVVFIVAKHHTLYLPKPNNKDKDKHHHHVNSLPRLFYHLLVPLLTTSA
                     VDSAARKQHLSYRVRVLRLELLLPVLYSPLLQ"
     gene            complement(<13625..>14851)
                     /locus_tag="CAGL0H00220g"
                     /db_xref="GeneID:2888778"
     mRNA            complement(<13625..>14851)
                     /locus_tag="CAGL0H00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446807.1"
                     /db_xref="GeneID:2888778"
     CDS             complement(13625..14851)
                     /locus_tag="CAGL0H00220g"
                     /inference="similar to AA sequence:UniProtKB:P41733"
                     /note="similar to uniprot|P41733 Saccharomyces cerevisiae
                     YLR459w CDC91 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446807.1"
                     /db_xref="GeneID:2888778"
                     /db_xref="GOA:Q6FSI7"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI7"
                     /translation="MTNQNVVVVICGALRLLISATFPSLRSQLDNTVEFSTPFTSFKS
                     LSEGVFLYDNGFPLYNGGVVHHSPLLIAFMSVIMKFRLDGLLYAVIDCIICWQLMEIV
                     KSNNATILQLLQKKDHILIGIIYALNPLLVLSNISGSTVIFTHFAISSALYFSSKGRY
                     TTSTFFMALASSLSIYSILLVIPFLALNVRSSEKAAGSKQFKMLLRDNLQSYLLFFSL
                     LLLWSYKVSYQSFDFLSACYFQYMTFAKSFPNIGLWWYFFIEMFSSFIPFFKGVFNLL
                     LVCFILPFTIRFNRLPIVAFVLSLGWIVLINPYPTLGAYGFLISLVPLFDKIYGYMKY
                     PVISFLLLMHAVILSPLFYHLWIDLGSGNSNFFFALTFVYALGLSSILSDLIWGSLRL
                     EYDGRKQDFNKRVTQI"
     gene            <16529..>18802
                     /locus_tag="CAGL0H00242g"
                     /db_xref="GeneID:2888615"
     mRNA            <16529..>18802
                     /locus_tag="CAGL0H00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446808.1"
                     /db_xref="GeneID:2888615"
     CDS             16529..18802
                     /locus_tag="CAGL0H00242g"
                     /note="highly similar to uniprot|P15303 Saccharomyces
                     cerevisiae YPR181c SEC23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446808.1"
                     /db_xref="GeneID:2888615"
                     /db_xref="GOA:Q6FSI6"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /translation="MDFEANEDLNGVRFSWNVFPSSKTDANKNVVPVGCLYTPLKEIE
                     DLQIASYNPVVCAGPQCKAILNPYCAIDPRSSSWTCPICNSRNHLPPQYANMTQENMP
                     IELQQTTVEYITNKPVQIPPIFFFVVDITAEQENLDALKESIITSLSLLPPNALIGFM
                     TYGNVVQLYDLSCDIIERCSVFRGDREYQFDQLVEMLTGQKPSNTMAPLANGKITPLS
                     LNRFFLPLEQVEFKLNQLLESMSPDQWSVPAGHRPLRATGSALNIATLLLQGCYKNVA
                     SRIILFASGPGTVAPGLIVNTELKDPIRSHHDIDSDRAPHYKKACKFYNSIAERVAEN
                     GHTVDVFAGCYDQVGMSEMKKMTDSTGGVLLLTDAFSTAIFKQSYLRLFSKDEEGYLT
                     MVFNGNLAVKTSKDLKLQGLIGHASAVKKTDATNVSDSEIGIGSTSVWKMSALSPHHT
                     YGIFFEIANPNAVSPITTDRANLAYTQFITQYQHASGTNRVRVTTVANQMLPFGTPAI
                     AASFDQEAAAVLMARIAVFKAETDDGADVIRWLDRTLIKLCQKYADYNKDDPASFRLA
                     PNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSME
                     EDPQPVLLDSISVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYADFKALLEE
                     PKVEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDNYQDMARGGSTIVLTDDVS
                     LQNFMAHLQQVTVSGQP"
     gene            <19281..>20294
                     /locus_tag="CAGL0H00264g"
                     /db_xref="GeneID:2888838"
     mRNA            <19281..>20294
                     /locus_tag="CAGL0H00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446809.1"
                     /db_xref="GeneID:2888838"
     CDS             19281..20294
                     /locus_tag="CAGL0H00264g"
                     /inference="similar to AA sequence:UniProtKB:P52919"
                     /note="similar to uniprot|P52919 Saccharomyces cerevisiae
                     YLR457c NBP1 NAP1P-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446809.1"
                     /db_xref="GeneID:2888838"
                     /db_xref="GOA:Q6FSI5"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI5"
                     /translation="MFETIKDLFAGVVTTSDRRKKEHGSLADIKRRSMNKRKRALGHN
                     KSITNTDQRNAEYLNKLKMRNSIRGKVGKPPLRGGYMNSVDIKPDTKESRARMVLNAV
                     KSIFSNEDQTLMNMASTDINKLLRNQGYDKNQENLKDSILRSNAFKKKVTELEYNKRM
                     LRDLRRSGVSGNYNIIRDDDLEEDRYLLLQKKYQKIKKRLYEVEQELKSVQDSLRYSQ
                     EMNALLQETLDKANIDDAYLKSRRQIKNLQKENVLPERELSPSPRRPIDPLFTSSPVR
                     KSRNGEENGSKPKTDYKHSPIKETSNFYDKYPKLPETEQLAQDKGNHSLSPIRIDYSR
                     YSS"
     gene            complement(<20670..>21305)
                     /locus_tag="CAGL0H00286g"
                     /db_xref="GeneID:2888777"
     mRNA            complement(<20670..>21305)
                     /locus_tag="CAGL0H00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446810.1"
                     /db_xref="GeneID:2888777"
     CDS             complement(20670..21305)
                     /locus_tag="CAGL0H00286g"
                     /inference="similar to AA sequence:UniProtKB:Q06199"
                     /note="similar to uniprot|Q06199 Saccharomyces cerevisiae
                     YLR456w or uniprot|Q06608 Saccharomyces cerevisiae
                     YPR172w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446810.1"
                     /db_xref="GeneID:2888777"
                     /db_xref="GOA:Q6FSI4"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI4"
                     /translation="MSIISKKFPDDLIALIRSSKYVHVATCSKYCEPSVSLMNYVYLE
                     KPQLFSEFFCADLKGAYEDSDGIDNGYIIFATFDETEKIGNIRENPKVSLLFHDWISA
                     NNLSLRKGNPLLNSSGSIEFSPQYSHGNRISNVLNNLEDNELNQMSATITGHARIVDC
                     DSDESTYYMRLLLGANPDADIFILAENAVIVIVKMLDAKVSDNENNVGIYK"
     gene            complement(<22157..>23119)
                     /locus_tag="CAGL0H00308g"
                     /db_xref="GeneID:2888471"
     mRNA            complement(<22157..>23119)
                     /locus_tag="CAGL0H00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446811.1"
                     /db_xref="GeneID:2888471"
     CDS             complement(22157..23119)
                     /locus_tag="CAGL0H00308g"
                     /inference="similar to AA sequence:UniProtKB:Q06188"
                     /note="similar to uniprot|Q06188 Saccharomyces cerevisiae
                     YLR455w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446811.1"
                     /db_xref="GeneID:2888471"
                     /db_xref="GOA:Q6FSI3"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI3"
                     /translation="MTTSNNLKTGDLVLCKVGSFPPWPAVVFPQRLLRKDVIKKKRNN
                     CIAVCFLNDPTYYWEQPHKLKRLEKNIITEYLSKEHKSQSQADLVEAYSQADQFGDLR
                     SFVVERFSSEDRIEDLEKDEELYGKLKSGEDPHITDPDTNSRKRKSSSKDDGKVSSSK
                     KIKASKDITSMAKSSDNQLIIDNSVDKEKKKSNKLDRSRREEISLLLRRRIQRNLIQR
                     DTPPTDVELQESHKLLSKIKENLDDQPPFFDLDTLRKSKLHKLLKVIVNNSDLKEFHD
                     ICKSILLHWSDIIATLKAEKLNHLKQAYQSETTDRDDPSLKEVQ"
     gene            complement(<24048..>31955)
                     /locus_tag="CAGL0H00330g"
                     /db_xref="GeneID:2888473"
     mRNA            complement(<24048..>31955)
                     /locus_tag="CAGL0H00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446812.1"
                     /db_xref="GeneID:2888473"
     CDS             complement(24048..31955)
                     /locus_tag="CAGL0H00330g"
                     /inference="similar to AA sequence:UniProtKB:Q06179"
                     /note="similar to uniprot|Q06179 Saccharomyces cerevisiae
                     YLR454w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446812.1"
                     /db_xref="GeneID:2888473"
                     /db_xref="GOA:Q6FSI2"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019439"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI2"
                     /translation="MSGRLWQQASDSVVDVLPILKWSMRELFYRSTWHILNAVVVFLV
                     VKFLLKVLIGLNIGFINPLRLRVCHLSYKDKIQISYIQFNPWQKRITVSGLKLKILKE
                     KSNKTEEVKTEKKENSNKKSLAKYAKYFPILRRILDGFEFHLEDLQLSDLGISIAGIG
                     LIISTIPKTGQLDTQFYLRKVLWKDEIICNESIISFKADTVTDAAKLNESQFLENIYL
                     DLKFGGINIPMNYLAAFKKSKETVDVGHLLDYEESEQDILVRNKLEMEMEMERLRFTD
                     EDIFEAVNNIENILDTVREYSDILSDFTISIDKFGVKNMMVTSHPALLKMNDYMNYSF
                     CCSNFTFNASKYRNDMPGFKLLFKEEDSPFKISSAISRIDFNVNLNRVDNNTSEVLKL
                     VSIPNITLFGETNILSQKFRTCNTTEAVSENSLFNIKSTISSPTIDVSLSDLSFLKSF
                     KKNIKVFTSTCSGCMFKNEVRKENSHTKMKQILSTYFKTFLPLINLKFSLEDPKFIIN
                     HNNNLIMAQLSVLVFDYESMCDLVAINEKRKEIIYESWCNVELLDVNLIHINKHQKYE
                     QSIFSSDSIAINNKLKLLPDLIVSSEMIIDTLNVDLSELPTLKMLSDVVRKLDDEIYA
                     VEQFYFNNLYEEFSTVIRNAKKQCNVIGKNMVENEIPLKEMIYKSLPDFFDYFLLTVR
                     NVSATLGIRSVFMPKDKFTSLEPQSGKDFIDGKLRKYCNQINKLQVTFFGNKTQWHSN
                     INGGHVGMTRSGDENKYKSYYASELDDISTSDATEVERPWNLSLLIDKITSTIIGECP
                     QLSDKLTIKTVAKIAIISIKVFPETEYYDTNENAKVIVQIENKSIKAIISLMNIFFIL
                     SGIHTLHHIFGNAVEENKGPSKAKKFFLAVSKVKKKSSIKKIRWTDIKQMLTVNIHSE
                     QYEQIFVLPNELRTSLDFSHMFLTIENLNNISFTGEYFRTCIESPTIKHYWVRLITIV
                     RYKVNADIEKLKSQTQKNNDSGGNSEPGVTLENESWHFSIPYDFEMFRIFDNFSTIAK
                     TLKQLIYSFKSSKNDLVIFAKPVSAAILPNIKLKSNRLLFTVDDDPFEAELNSIFQIG
                     LQEQRSRLEKRKEFNEQALKSLHGRAGATSHTDISVEELIWKKRLKINKKNTPDQLIK
                     QNMPLVNTPFNIDGKQNKNKTADHLITAELETEYDKLQEQLSHSWIERIRSHKQKQHK
                     KFLSDFTYVWGRVNYSKLPDDINKRVLDFSTNPFLTTLIIEDIDVDIAKPHCGVEHIP
                     DFIYEVGKGVPKDTKYSILVPMHLDAKFSEIRWHLRDYPLPFVYMPKLLPSQSRESQS
                     IRIHGDFMVTEDMIYSEQELRTVFVPLVPSIIVENKDKLYSLLVPRTMTSIKLFTNLE
                     FDLHSKDTLTVTWGGSYSPAIQQVMQCLDNFSKPPLDPSPKVGFWDKVRYIFHGRINI
                     NLKNNGKFEIALKGSKSPYKIGGQDAGFVIGFEDDVKIICNPNDDPKDFLTCSADRVH
                     FSIPNHFAKPLLVWSSPSKDAIFIPNQSDTNLQESASFYYLLNLEDKVNQNSDIHSMK
                     GAYIEKTGIKLTGGMKLKLGFVFERLIRGTSDRTYDSRNHWDVRLCNPIYVSDLHDHD
                     SFNDFRSDFIHLSLVLTSKSETSYNALQLSPKGLRTFFSWWKMFSGNFPVRRGPLFGL
                     QSIAPKFGEHLETLTYYADVSPLYITHMYHNLDADKIMKKSFLDTSEYAGIKAKAGRF
                     LMDLHQRKEVFTEYQEELDRIKKVQKLKFLDGLVATFDIDIRAVHGLFTKLEYTEQRE
                     DAKYDIHDNDMQWIDLTDFQEAFYVEIDNFLPNIKILPMLSAHKFIYSKHASYGDKYQ
                     VDPKTYNPIKPFDNSISHDCAIRKPFTPNFEVIRDRLERLKHVKATIESNHYGMDSES
                     EQKAHEKYLVRSEASVRNVQSLLEDLEIMTGLKEKIDSSKAYNYPAIQLIQDTNSESF
                     DNKYYVYHMLLKWNEGVRDIAFKFLHFSNLTHQFMELASHKTNRMFNDIINKRQQKDN
                     VNEEEDISSKIQRVKSEVEFDNANDDEHVKAALLEMFEEGLSQLGIDINHSISRNHFV
                     NFICPQIQLISDDDPNICVLVSTPIILLKVLSFDEETPDNVYLENTFLKRYGLFLSNA
                     NAFIFHKERFDKYPELVFDASLYGQEKGSDWPPWLGAEVAFHPTPLSKFAVIENFSAF
                     TFLQKLLPFSSMYDMVKDVIENKISACLPRVIVSATSEDYLAIYKIVTNLILYVEPDN
                     KSLKKQIETASLAFDFDDIERITSLIGNLTNAEQVLERIVKEFIFKRRLLKDVDLIDL
                     SNIYNERMNHLLQLYVILRVFTESNRDESNCTVLWDFKIKEVVLHMLHNSSTPFLDVI
                     VNNVNYQRLQTDTGFTDNMVSVRNINIFNRDKDAIYPTLVKPYSTRRLLDTQYDDQPV
                     VAIRWGVDKPVGGIRIVKSVTTNITGLVVTLEEETINRIISWLSLEHLKNLSPENEDS
                     DNSSMGSESISDMSFSQDTRIHITGTKDIDEMFKRSTNFLTIENMLINSFKLMISYKG
                     KGKMRLANVTNFLFTFPTLIFENQTMTLADLMIKIKKILIKVLIKHTGKFLGTKLKNH
                     PSDLSKEQPKGDDRKMIEYTKTVENGPTVDAIGSKDITE"
     gene            <33180..>34292
                     /locus_tag="CAGL0H00352g"
                     /db_xref="GeneID:2888804"
     mRNA            <33180..>34292
                     /locus_tag="CAGL0H00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446813.1"
                     /db_xref="GeneID:2888804"
     CDS             33180..34292
                     /locus_tag="CAGL0H00352g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446813.1"
                     /db_xref="GeneID:2888804"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI1"
                     /translation="MDDEFGPIRKSLKKVSVGSITQSNYDTDDLCTTEIIPLQKRPRH
                     APNVLDTPFAIVNYPCIVTDDNRKDTYATELFYEQVLFKTFRYKLLDNLLQNQLEFAP
                     ALNQIAKSLYKLVIKSFNKELTTVKNYRIVAPEVSSSRFTSNIIDNVVVFDTVASKHF
                     NLINIRLESPEGLQAKDVSRIHRFLKKSYPIDEVPMQSEGLNGFKNIIDYFTKLNSTA
                     IMRSLKPLHFKIDIFQYNYDVEKITNIIPTKPNFKIIISTIGSSHSLDDNPITTIVNL
                     SELSDINLSRMCQQALHCKCDMGKHTGLKEYQDLWNHCVADITQNKLGSNNLFHLFLV
                     SFTIGGLGTNFFFYLEQTLNGVRSMDQLLRNFGINR"
     gene            <34932..>36884
                     /locus_tag="CAGL0H00374g"
                     /db_xref="GeneID:2888586"
     mRNA            <34932..>36884
                     /locus_tag="CAGL0H00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446814.1"
                     /db_xref="GeneID:2888586"
     CDS             34932..36884
                     /locus_tag="CAGL0H00374g"
                     /inference="similar to AA sequence:UniProtKB:P11972"
                     /note="similar to uniprot|P11972 Saccharomyces cerevisiae
                     YLR452c SST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446814.1"
                     /db_xref="GeneID:2888586"
                     /db_xref="GOA:Q6FSI0"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:Q6FSI0"
                     /translation="MASSSNVKLGNTEFRKTPAGNLFTSDIKTIFSILLIRLDLNAHL
                     NERNKNPFILGSKQYEFSFSLQKAICLLRNLCLLPSENRACLKVCYTIEQPFSQFLMS
                     VFMTAKLLHTPADRTRKGPKDKVLLQPTPKGIAILQAFCRSIGLQRLPDVLFSSLNTM
                     NLFLFERSEFTDKLLMSRVLIYLLFIKLMGPFPNVWSPSKEHDYAYVALPQNISIEDI
                     KFSLDQNVMLSNFEPDNIAPPVDTLKGSNVYLNQSKILSPLAHKFFTNPDSDSHIQYY
                     VSTVGVRSKPDVEVNFKTTKNYVFTTKAIWQWLMDCCDIFYPRDAAHVTARFLFYGLL
                     EEVPASPENYAGLISKNKYVKLTTLGENIVKWGKKDDTGKNPQVDSKCLSNLGQLTSI
                     SRSPSVFPFLPRLSYPSSRQNLDKILKEPGLRHLFRHHLEKEHCSENLNAYLDVRRFL
                     HMMGGLKNKMKLDNYNDSLSPNSININYSLLSSTAKNNEDFLSLVGTCIETACNIYSI
                     YIMKDSPMEINIDSNLKNKIEKIIIGYVQYDYEKTCSVNSIEATIGNTLDSASGHTYL
                     LHKKNGILKDTTMKEFSREAFMNKFGKLEINNLLFMISSLGHLYLLYEHVENATYHMM
                     ETDSLTKFLDSAVIDKIGSAFSLISV"
     gene            complement(<37005..>39827)
                     /locus_tag="CAGL0H00396g"
                     /db_xref="GeneID:2888779"
     mRNA            complement(<37005..>39827)
                     /locus_tag="CAGL0H00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446815.1"
                     /db_xref="GeneID:2888779"
     CDS             complement(37005..39827)
                     /locus_tag="CAGL0H00396g"
                     /inference="similar to AA sequence:UniProtKB:P08638"
                     /note="similar to uniprot|P08638 Saccharomyces cerevisiae
                     YLR451w LEU3 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446815.1"
                     /db_xref="GeneID:2888779"
                     /db_xref="GOA:Q6FSH9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH9"
                     /translation="MDSVSPGFGTPFSDIQSDINLTNRAPNSEEASVTPELPPQSSPT
                     NGSKKPKKKKRVACVECRQQKSKCDAHDKAPEPCTRCQKKGVPCVLKKDFRRTYKRAR
                     NEAIEKRFKELTATLSNLSSEQILKRIEEEQQQLLDNSNFTKDKIKKMKDENMKKWQQ
                     ENQETSIINSINYQEENSPVAAHIDSNGNKTISEENYDKSANVVFHFSEMTEEQLKCS
                     PKNLGDVYVSSQQIAELFQEFATKYHIFLPVVNLEYGAEKIYNLSPCLFWVILLIGLR
                     RKPQSTHLMKKLSGLVKSVLAEITISPIIRYTPSETDEPVLNVASVYSVQAFLLYTFW
                     PPLTSSLSADTSWNTIGTAMFQAIRVGLNCADFSKEYTTANFELINEQLRTWVCCNIV
                     SQFIASSFGFPSYTSFDNSILNSTSLLFNQMKGTNIPLPLKQLTQIARFENQVINTIS
                     NNGTNVVGVADRETVHPLIQVLNQQLVHLDLSLRESNIDDIRKFSLLVAKTHLLTYYF
                     NDPFLSEVGSKDGNHNLMQLSNKTEALFETKKGLVKAYNAAIEFLSHAHSMWKSNPTI
                     IKYLPGVFVLNIWQSACIISKLANSSLAPMLDVAYGKKAYQNAVLLTFNASVLKHDMA
                     YRSSGIMRSIWSLYANMYESWKKEQRKKENSFVEEFTNFNLGITVRSRMAVSVFFDCL
                     YILKEKSGMAKLERESKRSHISGENDEKNDEDDESDSGIEKGTSKDAKNNDIKLSHVK
                     NPEMKARRIIETIPLDPNPINVSTGSSNGSLTNTPNSSTYDNQSVHANTNNKMSPESY
                     NRGNGTFNQYIRPNSDVLRKKEISKSLIRPPETSMFDIVRNQKPKITSDYRNATSGEF
                     SERQLQNGKSTAQSPILNDNLGIKSSNDLTNQQFIIPFSDDHINTTPTNDSPNSIMAN
                     WDNWESDVVWKDVDILMNEFAFNPTL"
     gene            complement(<41327..>42181)
                     /locus_tag="CAGL0H00418g"
                     /db_xref="GeneID:2888519"
     mRNA            complement(<41327..>42181)
                     /locus_tag="CAGL0H00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446816.1"
                     /db_xref="GeneID:2888519"
     CDS             complement(41327..42181)
                     /locus_tag="CAGL0H00418g"
                     /inference="similar to AA sequence:UniProtKB:P32643"
                     /note="similar to uniprot|P32643 Saccharomyces cerevisiae
                     YER175c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446816.1"
                     /db_xref="GeneID:2888519"
                     /db_xref="GOA:Q6FSH8"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH8"
                     /translation="MSSFSKSNFNSEGYKQSRPQYPLEFYKHLQQYHNGKCDLIVDVG
                     CGPGTATLQLSEVFNDTNEIIGTDYSERMIEAANNGNPAKNVNFHVAGGEDFTFLGER
                     QNKRQCDMVVSAEAIQYFNLDKFQDEVHKNLRADGTLAYWGYLEPVVLELPAVDDALY
                     DFCFGEEKLAPYWEKPAVDIIASYYRNIKLNDSLFKEVDLKVYNPREANYESAPFKMI
                     CEMTVQNLREYLQTWGIYYKWKHDPKNANKKDIIDEVIDKILENNYDLDTKIHVSWKT
                     FYTFARAI"
     gene            <43439..>44776
                     /locus_tag="CAGL0H00440g"
                     /db_xref="GeneID:2888855"
     mRNA            <43439..>44776
                     /locus_tag="CAGL0H00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446817.1"
                     /db_xref="GeneID:2888855"
     CDS             43439..44776
                     /locus_tag="CAGL0H00440g"
                     /inference="similar to AA sequence:UniProtKB:P47159"
                     /note="similar to uniprot|P47159 Saccharomyces cerevisiae
                     YJR124c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446817.1"
                     /db_xref="GeneID:2888855"
                     /db_xref="GOA:Q6FSH7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH7"
                     /translation="MRFRQNVVGAPRDVKLLWASVFLRLLSYGITNQVLTLLLSGIHM
                     GEDRIGLFMSLTLVGDVLCSYILTWYADSWGRRRVLIYGSIMMMLSGIVFSYSENFHV
                     LLIFAIFGVISPSSDEVGPFKSIEESMIAHLSSNDKRPDVYAMHSLVGTVGSALGAIS
                     CGVFIKFIKSHGYATTDVESYKLVFRLYAFIAFMKVIIMFMLSEKTELDSHFHDHIED
                     NNLSEAIVHDELTPLVETAAHKNEINKSRALSKETKATLTKLLVIFMVDSLGSGFMTS
                     GWMVYYYKNIFLLSPVALGTMFFVSQGVQALSTLPSSSITRRLGPVKTTLAVQIPSGI
                     FSILIPFAVNYLPLSIFLLNLHFATMAMDVTPRQIILTNLFKSSELTRVMGIVNIGKT
                     FARCIGPIFTGLLASKGLLWCCYIISGSLVITADAILAFWFLSIDHKIKAQCS"
     gene            complement(<45146..>45823)
                     /locus_tag="CAGL0H00462g"
                     /db_xref="GeneID:2888588"
     mRNA            complement(<45146..>45823)
                     /locus_tag="CAGL0H00462g"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_446818.1"
                     /db_xref="GeneID:2888588"
     CDS             complement(45146..45823)
                     /locus_tag="CAGL0H00462g"
                     /note="highly similar to uniprot|P26783 Saccharomyces
                     cerevisiae YJR123w RPS5"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_446818.1"
                     /db_xref="GeneID:2888588"
                     /db_xref="GOA:Q6FSH6"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH6"
                     /translation="MSDTEAPVEVQEEFEVVEEFTPVTLATPIPEEVQRGSTEIKLFN
                     KWSFEDVEVKDPSLVDYVQIRQPIFVAHTSGRYANKRFRKAQCPIIERLTNSMMMNGR
                     NNGKKLKAVRIIKHTLEIIHILTEQNPLQVVVDAITNTGPREDTTRVGGGGAARRQAV
                     DVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<47587..>49080)
                     /locus_tag="CAGL0H00484g"
                     /db_xref="GeneID:2888811"
     mRNA            complement(<47587..>49080)
                     /locus_tag="CAGL0H00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446819.1"
                     /db_xref="GeneID:2888811"
     CDS             complement(47587..49080)
                     /locus_tag="CAGL0H00484g"
                     /inference="similar to AA sequence:UniProtKB:P47158"
                     /note="similar to uniprot|P47158 Saccharomyces cerevisiae
                     YJR122w CAF17 CCR4 associated factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446819.1"
                     /db_xref="GeneID:2888811"
                     /db_xref="GOA:Q6FSH5"
                     /db_xref="InterPro:IPR017703"
                     /translation="MMKTLTRSILDLTRSSKNAVSIQCGRRFISSIKATNLDNALLVY
                     GEIPNKSYLQVRGPDTIGFLNGLVTSKLLPTFVKKNLTTIEVSDEKNKKDTNNNESPE
                     FNEKKGNWGIYNAESHNGPYLSRFGIYSAFLNGKGKLVTDSIIYPSPGVVNDQTEAKI
                     KLYPEYLLEFDKDIIPRMLTSFESHKLHNKIKFEEVKNTKTWDFFISFPGLTQNDPNP
                     WIDNVYVPLTYLKNAEASNEFAESFITSLFPKISNKILGFYIERRTETLLNNDGTAPQ
                     FFRIVTTEDVDNAFDAFNSEAFPFTFEKLEKDSSFFKQCKLQYGFLDGSDAIQPDSLM
                     PLELNFDYFPNTVSNNKGCYVGQELTARTYSTGILRKRLIPIEFENLSEQAVKLLNEC
                     DKYPDIEVEVDPKNQEPEPLQSTAPSPFGNSPFGNASTKLRQRKKAAGTLISFDGKYG
                     IALFRIEHFKNIYDTPTPSKFFLTIGQEKIDVTPQRPIWYNEWKSSQ"
     gene            complement(<50095..>51618)
                     /locus_tag="CAGL0H00506g"
                     /db_xref="GeneID:2888587"
     mRNA            complement(<50095..>51618)
                     /locus_tag="CAGL0H00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446820.1"
                     /db_xref="GeneID:2888587"
     CDS             complement(50095..51618)
                     /locus_tag="CAGL0H00506g"
                     /note="highly similar to uniprot|P00830 Saccharomyces
                     cerevisiae YJR121w ATP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446820.1"
                     /db_xref="GeneID:2888587"
                     /db_xref="GOA:Q6FSH4"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH4"
                     /translation="MVLPRLYAAPSSRAALQAARMASKFNSPVRFASTAALASGKVSA
                     VIGAIVDVQFEESNLPAILNALEIKTPQGKLVLEVAQHLGENTVRTIAMDGTEGLVRG
                     EKVVDTGAPISVPVGRETLGRIINVIGEPIDERGPINSKLRKPIHADPPSFAEQSTAA
                     EVLETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGE
                     RTREGNDLYREMKETGVINLEGDSKVALVFGQMNEPPGARARVALTGLTIAEYFRDEE
                     GQDVLLFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGLLQERITTTKKGSVT
                     SVQAVYVPADDLTDPAPATTFAHLDATTVLSRSISELGIYPAVDPLDSKSRLLDAAVV
                     GEEHYNVATKVQETLQTYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFAVA
                     EVFTGIEGKLVRLKDTISSFKAVLEGKYDDLPENAFYMVGGIEDVVAKAEKLAAEAS"
     gene            <52511..>54733
                     /locus_tag="CAGL0H00528g"
                     /db_xref="GeneID:2888565"
     mRNA            <52511..>54733
                     /locus_tag="CAGL0H00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446821.1"
                     /db_xref="GeneID:2888565"
     CDS             52511..54733
                     /locus_tag="CAGL0H00528g"
                     /inference="similar to AA sequence:UniProtKB:P47156"
                     /note="similar to uniprot|P47156 Saccharomyces cerevisiae
                     YJR119c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446821.1"
                     /db_xref="GeneID:2888565"
                     /db_xref="GOA:Q6FSH3"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH3"
                     /translation="MYAMEVPVVYPTEEEFADPIDYLNQPALRRLGKVYGMVRIVPPA
                     GFNPPLALDKARFKFKVRWQNLNELQLLNRARLFFINNLNTFNRLKGHPAHLEHTYVR
                     VATARLHLYDLYIHIMQRKGLLPTKSVLVDKPLWRSFLSRNKLSHTVSPEQLVQVFTS
                     YLQDYYSYLYRMYRKTGSGSIYNAMLYKEAIPHSALQTNDLDSQDDQDHQDNQDNQDD
                     RNEQGEETLRTQEPTPDEPVHHMARMSAAVGADDSELQDWCPICKHIPKDNELDDVSY
                     CDSCSQIFHNRCIKNNNYLNNASGEWICNNCIIGNGFYGFKYSTHYFTLKEFEQKYGT
                     DESPDVDKLEKEFWDLVGNQDVKTTVPYGADIHSEDPAELTGFPTNDKTYSTHPMNLL
                     NLPQASSSLLPFLNRNISGMTIPWIYVGSKFSTFCWHLEDQYTLSANYQHEGSPKVWY
                     SIPDNSCDNFHKLLHDLTPDLFEKQPDLLHQLVSLISPYDPLFKKYNVKWYKAVQHPN
                     EYIVTFPKCYHAGFNTGYNINEAVNFTSESWLPYGLEAISDYQLTKKMPVFDMYELMV
                     NILVMYYRDNLPSPVSDAFLQHCHHELLSYINKETRNIFSVMPFIAQERLLHVSNQLH
                     LDSEDTKEYIQEDDEDGFFCASCSTMCSFVFVLQCKLDRSRHAKRRKTTNNDNHLLKV
                     REFKKHLEEDSDSQVLCLTHFLECKDKSETINSLISLREFNELHHILKLSGNKMDGIK
                     "
     gene            <55179..>55673
                     /locus_tag="CAGL0H00550g"
                     /db_xref="GeneID:2888707"
     mRNA            <55179..>55673
                     /locus_tag="CAGL0H00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446822.1"
                     /db_xref="GeneID:2888707"
     CDS             55179..55673
                     /locus_tag="CAGL0H00550g"
                     /inference="similar to AA sequence:UniProtKB:P47155"
                     /note="similar to uniprot|P47155 Saccharomyces cerevisiae
                     YJR118c ILM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446822.1"
                     /db_xref="GeneID:2888707"
                     /db_xref="GOA:Q6FSH2"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH2"
                     /translation="MGILSAQNLILLRSALLLTIAFFCIKNVNSILQNSFFLVLSQAM
                     ELPALSMSQYSGQLGMFSMLFFFAALNDLVPLMEDNKTYFRSIVPVRLTVFFIIGAIA
                     YLWTENLYFHNNAVFIYCFIEIWINFLLLNAVREERNEEFKREHRFMNDDLIEEPAPF
                     EKAE"
     gene            complement(<55888..>56736)
                     /locus_tag="CAGL0H00572g"
                     /db_xref="GeneID:2888682"
     mRNA            complement(<55888..>56736)
                     /locus_tag="CAGL0H00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446823.1"
                     /db_xref="GeneID:2888682"
     CDS             complement(55888..56736)
                     /locus_tag="CAGL0H00572g"
                     /inference="similar to AA sequence:UniProtKB:P47153"
                     /note="similar to uniprot|P47153 Saccharomyces cerevisiae
                     YJR116w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446823.1"
                     /db_xref="GeneID:2888682"
                     /db_xref="GOA:Q6FSH1"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:Q6FSH1"
                     /translation="MSSLNDTVAAGYYEPLFGLSWYPDRLDNLWLAHLHEIVYAFIFY
                     QVCQYTIAPKINRYFFGKHYSDITDKKLKLDFDVHTVSMIQAVISIAILLPVLALPFD
                     LNIATYVNPWCSMVSALSCGYFVWDLALCLRHFSIYGFEFLFHAVGSLVVMLAILTPF
                     CQPWVGKYLLFEASTPFVNMNWYTIQLNHKHKSSSGPVIPNWLNMINGLLLLLTFFGV
                     RIVWGWSCNLLLLRQFWRARYELPYLAGAVVLSLNITMSLLNVLWFSKMLKIAKKMAS
                     PSKKQD"
     gene            <57283..>58644
                     /locus_tag="CAGL0H00594g"
                     /db_xref="GeneID:2888696"
     mRNA            <57283..>58644
                     /locus_tag="CAGL0H00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446824.1"
                     /db_xref="GeneID:2888696"
     CDS             57283..58644
                     /locus_tag="CAGL0H00594g"
                     /note="weakly similar to uniprot|Q12365 Saccharomyces
                     cerevisiae YPL255w BBP1 cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446824.1"
                     /db_xref="GeneID:2888696"
                     /db_xref="GOA:Q6FSH0"
                     /db_xref="InterPro:IPR029328"
                     /db_xref="InterPro:IPR029330"
                     /translation="MVDTDDGASVGGLKGVYKWTVDALFGSGVSPSAKYRGLNHGSSR
                     QRYSQDDTNYSRYKPLSSMRSRSRSNSWSVPVPQDPSFYKRYDLLPPISSDDEDYSEE
                     DKLQYGANSNRGSPMVKGLMNPAPVVPKQQNNGYGEFDRRSTNPLFTDPTDTFARRKT
                     SSSLMNNYRSSTEGIGDTAFIEETRNININGRDPLIAKLFGRITSPKKMANLPGKFPS
                     PAKATLDSNRRRKNSVLHSIGSGRVRETSTSLDDKKILSEYMDIISDLDRNNENLSAL
                     SEQVEDRNQRYEEIDTEYKKKYYDMRNELIKELKQSKKTHDNYYLLYNKYKELKEMAS
                     ESNRLKSTIYNLESEILEQGVSKNREIQNLNEKILKLESRCQELEAEKLLERDKYELR
                     IASLEAKLREQNISNGKNYFSDYSYSHRSREFSPDNYRYLNNYFSEEMSDFDADIPYK
                     NGR"
     gene            <59437..>60792
                     /locus_tag="CAGL0H00616g"
                     /db_xref="GeneID:2888605"
     mRNA            <59437..>60792
                     /locus_tag="CAGL0H00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446825.1"
                     /db_xref="GeneID:2888605"
     CDS             59437..60792
                     /locus_tag="CAGL0H00616g"
                     /inference="similar to AA sequence:UniProtKB:Q12060"
                     /note="similar to uniprot|Q12060 Saccharomyces cerevisiae
                     YPL254w HFI1 transcriptional coactivator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446825.1"
                     /db_xref="GeneID:2888605"
                     /db_xref="GOA:Q6FSG9"
                     /db_xref="InterPro:IPR024738"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG9"
                     /translation="MTAVQPQMRAMTPSFTGSGGTLTNGNSALFVKNAVGTPISMIDS
                     NQLNDIPSAGNYNSSNLTSNLKLKESLIEDQRVDISSMIEEITGILGRDQWTKYAQIL
                     SLFILGKLSRKELVNELDILFSGSNNMKPKMMRLHNHLLLGILANSLRENPLTMIKNG
                     SWGFGNGTNANGKQSKKGNKHNSQIELYKKIVMSLPIEDRNRIKSITKDAGKRGFVFC
                     SVLQSRLNNIPKIPIVTNADTLKRIKNDNMKTPLEWSQDIMNGFGAPLASESYSLPDT
                     DSFYLRIVGIAREHGIVGNIDAGCIDLISLALDVYLKNIIEMAIDTVRYRKKKYSDYY
                     DLDDFGTYQAVSSGTDTSKDAKDDIMEIERKRTISLTNEDIYTSLSLFPNMADASGAY
                     YNAMNLGLVNDDELVIKSSSIDDLPDFLEEKPFFTPVDEKNIGTPTELNWLIRDILTE
                     N"
     gene            complement(<61015..>62769)
                     /locus_tag="CAGL0H00638g"
                     /db_xref="GeneID:2888692"
     mRNA            complement(<61015..>62769)
                     /locus_tag="CAGL0H00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446826.1"
                     /db_xref="GeneID:2888692"
     CDS             complement(61015..62769)
                     /locus_tag="CAGL0H00638g"
                     /note="weakly similar to uniprot|Q12045 Saccharomyces
                     cerevisiae YPL253c VIK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446826.1"
                     /db_xref="GeneID:2888692"
                     /db_xref="GOA:Q6FSG8"
                     /db_xref="PDB:4GKP"
                     /db_xref="PDB:4GKQ"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG8"
                     /translation="MYRIKYRKLENITNKVSGNKEENTLERGLKRKQLNQLIRENEKF
                     VRTDKNLQIKIDKYQRKDIPNLKYEVQKRTGLLSQLEKTVNQINLNFEALEKEKTALS
                     SKNLAELTEIENKYKEVIEQKAAEFSQIFEKQQNAWREKIEELRNMPPEDELINQINN
                     LKHTLSSTEQNLEDKIAKNDNDLILYKQKLQVSFSEYKKKNSTSLEELQSQSKNLEST
                     MAELQNIKTEKNSQLRTLAEEQSELERIVMDKQLQVDKLNAEIEPVENKIKEYQNSFV
                     LLKNDIEGMKIKAIDNEQQYNEVYDTLGEELSRRRRLLNSITELKGCARLFANIIEDE
                     ISEKLIVNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENF
                     NLFSVGSSNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSDNADSQDLLSNNKDGGKDV
                     EIKLKIEESTISLGSTLITLDEITDKLQIKKKYSQLNHQNGIGLSKFQFFCLQDIEPI
                     PIDFYFIEIYQPSIYPILKRSTGTESNLNSPLEIVLKKIFHDTKSAFVFQIDHSAEVY
                     DILKLSSHLSFIRNPKGK"
     gene            complement(<63754..>64257)
                     /locus_tag="CAGL0H00660g"
                     /db_xref="GeneID:2888826"
     mRNA            complement(<63754..>64257)
                     /locus_tag="CAGL0H00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446827.1"
                     /db_xref="GeneID:2888826"
     CDS             complement(63754..64257)
                     /locus_tag="CAGL0H00660g"
                     /inference="similar to AA sequence:UniProtKB:Q12184"
                     /note="similar to uniprot|Q12184 Saccharomyces cerevisiae
                     YPL252c YAH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446827.1"
                     /db_xref="GeneID:2888826"
                     /db_xref="GOA:Q6FSG7"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG7"
                     /translation="MQHILRRSIVPISRNIGLSRRFADRPLWQSSARLFSTSMMLSHG
                     HIKKPNPGEELHVTYILKDGSQKTYEVADGDTLLDIAQANNLDMEGACGGSCACSTCH
                     VIVDPDYYDAIPEPEDDENDMLDLAYGLTETSRLGCQVKMSKDIDGIRVALPAMTRNV
                     SNNDFNQ"
     gene            complement(<65095..>68235)
                     /locus_tag="CAGL0H00682g"
                     /db_xref="GeneID:2888805"
     mRNA            complement(<65095..>68235)
                     /locus_tag="CAGL0H00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446828.1"
                     /db_xref="GeneID:2888805"
     CDS             complement(65095..68235)
                     /locus_tag="CAGL0H00682g"
                     /note="highly similar to uniprot|Q04336 Saccharomyces
                     cerevisiae YMR196w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446828.1"
                     /db_xref="GeneID:2888805"
                     /db_xref="GOA:Q6FSG6"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG6"
                     /translation="MNQLREELVNTTVEEKRLEENSKHEKYWYRWGPYLSERAWATVR
                     EDYSQNGDAWSHFPFEHANARVFRWGEDGLFGVSDNKQLVCMNVALWNGKDERLKERL
                     FGLTGHQGNHGEDVKELYYYLDNTPTHSYMKALYKYPFKKAFPYKELVQKNAERGYQD
                     REFEVHEVDGLFHDKATGDTPYFDVYFEMAKSDSNPDDLNFRITVHNRSNQDSGELYV
                     TPQIFYRNTWAWDAESKKNMPRLEKDAHANNLVHLFHKKFGKQKIVFQPSPDIKEGED
                     VEPELLFTDNEPNLVKLFNDKKNPSPYSKDAFEEYLVHGNKKLCNPEHKGSKAGAVYH
                     FKNIPAGESVTVRYKFTNDFDNTIFPSKDLAVIDEDIFDTTFDNRKEEADNFYWRVNP
                     SPIDKELRNVQRQAFAGLLWTKQFYNLTFDEWFKGDPNIKPRPPQNRANGRNSNWQHL
                     YIEDVLSMPDKWEYPFFASWDTAFHCIPLAMIDPDFAKKQLDLLTREWYMHPNGQIPA
                     YEWNFNDVNPPVHAWAVYRVFKIEKSLYNREDRHFLERVFQKLLLNFTWWVNRKDANG
                     KNLFEGGFLGLDNIGIFNRSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAKTNPA
                     YEDIASKFFEHFILISDSMSFEYQKDLDNGEIIKQNLWNENDKFYYDAISWGGDHREQ
                     LPIRSLVGLIPLYASMTLEPSIILQFKGFKKRVDWFVKNKKEIFGRNVASMSEEGVGK
                     RLLLSLVTKDRLEAILKRMLDETEFLSDYGIRSLSKYHEKHPFEMNVHGVQYKVQYLP
                     GESDSGMFGGNSNWRGPIWFSTSFLIIESLQRFHLYYGSDFKVECPVGSGKFLNLSQV
                     ADELSSRMVKLFLPDQKTGLRPVHGDIEADFLSKDPHFKDLIPFFEYFDGDTGRGLGA
                     SHQTGWTSLVAKWISEVGIYCTKSLDKKNLKENVPKGGFADGTPKMKDERRRKSTKSL
                     VNVESTKLELAEECDSKDKFENAYTAYVGANAEHILETKLMERLREKMQNLSFGDDIV
                     DDELATNANSDLACHF"
     gene            complement(<69155..>69547)
                     /locus_tag="CAGL0H00704g"
                     /db_xref="GeneID:2888656"
     mRNA            complement(<69155..>69547)
                     /locus_tag="CAGL0H00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446829.1"
                     /db_xref="GeneID:2888656"
     CDS             complement(69155..69547)
                     /locus_tag="CAGL0H00704g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446829.1"
                     /db_xref="GeneID:2888656"
                     /db_xref="GOA:Q6FSG5"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG5"
                     /translation="MSDIIFPISINEEEAPVVYKPVIQDPLYEDVDLDLDQDDDDDST
                     SDSDSVPSSYESVFTLGNNYTFTPLSYEDEMIPRSDAYADTDSHFYSKIQNRLYTTAP
                     RTTAEVPRQNYNFANVAQDNYKLWLSTV"
     gene            complement(<70626..>73754)
                     /locus_tag="CAGL0H00737g"
                     /db_xref="GeneID:2888650"
     mRNA            complement(<70626..>73754)
                     /locus_tag="CAGL0H00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446831.1"
                     /db_xref="GeneID:2888650"
     CDS             complement(70626..73754)
                     /locus_tag="CAGL0H00737g"
                     /inference="similar to AA sequence:UniProtKB:Q12344"
                     /note="similar to uniprot|Q12344 Saccharomyces cerevisiae
                     YPL249c GYP5 or uniprot|Q04322 Saccharomyces cerevisiae
                     YMR192w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446831.1"
                     /db_xref="GeneID:2888650"
                     /db_xref="GOA:Q6FSG3"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG3"
                     /translation="MATSTDLGNVETASDMAESTGVSSIDASPVKSKNSKKNKKKKEK
                     AKKKKQSQQALQNEAESIDDSAGNEKESTAEIQEPSNEELATSTQLEEPKLVVTTDHV
                     NKEHGESAEGQTDAKDEKDLNTIEKSQDNDLSKTGNSSDKTNDYMTEEDLNSSPLDHL
                     PEGENEAQKLNETNVSTKLNSEKQTNISDTQIKEEVLENPTLEHNDMGKESKENFPIQ
                     TPKNEDNGTNDEANDDMIDHGTTENEVLITEASKEIKNSLEKNLENDVKSDTLISTDP
                     TEDNLLPAPEMSTVDKTTNQQREESLIKVEENSGEKDLLPAQDQETTEKKDNSPENDH
                     SDHDSLLNAGKPIKHRFTSGDDYENSEQQGSNRNMHDFTYTDEDENHNGIQMSDHDDE
                     QYNGHYSGKPPALPTRHISQSPMSITTSDTDHRTPPALPSREMKTRVKNAVPPPLAEE
                     LKSDKFREEFEKGKIKAKHKRYPSSSSMRQSSSQLETAADVNLIANRYRKTSSHVLRE
                     TTSTQELLEEGQTQLKTNYTSILENLKEENVTEAQLEADHEYSKDEKKELLRTDWTFW
                     TEVVNDFPAVASQEPEKLEQQVIAGIPTQIRGIIWQLMTNSKSKEMEDIYNTLLPEPT
                     PHDAAIRRDLKRTNFIPQEKIEPLYNVIKVYTIFDPEVGYTQGMAFVIAPLLLNCETE
                     ADAFGLLVGLMKNYGLRDFYLPEMPGLVLSLYQFDRIIEENSSQLSNHLNREGVRASM
                     YATQWFLTMFAYKFPLSFVLRILDVIFVEGLESILKFAVNLMLKNEAKILSLKFDQLL
                     SFLKEELFEVYRVSEDKLDGADASSVIVHDSQPAVDDVAETRYDVDQFVQDAIADVQI
                     TPLSLRRYSEEYKEIQQLEHQRETQYESMRIKNHQLNKEYHKLQNDYKQLNHEHESIA
                     SELIEIRLKYQMLLDEHNDLQGSIESVRAEIQQLKDHGVSEDQAHVATNDLEVDLQRA
                     THRNTEVMRENMKLEDRIEELKLLVKELKMANRMNREPTTLGTTLGTTLGTNLRSSAG
                     ASWSGFKKVFGK"
     gene            <74843..>76999
                     /locus_tag="CAGL0H00759g"
                     /db_xref="GeneID:2888558"
     mRNA            <74843..>76999
                     /locus_tag="CAGL0H00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446832.1"
                     /db_xref="GeneID:2888558"
     CDS             74843..76999
                     /locus_tag="CAGL0H00759g"
                     /inference="similar to AA sequence:UniProtKB:P35187"
                     /note="similar to uniprot|P35187 Saccharomyces cerevisiae
                     YMR190c SGS1 DNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446832.1"
                     /db_xref="GeneID:2888558"
                     /db_xref="GOA:Q6FSG2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG2"
                     /translation="MSQIAEYFMNHLDPTGYDTSDSYGSCIVSSSQSYKGQSALEQCL
                     FVPSSSSLPSSQLSGLVNAQQTQPDSKKENKSSLNTANPWDKQVQNILKCTFHMEQFR
                     GSQIDIINSTLQGKHVFVLMCTGGGKSLCYQLPSLVTLGYTKGTTIVISPLISLMHDQ
                     VEALISKRIKACMLSSTSSSKQKTMALQLLSEGKLNLFYISPEMVMGSSPCKGIIRRL
                     YRQNRLARLVIDEAHCISSWGHDFRPEYKKLGQLTKEFDGVPVMALTATANDNIQEDI
                     LKILNLKNVVVFKDSLNRKNLYYEVVQKNSRTIEYMTYLLKTEFHGQSGIIYCNSKAS
                     CEKVSKELNQANISSEFYHAGKTANSRLNTQRKWQQGTIQVVCATIAFGMGIDKENVR
                     FVFHYDIPRSMEGYYQETGRAGRDGNPSKCILFFCLQDVNRLQILIQRENVSALQKEH
                     NLKKLQDVLVYCHNKVDCRRLQILEYFNEEFFPSNCMKTCDNCKNIGVSTIEQKDFTH
                     YAKQILSLLRKLGNERITTNQCQDIFRGSNNMKTRFSGYDNFEEHGSGKDLTKSETDR
                     LFVHLLKTGYVCEYFFTNSMGYSTKYLKLPDPIKEIKGKVMLNSLKKQYKAKKKQDID
                     VDNSQSRIDTFSSSLSLFKCHQNSSFQSEDVSMQNLLSENSQSMLDDNSSLIFETINS
                     CISTNLYCTEEKENHKHPKRKKRKSETLPFKKRKKS"
     gene            complement(<77292..>78833)
                     /locus_tag="CAGL0H00781g"
                     /db_xref="GeneID:2888795"
     mRNA            complement(<77292..>78833)
                     /locus_tag="CAGL0H00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446833.1"
                     /db_xref="GeneID:2888795"
     CDS             complement(77292..78833)
                     /locus_tag="CAGL0H00781g"
                     /inference="similar to AA sequence:UniProtKB:Q12523"
                     /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
                     YPL247c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446833.1"
                     /db_xref="GeneID:2888795"
                     /db_xref="GOA:Q6FSG1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FSG1"
                     /translation="MEYQPGKRASVSFGSPSHSVHQSYTTSPFSSGVNLATTAEGVPN
                     NTGGSGSGANGEDVFMTNRSPMYSPLDFLHPLYSPNYSQLHQIRAGLNNTLKNMNQGV
                     VCEYGAHFPLYGVDWSIEDYVCIGSYKEDSRNKLQVIHSPDLFKWDNVAECDVIYPVS
                     NIQWMPSAFRSRKIATASDSLRIWSLNTEENKLEEQLNLSLCKFHKQHPNNKAFVGLS
                     QIPTKTSDVNPSVLGEFPPITSFHWNPVDTNILISSSIDTTCIVWDLQSSNYVKTQLI
                     AHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSR
                     SDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNGHSASINQ
                     IKWHPTKKNTLISCSDDCQVLFWDISSYFDQGAVSHTTTPRPAASGASMEVDSEGDYS
                     YDDSASKTSSIKATKPLSKDLDVPTMCYSNKTHEINNIVWRPQRGDWFGCVSGKKFQN
                     VRTPL"
     gene            complement(<79284..>80084)
                     /locus_tag="CAGL0H00803g"
                     /db_xref="GeneID:2888842"
     mRNA            complement(<79284..>80084)
                     /locus_tag="CAGL0H00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446834.1"
                     /db_xref="GeneID:2888842"
     CDS             complement(79284..80084)
                     /locus_tag="CAGL0H00803g"
                     /inference="similar to AA sequence:UniProtKB:Q12270"
                     /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
                     YPL246c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446834.1"
                     /db_xref="GeneID:2888842"
                     /db_xref="GOA:Q6FSG0"
                     /db_xref="InterPro:IPR022764"
                     /translation="MIAPQRMLMPEGRPPAGLTTGLLIFLTFLFGISQLYEDFKNHFV
                     LTPNSLFDIDLGKLSLYPLMHLSYLHLVFNALAIVGPLNNFESSHGTIHTGVVLNLSA
                     VIAGIIYCVVSRLLSLETGVAGASGWVFTFITYLCVKESQLYPRLELSRFIPGVTQSI
                     PTQFTPVVFLLFTAIVFFQSSFLGHTAGMIVGYIMGYGETWFNILIPPAWIIEKIEEK
                     ADPLINLIPFGIKFYRSTEINTDDGYRSFFPGQEVLPTTTPGNVLGTA"
     gene            <80996..>82306
                     /locus_tag="CAGL0H00825g"
                     /db_xref="GeneID:2888792"
     mRNA            <80996..>82306
                     /locus_tag="CAGL0H00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446835.1"
                     /db_xref="GeneID:2888792"
     CDS             80996..82306
                     /locus_tag="CAGL0H00825g"
                     /inference="similar to AA sequence:UniProtKB:Q12179"
                     /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
                     YPL245w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446835.1"
                     /db_xref="GeneID:2888792"
                     /db_xref="GOA:Q6FSF9"
                     /db_xref="InterPro:IPR018647"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF9"
                     /translation="MTVSRASRFKRAKPANVVKSIAMDKLSNVKLSEEQQQLRGRILE
                     FIRQNLASYQKGGKPGMFVVQGDAGTGKSVILNSLFNDVQKLANNNPDTTDILKGTRN
                     YLIVNHPEMLKLYHRMSTNYTYINKASLERPTSLINNLQKRKEMADVVIIDEAHLLAT
                     SKDAFKRFYGENHLKELLELAKVLVLVYDEKQALRMGCYWDENSENGANLQTFYDEIP
                     ESKRGWYNLKQQFRVAAPPDVLDWINDISVEGKIPKYPKSAKGSLEPKFDFQIWDDCN
                     EMYMKLKEKNETFGQCRMLSTYDFPYRLDGKIYYVTCGDFKLRWDMYAPKALLPWSER
                     EDTIDEVGSVYTVQGFDLNYAGVILGRSVGYDKANDCIKLRPELYDDHAGFTKKKNIS
                     DADTVKQKIIMNSINVLLTRGTKGLYVYAWDPELRERLARSRTE"
     gene            complement(<82430..>83518)
                     /locus_tag="CAGL0H00847g"
                     /db_xref="GeneID:2888648"
     mRNA            complement(<82430..>83518)
                     /locus_tag="CAGL0H00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446836.1"
                     /db_xref="GeneID:2888648"
     CDS             complement(82430..83518)
                     /locus_tag="CAGL0H00847g"
                     /inference="similar to AA sequence:UniProtKB:Q12520"
                     /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
                     YPL244c HUT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446836.1"
                     /db_xref="GeneID:2888648"
                     /db_xref="GOA:Q6FSF8"
                     /db_xref="InterPro:IPR013657"
                     /translation="MSKSNSIFPVLFCAAGIYASFLTWALVQEPLTTQVWENSHKRFQ
                     CPNVIAVVQAVAAVCVGYFYMRAKGAQRNYGAIAMVRDYAKPLALISFTQSASSPLSQ
                     YALQYVDYLTYMLAKSCKMIPVLLVHLIIYRTTISRKKSVVAVLVSIGVTIFTIGGSK
                     GKISGSISGSNDEHFFQKASGFLLLFLSLFMDGLTNATQDKMLKNNRVQMAIQNAETQ
                     DKKQQHKVFHTLTGAHMMFALNFFVAIWNIAYLLVIDRGQICNAHAMLKKDPIIVSYL
                     LAYALCGSLGQCFIFYTLELYGSLVLIMITVTRKMMSMLLSIIVFGKTVNATQWLGIV
                     IVFSGITWEALDKRREKKALEAKVQKSE"
     gene            <83996..>85786
                     /locus_tag="CAGL0H00869g"
                     /db_xref="GeneID:2888531"
     mRNA            <83996..>85786
                     /locus_tag="CAGL0H00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446837.1"
                     /db_xref="GeneID:2888531"
     CDS             83996..85786
                     /locus_tag="CAGL0H00869g"
                     /inference="similar to AA sequence:UniProtKB:P38687"
                     /note="similar to uniprot|P38687 Saccharomyces cerevisiae
                     YPL243w SRP68 signal recognition particle protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446837.1"
                     /db_xref="GeneID:2888531"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF7"
                     /translation="MPIFSPINATYGVRVEQILETDQDFVKYHDKLNRKLQKLRHRCQ
                     GVTKDTKKYSEKEKFSKITSDNYDKQSKLYGVLYLLQVERDLSLVETLKLRGRQRGKL
                     KRPERKVIQTRLKKVAKLVEGLVALTQNEQNYVTRLQYLIYSKLAKAEFILNGKLTTK
                     KKAESDVAGLLALAFAGLQYLAEHNYISEDISSFIQSKYEYSLMQYAGNLVSNVRLQN
                     FIIESLKSIGDKDEIVKLLLNNGFKLDIKEVDDTTTNSLTNINWRSFQAKITDREVSH
                     LIELAESVEISKLSDYSSKLLYWEDALSKQEAVIANYDENESTENADIDDPQENNQIL
                     LSYVKYNKLMVNILRDNEICKELWQQWDKSCSTLSAKVVKYKELERITSNLSVFLHEV
                     MELPGIYSDDELMYQLELLDLHYKTLLSSKALAYLYQSKGKYREALALHVRSFQELNS
                     KLEQDMLYSNDEILPNSLFDKLDIEKNQSNIKAAWTGVIALAGYQKSLETTGKSKYKL
                     SVIEKISNQKEIEASDVNISNLFPLTPHMQPVGAKPTLFDLAFNYIQYEKFEQRNITE
                     NKPAEKQSSEPENHKEEQPKKRGFLGLFGR"
     gene            complement(<85886..>90313)
                     /locus_tag="CAGL0H00891g"
                     /db_xref="GeneID:2888859"
     mRNA            complement(<85886..>90313)
                     /locus_tag="CAGL0H00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446838.1"
                     /db_xref="GeneID:2888859"
     CDS             complement(85886..90313)
                     /locus_tag="CAGL0H00891g"
                     /inference="similar to AA sequence:UniProtKB:Q12280"
                     /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
                     YPL242c IQG1 involved in cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446838.1"
                     /db_xref="GeneID:2888859"
                     /db_xref="GOA:Q6FSF6"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF6"
                     /translation="MTDSNSFLQRYVDLVNTNESPVSPLGLKSSSKTNLLSPSPVKSK
                     LSSPVSLSMADKENQGYKKSFDLPQTPTKSQSVSKAFTADELRYYEFLCRVHEVKVWI
                     ESVISEELPSVTELATGDVMRDGVFLAKVTNKINPALAPSVFPAGDKLQFKHTQNINA
                     FFSLVEHVGVPDSFRFELQDLYNKKDLPHVFETLHIMISIINKKWPGTTPDIKNVSGT
                     MVCTKEDIQVCRRAWPRIKDFGSLANTSAVPSPKKVDIPKSEGLIQDFSSSITKDKKV
                     NTMEQQPKTPIKPKAEGRPTYISSFKTPVSKVLDTSKTDEYMSLKDGPSAANIFAKTP
                     SLSYSPSKMTSFSYYSPSISKYLTFDTDFYMRRSQYRDSELSHYSTYKYSPSRYSPTR
                     KTRMNEEEFLDCVMKIQAMTKGVNIRYQIYLQNQLLSLFKEDVVGLQSLIRANSLRKM
                     KGTKSHKWRSIEKSVDFVSLTSLIRGNRIRDKLDKKRIAVNRKESSIILFQSICHGIL
                     ARRNATVLSSYVKNNTTIVTIMQGLLRGKLARNVVSHTSKDLHANIPCLTDIQATVRS
                     ILVRQCIDNRRKAFFAPSISSSLEAFQTVGRSLLQRREIQRINIELSESHKLIALLKG
                     HSVRRRIGRCQTDLSSELEPAIGFQALVRGILVRYTLDLVDDIVEYHQIEVLQSLIRG
                     ALQRGAIKENTHHYRKNISHIIQIQSHIRMFQMKTAYQELMTYPNPSLWSVKKFVHLL
                     NNRKSIESIQDEVETYQASLDSENMKKTKVLREIKHQLDLLDVLERQNLAKGINHGTF
                     SKIKSKVPNSNYPGFEGLFYLLQVDPSYWKLMAAKEKEFSMRNIYSTFTTTNKKMEER
                     ERRLFMKLVSELLQQDIQECTSVGEFMAFSSPSWKLLLDEFIEKEYSEAFELFVPVLS
                     FLGNRETDFTSDPYVLYEKFYSEAPSSQPIENQRVKNEFIKNLRNIWHAIEMIAEIFS
                     RKTNEIPVELRYICTKTLCYFADKNICEEEALKAISMVLIESFIEHFMVNFQKFGFDQ
                     YNDENINDKIKVVIESLRIVFLQTSFDGYHKPLNQYSGEIRPHIKNLLYNLLVDLEYE
                     QVGYAEIYNDMVSTSPVLELLSSKVIEVAQMFSDYSEDFTDLDPIQDVLKTMDFKLMS
                     NNSGRVTLELDSSSYRFLTGDDGIRKVYDQVKRAFVIMIQVEDVETNLYDLSVSSVLP
                     QDEPVFQELLRNNIGLEKDSFVSKLTPRTYFTLKNETLRNIQELTTAKVICMKDNKLQ
                     NFLNDIANTIKNPDYALHFVEKEVEMTNRTLVEIQNVNHKLESELRNMRSFVSSTISD
                     IQKTSDFTPHHKGALGNLKSAYKKVQNKDSKLDGLKYKWNARQLYEKGILKRIQGENL
                     GKHSVKVFGSSGPKFPDINFRISTTNGSRFGIQMTDKRKGPEHKHMDITDFFEFRDLL
                     EKQAKNPKGTITLLNRKVDLNVAELLKLVTTAFYYRQSI"
     gene            complement(<90756..>91592)
                     /locus_tag="CAGL0H00913g"
                     /db_xref="GeneID:2888460"
     mRNA            complement(<90756..>91592)
                     /locus_tag="CAGL0H00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446839.1"
                     /db_xref="GeneID:2888460"
     CDS             complement(90756..91592)
                     /locus_tag="CAGL0H00913g"
                     /note="some similarities with uniprot|Q08973 Saccharomyces
                     cerevisiae YPL241c CIN2 involved in chromosome
                     segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446839.1"
                     /db_xref="GeneID:2888460"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF5"
                     /translation="MDIAQQLRRLEDTAEEAQEQWLAELDCAYAQFNERIADLTKYDR
                     EKCKRRFDALFAWRNSGGGSGGGSGQGPHGQRLRFRFKHTPRLKTSTEAPAGDPAARS
                     TPPLQHVDAVLELSEMQMKRVFNLDRLDRCVVLYDGASNDAMSAFSMAHARNTVVSLN
                     VPQMLGSIFVTDCEHTTLLIRLRFGEKVQIRLHNLVNCQIQVEPADNTASAQTVIIED
                     CDEVTFHSTAQDLIAIRNFNVFKAHTDKPPYKWGPPLPDQDQDPIKLREAYIAAERGI
                     VM"
     gene            <91979..>92560
                     /locus_tag="CAGL0H00935g"
                     /db_xref="GeneID:2888693"
     mRNA            <91979..>92560
                     /locus_tag="CAGL0H00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446840.1"
                     /db_xref="GeneID:2888693"
     CDS             91979..92560
                     /locus_tag="CAGL0H00935g"
                     /note="highly similar to uniprot|P46683 Saccharomyces
                     cerevisiae YPL239w YAR1 ankyrin repeat-containing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446840.1"
                     /db_xref="GeneID:2888693"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF4"
                     /translation="MSLHEKPLEQEDQDAVILDARAGDLESLQEIFTTLIHPKLLATC
                     VSSDNGSTALHMAAANGHLEVVKYIMEQVKQSADAGAVGRYVNLQNKTGNTALHWATL
                     NGKLDVVQYLCDECDADPFVKNEFGHDPIFEAENNGKEEVENYFLKKFDVEPESESES
                     EDDVKVSHGTEIEQVTKEATEVLAKQTESLQLE"
     gene            <92911..>93657
                     /locus_tag="CAGL0H00957g"
                     /db_xref="GeneID:2888831"
     mRNA            <92911..>93657
                     /locus_tag="CAGL0H00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446841.1"
                     /db_xref="GeneID:2888831"
     CDS             92911..93657
                     /locus_tag="CAGL0H00957g"
                     /note="highly similar to uniprot|P09064 Saccharomyces
                     cerevisiae YPL237w SUI3 translation initiation factor eIF2
                     beta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446841.1"
                     /db_xref="GeneID:2888831"
                     /db_xref="GOA:Q6FSF3"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF3"
                     /translation="MSDIEVKKVVDDPFAGLKKKKKKSKSVKEEEVGADEVTEALSEL
                     TLKKKKKKSKEVTDEFEKELAKAGLTGESNSKESSVGQESSIQQNVGLPYPELLSRFF
                     NILRENNPELAGDRSGPKFRIPPPVCLRDGKKTIFSNIEEISEKLQRSTEHLIQYLFA
                     ELGTSGSVDGQKRLVIKGKFQSKQMENVLRRYILEYVTCKTCKSINTELKKEQSNRLF
                     FMVCKSCGSTRSVSSIKTGFQATVGKRRKM"
     gene            complement(<94328..>95527)
                     /locus_tag="CAGL0H00979g"
                     /db_xref="GeneID:2888454"
     mRNA            complement(<94328..>95527)
                     /locus_tag="CAGL0H00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446842.1"
                     /db_xref="GeneID:2888454"
     CDS             complement(94328..95527)
                     /locus_tag="CAGL0H00979g"
                     /inference="similar to AA sequence:UniProtKB:Q12003"
                     /note="similar to uniprot|Q12003 Saccharomyces cerevisiae
                     YPL236c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446842.1"
                     /db_xref="GeneID:2888454"
                     /db_xref="GOA:Q6FSF2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF2"
                     /translation="MLWQWLSGPLSVLCCGFCPDFSNTFLLVNGRKYSIVRLLKEDDM
                     SFLYLVRLEDGMPLLSAAASGDDDDGYESVNTYTLKRIRCPIGNISNVSDAMREIDNY
                     KRFQSPYVVSSVDSQVIQELDGAKTIYIVFPHYPLGSLQDSIDDRILDGTFVSESECI
                     RIMCGIARGLLCLHDSSSAPRGVRTLTTGVDEGASDNVNTDFNLSDNLGDDRDKISAS
                     YTDEAGLSMDEHLLELDSISTTSVVPVSYSHKMLSPSNIIFSSNGLPIISELGSCSKA
                     DVEIKTAKQLNRLREWVDDNFNSYMAPEFLDLKTNSKLSTKVDVWSFGCICYALLFGM
                     NPFEREEQLYGASIKYAISTGKFSFPSQSRYSDSILDIIRSCLQVDPSERPSVSIVLN
                     NLQQLQS"
     gene            <95818..>97248
                     /locus_tag="CAGL0H01001g"
                     /db_xref="GeneID:2888577"
     mRNA            <95818..>97248
                     /locus_tag="CAGL0H01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446843.1"
                     /db_xref="GeneID:2888577"
     CDS             95818..97248
                     /locus_tag="CAGL0H01001g"
                     /note="highly similar to uniprot|Q12464 Saccharomyces
                     cerevisiae YPL235w RVB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446843.1"
                     /db_xref="GeneID:2888577"
                     /db_xref="GOA:Q6FSF1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSIQTSDPNDPNGSLKSLSLIAAHSHITGLGLDDNLQPRASSEG
                     MVGQLQARRAAGVILRMIQNGSIAGRAILVAGPPSTGKTALAMGLSQSLGKDVPFTAI
                     TGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITGGHKQGKLT
                     IKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGY
                     DTKFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINT
                     KVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIIMMATNRGISKTR
                     GTNYKSPHGLPLDLLDRSIIITTSNYNEEEIKTILTIRAQEEEVELSPDALDLLTKTG
                     GETSLRYSSNLISVAQQIALKRKSNTVEVADVKKAYLLFLDSSRSVKFVQENQDQYID
                     DNGKVIISTSGEMTQPADGEAMDTTE"
     gene            <97613..>98647
                     /locus_tag="CAGL0H01023g"
                     /db_xref="GeneID:2888570"
     mRNA            <97613..>98647
                     /locus_tag="CAGL0H01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446844.1"
                     /db_xref="GeneID:2888570"
     CDS             97613..98647
                     /locus_tag="CAGL0H01023g"
                     /inference="similar to AA sequence:UniProtKB:Q05635"
                     /note="similar to uniprot|Q05635 Saccharomyces cerevisiae
                     YDR279w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446844.1"
                     /db_xref="GeneID:2888570"
                     /db_xref="GOA:Q6FSF0"
                     /db_xref="InterPro:IPR019024"
                     /db_xref="UniProtKB/TrEMBL:Q6FSF0"
                     /translation="MTIEDEQKRVGIEGICLLPSEIKLLSEAYFFELPASSNNESSST
                     TKLLKYGTEIYQVTDYCFGKGRKYEKVKDEINDRYHYDEEGKPLRSAIHVNSEDKTNY
                     TVLPNANIKYFSKYDLTYNLIGFKFKDCVTGKESEYFKPTHKETTKKDDDRYLTLRDH
                     QDMLIDNGHANWSQIPSPTLEHCLSNISDQIEEAGDKYYKITLDKILNYLKLKIVNIV
                     ENFPNSISVPPSLDKNDLNAFKIFIASNILVSLVPKIIFVSLQDDDIPIEKYDISVKQ
                     AFHDIEVFYKTSTDKDAEQKILLEAATNVGMPGDSGPRQMDKKPKKVVPKKPKVAVGR
                     GAIDGFFKKK"
     gene            complement(<98818..>99903)
                     /locus_tag="CAGL0H01045g"
                     /db_xref="GeneID:2888442"
     mRNA            complement(<98818..>99903)
                     /locus_tag="CAGL0H01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446845.1"
                     /db_xref="GeneID:2888442"
     CDS             complement(98818..99903)
                     /locus_tag="CAGL0H01045g"
                     /inference="similar to AA sequence:UniProtKB:Q05648"
                     /note="similar to uniprot|Q05648 Saccharomyces cerevisiae
                     YDR282c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446845.1"
                     /db_xref="GeneID:2888442"
                     /db_xref="GOA:Q6FSE9"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE9"
                     /translation="MTNIDSYGVKTTKFTKGIANPTRYLRRSFVPRSKKVNAVDTESE
                     DDKFESSILKTLVIKPCTTVTTGERYDLGKCLEILNINGFQPSNLIPGEIVSFNYRTN
                     GIDGTIMILGQTGSVVCWGVDERTALIEIVPLISEAIVNKLEVEEYETEDMDYIEIES
                     AEDLENLRSHSGIQSEPKINSRLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVL
                     ENAMERHISNTRIITEKISTGIKLKVKESDALKSIGRLFLIRGRLNLYSELIETPDLY
                     WSEPELEIIFKDVSRYLDISPRINILNSKLDYSTDECRAILSLLNERNSSFLEWIIIY
                     LITFEVIFELFHFYKSNQESTKRVEVD"
     gene            complement(<100610..>101530)
                     /locus_tag="CAGL0H01067g"
                     /db_xref="GeneID:2888501"
     mRNA            complement(<100610..>101530)
                     /locus_tag="CAGL0H01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446846.1"
                     /db_xref="GeneID:2888501"
     CDS             complement(100610..101530)
                     /locus_tag="CAGL0H01067g"
                     /inference="similar to AA sequence:UniProtKB:Q05541"
                     /note="similar to uniprot|Q05541 Saccharomyces cerevisiae
                     YDR288w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446846.1"
                     /db_xref="GeneID:2888501"
                     /db_xref="InterPro:IPR002190"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE8"
                     /translation="MDEEYSSEQSPEINSKLDNVAYRLVGFILSSTEQGNSVLGRAKL
                     QKAIKQYASNENVVRCPMSDVLLKVNQILDDTYGFELIGVSTNKTTSQADQSGRSTPI
                     AIADSTKSIKSSDINYFVLRNKLKPITAVENFKIELAKEAYETFLSKELGENEDYNSD
                     GENIIPQSQINATLSSDYEIKDNLVLKGILSVMLCIILFSKNNLLERDLYEELKKFGI
                     SENNPIPLLDMSIDSVLRIFVNQQYIDKRDQNTETGNVITTYHIGRRTKYEFDFDSVV
                     LLVKEIMDIDVTKEERLKRDVKRALADSYS"
     gene            complement(<102118..>103005)
                     /locus_tag="CAGL0H01089g"
                     /db_xref="GeneID:2888626"
     mRNA            complement(<102118..>103005)
                     /locus_tag="CAGL0H01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446847.1"
                     /db_xref="GeneID:2888626"
     CDS             complement(102118..103005)
                     /locus_tag="CAGL0H01089g"
                     /inference="similar to AA sequence:UniProtKB:Q05533"
                     /note="similar to uniprot|Q05533 Saccharomyces cerevisiae
                     YDR287w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446847.1"
                     /db_xref="GeneID:2888626"
                     /db_xref="GOA:Q6FSE7"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE7"
                     /translation="MAKKLTGEELRKIEQHLIEFLKTDIGPILKNASGTKFDSYDEKV
                     NDVDLVTVVDKKVETLIRKFAEENYPEIKFIGEESLSKDERFDLEDPTFIVDPIDGTT
                     NFIHGFPFSCTSIGVAQGGKPVIGCVYNPHLNQLFHASLGNGAYLNDEPINIEKRTLS
                     LKKSIIGLEGGSEREDGKGTNFTKKFDTYRKLLSDRGAFIHGFRSLGSAAMNICYVSI
                     GYMDAYWEGGCWAWDVCAGWCILNEAGGKIVGGNPGQWNIPINNRSYLAVRGGLVDDD
                     EQEKFIQDFWGFVEGALKY"
     gene            <103424..>103768
                     /locus_tag="CAGL0H01111g"
                     /db_xref="GeneID:2888601"
     mRNA            <103424..>103768
                     /locus_tag="CAGL0H01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446848.1"
                     /db_xref="GeneID:2888601"
     CDS             103424..103768
                     /locus_tag="CAGL0H01111g"
                     /inference="similar to AA sequence:UniProtKB:Q05530"
                     /note="similar to uniprot|Q05530 Saccharomyces cerevisiae
                     YDR286c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446848.1"
                     /db_xref="GeneID:2888601"
                     /db_xref="GOA:Q6FSE6"
                     /db_xref="InterPro:IPR008554"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE6"
                     /translation="MRSCLPRRLIQTATTGVSKGGVKLTLFSKPQCGLCEEAKEIIED
                     VLESDAIPKHNISMNIVNINQLNNKKWWDLYCFDIPVLHIEKDNDKESLFKMMHRIDE
                     DVLVDKIQTYLK"
     gene            complement(<103968..>106608)
                     /locus_tag="CAGL0H01144g"
                     /db_xref="GeneID:9487999"
     mRNA            complement(join(<103968..105360,105539..>106608))
                     /locus_tag="CAGL0H01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999502.1"
                     /db_xref="GeneID:9487999"
     CDS             complement(join(103968..105360,105539..106608))
                     /locus_tag="CAGL0H01144g"
                     /inference="similar to AA sequence:UniProtKB:P31111"
                     /note="similar to uniprot|P31111 Saccharomyces cerevisiae
                     YDR285w ZIP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999548.1"
                     /db_xref="GeneID:9487999"
                     /db_xref="UniProtKB/TrEMBL:B4UN05"
                     /translation="MSFFRDNINLPFKNRSNIFQNKLRTVSDATDYNNENSKPEVAAS
                     EDSSIVMDEYINKIIETEYSENTVVNDDVGNSFQKPNDELQITEIRIIDDKEQLAPVQ
                     DQSHNQTQQELRPNFTQVKESKNENIMQPLITENSNDVLLEAFTNTQKICSNLKSQLL
                     KEQRENERLKKMLNDFEETNQKTGKKINEYKSLFESLNEKLSVLSHQKIQNEKSLKEF
                     VTFQEEQKSKLDKSQIEIESLKSKLNEGKNILDVMKNDLMQKSSEIDFLKKELDECSG
                     LLSEEKIKSNKINQTIENKNNDLVHYLDKNITNQQNLMDELFKQVSTNNLKKLLQRLD
                     IALTKMQSFVESKSSDILVKIQESYRNNNALELSLENNITNIFNSLSSFIENNANQIN
                     DIISSNSKNAIASIDNIDKRFNSFENSLKSENSQLLKLLEKHEQNFSSKLESIDSSLK
                     EYCSEVDVTKKLKDKILALEKYNIKLENDVENNQHSEKRLEQLLTSQRNEIESLKVEL
                     KSKNETLKNSTADVFKLKEELSVKVAEISRLNEINNLQKVNYESKLGSQSEILKVLIK
                     EKDELKTKIDSIDDDRKRVEDELYKKVANFDKINKQLQSVNVEMVQLAANKLELEEET
                     RNLRTVLKESEKCTTSIERELKVLKQERIQLKAENQDLVSEKLEIEGKLKEMASKCMV
                     NNKEKKKVASADKNPINGYRNDSNSNARNLEEVKKDDLLQKKHQRPSSIIKENTHKQD
                     DEDILDDVFDLSYSNSASDFESVSSIAFPKLAANSKVKVNSNLEKTIGDKQNGRNTSK
                     KKFLIEDVNGDKNTNFKRRKKT"
     gene            <108423..>109316
                     /locus_tag="CAGL0H01177g"
                     /db_xref="GeneID:2888534"
     mRNA            <108423..>109316
                     /locus_tag="CAGL0H01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446849.1"
                     /db_xref="GeneID:2888534"
     CDS             108423..109316
                     /locus_tag="CAGL0H01177g"
                     /inference="similar to AA sequence:UniProtKB:Q05521"
                     /note="similar to uniprot|Q05521 Saccharomyces cerevisiae
                     YDR284c DPP1 diacylglycerol pyrophosphate phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446849.1"
                     /db_xref="GeneID:2888534"
                     /db_xref="GOA:Q6FSE5"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE5"
                     /translation="MNIDRLTFGLARGERESNSRLERLATTTSSKWRIQDVCLLLIIM
                     VVNYPVYYQEPFQRQFSLDDRTISHPYAEVERVNDVMLFIYSFIVPALSIFVVWLLFA
                     DPRHRYYLIYVSMLGLIFAWFSCSLFTNFIKNWIGRLRPDFLARCQPRSDLPTDRYYT
                     IDEVCTTENYDVLLDGFRTTPSGHSSESFAGLGYLYYWLCGQLLTEKKYVGLWRKTLA
                     LVPLLIASLIALSRTQDYRHHFIDVIIGSILGMVFAHFTYRRYFPSITDELPFKPLLD
                     DSTVGTDLYSSANEEVSLPTV"
     gene            <110610..>115556
                     /locus_tag="CAGL0H01199g"
                     /db_xref="GeneID:2888699"
     mRNA            <110610..>115556
                     /locus_tag="CAGL0H01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446850.1"
                     /db_xref="GeneID:2888699"
     CDS             110610..115556
                     /locus_tag="CAGL0H01199g"
                     /note="highly similar to uniprot|P15442 Saccharomyces
                     cerevisiae YDR283c GCN2 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446850.1"
                     /db_xref="GeneID:2888699"
                     /db_xref="GOA:Q6FSE4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR016255"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR024435"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE4"
                     /translation="MSRSYLSLDEYYEIQCNELEAIKSIYMDDFEDRTRKKSKWDKQP
                     QIQFDISLRSMDKDPEELSLVVHFAMTPMYPHTAPEISFGERSNVTDTQIKVLENRLK
                     EIFKELKGQEMVFEITSYIQEKLDEFQNNVTTSSLEDERLQRIKEEEEKMIREEEERK
                     RRIEEKKINEQKRIDEIVQKELAKRQDDEDDEKIFQHKSQVNLMPPQDWISSGEAILF
                     PKVMKAKLPNNTQFKFCAVVAPKQIFLQNDILSFANQYLVKPYVPSDSPLADVLMSSE
                     MMQNFYFLLTEIHLKNPYFNTSNGKKEIANLEKELESLLKVQHDNVLRVFSFTVERMG
                     KNHSSFFWKIRILTEYSPAYSVGEIVQSVNFVNLATARVWIIRLLEGLESLHKAGIPH
                     RCISLETVLLLKDTDLGNTVPKLTHPSYAYIIINMLSRYPNKDDNNIELPEFAWPAPE
                     LSKNPSMKPTRMTDIWQMGVIFLQMINGIESVVDFSTPSDFLEAYAMDESLHDVLSKM
                     LNNDPKKRLGTLELLPMKFFRTNIDSSANKLFIHTEKSFQNFQNMGSSYETKDRTLSS
                     SSMRRRSFNVGSRFSSVNPSTKSRYATDFEEIAVLGKGAFGQVVKARNALDSRYYAIK
                     KIRHSEEKLSSILSEVMLLASLNHQYVVRYYAAWLEEDIVDNDVFESSDDESYSDESS
                     EISKDDLLLSSGFTSRLSTKDLDESNFDFISNSGYPDIVFENSGDDNSKNESDESNES
                     DETDSDFSDAESASNGIEFVREDSMKKTKKRSTLFIQMEYCENRTLYDLIHNEGLNKE
                     RDEYWRLFRQILEALSYIHSQGIIHRDLKPMNIFIDESRNVKIGDFGLAKNVHKSLDA
                     LKLDSQMSTGSVDDLTSAIGTALYVATEVLTGKGNYNEKIDMYSLGIIFFEMIYPFST
                     GMERVNILKDLRSSNVKFPNDFDNNRMKTEKKIITLLVDHDPQKRPGAKTLLNSGWLP
                     AKHADEVIKEALKSLSNPSSPWQQQVRETLFDQPYSLTNDILYDNNKQVTTKFAQILR
                     ARMTEEVVKIFRKHGGVENNGPPRIFPKAPIYGTQNVYEVLDLGGTVLQLQYDLTYPM
                     ARYLSKTTSTINKQYRMQYVYRPPENSKSSLEPRRFGEIDFDIISTSSSESSFYDAES
                     IKIIDEILTVFPVYEKTNTLFVVNHADILDNVFNFLNIDKAQRPVVSRLLSQIGFAKS
                     FREIKAELKSQLNIASTALNDLEMFDFKLDFEGAKKRLQKLMIDSPYLRKIEESLNHI
                     SKVLNYLKPLEVTRNIVLSPLSNYNSAFYKGGIMFQSIYDDGSSRNLIAAGGRYDNLI
                     SYFARPSGRKSSTAFRAVGFNLAWETIFGIAQSYFKLASKNRTKKRKEFLKDVSIDWK
                     PSRCDVLVSSFSNSIFDTIGVNILNQLWKNGIKADFLRNCYTVDDVVSGAQQDGVDWI
                     VLIKQQSYTVNSQKRKYKPLKVKHLGSDIDVDVTLEEFLVLYRQETTRKLGVENQLLA
                     SEKYEETKRWDDGSSAGSSQEDDNDEPLNGNANRKITYVPNMATRSKKASKREKWVYE
                     DGARHASQAIINDLSNAPIIAVDALRDEAMDIIAITSLAQKDEWLRKVFGSGNNSTPR
                     SFATSIYNNLSKEASKGHKWAILYCHKNNKSCVVDLQR"
     gene            complement(<115828..>117006)
                     /locus_tag="CAGL0H01221g"
                     /db_xref="GeneID:2888526"
     mRNA            complement(<115828..>117006)
                     /locus_tag="CAGL0H01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446851.1"
                     /db_xref="GeneID:2888526"
     CDS             complement(115828..117006)
                     /locus_tag="CAGL0H01221g"
                     /inference="similar to AA sequence:UniProtKB:Q05543"
                     /note="similar to uniprot|Q05543 Saccharomyces cerevisiae
                     YDR289c RTT103 regulator of Ty1 Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446851.1"
                     /db_xref="GeneID:2888526"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR006903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE3"
                     /translation="MSFSASQFIGKLGTLEDSQESINSASKWLLSQYREADNVANTWK
                     DYMLKDSVKARRKLLGIYLLNHVVQQAKSQKIDHFQKAFSNVVYEVIKNVYPQLHPEM
                     QKKAKRVVDIWYDRGIFPKDILQKLRNSILEINKTAKLDLESGKDKKTSSSRSGSIDK
                     DRTKLSLELPDTIEQYAMLHKELRKLQQNAVSLKTRFDNSASELDPSSHVYEDNYNTV
                     SKIANLAVDAVQKSMDTRQKAIDIIQSVLNAEKKQYEASQTMLTEINFSLMSKNPAKI
                     QQIPEDNVLPTYTSGSNANDSSSDDDSDASDSSESSSDEKEEKQLSDLNDRKRSPDDN
                     LNENDSSKKMKAIENEENVGETEKNELDEAEKNSENNGEDTGGNITSNIQDLLSKLAN
                     "
     gene            <117461..>120745
                     /locus_tag="CAGL0H01243g"
                     /db_xref="GeneID:2888552"
     mRNA            <117461..>120745
                     /locus_tag="CAGL0H01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446852.1"
                     /db_xref="GeneID:2888552"
     CDS             117461..120745
                     /locus_tag="CAGL0H01243g"
                     /note="highly similar to uniprot|Q05549 Saccharomyces
                     cerevisiae YDR291w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446852.1"
                     /db_xref="GeneID:2888552"
                     /db_xref="GOA:Q6FSE2"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE2"
                     /translation="MDEPVLKRPKVEEQREESAGQDDFQLRDFKKFFFKLNTLYTFLS
                     CRKHVVPSFETLSKPLNASMKREVNEMDFARVVALMPRGTVFKYIDENQIVTERKLFD
                     FNKGGYQQRDNDIFELEEIEKQFEESRSTQILIFEFVDGTMKRTWNRNGQDNPNKQVF
                     LPTYTPEEMKKMIKKREAFFNERLSLFIEEASNEGIPTMKKLDELALKHMPKPKDYED
                     PITSMLKAKEEKEKQVVNEETGESRPLMTEMVSKLKKSEHYNGQIKTHMEIPQRHAEY
                     GELNVDIDSEILDAIGYSQFYSHQADAINAVHNGENVIITTSTSSGKSLIYQLSAFDL
                     MFRNPESTFMYIFPTKALAQDQKRAFQVILSKIPSLKNVVVDTYDGDTDPEKRSFIRN
                     NARVIFTNPDMIHASILPNHVNWRRFLFNLHLVVIDELHIYKGLFGSHVALVMRRLLR
                     LCREHYDNFFTRFISCSATLKNPVKHMMDIFGIDKVRLISNDGSPRGTKHLVVWNPPV
                     LSQHDRKRENFISESAKILVDLILANVRTIAFCYVRRVCELLMKEVRSIFEEMGRQDL
                     ITDVMSYRGGYSAADRRKIEREMFHGNLKAVISTNALELGIDIGGLDAVLMCGFPLSL
                     ANFHQQSGRAGRRSKDSLTVVVASDSPVDQHYVAHPDLLMNSEDPDSFQDLVLDFTNM
                     LIVEGHVQCASFELPVNIERDKKYFNDKLLRNICHERLQKDENGYHCNIRFLPWPSKH
                     VNLRGAEEDQFAVVDITNGRNKVIEEVEASRTSFTLYDGGIFIHQGYPYLVKEFNPEE
                     KYATVQRVDVDWVTNQRDFTDIDPQEIEYVRSMEGTDVPVYFGKIKVTIIVFGFFKLD
                     KFKRIIDAVEVHNPPVIINSKGLWIDIPSRALEILESKQLNAAGAIHAAQHAIMGLLP
                     KFIVAGSNEIQTECKAPEKEFAERQTKRKRPARLVFFDSHGGSYGSGLSSKAFEHIQE
                     ILNGTLQRITDCPCEDGCPECVAASYCKENSLVLSKPGSLVILHCILGHEEDDYIDLI
                     KDGPEPNMPEIKVETVIPVKEHVNFAPDFEILDIKNIKKEEGYIINEDENNKLYIKKE
                     EETINH"
     gene            complement(<120894..>122711)
                     /locus_tag="CAGL0H01265g"
                     /db_xref="GeneID:2888550"
     mRNA            complement(<120894..>122711)
                     /locus_tag="CAGL0H01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446853.1"
                     /db_xref="GeneID:2888550"
     CDS             complement(120894..122711)
                     /locus_tag="CAGL0H01265g"
                     /inference="similar to AA sequence:UniProtKB:P32916"
                     /note="similar to uniprot|P32916 Saccharomyces cerevisiae
                     YDR292c SRP101 signal recognition particle receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446853.1"
                     /db_xref="GeneID:2888550"
                     /db_xref="GOA:Q6FSE1"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007222"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR015284"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE1"
                     /translation="MFEQLTIFTPQGEVLYYYNCYDRKFAEAQVNAVISHLLTSPISR
                     DHGSSKYKLLSIPSVSKNAKPFTVLSHVSKQPELYFIITYPEPSMELNNEAQEVLDVA
                     IALWDSLPINDIIIKAAKGTGKKNAFNCIDISGEISEDIEKFDNYLRTKYNESIKVDQ
                     ANTNINSDEIRAESPGAKKKSKAKKPIKGGNNRKWGIDGALEETGNDSGTLDFSDPNA
                     KPTGEMSQNVDTNIDTSDFGSKSKSGDFLIKEIDDILSQQQQQKSSSGSDNTGYTKSA
                     FGFLQKHLLGNKTITEKDIHEVLEKFKQKLITKNVSPEAADYLLKQVSRDLVGSRTDN
                     WTSVENTVKQAVSKSLTEVLTPGVSVDLLHEIQKKTGNRSADGKKNPYVFSVVGVNGV
                     GKSTNLSKLAFWLLQNNFRILIVACDTFRSGAVEQLRVHVENLAQLMDEKHIRGSKNS
                     RGKSGNDYIELFEAGYGGSDLVTKIAKQAIKYAKEQDFDIVLMDTAGRRHNDPTLMSP
                     LKNFAEQANPDKIIMVGEALVGTDSVQQARNFNNAFGKNRNLDFFIISKCDTVGEMLG
                     TMVNMVYATGIPILFVGVGQTYTDLRTLSVNWAVNTLMS"
     gene            complement(<123328..>127302)
                     /locus_tag="CAGL0H01287g"
                     /db_xref="GeneID:2888477"
     mRNA            complement(<123328..>127302)
                     /locus_tag="CAGL0H01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446854.1"
                     /db_xref="GeneID:2888477"
     CDS             complement(123328..127302)
                     /locus_tag="CAGL0H01287g"
                     /inference="similar to AA sequence:UniProtKB:P24276"
                     /note="similar to uniprot|P24276 Saccharomyces cerevisiae
                     YDR293c SSD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446854.1"
                     /db_xref="GeneID:2888477"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FSE0"
                     /translation="MSKFHRQDGASGTTNNNMYVTTTGGGKNAPKQIFVAHRRSQSEL
                     TSLMIEQFTLQKQLEAVQAQQQQLLAQQQQLAQQTQMYASQAQAQPQPGTGQGQGQGT
                     GQGVDAMLGANTTAAAVAAAGMANQSGQNQAHHAMGGGFLPQPPNPHYSTGNSGNSGN
                     GGNGGNSASGGLGSNQSLASPNNLMAGGNRSRTHSRNNSGYYYSNTYDGASVTTPSGP
                     NAHRRTGSQSSVYGHSRRHSLGLNEAKKAAAEEQAKRVAGINDSLSGVNVKIEPVSPD
                     LGSQEQSSFEFPQKTHRRSNSNLSPASYKFPASTPTSSANTGNDDDFTPTSSMNRRSR
                     NRNSEYNIGINSNWRVQAQQQQQQQQQQGQQQYQNTQRSPFRHRASNSRDFNSFSTLE
                     PPAMFQQGHKPRNSNSSIHSFSSNSGGGNNQNSRKSLFAPYLPQANIPQLIQEGRLVA
                     GILRVNKKNRSDAWVSTDGALDADIYICGSKDRNRALEGDLVAVELLVVDDVWGSKKE
                     KEEKKRRKDALQQDIIPLNSNDDYHNDASATPNTGAPSYNSDDVVLSMRSDGDLGSPT
                     KSSIKRKGSLKQRPTQKKNDDVEVEGQSLLLVEEEEINDKFKPLYAGHVVAVLDRIPG
                     QLFSGTLGLLRPSQQANNENAKAPQSPKIAWFKPTDKKVPLIAIPTELAPKDFVENAD
                     KYTDRLFVASIKRWPITSLHPFGILVSELGEINDPNTEIDSILRDNNFLSNEYSDPKD
                     PSKEKTTFHPLEVSDSAVAARKQFDNAHGYSVLCIEENGSISEFATHLRRDNEGNLEL
                     GCHVVDVTSYIEEGSSLDRRARKRSSGVYMPQKVVDLLPETLNDAISLKPNKSTLAIS
                     VVYTLDPSTLKIKETWIGTSNVTPTGKMSVSELDKRYNTGSADPVSSALKDIATKFYA
                     DRINWPEAQLSPALSLLDSLDDEKVKADLNLFSSSIGGSVISELQRKVNATVAEKLYT
                     KLGDLAFLRRQTAPVATKIASFIKKVEHFGYEIDTFSADTILKSILKIDDPDVRTGVE
                     ILLFKTMSRARYFVAGKLDPDQYGHYILNLPLYTHFTAPMRRYADHVVHRQLKAAIYD
                     VPYSDDMDSLKITSEYCNFKKDCAMQAQEQAIHLLLCKTINDMGNTTGQLLTMATVLQ
                     VYESSFDVFIPEFGIEKRVHGDQLPLLKAEFDVVSRVLELHWQPGIDSATFVPPDEKN
                     PKSYRNSIKNKFRSTTAEIADTEFDRMSNNDSLVSDSLSKELSKLSLSVPQLRLPERK
                     DGKNALNNFLATVNTRTENDNYIQEIYELQKIPILLRAEIGMALPCLSVRALNPFMKV
                     EPKH"
     gene            complement(<127948..>129645)
                     /locus_tag="CAGL0H01309g"
                     /db_xref="GeneID:2888490"
     mRNA            complement(<127948..>129645)
                     /locus_tag="CAGL0H01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446855.1"
                     /db_xref="GeneID:2888490"
     CDS             complement(127948..129645)
                     /locus_tag="CAGL0H01309g"
                     /inference="similar to AA sequence:UniProtKB:Q05567"
                     /note="similar to uniprot|Q05567 Saccharomyces cerevisiae
                     YDR294c DPL1 dihydrosphingosine phosphate lyase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446855.1"
                     /db_xref="GeneID:2888490"
                     /db_xref="GOA:Q6FSD9"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FSD9"
                     /translation="MNINDIKELVDQVSVEDVVNCVVNKTTRYLDDTPWYNILKDYVF
                     LIVLYKFVKKIYYYLAGYGLLKSMQLLYKSVANWIFQRLLESPLLRGSVNKEVSKAVA
                     GMEKELIKNDDQLADFEVLPKEGLSSESINSELDKLNSILPHTSWEQGRVSGAVYHGG
                     KELIKLQSEAFEKYCVANQLHPDVFPAVRKMEAEVVSMTLKMFNAPETGCGTTTSGGT
                     ESLLLACLSAKVYGLKHRGITEPEMIVPVTAHAGFDKAAYYFGIKIHHVDLDPVTYKV
                     DLKKVKRLINGNTVLLAGSAPNFPHGIVDDIEGLGKLAQKYKIPLHVDCCLGSFIIAF
                     MEKAGFNDIGSFDFRVPGVTSISCDTHKYGFAPKGSSVIMYRNSELRKHQYYVDSKWT
                     GGLYGSPTLAGSRPGALVVGCWSTMIHMGESGYKDSCTRIVSTARKLKDHIRNKLPQL
                     EVLGDPKLSVVSFSSNKLNIYELADRLAKSGWHLNALQKPAALHLAITTLSVPTIDTF
                     IETLTEAVEQMSADPTSTPSTEGTSALYGVAGSVKTTGVADKLITAFLDTLYKVKSD"
     gene            complement(<130263..>132407)
                     /locus_tag="CAGL0H01331g"
                     /db_xref="GeneID:2888444"
     mRNA            complement(<130263..>132407)
                     /locus_tag="CAGL0H01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446856.1"
                     /db_xref="GeneID:2888444"
     CDS             complement(130263..132407)
                     /locus_tag="CAGL0H01331g"
                     /inference="similar to AA sequence:UniProtKB:Q06629"
                     /note="similar to uniprot|Q06629 Saccharomyces cerevisiae
                     YDR295c PLO2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446856.1"
                     /db_xref="GeneID:2888444"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="UniProtKB/TrEMBL:Q6FSD8"
                     /translation="MDKANIHYLPIGLTTSQVDLIEILISLHAHSLLKECAKRYNNDS
                     KGADVLKTEDHQGKYPIIPQKRMTYMLDANIRAIANHPSLLVDHYIPRQFLRMEPTEI
                     SITSSDKFKKLNTILSMIIQRDRKQFPKPLKVCLISHSIKELDLIEGLVLGKYFKIKR
                     FSGTPLYDEKHDLPYDMPPKSAASSRTSNTSGGKRGRHLSTRSTESSTTDVTINTKST
                     NSNSTNTASVASSPNDSDSKTTDSTSTYTGYTKDTYHYSRKIKKQLHPDIYIDDWLFL
                     TTTRHLTHDPTLLNNINVDLIICFDPLLDPSLPGVSSIRNVNGKSNPIPLIKLVVCNS
                     PDHFMLERTLLKNEELIKSKQAEDGKLDDDSLEYVNTVDGLMHFLLTRSKYYRSMHGS
                     DELQTDVDYQRLITSLLRNENCNNVVPQLRIESFDFKKAFNEQASIFEPRLSKLKYSN
                     SELKIFNTVFDIKSYQSTLMKQTVERLKDLENEKEENEKVILRKRLHSTETQNELDGL
                     KQEIGVFYKKFKDDEKSMIDSEKRLERANAETSKLRERISAVEEQKAKLESLINLSTD
                     QEMSSQMEELNELIRKTRVNLKELRTQNEQSSNENDELRSQYQLDSSKAAESASTLSA
                     LRTELEDLNKLLSGPALKLKVNALTAEEKRVRKELYQIQAKSKYLKHYIELMESQYSL
                     KTNGAPNSSVGGRTSNNSTRIRSTRSATPSYT"
     gene            <133494..>134099
                     /locus_tag="CAGL0H01353g"
                     /db_xref="GeneID:2888662"
     mRNA            <133494..>134099
                     /locus_tag="CAGL0H01353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446857.1"
                     /db_xref="GeneID:2888662"
     CDS             133494..134099
                     /locus_tag="CAGL0H01353g"
                     /inference="similar to AA sequence:UniProtKB:Q06630"
                     /note="similar to uniprot|Q06630 Saccharomyces cerevisiae
                     YDR296w MHR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446857.1"
                     /db_xref="GeneID:2888662"
                     /db_xref="GOA:Q6FSD7"
                     /db_xref="InterPro:IPR024629"
                     /translation="MSLMNKAVSRFRTAGWLEKAGYSPWLYLYRNLERGQVMYSQLPE
                     YGERNIKTQFKRHQWENKTPSLRRDIWRVMCVVQMPNHQDSVQVYQNLCRLRYMRDVL
                     YREEAQKHRKLNDKGQVWYSGQYRPTYTQEAVADLKESIDKSGSAGPVTLVWEDMWRM
                     GERSVWEELDLEIKHRALPKLGNVIRDEHAMLKQLQLESLE"
     gene            <135473..>136495
                     /locus_tag="CAGL0H01375g"
                     /db_xref="GeneID:2888704"
     mRNA            <135473..>136495
                     /locus_tag="CAGL0H01375g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446858.1"
                     /db_xref="GeneID:2888704"
     CDS             135473..136495
                     /locus_tag="CAGL0H01375g"
                     /note="highly similar to uniprot|P38992 Saccharomyces
                     cerevisiae YDR297w SUR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446858.1"
                     /db_xref="GeneID:2888704"
                     /db_xref="GOA:Q6FSD6"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6FSD6"
                     /translation="MSVNGTLFEQSFNLKGGYDYMHTVSAPEIKLTPREDLTSYCSDG
                     ILALAAPVIAYWAQSAFFHIIDVFHLAEKYRIHPSEEIEKRNRATRLQVLREVIFQHI
                     VQTVVGLIFLKFADESVTGFEQNEMWHWRQQAPGFIPDAAVYYAYMYGVSLIKLSLGF
                     LFIDTWQYFWHRVMHLSPFMYKYFHSIHHELYVPYAYGALFNNPVEGFILDTLGTGIA
                     MFLTGLTHREEAVLFTFATMKTIDDHCGYALPFDPFQIVFPNNAVYHDIHHQQFGLKT
                     NFAQPFFTFWDNLFGTNFKGFEEYQKKQRRVTIDKYKEFLAKREAEKLEKIKNFSKKN
                     ENKKEK"
     gene            complement(<137328..>137951)
                     /locus_tag="CAGL0H01397g"
                     /db_xref="GeneID:2888603"
     mRNA            complement(<137328..>137951)
                     /locus_tag="CAGL0H01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446859.1"
                     /db_xref="GeneID:2888603"
     CDS             complement(137328..137951)
                     /locus_tag="CAGL0H01397g"
                     /note="highly similar to uniprot|P09457 Saccharomyces
                     cerevisiae YDR298c ATP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446859.1"
                     /db_xref="GeneID:2888603"
                     /db_xref="GOA:Q6FSD5"
                     /db_xref="InterPro:IPR000711"
                     /db_xref="InterPro:IPR020781"
                     /db_xref="InterPro:IPR026015"
                     /translation="MFSRVFVRAASNAAKAGVKPPVKLFGVEGTYASALFTAASKETS
                     VESASSSLVKLSSLIKEDAKLKHIMENPALSTKDRAVVVDSLVKSSANLDKPVVNLLK
                     VLAENNKLGLFDKISSQFSILNDAHNGLIRGSVTTAQPLDSKNFKRLEKALQQSSLVG
                     QQKTLKLDNVVKPDIKGGLIVEVGDQTIDLSVSSKIQKLNKVLEETI"
     gene            <138944..>140512
                     /locus_tag="CAGL0H01419g"
                     /db_xref="GeneID:2888544"
     mRNA            <138944..>140512
                     /locus_tag="CAGL0H01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446860.1"
                     /db_xref="GeneID:2888544"
     CDS             138944..140512
                     /locus_tag="CAGL0H01419g"
                     /inference="similar to AA sequence:UniProtKB:Q06631"
                     /note="similar to uniprot|Q06631 Saccharomyces cerevisiae
                     YDR299w BFR2 involved in protein transport steps at the
                     Brefeldin A blocks"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446860.1"
                     /db_xref="GeneID:2888544"
                     /db_xref="GOA:Q6FSD4"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /translation="MGKLLADKLGKLANKPVVGDVDIEDDRVFEHRESGSDSDMDSGD
                     EELKKAHYAQVGESKLRKQLDSEKNLQELDTKYVGSVGSREDIYGENASSGSDSGSDS
                     ELEDDESDAPANDLQSNDESESVESESEESDHESGSESDNGEVLRKIVEKETRQAMNR
                     ISDLTKRDASKGYSILSQNKFFENILDTRIKLQKAMNSANVLPVTKASWKLELKEDSE
                     NKKLLEENLSMVENLLNRVINFRIDIQAKEGISTDSKLETSKKRDITDLNESTDALDK
                     DLKKYRTAVLQKWSAKVSSASGSSAMKSSKFKAVNQSADAQVENQLADTPRLIKRTCL
                     NRRNVLPINFTEDMEQGRLTKFESTSNTGENNDEDENADIPKNYDPRRKDNNAIDIST
                     NPYIFDDGDFYRVLLNDLIDKKTSSANLGVTSSATNSAIIVSKSNYKLKKNVDTKASK
                     GRKLNYSIQEPIANYEAPVSSGYKWSDEQIDEFFAGLLGQKINFNEDSEQDSESDVGD
                     EEEAIKNDDIQIFA"
     gene            complement(<140740..>142023)
                     /locus_tag="CAGL0H01441g"
                     /db_xref="GeneID:2888878"
     mRNA            complement(<140740..>142023)
                     /locus_tag="CAGL0H01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446861.1"
                     /db_xref="GeneID:2888878"
     CDS             complement(140740..142023)
                     /locus_tag="CAGL0H01441g"
                     /note="highly similar to uniprot|P32264 Saccharomyces
                     cerevisiae YDR300c PRO1 glutamate 5-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446861.1"
                     /db_xref="GeneID:2888878"
                     /db_xref="GOA:Q6FSD3"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:Q6FSD3"
                     /translation="MTETRVGGKPFTIVIKLGTSSLVDEKTKEPRLAIMSLIVETVVK
                     LRRLGHNVVIVSSGSIGVGLHILGMEKRPKHLSEVQAIAAIGQSKLIGRWDSLFAHFG
                     QSIAQILLTRNDILDWSQYRNAQNTVEELLKMGVVPIINENDTLSVQEIKFGDNDTLS
                     AITAGLIHADYLFLLTDVDCLYTADPRSDPDAKPILIVPDLSKGLPGVDTSSGSGSDV
                     GTGGMQTKLVAAELATNAGVHTIIMKSDAPSNIYKIVKYIQSLHDTGEDNKVFEGDLM
                     KLQLEEYEKLDRMGVPFHTKFLANSISRHLRNKEFWILHGLVTSGAVIIDEGAYKALT
                     RKNKAGLLPVGVIEIEGSFHEMECVDLKVGKRLPNGELDPDYPLTIVGRARCNYPSLE
                     ISKIKGQQSDEIENELGYCNSEYIAHRENMAFPPH"
     gene            <142420..>146505
                     /locus_tag="CAGL0H01463g"
                     /db_xref="GeneID:2888551"
     mRNA            <142420..>146505
                     /locus_tag="CAGL0H01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446862.1"
                     /db_xref="GeneID:2888551"
     CDS             142420..146505
                     /locus_tag="CAGL0H01463g"
                     /inference="similar to AA sequence:UniProtKB:Q06632"
                     /note="similar to uniprot|Q06632 Saccharomyces cerevisiae
                     YDR301w CFT1 pre-mRNA 3 -end processing factor CF II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446862.1"
                     /db_xref="GeneID:2888551"
                     /db_xref="GOA:Q6FSD2"
                     /db_xref="InterPro:IPR004871"
                     /translation="MNVYDDVIDPTVVSHSVCGHFTTTDYLELIVIRTDVLSIYKPIR
                     SGRLYLMEEHKLSGRINDVALIPKHSNGSNGNGINLSYLLLSTGVAKLSLLMYNNMTS
                     SIETISLHFYEDKFESATMLDLARNSQLRIEPNGNYAMLFNNDVLAILPFYTGINEDE
                     DEDYINNDKSKINDNSKKSLFKRKKGKTQNNKVTHPSIIINCSELGPQIKNIKDIQFL
                     CGFTKSTIGVLYQPQLAWCGNSQLVPLPTNYAIISLDMKFSIDATTFDKAIISEISQL
                     PSDWHTIAPTLSGSLILGVNEIAFLDNTGVLQSILTLNSYSDKVLPKVRVIDKSSHEV
                     FFNTGSKFALIPSNENERSVENILLFDENGCIFNVDLKSEGRLLTQFNITKLPLGEDV
                     LSQKSNPSSVSIIWADGRLDTYTIFIGFQSGDATMLKLNHLHSAIEVEEPTFMKDYVN
                     KQASAAYNNEDDDDDDDDFNLYSDEENDQVNNKNDRTFGTNESNEPFTAQELMELRNI
                     GPINSMCVGKVSSIEDNVKGLPNPNKQEISIVCTSGYGDGSHLNAILASVQPRVEKAL
                     KFISITKIWNLHIKGKDKFLITTDSTQSQSNIYEIDNNFSQHKQGRLRRDATTIHIAT
                     IGDNKRIVQVTTNHLYLYDLTFRRFSTIKFDYEVVHVSVMDPYVLITLSRGDIKVFEL
                     ENRNKKKFVKVPLPEILTEMVITSGLILKSNMCNEFLSGIGKSTIEQLLFTFVTADNQ
                     IIFFTKDHNDRIFQLNGIDQLQDSLYISTYQLPDEIIPDPSIKQIMINKLGNNSKDEY
                     LTILTFGGEIYQYKKSRSRHSRFYRNVGRNDHPITGAPDNAYPKGVSGIERIMHYIPN
                     FDGYSVIFVTGNTPYIIMKEDDSLPRIFPFGNIPIVSMSRWGEGSVICIDDIKNARIY
                     SLNQDNIYYGNKLPIRKIKIGSMLQNYKTLNSIVYHERTQLYLVSYTKEISYEAKAED
                     GSLLIGYKPELPNAKAFKSGVLLINPKSWEVIDELDLPDNSLVNDMKSSFIQIDTRTK
                     RKREYIIVGIGYATMEDVPPTGEFHIYDITEVVPEPGKPNTNFKLKEIFKEDIRGIVS
                     VVNGISGRFLISQSQKIMVRDVQQDNSVIPVAFLDVPVFVTSLKTFGNLIVIGDAMQG
                     IQFVGFDAEPYRMITLGSSITKFEVISVEFLVNNGDIYFLVTDRDSIMHVLKYAPDQP
                     NTLSGQRLVHCSSFNLHSLNNCTMLLPKNDEFPRDQRYSRSFQTITAQVDGSISKIVP
                     VKEETYRRLYFIQQQIIDKEPQLAGLNPRMERQDNKYYHLGHSLRPMLDFNIIKRFKD
                     MSMNRRSHIVQKLGKNSNLEVWRDLIDLEFSLRSLKPTDQN"
     gene            <146756..>147409
                     /locus_tag="CAGL0H01485g"
                     /db_xref="GeneID:2888443"
     mRNA            <146756..>147409
                     /locus_tag="CAGL0H01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446863.1"
                     /db_xref="GeneID:2888443"
     CDS             146756..147409
                     /locus_tag="CAGL0H01485g"
                     /inference="similar to AA sequence:UniProtKB:Q06636"
                     /note="similar to uniprot|Q06636 Saccharomyces cerevisiae
                     YDR302w GPI11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446863.1"
                     /db_xref="GeneID:2888443"
                     /db_xref="GOA:Q6FSD1"
                     /db_xref="InterPro:IPR009580"
                     /translation="MPVKKRTPLKHKSVSFSDDITQTQHNHHHRKKQNGERPPVFIRK
                     TWLTIPWHLIALVYIYVKVFNNYNTAELLACLVPLQILYTIFQFNKATIYGNKRLKFN
                     YSLAAISILACIVLSIPVVVIIILFGAPLLELLWETWLLALHCSFLAYPAVYSVLNCD
                     FKVGLWKRYFILIVVGCWISCVVIPLDWDRDWQAWPIPIVIGAYLGAFVGFAYGAYL"
     gene            complement(<147689..>150073)
                     /locus_tag="CAGL0H01507g"
                     /db_xref="GeneID:2888489"
     mRNA            complement(<147689..>150073)
                     /locus_tag="CAGL0H01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446864.1"
                     /db_xref="GeneID:2888489"
     CDS             complement(147689..150073)
                     /locus_tag="CAGL0H01507g"
                     /inference="similar to AA sequence:UniProtKB:Q06639"
                     /note="similar to uniprot|Q06639 Saccharomyces cerevisiae
                     YDR303c RSC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446864.1"
                     /db_xref="GeneID:2888489"
                     /db_xref="GOA:Q6FSD0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FSD0"
                     /translation="MDIRGRKMKKPPACAQCRRRKVGCDRVRPVCGNCARAGKGDCFY
                     PDVPGQYIQNNGGSPLPQNGSGRPEEISTVDQIREYNTRLQLSNMDGNELPQAPKQYI
                     PRTSTFPHNKEVPSGSSMRSNVNWVQGPAIFVDEGVNYGQDEAVLKELEFIKKRLMEL
                     KEISGRDITGINLDWTVTKPNDTIETKKNKKRKENFLTDAEFDLESGYESEFNKYRDM
                     DPSFLDDSEIFDILENCETDTHRDEIMGYLDSKCSNDLFNFNTVCCLDPFLYKQFLKR
                     IDRTVCGKYQDNLKNWKEKTITGSQYKKPTYVVKFPNKANTKEFINIFNSIVQESSSL
                     IPILNLAQLPESIEKLFSMGSTFDVTKHVLSQLFQLGEINICLLLCYQAIVSSVLINL
                     TEEMNIIFQEIKAMFSILESNIFTINSEIERRSDVENHTEYLRYTALWKFYFSISPSF
                     ADSVDYNEDVNLGISLGTSHEHSDTSNILMWNFIEKNYQYRTLFRGQIPKLTLSHPLN
                     TAFVRDPLYDIDKKLLSHHGEIISNLLSRDEKLPISRVEEIKNDLNMEISNITKHLTT
                     VAANISNVNDTILTKNLSIYLTYFLMLQYEKENDVENYKKTYLDFIMLTQETIFYIFS
                     NFANMKFTGHEFVYINKFFKVLESIAIMYLGGYERSERQYSKLSDENAKQENRFHSGL
                     CFLILQKLHMLVRDYSKNCKVVNPLATKLLSKLETIMSHRFEPVEIERKNIFESISTD
                     LLRLFNTKLYRLSESLVKKEFYEGGVKYDPNHWDTMGITENNIDAVIDTYYSCS"
     gene            complement(<150689..>151306)
                     /locus_tag="CAGL0H01529g"
                     /db_xref="GeneID:2888452"
     mRNA            complement(<150689..>151306)
                     /locus_tag="CAGL0H01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446865.1"
                     /db_xref="GeneID:2888452"
     CDS             complement(150689..151306)
                     /locus_tag="CAGL0H01529g"
                     /inference="similar to AA sequence:UniProtKB:P35176"
                     /note="similar to uniprot|P35176 Saccharomyces cerevisiae
                     YDR304c CYP5 peptidyl-prolyl cis-trans isomerase D
                     precursor of the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446865.1"
                     /db_xref="GeneID:2888452"
                     /db_xref="GOA:Q6FSC9"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC9"
                     /translation="MKLNIIWTLCLLFGIVSAAVKPEVTHKVYFDIEHDGVSKGRIVI
                     GLYGKIVPKTVENFYELSISDDSNMGYLGSIFHRVIPQFMIQGGDFTHGTGIGGKSIY
                     GSTFPDENFDLKHDRPGLLSMANRGKDTNGSQFFITTVATPWLDGRHVVFGEVLEGMD
                     VVTYIENVKTNAQNRPLKDVVIADSGELETAPLGNKPRDVPDDEL"
     gene            <151640..>152755
                     /locus_tag="CAGL0H01551g"
                     /db_xref="GeneID:2888879"
     mRNA            <151640..>152755
                     /locus_tag="CAGL0H01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446866.1"
                     /db_xref="GeneID:2888879"
     CDS             151640..152755
                     /locus_tag="CAGL0H01551g"
                     /inference="similar to AA sequence:UniProtKB:Q04430"
                     /note="similar to uniprot|Q04430 Saccharomyces cerevisiae
                     YDR531w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446866.1"
                     /db_xref="GeneID:2888879"
                     /db_xref="GOA:Q6FSC8"
                     /db_xref="InterPro:IPR004567"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC8"
                     /translation="MTLMRFKDCDYSRRLFTIAIDIGGSLIKVVYSPLDSQVIHFATV
                     ETAKVSKLLELLDDVIQEHNSGDFSSTQIVATGGGAFKYNDLIIETFPGIHSYTKFEE
                     MQGLAKGLDFFIHQVPDEVFTYSDHEGEKIVETIASSPTAKPTIYPYMLVNIGSGVSM
                     LKVDAPNVFTRVGGSSLGGGTLWGLLSLITGAQSYDEMLNWAQEGDNTTVDMLVGDIY
                     GTDYNKIGLKSTHIASSFGKVFQDRDHPMINGNSKHRIRQEEIDHLEDHAKDNHTCNE
                     CINHRNKKFKNEDICKSLLYAVSNNIGQISYLQAKIHNVQNIYFGGSYIRGHLTTMNT
                     LSYAINFWSQGSKQAFFLKHEGFLGAMGAFLDACEGK"
     gene            complement(<153035..>154114)
                     /locus_tag="CAGL0H01573g"
                     /db_xref="GeneID:2888670"
     mRNA            complement(<153035..>154114)
                     /locus_tag="CAGL0H01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446867.1"
                     /db_xref="GeneID:2888670"
     CDS             complement(153035..154114)
                     /locus_tag="CAGL0H01573g"
                     /inference="similar to AA sequence:UniProtKB:Q04431"
                     /note="similar to uniprot|Q04431 Saccharomyces cerevisiae
                     YDR532c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446867.1"
                     /db_xref="GeneID:2888670"
                     /db_xref="GOA:Q6FSC7"
                     /translation="MEAQLHELQEEITRSSDLVLTEQDKRLQGTLREIDQSIRKLIET
                     SDYLKLSGDADSLIDIKQLEVKSRELDSLMDLLRKLYWREESLDLFLKYTINSDAEQV
                     PVFSDTDPKYQSLQDEVSHLRDDVMTVKNQEIDQITGEILQVAHEITEKQDQVNMLYL
                     ETTNELDKCWELLDEWQRLQDDQRITKNEDNSNRKDTELNAMEECYEEWKTLEELAVL
                     NDNLQKQIDELEKVDNKAINSTQLAEESIVNTVQLNDLIDMWKRRIIASIHEDISEIV
                     LYPYSRKLQLRVANRYTIIIQLDKHQTHDGKSTIHDIDLFTEQDSRIIPMRELRKQVL
                     QECKGHSNILQALKNIINRVINNDN"
     gene            complement(<155153..>156436)
                     /locus_tag="CAGL0H01595g"
                     /db_xref="GeneID:2888583"
     mRNA            complement(<155153..>156436)
                     /locus_tag="CAGL0H01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446868.1"
                     /db_xref="GeneID:2888583"
     CDS             complement(155153..156436)
                     /locus_tag="CAGL0H01595g"
                     /inference="similar to AA sequence:UniProtKB:Q04418"
                     /note="similar to uniprot|Q04418 Saccharomyces cerevisiae
                     YDR527w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446868.1"
                     /db_xref="GeneID:2888583"
                     /db_xref="GOA:Q6FSC6"
                     /db_xref="InterPro:IPR013929"
                     /db_xref="InterPro:IPR013930"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC6"
                     /translation="MDLLGDIVEKDVDEVSEVGELPDGGFPKLYKPEKVSSWKARLKR
                     KQQASQTGKVNELSSSRESMRAVEESAAQRIHRENLETMRKMSPEEIARERQELLESL
                     DPKLIQKLLKNVQKSDKIFAEIEGASGTWVGGKNEAVANVDDLPPLDEDMVNRALDLN
                     ATELPKETSASLPKDDESDKQESEDQDIAPPLDDDDVAPLEFQVAQTIDHMANEDLLK
                     DVHFVAPKVDENDDDDPLDINDPEFNEKLHKKFFPNLPKEVDKLKWMEKLPEDKGIST
                     IEDVTQCRFDFKGNLVPPNRPIDNTNSGLHHHSEDQHLAGYTIIELAHLARSQFASQR
                     AIAIRTLGRILYKLGKQEYNSQLTVEVNDESEAEDATKHIYMMFWDLVKDTKVIELLE
                     LGSDEKYTKSLSIRNYAIEALWLWKQGGGNKYKNK"
     gene            <156752..>156919
                     /locus_tag="CAGL0H01611g"
                     /db_xref="GeneID:9488000"
     mRNA            <156752..>156919
                     /locus_tag="CAGL0H01611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999503.1"
                     /db_xref="GeneID:9488000"
     CDS             156752..156919
                     /locus_tag="CAGL0H01611g"
                     /inference="similar to AA sequence:UniProtKB:Q3E6R4"
                     /note="similar to uniprot|Q3E6R4 Saccharomyces cerevisiae
                     YDR524C-B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999549.1"
                     /db_xref="GeneID:9488000"
                     /db_xref="GOA:B4UN06"
                     /db_xref="UniProtKB/TrEMBL:B4UN06"
                     /translation="MNNTRLMSMSFEQNPRLRPTATGGRNTATNTRNQSLACICTVLL
                     CYIGSQSFAVL"
     gene            <157279..>158328
                     /locus_tag="CAGL0H01617g"
                     /db_xref="GeneID:2888889"
     mRNA            <157279..>158328
                     /locus_tag="CAGL0H01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446869.1"
                     /db_xref="GeneID:2888889"
     CDS             157279..158328
                     /locus_tag="CAGL0H01617g"
                     /inference="similar to AA sequence:UniProtKB:Q04412"
                     /note="similar to uniprot|Q04412 Saccharomyces cerevisiae
                     YDR524c AGE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446869.1"
                     /db_xref="GeneID:2888889"
                     /db_xref="GOA:Q6FSC5"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC5"
                     /translation="MERLNRPSELWERIRALDESNKRCCDCGSRHNVDWVSINLLCVV
                     CIQCSGVHRSLGSHISKVRSLNMDDLHSNRELKYLLVNHLINRNVNSVYEARIPAGIK
                     IRKDAQPADRARYIVDKYMHKKYVERTMQATLTNSQMANDKDIRDTEIEDLVRHIRAK
                     SILGLQRSLAMSKHTLKDLCLHYGIRSPTLFQLSLEQFEATSSGTLVYYISEYLLLNG
                     LLIDDQRAVGKTKLDVSPGALEYWTSRQNMYDTYANAMMQNNGETNGGSNGLARDRTK
                     NGRMSNGLPRRANTQNDGKRRLYLDTQSSAFDNNRSSGPFSATSNKKRWSLASPTSIL
                     SIHKSLSRRDSHKKS"
     gene            <158967..>160532
                     /locus_tag="CAGL0H01639g"
                     /db_xref="GeneID:2888845"
     mRNA            <158967..>160532
                     /locus_tag="CAGL0H01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446870.1"
                     /db_xref="GeneID:2888845"
     CDS             158967..160532
                     /locus_tag="CAGL0H01639g"
                     /inference="similar to AA sequence:UniProtKB:P08458"
                     /note="similar to uniprot|P08458 Saccharomyces cerevisiae
                     YDR523c SPS1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446870.1"
                     /db_xref="GeneID:2888845"
                     /db_xref="GOA:Q6FSC4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC4"
                     /translation="MSKRFVIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLENSEEE
                     VELLAQEIFFLAELKSPYVTNYIATVVEDVSMWIAMEYCGGGSVGDLLKYHYTSGLPE
                     HKTRFITREILKGLSYLHSQRKIHRDIKAANILLTDEGKVKLSDFGVSGKLLSSFRRD
                     TFVGTPYWMAPEIVAHDSEGYDERADIWSLGITVIEMLRGSPPLSKYDPMKVIANLPK
                     RKPPKLHGDFSDDAKHFVALCLIKESAIRPTAADLLTTRFTTNTRVENLKDDVDLIKH
                     VKLKINRHSKSPKFPLEVKIYEDGTDCASANYWDFDTSGLSVVPATASVDNSFASNEA
                     SRIDETTEYHTGKGELVSAMTGSPISNNMISPYQDSYKSTVTPITPMPLGESFRKYSA
                     PVKQQPAYDIGSGMEIDQQTCLDGEPHSSTDKVAHEDYKKSVDHKVNVKNTTISIVGF
                     DYYRNVIHHSFKRMEDRAHDKRTKEVVLEILKHFAAVETTIPGFSEVFIEEISLRLEA
                     LRDYYEKHKSQLA"
     gene            <160886..>162262
                     /locus_tag="CAGL0H01661g"
                     /db_xref="GeneID:2888686"
     mRNA            <160886..>162262
                     /locus_tag="CAGL0H01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446871.1"
                     /db_xref="GeneID:2888686"
     CDS             160886..162262
                     /locus_tag="CAGL0H01661g"
                     /inference="similar to AA sequence:UniProtKB:P08459"
                     /note="similar to uniprot|P08459 Saccharomyces cerevisiae
                     YDR522c SPS2 sporulation-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446871.1"
                     /db_xref="GeneID:2888686"
                     /db_xref="GOA:Q6FSC3"
                     /db_xref="InterPro:IPR000494"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC3"
                     /translation="MHCKSPNMKLALHWYFVLSFILSAIVAYENFVIMEEKKLLPFVK
                     LVRDNYTVELIPDDITLTDEQTADQCKESSITVNSPEELFYLQRRCDILEGNLIIGTD
                     YQERIIDLGFIKEIKGDLVLDGNANIFRLVGENLNTIGGTFTLRGTMSLVAIIFPVLR
                     RINIIDWQVVPVLDHLELGSNLEGLQQLIISDSSISDLNVFKGVQELDIFNINNNRFL
                     EIINSDLKRVSKQLRIHANADELVINMSQLESVDNITIRDAAGINLPELTYVNSSMEI
                     IENFCSDLILPKLKRVDGTLGIIGNPSLQNVSYQNLRVIQGGLMIANNSELTNLDFFP
                     NLKQIGGAIHFDGNFITANMPKLKLVKGSAFIRSTADYFDCKRWFTPVNGRAIVRGGK
                     LKCIANERESTIRIGDDGSLIDNDDSPQYDDSPENKDRQENSAMLRSKIRGLLPLTTL
                     LSMYLILF"
     gene            <162753..>164852
                     /locus_tag="CAGL0H01683g"
                     /db_xref="GeneID:2888869"
     mRNA            <162753..>164852
                     /locus_tag="CAGL0H01683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446872.1"
                     /db_xref="GeneID:2888869"
     CDS             162753..164852
                     /locus_tag="CAGL0H01683g"
                     /inference="similar to AA sequence:UniProtKB:Q04411"
                     /note="similar to uniprot|Q04411 Saccharomyces cerevisiae
                     YDR520c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446872.1"
                     /db_xref="GeneID:2888869"
                     /db_xref="GOA:Q6FSC2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC2"
                     /translation="MEVENANNGMNAGVTESVTHTQEDSKAPKENGSKNDNEDKKPRR
                     KKRKTSSCDVCRRFKTRCDFDVMYGKCYRCKVLNLECSLTMERQTEINKTQKLGVNAL
                     LNNDDSKDLKPMNIDEITMKVRDMDYNYGVLNHKLDLILNMLQKSHNEGRLPSGNDKQ
                     GKLVPFTSVYDDIRPSNDGYRIHEPPLKLINDLDARLFPLDALTQKAKMEREQRPSAV
                     ARVKFLDFYKKHQELCHQLSKEFLMRSHFWIIPGGIKEIDETYANKHLFITSVFTIIA
                     MSFADNDKYAQQQEELYPLVERLLTNTLTMFEKLTDYDIEAILYCSMFNISRKAKRYR
                     QLKYNSLVLSNFALYSLLNIVDFHRIKERVNAAEFDMKDLYHLRILNSLTACHLEYSI
                     SSGQIWEQNSAIKEFNNLVVKFPQANFADDIKVSEINLNVVVNAIFMNFKTYFHRYLY
                     KYSDNSTVQEKQLLLFDELELWLKDWEELLAKDGAGVLLFTYDFYHIMICRSFITDNK
                     DEVSKYPDFLDNVLYTMKEHAFSLLRGFLRLPPSLIKGAPIFTTYELVYACLSLCDYI
                     HLFDQPERQQVLSTCTRVYWHLSTIGEKMNEATDNVGTIIKSIIDTSKQSVSKTQDMA
                     THNNHSSMRDSMASSGSKLQTSPRQHNNTLSDTKSSGMQLPDVDQYNSFEEFFQGFFN
                     NLKPSTQQIFESSKQTK"
     gene            complement(<165115..>165525)
                     /locus_tag="CAGL0H01705g"
                     /db_xref="GeneID:2888506"
     mRNA            complement(<165115..>165525)
                     /locus_tag="CAGL0H01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446873.1"
                     /db_xref="GeneID:2888506"
     CDS             complement(165115..165525)
                     /locus_tag="CAGL0H01705g"
                     /inference="similar to AA sequence:UniProtKB:P32472"
                     /note="similar to uniprot|P32472 Saccharomyces cerevisiae
                     YDR519w FKB2 FK506/rapamycin-binding protein of the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446873.1"
                     /db_xref="GeneID:2888506"
                     /db_xref="GOA:Q6FSC1"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /translation="MLSQIWILFTFMVCVIASKSKSDGLKFEITKKIPISKCKLKALP
                     GDMVSVHYTGSLAENGKVFDSSLRRNEPIQFKLGAGQVIAGWEQGITGMCLGEKRTLH
                     IPPELAYGSRGAGGVIPPNAVLDFDVELVDIARN"
     gene            complement(<165968..>167569)
                     /locus_tag="CAGL0H01727g"
                     /db_xref="GeneID:2888494"
     mRNA            complement(<165968..>167569)
                     /locus_tag="CAGL0H01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446874.1"
                     /db_xref="GeneID:2888494"
     CDS             complement(165968..167569)
                     /locus_tag="CAGL0H01727g"
                     /inference="similar to AA sequence:UniProtKB:P32474"
                     /note="similar to uniprot|P32474 Saccharomyces cerevisiae
                     YDR518w EUG1 protein disulfide isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446874.1"
                     /db_xref="GeneID:2888494"
                     /db_xref="GOA:Q6FSC0"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6FSC0"
                     /translation="MVSVKSLALAIGVASAIQLPDAIAPDSSNIIKANISQFATHVKE
                     NPIVMVEFFTPWCTHSKMLQPRLSEAATIVKGVKIPILQVDCTQYGVLCDQQMIDFYP
                     TLKVYKNHRLVGAENYKGSQAGNEIANYLLNLKNNPVTNITSAQEVEKMKSETDMPIV
                     HNRGNLEIDEILRSVALDMSEKFAFIRDTVASENGTLEMYFPGTNRTAVYDGPQPPTE
                     ESISIWMHMENLPFFADIEAADFKNYMATKLPIAYFYYSTPQELNDFTGLFNELGEKY
                     RGKLNFVGMNPHKFQEHLKLLNLKQRFPLFVIHNVNNNLKYTLDQFTDESDKVMKKLE
                     SEDIKKLVEDFVEGKAQPIIKSEPIPKTQDSVLYKLVAKTHNDFVYNNDKDVFVKYYA
                     PWCQHSKAFRPVLEEIAELFGSNPETKEKIVFAEVDSTANDIIDFPVAGYPTLVLYRA
                     GSKPGSQPIIFEGKRSLENVLDFIKSHSTSNLDGQALLEKQKQDEAKAIEDAQAAEAA
                     EAVNAQAQAANADQKAFNNEIKDEL"
     gene            complement(<168305..>168634)
                     /locus_tag="CAGL0H01749g"
                     /db_xref="GeneID:2888862"
     mRNA            complement(<168305..>168634)
                     /locus_tag="CAGL0H01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446875.1"
                     /db_xref="GeneID:2888862"
     CDS             complement(168305..168634)
                     /locus_tag="CAGL0H01749g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446875.1"
                     /db_xref="GeneID:2888862"
                     /db_xref="GOA:Q6FSB9"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB9"
                     /translation="MFASGYDRMQHAVEPITATVEPVPMVDAVQKTDKPVPQEEARQE
                     INSDAIASRSQDSLVSNTISTKNIQVRDTSLSALVKNAQQYKGALDKRNEEIKKRKRE
                     QKQRYGW"
     gene            <168840..>170054
                     /locus_tag="CAGL0H01771g"
                     /db_xref="GeneID:2888688"
     mRNA            <168840..>170054
                     /locus_tag="CAGL0H01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446876.1"
                     /db_xref="GeneID:2888688"
     CDS             168840..170054
                     /locus_tag="CAGL0H01771g"
                     /inference="similar to AA sequence:UniProtKB:P40354"
                     /note="similar to uniprot|P40354 Saccharomyces cerevisiae
                     YJR062c NTA1 amino-terminal amidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446876.1"
                     /db_xref="GeneID:2888688"
                     /db_xref="GOA:Q6FSB8"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB8"
                     /translation="MKLKVSLRIVSVQLNSQIGQIDETLRRTTVLIDRLKQEVEGQKP
                     PDLVVFPEFALTGYNFKNRSHILPYVCKAGEGPSFELAKRVSKLFGCYTVIGYPEKCE
                     QKLYNSAIVTGPDGSVHFNYRKAFLYETDEQWGCEENPKGFEQFKMKFRARPIDQDSA
                     ELSPVDIDLNTSIGICMDLSPYRFEAPFQDMEFSSFNLEKGTELIICPMAWLHSRSIT
                     EHTDSEKITPKDIECLLSEQGLSIFGSQGQYQFDFDNRATTKPVSQDITDINRDNPVY
                     SNLDEPDMSNINYWLLRFLPFLSLDVRRNWFQSFADQLLPLKNSYMGMTPKHPWGFAG
                     KNAALVIANRCGVEDCKTIFAGSSGIFKFNGSEDKDNNTDSTNQSVKLFGNLGKGYEG
                     LLMRDIDLMIDR"
     gene            complement(<170210..>173017)
                     /locus_tag="CAGL0H01793g"
                     /db_xref="GeneID:2888451"
     mRNA            complement(<170210..>173017)
                     /locus_tag="CAGL0H01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446877.1"
                     /db_xref="GeneID:2888451"
     CDS             complement(170210..173017)
                     /locus_tag="CAGL0H01793g"
                     /inference="similar to AA sequence:UniProtKB:P40355"
                     /note="similar to uniprot|P40355 Saccharomyces cerevisiae
                     YJR061w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446877.1"
                     /db_xref="GeneID:2888451"
                     /db_xref="GOA:Q6FSB7"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB7"
                     /translation="MLNNAGYSKDKMRDTEKYPINTVYDRHEHSIIHSLPAVKRIKLW
                     LRFILKRLIVLLLLIQAFLTIRVWLDPEGEHIQYIHHFIKHHEPNKSINPSKLYEKMM
                     FNTEMIWPDEYSYKNNLLTVQIGQNKGQILQSIDDLKFYDNDPRLIWSVLLDYLSKEG
                     PDQIPFSWYDWSDYQQYNRILALSDEVKSRVNCAVMYSPGFDKQLLLDIEAEINEPLF
                     QVNRHRYSEQYWYKVLARKAKFINLVDYCSDGITSRFDLPVNIKKPQAHATPEQYEFQ
                     NKAFMMRSKLHMPFSLTILNKDRSFFQVPISTDINPQNIIESELLAKFIEKNKVNEDD
                     QDLVFNHTILFDQFLESKSNEKYKLKNPELTDRIHDELLVHVKENDFIFDPLERIAYL
                     EKEEHLTTHQRKYLESLKYSITVDPLLQKKHFNEARDLLLYSKSGSHRDARFFYNSFN
                     PDIDGIEYQMKMNSLIRNFLKFTKANGLITWLSHGTLFSHLYNGLTFPWDDDFDLQMP
                     IRHLNMLAEHFNQSLILEDPREGNGRFLLDVSSTITIRTNGNGNNNIDARFIDVDSGI
                     YIDITGLSVSSQYTPKYAENYIVDRPNDKSKSSELEYHNYEPFKYGFNQDNFDDLSTR
                     VRNNEILSMEEKDTLLKLAASESQRKRKNKRFVDEELSSEQRFTNHLEKKLYNCRNGH
                     FISFDSLSPLYNSIYHGQSALIPRKPIQHLEHEYKLTKTYGFLTFEGNIYLPGMKLWY
                     SFKDIRNIIRLAVDQSVPIPTNLHQLRGIDHYFLLKAFLIQNMHDAIAITHNTFEATS
                     FRLKELEIMFDRNLSFERIVDAFKVFRREKGRNIMNPFKDPTLFSYEKRLFNKLVKDK
                     DVLAIAKIKENVCSKLILRTWHSIQEILEKRYNGFEVIVNDNEPHNLNYAGLNYENDE
                     NLSNYPVFESDSDLIENIIVQ"
     gene            complement(<174644..>175972)
                     /locus_tag="CAGL0H01815g"
                     /db_xref="GeneID:2888870"
     mRNA            complement(<174644..>175972)
                     /locus_tag="CAGL0H01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446878.1"
                     /db_xref="GeneID:2888870"
     CDS             complement(174644..175972)
                     /locus_tag="CAGL0H01815g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446878.1"
                     /db_xref="GeneID:2888870"
                     /db_xref="GOA:Q6FSB6"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB6"
                     /translation="MERSNRSRKSRRQEVSEDILERELKQYVNSSERMHESDAVERSP
                     KRRKGSHREVDIETTVHTTVHYDEKEEVNGSDLNDDEQRRAIEGAASEDETHAVEGEH
                     EDEDERENHVNDHDDNRDPNVDDELHRADADHQEHDEEDRDEDQHQHQHQEQEQEQEQ
                     GHEPEHEQEQEAEHEQEPEQEQGQEPEEEHGHEHDHEENMESIREIANDSGDAAAAVS
                     TIRIHYQDLSGNSRGDTTINVGPENPELYASLSSRSDVKTENKKKRGKQTKGDESIQD
                     WRKIRKESHKEVERRRRETINLAIDNLRKLLPKPEYSKAGILNSAAALIQKLKESESS
                     QMNKWAIQRIVTEQTKTAHQKSNEKLAAALDDAYQELTRLKSILKENNIKYEDKFVIP
                     EDTLREAKELESELNRAQEEIDQIDPRASAEPEEEEEERDEEAGEDESKE"
     gene            complement(<176352..>178736)
                     /locus_tag="CAGL0H01837g"
                     /db_xref="GeneID:2888883"
     mRNA            complement(<176352..>178736)
                     /locus_tag="CAGL0H01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446879.1"
                     /db_xref="GeneID:2888883"
     CDS             complement(176352..178736)
                     /locus_tag="CAGL0H01837g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446879.1"
                     /db_xref="GeneID:2888883"
                     /db_xref="GOA:Q6FSB5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB5"
                     /translation="MTNINDKEEVHHSPSVMTLKKFGRKLMNHPQVSSGKPVLDAQGE
                     PIRPLSKRSTSPTGKTLVRNSSRSPSRARSSSLSKKVPARATEANFTRGPVSSAKSSV
                     ALNELIKHSHNPYVITEEHSQRAPNQLQRKPSAGGGSGIAGRREAHTHHGNKPASMAG
                     HANQGHSLSRNPSKSGLHADANMVYNPYGMNPNLRRPDTAYIDTLKENAGDLSFYMHD
                     GNEKIRMLPLPIEDPNKFLPEEMQQFSINLADNFVFDAANKPIGSGGSSEVRKVKSAY
                     KAKDVYALKKLNMIYHETPEKFYKRCSKEFIIAKSLSKNIHIIKTFYLLKVPTTTYTT
                     RGWGFIMEYGVKDLFELMARSGWRNVPLEEKYCLFKQVAEGIKFCHDNGIAHRDLKPE
                     NVLLSKDGVCKLTDFGISDWYRKDPNDPNSPLKTTEGMIGSPPYTPPEVMYWDAKKHY
                     AESLKKPYDPLKMDPYALGIMLITMVNNIIPFLDSCNTDLRFREYETSYENFIAHGNP
                     AFRQKGVYKPGPGSEYSLAKQFRNTEASRVAWRLADPKPETRYTMEDLFNDPWFQNIK
                     TCVYPDDAYTVTEPELRKATTQEGLVYANQLYAKDTIETAAGTVGATFEDASDTIPVH
                     TGNHGASTGTEKTHEEGCNASSPKPRSMVEIAEHPVLHKEKPTEHHGKVTFSMDDDND
                     NDNDKDNEEEPKENKLDAMIESPAPTKAQQSPKAQDATRTTSTLRTPEIHVEPQVQRG
                     SPVSSMASRSTTASPPHKEMSELSVSKKRVVHNHFDIPHSSVNTHPSMVSLFSK"
     gene            <179000..>179443
                     /locus_tag="CAGL0H01859g"
                     /db_xref="GeneID:2888641"
     mRNA            <179000..>179443
                     /locus_tag="CAGL0H01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446880.1"
                     /db_xref="GeneID:2888641"
     CDS             179000..179443
                     /locus_tag="CAGL0H01859g"
                     /note="highly similar to uniprot|Q00381 Saccharomyces
                     cerevisiae YJR058c APS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446880.1"
                     /db_xref="GeneID:2888641"
                     /db_xref="GOA:Q6FSB4"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB4"
                     /translation="MAIQFILCFNKQGVVRLLRWYEKVPAGHERTQDVIAQIYRLISS
                     RDHRHQSNFVEFSERTKLVYKRYAGLYFVFGVDLKDEESIYLSHIHLFVEVLDAFFGN
                     VCELDIVFNFYKAYMVMDEMFLGGEVQEVSKDALFERLSALDRLE"
     gene            complement(<179511..>180167)
                     /locus_tag="CAGL0H01881g"
                     /db_xref="GeneID:2888492"
     mRNA            complement(<179511..>180167)
                     /locus_tag="CAGL0H01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446881.1"
                     /db_xref="GeneID:2888492"
     CDS             complement(179511..180167)
                     /locus_tag="CAGL0H01881g"
                     /inference="similar to AA sequence:UniProtKB:P00572"
                     /note="similar to uniprot|P00572 Saccharomyces cerevisiae
                     YJR057w CDC8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446881.1"
                     /db_xref="GeneID:2888492"
                     /db_xref="GOA:Q6FSB3"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB3"
                     /translation="MREMRGKLILIEGLDRTGKTTQVDALAERLRGCGLKVVAAKFPN
                     RESEIGQLINRYLTNRDFQLPDQAVHLLFSANRWEYIEELKQQLNDGYCVVLDRYVFS
                     GVAYSAAKGTPGMDLQWCLQPDKGLLKPDLTLFLTNEDRESIANRAGFGEERYEDSDF
                     QLKVKQKFHEAFHAYCQEGELRTVNVTGKGIEQVSAEIWDVIEPLLHETRATNEFKYF
                     "
     gene            180340..180427
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0H01903r"
                     /db_xref="GeneID:2888446"
     tRNA            join(180340..180379,180391..180427)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0H01903r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2888446"
     gene            <180615..>181229
                     /locus_tag="CAGL0H01947g"
                     /db_xref="GeneID:2888899"
     mRNA            <180615..>181229
                     /locus_tag="CAGL0H01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446882.1"
                     /db_xref="GeneID:2888899"
     CDS             180615..181229
                     /locus_tag="CAGL0H01947g"
                     /inference="similar to AA sequence:UniProtKB:P47115"
                     /note="similar to uniprot|P47115 Saccharomyces cerevisiae
                     YJR056c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446882.1"
                     /db_xref="GeneID:2888899"
                     /db_xref="GOA:Q6FSB2"
                     /db_xref="InterPro:IPR029196"
                     /db_xref="UniProtKB/TrEMBL:Q6FSB2"
                     /translation="MERLNSLERSLPPEQPPTEKAIATLNSELSQEFKLAANSVTKLY
                     RLANERASLVRHQGYLDCVEDVLSLIDGSTGSNGSNGSKEPTVEDIREWCLKRRQEML
                     SSKDGRVDSHRSDGRGGQGRVAPKVDFHLQKSFLGKTEVPQGGKIEVPTFKLGKPPLS
                     VEHHARPGRRRQLNTPAATNTTFTSTPNNENSEMHESVPKKPKL"
     gene            181552..181623
                     /locus_tag="CAGL0H01969r"
                     /db_xref="GeneID:2888875"
     tRNA            181552..181623
                     /locus_tag="CAGL0H01969r"
                     /product="tRNA-Asp"
                     /note="tRNA Asp (GTC) cove score=60.99"
                     /db_xref="GeneID:2888875"
     gene            181861..181963
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0H01991r"
                     /db_xref="GeneID:2888877"
     tRNA            join(181861..181898,181918..181963)
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0H01991r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2888877"
     gene            <182137..>182961
                     /locus_tag="CAGL0H02035g"
                     /db_xref="GeneID:2888625"
     mRNA            <182137..>182961
                     /locus_tag="CAGL0H02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446883.1"
                     /db_xref="GeneID:2888625"
     CDS             182137..182961
                     /locus_tag="CAGL0H02035g"
                     /inference="similar to AA sequence:UniProtKB:P38806"
                     /note="similar to uniprot|P38806 Saccharomyces cerevisiae
                     YHR090c YNG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446883.1"
                     /db_xref="GeneID:2888625"
                     /db_xref="GOA:Q6FSB1"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /translation="MDPSLLLDQMLQDVSNLPAEFRYMLEEVGLEDEQCLELRKRYQQ
                     KEGILHKYIKQNGSLAANPKEDELLAEVEQSMAQVRELQEEKCQRANTILFLVSRHLN
                     KLQQNIIMLEEDGLLAPAEDEMESGPDFSRESSVVGSTVSERKRKAASEDHPRRKKQS
                     RSMSNTHREKSYNKGDDTADVKSPASTEREGTLDLQNYQEELFSSMNDNEKEDQNLYC
                     FCQRVSFGEMVACDGPNCKYEWFHYECVNLTEPPKGTWYCPDCKQEMSKKLKKKKQ"
     gene            <183306..>183974
                     /locus_tag="CAGL0H02057g"
                     /db_xref="GeneID:2888567"
     mRNA            <183306..>183974
                     /locus_tag="CAGL0H02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446884.1"
                     /db_xref="GeneID:2888567"
     CDS             183306..183974
                     /locus_tag="CAGL0H02057g"
                     /inference="similar to AA sequence:UniProtKB:P28007"
                     /note="similar to uniprot|P28007 Saccharomyces cerevisiae
                     YHR089c GAR1 nucleolar rRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446884.1"
                     /db_xref="GeneID:2888567"
                     /db_xref="GOA:Q6FSB0"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /translation="MSFRGGFRGGRGGSRGGFGGRGGARGGRPIQQGPPDTVLEMGEF
                     MHPCEGDVVCRSINTKVPYFNAPIYLENKTQVGKVDEILGPLNEVYFTIKCGEGVQAT
                     SFKEGDKFYIAPDKLLPIERFIPKPKVAGPPKPKNKKKRSGAPAGRGGARGGFGGRGG
                     SRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGRGGSRGGFGGR
                     GGRS"
     gene            complement(<184473..>185357)
                     /locus_tag="CAGL0H02079g"
                     /db_xref="GeneID:2888873"
     mRNA            complement(<184473..>185357)
                     /locus_tag="CAGL0H02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446885.1"
                     /db_xref="GeneID:2888873"
     CDS             complement(184473..185357)
                     /locus_tag="CAGL0H02079g"
                     /note="highly similar to uniprot|P38805 Saccharomyces
                     cerevisiae YHR088w RPF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446885.1"
                     /db_xref="GeneID:2888873"
                     /db_xref="GOA:Q6FSA9"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA9"
                     /translation="MAPEEIKIKNKLKRQELFAQIKDQKNKERHKMRHARSKEERENP
                     ELKEKRLKENVTKTIDNMRVYDETIGKEIEGDEDDLMKFFNSSSNEPPKILLTTNVNA
                     KKSAYEFANILIEILPNVTFIKRKFGITLKEMTDICIKRNFTDIVIINENKKKVTGLT
                     FMHLPEGPSFYFKISSFVEVKKIVGHGKPTSHIPELILNNFQTRLGKTVGRLFQSIFP
                     KNPDFEGRQVITLHNQRDYIFFRRHRYVFRNEEKVGLQELGPQFTMKLRRVQRGIKEE
                     TEWEHRPEMDKEKKKFYL"
     gene            complement(<186150..>186539)
                     /locus_tag="CAGL0H02101g"
                     /db_xref="GeneID:2888701"
     mRNA            complement(<186150..>186539)
                     /locus_tag="CAGL0H02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446886.1"
                     /db_xref="GeneID:2888701"
     CDS             complement(186150..186539)
                     /locus_tag="CAGL0H02101g"
                     /inference="similar to AA sequence:UniProtKB:P38804"
                     /note="similar to uniprot|P38804 Saccharomyces cerevisiae
                     YHR087w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446886.1"
                     /db_xref="GeneID:2888701"
                     /db_xref="GOA:Q6FSA8"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA8"
                     /translation="MSLNELFHGNQHDDTKKKPRRNSSTEVLQYFYKGKETDLVIYVT
                     SQAAADDYLASPSPSKLANVVEVFKVFTNLDGKGATGTFGEASKAQLENEFGKGKKVE
                     EVIGLILKEGVPNGKTNRVKTEGNFQK"
     gene            complement(<188454..>190121)
                     /locus_tag="CAGL0H02123g"
                     /db_xref="GeneID:2888450"
     mRNA            complement(<188454..>190121)
                     /locus_tag="CAGL0H02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446887.1"
                     /db_xref="GeneID:2888450"
     CDS             complement(188454..190121)
                     /locus_tag="CAGL0H02123g"
                     /inference="similar to AA sequence:UniProtKB:Q00539"
                     /note="similar to uniprot|Q00539 Saccharomyces cerevisiae
                     YHR086w NAM8 meiotic recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446887.1"
                     /db_xref="GeneID:2888450"
                     /db_xref="GOA:Q6FSA7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA7"
                     /translation="MSYNRYMEDAYRYGSAAGTMGASAAGAQMSPVSVSPMSMNAGMN
                     TGMNTGMNTGMNTGMNTGMNTGMNGGMNGGMSTGASTPGSQLYMGDLDPSWDEAVVKG
                     IWAALGEENIGVRMMWGGDADFHRKNLGYCFVEFPSPAHASNALMKNGMEIPGFVHKK
                     LKLNWSAQSVNNGSGASVANGAVANQQTNNSIFVGDLAPSVTEAQLFDLFINKYPSTV
                     HAKVMYDQLTGISKGYGFVKFKSSMDQQRALVEMQGCFLNGRAIKIGIAGGNNNNNSN
                     SNYNNQRMANDNISNGLGQQSRSLNGQLPQQFVNATPQQPVLNHFTDPNNTTVFVGGL
                     SPLVTEDELRSYFEPFGTIIYVKIPAGKGCGFVQYVERSSAETAITKMQGFPIANSRV
                     RLSWGRSAKKTALIQKALLRSRETNYQQQLPQQGQPLQSQLQLQQQQQQQQQQLQQQQ
                     PLLYGYSPVNLNNGSGLSTSQNMLSDIYQPEEQNLNGYDLLPGRENLNYVNVLPSRDL
                     YAYNQIGNQPIVNNGMPNLSVTNDLSVNNTTAALERLNSGTASFSFV"
     gene            complement(<190804..>192690)
                     /locus_tag="CAGL0H02145g"
                     /db_xref="GeneID:2888874"
     mRNA            complement(<190804..>192690)
                     /locus_tag="CAGL0H02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446888.1"
                     /db_xref="GeneID:2888874"
     CDS             complement(190804..192690)
                     /locus_tag="CAGL0H02145g"
                     /note="weakly similar to uniprot|P13574 Saccharomyces
                     cerevisiae YHR084w STE12 transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446888.1"
                     /db_xref="GeneID:2888874"
                     /db_xref="GOA:Q6FSA6"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA6"
                     /translation="MMASDDRAVIGNALKSIDELTYFLATAPVNWQPGQVIRRYFLNE
                     ELGYISCVFWDNIFYITGTDIIKICIYKMLLFGRVVLQKKKFEEGIFSDLRCLKIGEH
                     ASLEQPKSPFLDFLYKNMCVKTQKKQKVFYWFSVPHDKLISDALERDLKRESNGMNQL
                     ITTRAVREPALTFKYNRSIAGSVFQQARNYFVLRSRIIFSDVFSTPIDVNRAPNSNQR
                     VTGNPNDLGVNLSSSQDTVETSSQKYAASNQSYSSVHTPIPSSDTTPHTQHADLRNMK
                     PSNDRAVSKTSQVPPKDNETVNISKQQFMPALIDPTTGFFEGVQYYISNMGSKEYMCK
                     QRNTPAVNLNADIKQSSPDNLIEKEEDPHASIQVEGPLRCSCGYSARNTGRSTASSSS
                     SDNSALQSTDDGSDPGILQSRPPPPPSPPPPQFKPEQDPDRGSPTNSASRMGTQVEQK
                     DSFHEYTTSSNEETIRSGVSVAHTQRSGSQFDDGLASAETYDKDDYNIAGRTSGSDHD
                     DYDNHSIESALDIVLPAGTEGNTSSMISTDDEFYSTFMEPFDASKYFLSPMDRMRSGF
                     LISPQSMQPDITFAQDEEQKSQHQLQQHQHPNTHPPQLQHQLQHQRRPRTLRQGKYLK
                     KSIR"
     gene            complement(<196897..>197907)
                     /locus_tag="CAGL0H02167g"
                     /db_xref="GeneID:2888560"
     mRNA            complement(<196897..>197907)
                     /locus_tag="CAGL0H02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446889.1"
                     /db_xref="GeneID:2888560"
     CDS             complement(196897..197907)
                     /locus_tag="CAGL0H02167g"
                     /note="weakly similar to uniprot|P14693 Saccharomyces
                     cerevisiae YHR083w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446889.1"
                     /db_xref="GeneID:2888560"
                     /db_xref="GOA:Q6FSA5"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA5"
                     /translation="MSSTTMKVPTPVKWVFDRFPVVQYQTIPQSKAIAYSDTVNRCFE
                     FRDVKSSMHNPEYDGGNSKNDNSGNDNFQLGVYSVHGFEIGGTDVMLARDPLCLYAQL
                     SLCKKNNLRLPTKFEEGNNEKKNQPKLDAESTLDSHFTTDVAGIRKPGNKVVILSEKA
                     HKDERLPILIETTMNGQSKNIKRYVRSMDSIMIILDSKLESAELAIGNLLDTTVYDAF
                     LLCTIHNNLVYETYGCSPDTLHTLSKRNRFFTRHPQISSLSLGQIYTPSPSDLEKQLA
                     MAKDILLLLQSTHDKFSDYLRLKVASYVLALLHLPSFGEFLRAECSKLLDDSTTIVKD
                     FV"
     gene            complement(<199107..>199700)
                     /locus_tag="CAGL0H02189g"
                     /db_xref="GeneID:2888639"
     mRNA            complement(<199107..>199700)
                     /locus_tag="CAGL0H02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446890.1"
                     /db_xref="GeneID:2888639"
     CDS             complement(199107..199700)
                     /locus_tag="CAGL0H02189g"
                     /note="weakly similar to uniprot|Q03525 Saccharomyces
                     cerevisiae YMR269w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446890.1"
                     /db_xref="GeneID:2888639"
                     /db_xref="GOA:Q6FSA4"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA4"
                     /translation="MDGKSYLKSYGWQEGEGLRKGSLKKPILVKHKRDKKGLGGAVGH
                     NDGEAWWERLFDGQLKNLDVSTDSNSDGEIVFKQNSVVASGVPKSSSPLYQWFVKGTG
                     LKGTIDEKPDLKESKTVTVVSDSFKVSKKRKYDEDYKVSKKHKKDKKAKKDKKAKKDK
                     KAKKDKKDKKDKKDKKDKKDKKDKKDKKAKSKSKGGN"
     gene            <200049..>201194
                     /locus_tag="CAGL0H02211g"
                     /db_xref="GeneID:2888872"
     mRNA            <200049..>201194
                     /locus_tag="CAGL0H02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446891.1"
                     /db_xref="GeneID:2888872"
     CDS             200049..201194
                     /locus_tag="CAGL0H02211g"
                     /inference="similar to AA sequence:UniProtKB:P49960"
                     /note="similar to uniprot|P49960 Saccharomyces cerevisiae
                     YMR268c PRP24 pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446891.1"
                     /db_xref="GeneID:2888872"
                     /db_xref="GOA:Q6FSA3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA3"
                     /translation="MGTQHGNHSGPKRSPKRIRERCTVLVENVPKSYNQGKIKKFFKD
                     CGDVLQVNSYESWREGNRCQMARVEFADEDGARSALTRTLRNMGSNTIEVNELKDSTV
                     WMTNYPPTFQQRDIRNIFKDHKIVALNVRLPSLRFNSNRRFAYVDLPNMESLDKAIQL
                     LNGKDINGYKLVVKKSNPENRDKRSDAPVLERREIIIRNLPKTMLVKDTLLDIFKKYG
                     AIDDLRIPKKQLEMLSDLNHGCAFVVYTNPEDAKSALEMNNHVIDDIKISVNLSDSHA
                     YLERKEVNRIINSKHTEKYAAIYPISDKTSKEQIRNFINDKNAVLVEELKNIYLVTDY
                     KAVFLKFERESTAAKAMLQLNNSTFDRKTIKCTTIRELMNFSSVNTN"
     gene            complement(<201264..>202160)
                     /locus_tag="CAGL0H02233g"
                     /db_xref="GeneID:2888876"
     mRNA            complement(<201264..>202160)
                     /locus_tag="CAGL0H02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446892.1"
                     /db_xref="GeneID:2888876"
     CDS             complement(201264..202160)
                     /locus_tag="CAGL0H02233g"
                     /inference="similar to AA sequence:UniProtKB:P28239"
                     /note="similar to uniprot|P28239 Saccharomyces cerevisiae
                     YMR267w PPA2 inorganic pyrophosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446892.1"
                     /db_xref="GeneID:2888876"
                     /db_xref="GOA:Q6FSA2"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA2"
                     /translation="MQCYKMAFKKLALINQCRRAYGSIRQGSKYSTTYRQYLKLEDGS
                     VGSYFHDVPIGIQKDKCYVNMVVEVPRWSSGKFEISKELKLNPITQDVKKGKVRFVNN
                     IFPYHGYIHNYGAIPQTWENVTSSSSLPGVKEPLFGDNDPLDCCDIGSTVLKMGDIKT
                     VKVLGSLALVDDGELDWKIMVINTEDPMHEKINNLADVEKYCPGLLDATRYWFKNYKV
                     PTGKPVNEFAFNGEFQDYDKTMKTIEQCHQEWKGLVAGKISASPNILLPTTERKGTSI
                     SVKDDRLPDTPVPDHVNKWYYV"
     gene            complement(<202569..>205325)
                     /locus_tag="CAGL0H02255g"
                     /db_xref="GeneID:2888909"
     mRNA            complement(<202569..>205325)
                     /locus_tag="CAGL0H02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446893.1"
                     /db_xref="GeneID:2888909"
     CDS             complement(202569..205325)
                     /locus_tag="CAGL0H02255g"
                     /inference="similar to AA sequence:UniProtKB:Q03516"
                     /note="similar to uniprot|Q03516 Saccharomyces cerevisiae
                     YMR266w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446893.1"
                     /db_xref="GeneID:2888909"
                     /db_xref="GOA:Q6FSA1"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA1"
                     /translation="MSSDHVTSTSTQQVVTALITNGVIFGAFVGAFVLLRLKLKRIYE
                     PKSSFDLINDEKKPEPLPSGIFSWILPLLKKSDNFVLQQAGLDGYFFLRYLFILAAFF
                     AVSIMYIFPILIPINASNGAHETGLNQLAYQNVKHRHRYYAHVFCGWVFYWSFLFVVY
                     RELMYFNSLRQAVLSSPRYASKLSSRTVLFQTVPGEYLNEQEFSKLFEGVKNIWIART
                     QGDLPKKVEEREKLAMTLESTEIAFLKKCLKQLKKNKDGQLDIHSLVTDKKLRPTHRT
                     TRFIGKKVDSIDYLKEEIKKLDDEVKELQSCHEDEKTLNSIFIEFESQYQAQIALQIR
                     AYHAPLYMSPAYVGIEPKNVVWFNLRLFWWERMVRELGSVGAIIALVILWAIPVAFVG
                     MISNITYLTNKLHWLRFIYHLPDVLLGLLTSLAPTVALSLLMMLLPMFIRGMAKIQGA
                     TSSQQVEYFTQQSYFAFQVIQVFLVTTITSAATSTVTQIVEEPTSAMRLLAENLPKAS
                     NFFIAYIILQGMSIASGSLLQISPLAMFYALGYLLDKTPRKKWTRFTTLGSVDWGTTF
                     PIYTNLAVIVFSYAIISPIILLFGACGFLLLYIAYLYNLTYVWQEASDARGVHYPRAM
                     YQTIVGLYIGQICLLGLFAVGKGWGPIVLQAIGLAVTTIIHLYFNKTFDKLMRVVPVD
                     TMKSSDGISDTPSYKNIYQQSSCAPIEENHEPHKLFGSSRAHLALKSSGYASSSPLAK
                     DVSYRDSFHSDNTLENEDAPIRTSSPRKDINVLDTTELLADGHVKKIPQVSSWKRFFL
                     PHIFLSFKAVKHRIPEIYNLEDPDELKDEDDIRNAYNFPAVSAELPVLWLPRDPHGIS
                     TYLIDDIASVIQASDEGAVINEDGKITILGNPPKEGLVEEKISHLSKQESHSENPFET
                     PEEL"
     gene            <206023..>206397
                     /locus_tag="CAGL0H02277g"
                     /db_xref="GeneID:2888709"
     mRNA            <206023..>206397
                     /locus_tag="CAGL0H02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446894.1"
                     /db_xref="GeneID:2888709"
     CDS             206023..206397
                     /locus_tag="CAGL0H02277g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446894.1"
                     /db_xref="GeneID:2888709"
                     /db_xref="GOA:Q6FSA0"
                     /db_xref="UniProtKB/TrEMBL:Q6FSA0"
                     /translation="MSHSVRCWLSFYLEMLCLLAAKVLILFELYDEKVWSGPSKTLCT
                     MQYGLFEMGNWKGEVKIQNCETKCKTVNDMIIVPKTIAFIIAVMVTSLDLTRFYLSSN
                     AKNGAYRYYNCVDWSLLNLTVQ"
     gene            <206827..>208236
                     /locus_tag="CAGL0H02299g"
                     /db_xref="GeneID:2888676"
     mRNA            <206827..>208236
                     /locus_tag="CAGL0H02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446895.1"
                     /db_xref="GeneID:2888676"
     CDS             206827..208236
                     /locus_tag="CAGL0H02299g"
                     /inference="similar to AA sequence:UniProtKB:Q03508"
                     /note="similar to uniprot|Q03508 Saccharomyces cerevisiae
                     YMR265c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446895.1"
                     /db_xref="GeneID:2888676"
                     /db_xref="GOA:Q6FS99"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:Q6FS99"
                     /translation="MTSSLTEHQVLEEWNSIPGEVHVPIVSAAEITKLHIYDFDNTLF
                     NSPVPNPQLYTKRVENLLRSSPHISSFGSWWDDPRPLEIIAKLMNHDSERAAFWNENL
                     LRLARLSWRDTSTVSIVLTGRKEKNFHSLFGKLFQISRDKWATEQIAKDDNKYSADDY
                     LFNAICLKKQREETNTFDYKCKCILSFLDRYPNLEEVTIYDDRIHHINKFKNFFNSLL
                     NTKIKWIIVPVAPRFHYLPIRDENTLIPKFVNEQERAESGLVLNLSRTPMQVGYFLTV
                     GSQKKLLHWGLNYLRQHFKDTKVQLSNFAEYPMYIPCTAPGNGITASQARKCFTHFDE
                     IQISKNNDNEKRSDEDIIKYFCSQKTMLSEWSTSFKVVAIAIREAPIQASSRKAQNNK
                     AMEIYYRTIPVGPKKEAWTSWPEFIIVGYNYDKNIQVQMEEINSVLTNPKSLRWHNVK
                     VGIKIKTYFGFFSKRDTDL"
     gene            complement(<208420..>209031)
                     /locus_tag="CAGL0H02321g"
                     /db_xref="GeneID:2888868"
     mRNA            complement(<208420..>209031)
                     /locus_tag="CAGL0H02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446896.1"
                     /db_xref="GeneID:2888868"
     CDS             complement(208420..209031)
                     /locus_tag="CAGL0H02321g"
                     /inference="similar to AA sequence:UniProtKB:P38428"
                     /note="similar to uniprot|P38428 Saccharomyces cerevisiae
                     YMR264w CUE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446896.1"
                     /db_xref="GeneID:2888868"
                     /db_xref="GOA:Q6FS98"
                     /db_xref="InterPro:IPR003892"
                     /translation="MEHSAAVVVATLILGIFVVKWFAAPKEHPSAQRLPNTQLPSSSN
                     NQQRTAGSSNGRGSQRRVSSTSRRNITPEMIETVRNVIPALHPEQIRYDLESTGSVEQ
                     TMERYFNGESFPFPPGYTPARESSANGQHNNIDEPSDIRKRSNIRPDNLLSKFNVDMS
                     VDMSDMSIKELEIDERKKLLVWEARKNMEKRLETDTELASLIK"
     gene            complement(<209419..>209955)
                     /locus_tag="CAGL0H02343g"
                     /db_xref="GeneID:2888655"
     mRNA            complement(<209419..>209955)
                     /locus_tag="CAGL0H02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446897.1"
                     /db_xref="GeneID:2888655"
     CDS             complement(209419..209955)
                     /locus_tag="CAGL0H02343g"
                     /inference="similar to AA sequence:UniProtKB:P38429"
                     /note="similar to uniprot|P38429 Saccharomyces cerevisiae
                     YMR263w SAP30 subunit of the histone deacetylase B
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446897.1"
                     /db_xref="GeneID:2888655"
                     /db_xref="InterPro:IPR024145"
                     /db_xref="InterPro:IPR025718"
                     /db_xref="UniProtKB/TrEMBL:Q6FS97"
                     /translation="MARANNSNSESETKTRNNNQGNAGSSNASNTTSAGSNSQSSRSN
                     AKQRLTAAQQQYIRDLINEHITNNDPTLEEKPHPLDFEQYSEEFIRAYKDHFGLNVPD
                     QMTLQGYLLGSELGKRTISYKRNVSSVPGHRITKTEAASKIKKHFNSLSIKETECIPN
                     FIYKVRNQKKKFKMEFRG"
     gene            complement(<210361..>211257)
                     /locus_tag="CAGL0H02365g"
                     /db_xref="GeneID:2888810"
     mRNA            complement(<210361..>211257)
                     /locus_tag="CAGL0H02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446898.1"
                     /db_xref="GeneID:2888810"
     CDS             complement(210361..211257)
                     /locus_tag="CAGL0H02365g"
                     /inference="similar to AA sequence:UniProtKB:P38430"
                     /note="similar to uniprot|P38430 Saccharomyces cerevisiae
                     YMR262w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446898.1"
                     /db_xref="GeneID:2888810"
                     /db_xref="GOA:Q6FS96"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:Q6FS96"
                     /translation="MLVDAHCHLDGSADSRGCAEYARNVRVCLMSTNPQDAEMLSVGI
                     GLGNAVCAFGVHPWFSHWFYVGDAPGKLEHYSRVMQADAADEGFLSLVDELPDPIDLD
                     QYIRDHFPKGRWQVIGEVGLDKLFRVKRRDGTLSRWHVSMDHQRVVLDRFLDLAVRTG
                     LSVSLHGVKAHGSLLDRCEKKLLNTPCNICLHSYTGPADTLTALWIRKFGHERIFVSL
                     SQYINLDDKHRAVTENILDICPKTCILPETDFEINKHDAQRLEMSLRTVYNFIGQRWG
                     IDNYEELMQTNFESFYGHSIAQ"
     gene            <212116..>215460
                     /locus_tag="CAGL0H02387g"
                     /db_xref="GeneID:2888666"
     mRNA            <212116..>215460
                     /locus_tag="CAGL0H02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446899.1"
                     /db_xref="GeneID:2888666"
     CDS             212116..215460
                     /locus_tag="CAGL0H02387g"
                     /inference="similar to AA sequence:UniProtKB:P38426"
                     /note="similar to uniprot|P38426 Saccharomyces cerevisiae
                     YMR261c TPS3alpha or uniprot|P38427 Saccharomyces
                     cerevisiae YML100w TSL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446899.1"
                     /db_xref="GeneID:2888666"
                     /db_xref="GOA:Q6FS95"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FS95"
                     /translation="MTLIVASLFLPHRPQFEVTASAGETQELIENNLVKLNPLASNEA
                     SPQARPNLDNYIRNTRSALNVPFAQGRNVSQESLLSLNNAGNTSGNIDDLVSSEQFLV
                     NLTANATASGTPNPSYHTKGNMGRPNLGAGGSAEEFFSTSNPPSNRGASPVLSIASAP
                     QVQNNLDSTLNNRGSPPPQQLDSQMADPTAHLLKNVSKSLLTQSLHDSTKEASAPMPS
                     SSANSMGQSRYNHANTSIGTAVTPKSRPLPGHSNSSSIIDFSLSRNKQHAPALPALRR
                     IQKNKVGSPTKPSPLNTQPQSSNLKYSKTLHQMHGDSAYNSDWTTGDDSDHLEEHEEP
                     DNDDDLRQEYLVPQFGGFSTTSKVRETLLKSSRELFAQLPWTIVNSDKGNGSLKNAVN
                     TAVNEKTTKENVKWVGTMGIPTDEIPDEIVENIAKVMEEQYNCGAVVTDDITFKGAYK
                     NYCKQILWPTLQYQIPDNPKSKAFEDHSWQYYHRLNQQFAEKIINVYKDGDIIWIHDY
                     HLMLVPGMVREVFPDAKIGFFLHVSFPSSEVFRCLAHREEILEGLIGANSLGFQTKEY
                     ARHFLQTSNRLLAADVSDDELKYDGRIVSVKQVPVGIDYFTLREKLKDENVLQWRHLI
                     KERWHGKKLIVCRDQFDRIRGLYKKMLAYERFLKDNPQYIENVVLVQVCIGKSTDLEL
                     ERQIMVVVDRINSMSPNISLIQPVVFLHQELDFPQYLALNSEADLFMVNALREGMNLT
                     CHEFIGCSSDKNAPLILSEFTGSSSVLSEGAMLVNPWDIKQVAACIKEGLEMSREEKK
                     RNWKKMVKSVITHDSDSWFVSCLQNLNNSWEFTKERSTVFNLRFETFSDDYNDTSKRL
                     FIFKISEPPNSRMISVLNELSSKNRVYIMNSFSKVVNESLYSRVNNIGLIAENGAFVR
                     LNGDWYNIVEDVNWRAEVVKILEDKVERLPGSYYKIADSMIRFHTENAEDQERVSGVI
                     GEAITHINTLFDDAGIHAYLHKNIVFVQQTGLSLNAVKFLLRYYNTAASGDNVTPMIN
                     SEQSPRSRSDSISVSQKPIDFLCISGSSSPVIEPLFKLVKDQRNSGMLRHGHSIVYGD
                     TTSSYAREHVNGSNGLFNVLNRLMRS"
     gene            <215958..>216419
                     /locus_tag="CAGL0H02409g"
                     /db_xref="GeneID:2888488"
     mRNA            <215958..>216419
                     /locus_tag="CAGL0H02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446900.1"
                     /db_xref="GeneID:2888488"
     CDS             215958..216419
                     /locus_tag="CAGL0H02409g"
                     /note="highly similar to uniprot|P38912 Saccharomyces
                     cerevisiae YMR260c TIF11 translation initiation factor
                     eIF1a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446900.1"
                     /db_xref="GeneID:2888488"
                     /db_xref="GOA:Q6FS94"
                     /db_xref="InterPro:IPR001253"
                     /db_xref="InterPro:IPR006196"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018104"
                     /db_xref="UniProtKB/TrEMBL:Q6FS94"
                     /translation="MGKKNTKGGKKGRRGKNDSAGPKRELIYKEEGQEYAQITKMLGN
                     GRVEASCFDGIKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDVVHKYNLDEART
                     LKSQGELPENAKINETDNFGFESDEDANFEFGNADEDDEEEEDEEFDIDDI"
     gene            <216932..>221182
                     /locus_tag="CAGL0H02431g"
                     /db_xref="GeneID:2888887"
     mRNA            <216932..>221182
                     /locus_tag="CAGL0H02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446901.1"
                     /db_xref="GeneID:2888887"
     CDS             216932..221182
                     /locus_tag="CAGL0H02431g"
                     /inference="similar to AA sequence:UniProtKB:Q03496"
                     /note="similar to uniprot|Q03496 Saccharomyces cerevisiae
                     YMR259c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446901.1"
                     /db_xref="GeneID:2888887"
                     /db_xref="GOA:Q6FS93"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019442"
                     /db_xref="UniProtKB/TrEMBL:Q6FS93"
                     /translation="MPNQELNSIKDFLLKTNPSKINQENKDDILETYINYFTIVKNEL
                     LYSASLTDEDRLFLTDTLSINILRSTQTIKNKKLDTSTFESRLHTEIFTEELNNQIFN
                     YVVNFWAETGPVQMNALRDLFAKFMGLNKIIQDDASFQEMCHCWLKNISKIPNTLKVQ
                     YYLIEALSNDIDLFEIMEDKPDFFQTSLSLMNLDSLSTPISKCLVSMLLNIFKIHLQS
                     DKSRLNEWVNLWKGSLLKYLGIKEYSKNITIYILEPLLKSMPKEAFSILVDSGFENNN
                     QLLLSVIRLGQELNIIEDPFLRNEMIAMSTLEDLLKTNAQKLLTFQVLIYSKKSSKPI
                     DPRIYHLVLQSMNSFFLEVDVGMRNYFWSSFKGLLLRVRDSTYALHRDANKLQKANKF
                     PEEVQQKLSTVTLAREFLSKVYEIVIFHLLPGSSYQSHHLGLKFLRLFLELGIDKKAT
                     NLIIELQDDREFPFSLDIVDDKHLQDTLLSLLISKFPDIRESSRKLLELMNKPQNSKL
                     ELNESMKNDIEIQAAIYLDLYQHCELGASLHQYSYMICNDKGKYMDSFILKIKRMLSI
                     HDYNKSEFIRQPIGGYFLGLSSLMKQYFLLHKNKNDNQYFETCFDLVCTNWSYMKEIS
                     SYNSSNDILPESYRNCGVKDSIITTQAFRAIKEASGLLEILMESCELDADNISSIGDI
                     LIDQLFTVRHSGAFQAVLPAFKLCTAMAKKKVPLLLNEWLDKSIDMVETKTQHITRRS
                     GGIPFIVSIILGTSADKSMLDLAFKRLVNIAIEPITEFQDVIDHPQVNAFNCIKSLFT
                     EAKLATIILSHVSKSLELCLMSFTSSIWAIRNCSMMLFTAIQNRVFGKSGKDYPARLF
                     FNRFVDVDKLLLESLNKTTTAIHTHSILSDRHIEVLYLIVTLLSRLESTPGYTGLADF
                     ISLLKNNIDCKDWKVRDLIARTLAKYEFENLLSHEFLLEWDCSNQNNLHGKLLFTKYC
                     LQQGINKNLEQFKLKDICVFLISKLDETILRNKCYITIKECTEIVLLLLESNMFDKSE
                     IDQMCSIFGMFLCNTIENPSQDGTKQLALAATLQVLLQIESQANIQCILQLVLLSNWY
                     ECHLIAMQYINSTMDLSLYSDEMYSSVCTIAKNNNNLPEVRKLALKTAVYLNFDKSLQ
                     LILSVFENNRVESLRTQSIEQIGNYITAEIFEKWWPLLQDMFLDNQIEDIRLSALRSV
                     INAPQLLDHPKVVFRMLLTLNDDDEDIRLECAHFINRALLAENDIQFDTAPYHTAISV
                     MHRGKIDAKSTHQLAKIVMDSIINDMNKFNNMENTSTIGDHLFDKEEDNIFRNRVLEN
                     MIMVKIIACNADNELREAIKTFLISYCPSIISIIANSHTSGSLFHWVTHIDHFTKIYT
                     TRLLLSEFCPEDVSAFDSALIKLGIPHNTIFTMKNIIV"
     gene            <221539..>223194
                     /locus_tag="CAGL0H02453g"
                     /db_xref="GeneID:2888572"
     mRNA            <221539..>223194
                     /locus_tag="CAGL0H02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446902.1"
                     /db_xref="GeneID:2888572"
     CDS             221539..223194
                     /locus_tag="CAGL0H02453g"
                     /inference="similar to AA sequence:UniProtKB:Q04847"
                     /note="similar to uniprot|Q04847 Saccharomyces cerevisiae
                     YMR258c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446902.1"
                     /db_xref="GeneID:2888572"
                     /db_xref="UniProtKB/TrEMBL:Q6FS92"
                     /translation="MMNSSMDNDYQANLNSVLPLVCEYLNQNDVFNLTLCCTTFNKSL
                     QRHLFKSIIIQTEPVLRDVRSHLDWNTTYITGCRNIIKSNDQNDIYVYDRVEELIRSG
                     KLHLIEKLVIEKDIFFDKDNGNALLIKLIERIIEIDLIKVLEIKDYDLFSNFYDSYLK
                     LTHLTKIEVIELDDLENTKSLFTLREIVLTLINDNERQIINLSENTKKILRSNIKSVH
                     INDVDYASGEIINLLKRNHISFPKAQNISFKHVHRLECGPITDINLGNIFDLKKIKAL
                     EAVINCEEYGHCSCLDEFLTKIRDDLIVINKLALSQKHFITVPNHKEQEDWDIIICRF
                     LVNIPDVDSNLSTLIIKHDPPFEGFAEDSVDGNYIRRKNLFMSVFPVLKALRSLWAPV
                     VLQTISAYEVPMADILWNGCECEYCKKWLPVFDQYLMNHQYYSKDEGDYKDIIPTPFA
                     AFTGYSLAKRVIDDVNSLLELTTRAPHMFNWDFHTYDAIRHFETYECHFDERVFPMLG
                     TAISHFFYNYMDFLVKHLPNLAFTQFSGIYFTVKDQKYDCIYD"
     gene            <224077..>226485
                     /locus_tag="CAGL0H02475g"
                     /db_xref="GeneID:2888596"
     mRNA            <224077..>226485
                     /locus_tag="CAGL0H02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446903.1"
                     /db_xref="GeneID:2888596"
     CDS             224077..226485
                     /locus_tag="CAGL0H02475g"
                     /note="weakly similar to uniprot|P08468 Saccharomyces
                     cerevisiae YMR257c PET111 required for translation of COX2
                     mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446903.1"
                     /db_xref="GeneID:2888596"
                     /db_xref="UniProtKB/TrEMBL:Q6FS91"
                     /translation="MMRKWIIQGNLIKHFSRECAEDPLVNSIKLIILRHDYSTNKVGI
                     SVKEQVPREQNDENNKRAQFYDESFRFLTGTPMHITNRRLTSDLENISFICKSSPSFI
                     SEEEYTRIYRIIQDPGSSEYLVSSSILSISNHKHKLIPLPKLLSMIHILSENGYLNEI
                     HMLFGNCKAHLSILKSDQPEDLYRQFLELMLDVEYKLLNFHSIEKIFSEYIKMPNIKA
                     KYMTYGLRAFIENNDFQLAKAFFFQALTHSDNFPMTPKELHSFLSGISDHNDLTNTLL
                     IFYSWISAKCKQLDDNPNFPLPETMQLIHRMILLFQDRVQLTQFCSNVVVKQSGYLDS
                     VDYKLTVYFDKVRKVLADTGPPNKDRPEIFKGIQQYIDLLDGMTDKRELFFKRLLCIC
                     TDSHDLDKFMEIVALIEADKEVDMEIFVKDMVGKIIARKRRFGTALKYYEDLVLNGIE
                     GKKFPIKHEYLSSLWIAIVSDYPTLAEPIKQELFLTLNTDKYKRAYPWLKYFLQEVSQ
                     LKEWKLLGGVSWNVLHLRISEYDKLKELDKFIKSADCLEIEHIIQQTLRDGLVPNFHF
                     NYSLIKLLLKGSLVSSAKTIDDTMRKNYYSIPEKLNILWLRNDIDTMKKNMNSLTNRE
                     YKRMISSMLDDFVNSRVLSLGFKDYIQLTHLAMDYGLYGMAFKLLKSGKMIFQEKNGT
                     NWKLYYLASLKLHTQTLQLDQFMAVLQSWIKNKDAYVITPGCLRRLKSYSRFFKKNSG
                     NMDNFDADKLKELEQNIQVLKTKYLENKYKGLNDMHRMCQFIKTALDRDAKTITTQNA
                     NGST"
     gene            <227288..>227473
                     /locus_tag="CAGL0H02491g"
                     /db_xref="GeneID:9488001"
     mRNA            <227288..>227473
                     /locus_tag="CAGL0H02491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999504.1"
                     /db_xref="GeneID:9488001"
     CDS             227288..227473
                     /locus_tag="CAGL0H02491g"
                     /note="highly similar to uniprot|P10174 Saccharomyces
                     cerevisiae YMR256c COX7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999550.1"
                     /db_xref="GeneID:9488001"
                     /db_xref="UniProtKB/TrEMBL:B4UN07"
                     /translation="MANRIIELQKLFQSSTKPIWWRHPRSAFYLYPYYGLLAVAVVAP
                     LLYIPNAVRGIKAPKNN"
     gene            complement(<228026..>228775)
                     /locus_tag="CAGL0H02497g"
                     /db_xref="GeneID:2888635"
     mRNA            complement(<228026..>228775)
                     /locus_tag="CAGL0H02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446904.1"
                     /db_xref="GeneID:2888635"
     CDS             complement(228026..228775)
                     /locus_tag="CAGL0H02497g"
                     /note="weakly similar to uniprot|Q04839 Saccharomyces
                     cerevisiae YMR255w GFD1 protein of the nuclear pore
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446904.1"
                     /db_xref="GeneID:2888635"
                     /db_xref="GOA:Q6FS90"
                     /db_xref="InterPro:IPR020401"
                     /db_xref="UniProtKB/TrEMBL:Q6FS90"
                     /translation="MVLDSKWADAPDEDEVVEVKRDMRKNKSVSRPNSRQRTRNSTND
                     QETTPRESAKEESRPNSGRSLLDRIDKSFLVNSEDKKAAGHAIRDDRHMSPLPKEPKS
                     KSSGTKSASRNSLLDRIDQSYLVDNKSSSKTSATPSPPSTASSNYSRQKSPDTAQTTP
                     GCTRPSSRNMQSRTNGENGKKTDPAANKVKMELLKKKIEEQKKLLNERTHKEKQKELL
                     AAFLEGDEQFAWDDEKEEDELINKLKSSQIS"
     gene            <229511..>230665
                     /locus_tag="CAGL0H02519g"
                     /db_xref="GeneID:2888657"
     mRNA            <229511..>230665
                     /locus_tag="CAGL0H02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446905.1"
                     /db_xref="GeneID:2888657"
     CDS             229511..230665
                     /locus_tag="CAGL0H02519g"
                     /inference="similar to AA sequence:UniProtKB:Q04835"
                     /note="similar to uniprot|Q04835 Saccharomyces cerevisiae
                     YMR253c and similar to uniprot|Q08980 Saccharomyces
                     cerevisiae YPL264c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446905.1"
                     /db_xref="GeneID:2888657"
                     /db_xref="GOA:Q6FS89"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="UniProtKB/TrEMBL:Q6FS89"
                     /translation="MADASKTIVKESDFEINDGNDASSAGSATEAGMVARLNQEYLKP
                     NVGLIFLIVSQLFNSLMVVSTKVLELDREGLEPDEPSIQPLQILLVRMIITYIGTLIY
                     MKINSSSIEYVPFGNPAVRPWLIMRGAMGFFGVFGMYFSLMYLTISDAVLITFLAPSV
                     TIILAWIILRESFSKAEGIGSFVSLAGVVLIVRPTFLFGNPTTSDGDIDETTDPHKRL
                     IATLVALWGVVGISSVWIIIRYIGKRAHAIINVSYFSLITGLIALFGILFVPSVHFQT
                     PRTLKQWLLFANLGICGFCHQLLLTIGIQKERAGRGTLMSYTNLIYAVFWDVLLFGHW
                     PSFWSICGMILITGSTLYIVKMKANDAKPQAVNNNSIQTEFDLEDLSSVR"
     gene            <231364..>231687
                     /locus_tag="CAGL0H02541g"
                     /db_xref="GeneID:2888504"
     mRNA            <231364..>231687
                     /locus_tag="CAGL0H02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446906.1"
                     /db_xref="GeneID:2888504"
     CDS             231364..231687
                     /locus_tag="CAGL0H02541g"
                     /inference="similar to AA sequence:UniProtKB:Q04814"
                     /note="similar to uniprot|Q04814 Saccharomyces cerevisiae
                     YMR252c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446906.1"
                     /db_xref="GeneID:2888504"
                     /db_xref="GOA:Q6FS88"
                     /db_xref="UniProtKB/TrEMBL:Q6FS88"
                     /translation="MMYKVGVRSINSVRQLSRFRRWHELDLAEQHKFIHKFAENYRKR
                     YPGSKTNLSFRGLMKDIDTYKDSPSVFGIFYNSICDNIDHGRDNGRFAHDSFRKLVLH
                     RNDST"
     gene            complement(<231892..>232068)
                     /locus_tag="CAGL0H02563g"
                     /db_xref="GeneID:2888882"
     mRNA            complement(<231892..>232068)
                     /locus_tag="CAGL0H02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446907.1"
                     /db_xref="GeneID:2888882"
     CDS             complement(231892..232068)
                     /locus_tag="CAGL0H02563g"
                     /inference="similar to AA sequence:UniProtKB:Q3E6R4"
                     /note="similar to uniprot|Q3E6R4 Saccharomyces cerevisiae
                     YDR524C-B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446907.1"
                     /db_xref="GeneID:2888882"
                     /db_xref="GOA:Q6FS87"
                     /db_xref="UniProtKB/TrEMBL:Q6FS87"
                     /translation="MKVSNVVLGAIAIAAVNAQNASNHSSSSKNAANALPANNAYTAG
                     VAGAAVAGALAFLI"
     gene            complement(<232974..>234755)
                     /locus_tag="CAGL0H02585g"
                     /db_xref="GeneID:2888533"
     mRNA            complement(<232974..>234755)
                     /locus_tag="CAGL0H02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446908.1"
                     /db_xref="GeneID:2888533"
     CDS             complement(232974..234755)
                     /locus_tag="CAGL0H02585g"
                     /inference="similar to AA sequence:UniProtKB:Q04792"
                     /note="similar to uniprot|Q04792 Saccharomyces cerevisiae
                     YMR250w GAD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446908.1"
                     /db_xref="GeneID:2888533"
                     /db_xref="GOA:Q6FS86"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR010107"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FS86"
                     /translation="MLHKHTDKQRLPVNIVDHHHIDPCLQDFKLLSKELQDIASNSEK
                     LKALGSKENKESHLLSMKYVIPKEGVPADQAYDMIHNELTLDGNTHLNLASFVNTSTT
                     HEVRKLISENLTKNLADNDEYPQLIELTQRCISMLSGLWNANPEEEPIGCATTGSSEA
                     IMLGGLAMKKMWEKKMKAAGRTDTSKPNIIMSSACQVALEKFARYFDVECRLVPVSRK
                     SHHMLDPNLLWDFVDENTIGCFVIMGTTYTGHLENVAEVGDVLTAIEKQHPEWANKDI
                     PIHVDGASGGFIVPFAFSREQLKAYGVPNWGFDHPRVVSINTSGHKFGLTTPGLGWVL
                     WRDESHLAPELRFRLKYLGGVEETFGLNFSRPGFQVVHQYYNFMNLGYDGYRDTFKRS
                     LFVARVFAHQILRSPIFNDYFEVVSSIHESIDGDKVPDAANDYWENPEKYKPGVPLIA
                     FKFSDKFQKEYPEVPQALLSHMLRTRGWIIPNYPLPHSTDGSDKCEVLRVVFRNEMSL
                     DLAQLLLSDIQAVLRKLQGSYSGLKTISHESDSDKRRDYVYKMLLALASPDADIGEDE
                     DEETKEKKASKKEEIKQRLKRNYRGTC"
     gene            complement(<236058..>237278)
                     /locus_tag="CAGL0H02607g"
                     /db_xref="GeneID:2888575"
     mRNA            complement(<236058..>237278)
                     /locus_tag="CAGL0H02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446909.1"
                     /db_xref="GeneID:2888575"
     CDS             complement(236058..237278)
                     /locus_tag="CAGL0H02607g"
                     /inference="similar to AA sequence:UniProtKB:P21182"
                     /note="similar to uniprot|P21182 Saccharomyces cerevisiae
                     YOL052c SPE2 adenosylmethionine decarboxylase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446909.1"
                     /db_xref="GeneID:2888575"
                     /db_xref="GOA:Q6FS85"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="InterPro:IPR018166"
                     /db_xref="InterPro:IPR018167"
                     /db_xref="UniProtKB/TrEMBL:Q6FS85"
                     /translation="MTVTIQELTNHSYIDHELSATLDSTEAFEGPEKLLEIWFFPHRH
                     CIPKDENGDMKTLRSIAVEKWVAILKLVKCEVLSIKSTEKMDAFLLSESSLFVCDHKI
                     TLKTCGTTTTLFCLEELFRIVEEELGWDMRAKKEENVGKYHPHKVFYSRRCFMFPLKQ
                     RSIHKRWSDEIEYLNKFFCYGSSYLVGRSDQSNHWNLYVTETNKNMNITDDCGEDDED
                     ETLEILMTELDQTCAQQFSCKREVKTVEQSQQDENTSEDEGHLSGYKMTNATRLDRVY
                     NNEKNVSFHHDAFAFTPCGYSSNIIMDEEYYYTLHVTPEKGWSYASFESNVPVRHVSN
                     NKQDNISVINHVLSVFQPRDLCITFFCKSMDNESFKKLMKTSGEIPNYTKKDRIIYDL
                     DDYHLLYIRFERNC"
     gene            238083..238155
                     /locus_tag="CAGL0H02629r"
                     /db_xref="GeneID:2888793"
     tRNA            238083..238155
                     /locus_tag="CAGL0H02629r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (AGC) cove score=75.92"
                     /db_xref="GeneID:2888793"
     gene            <238495..>243129
                     /locus_tag="CAGL0H02651g"
                     /db_xref="GeneID:2888647"
     mRNA            <238495..>243129
                     /locus_tag="CAGL0H02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446910.1"
                     /db_xref="GeneID:2888647"
     CDS             238495..243129
                     /locus_tag="CAGL0H02651g"
                     /inference="similar to AA sequence:UniProtKB:Q04781"
                     /note="similar to uniprot|Q04781 Saccharomyces cerevisiae
                     YMR247c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446910.1"
                     /db_xref="GeneID:2888647"
                     /db_xref="GOA:Q6FS84"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FS84"
                     /translation="MSFGVNTFQKYRDDSGLGHNGVAVSLNYYDGLPESSLLNSLSSN
                     ELKLIFKSLMKRDDTTKEKALNELMGLVEHYDHNSFLFDDIMLLCWSQLYAKLCMSEL
                     KNIRLVCQQVTLGIITKMRKSVAKYFKDLIPFVLLGTCDTDSAVARLCATGIKTCFND
                     DEDKVTALYSLFDIPILSLTKAILVTETPQTLTDERYSTPDDADFKYQRVVVSAINLL
                     LAAIERNKAILEDETFNEIMDNENLWKLMSIKNLNSIKTYESLIRLAITLSEEEFLTS
                     HKHVLKLISKKLLKSLSQFNDKNILKVNYICPLILTLFMCLNKYKNGKFWSYDKISKD
                     RLVGFLSTAMKSPTVGFFPTFFRFYTSVESQDILDKELEWWPLIRIGNKNLCNKSFLG
                     RDGAKILKEYWSCRVQLNNSSFSNKNELLIEDIKEVINSTDITNVVEVKQLFRNYLNN
                     TAILHEIDVLLASHGNLTRDIKLKFDNFLNLFFLEATESDVISMSKTLIKAWDNKEGP
                     PESTLFVSNRLIKNGKEHPESLYFFFERLLDLMNEDNHSEISNLFVSYSSIIKVPDEK
                     VISLFGSFIMRVTIISKNVNSVKDILCQIPRIYCEKLCSADESTIKKIFDTIIQSYSG
                     DTNVQFFQSPIINIFTIHRLFEVFVSKGEFSKLVSDINYLDSTCKQYLYAQETFYDHT
                     LNELNDMQFFTLLKEACLVLGVNDEIDANIVKVLLRKIKKSFSKQSSEQYFEVLDILL
                     KHNKDTINVFLPSDPLKLLKEFNPSSLLLCDGNFGANVAFFLSGPTLEDYEKAKPLLH
                     QAMFIDTYLSKNNKTDLDAWIIFLTIMSEIAADYNYLSESPEYIFQDLENTIYKSVER
                     PFSFLSILNLLNNVEAKNNSWLSKLIDFEESNSMVAYYSGMIVRRILINEVDYMSSSD
                     KNFISQELYTFLSKALREKEHGLKLFYATILLATSKDVVMPEALIKVGALLISQIVGI
                     SEMELIKGKSKVLLILFSMLAGSINISEPVLPIPKLNMALKTLDNILDSDIAYDEEFI
                     IHRLLIMKFIGAIVSQSNLEQAHSQALKLAERLIADGFSMSLLEETPMKPELQYLATQ
                     LHKYCIARNEWECTEEYRSEIETGFMDTMLNSVSVFKNNHCSAQYYIMCEGIFSARKT
                     NEQIKNLDSMIEQFVSMQLCCNIGYMRLLVAILEKTIYEKQQINLIEFELENQKLGKD
                     KTQDDNQEDERSFEEYKIPEILMTSLITNLPSEYLEYENQYRFLNYLWTWYLTVSYFK
                     DVSYNMRELYMDQLKEKDLITQMLDFIVDQIDFDDTTYWKTVEINDISNYEIHNNQLE
                     PFIEAVNDECKKLLVHLMYKIFSASGTLSAKWYMNIKNKSLSSKIDRFVSEFVSPILI
                     SNELREVENKKESLTSKDDSLTIKINEKLHEVKASFLIDEQKLEIAFKLPVNYPLENI
                     QVIGISRVGISEQKWKQWIMSTQHVITGMNGSVQDSLELFTKNVGLQFSGFEECAICY
                     SILHAVDRKLPTKTCSTCKNKFHGACLYKWFRSSGNNTCPLCRSEINFRR"
     gene            complement(<243231..>244034)
                     /locus_tag="CAGL0H02673g"
                     /db_xref="GeneID:2888651"
     mRNA            complement(<243231..>244034)
                     /locus_tag="CAGL0H02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446911.1"
                     /db_xref="GeneID:2888651"
     CDS             complement(243231..244034)
                     /locus_tag="CAGL0H02673g"
                     /inference="similar to AA sequence:UniProtKB:P36144"
                     /note="similar to uniprot|P36144 Saccharomyces cerevisiae
                     YKR060w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446911.1"
                     /db_xref="GeneID:2888651"
                     /db_xref="GOA:Q6FS83"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q6FS83"
                     /translation="MAPSLCDSAFARKGVDALISYATNQDSNNDIQLIIHTEKKLGIK
                     KDYIPRVIPLKHNKMSKVKDMRILLITKDPANKYRDVLTSNELTSDTFKEIISVKNLK
                     RRFRGSKLTSLYKEFDMVVADFRVHHLLPAILGSRFYHSSKKTPYMVRINKEVKHKGA
                     KMDETIDPVYLKAQLKSICRNTSYMPNEDNCINVKVGFVSTHTAKQILENIQDVIEFL
                     SDKNMKPSGGVIKGSIKSLQVKTASSASIPIYQYNENKEKNIPNDRLVL"
     gene            complement(<244561..>246210)
                     /locus_tag="CAGL0H02695g"
                     /db_xref="GeneID:2888809"
     mRNA            complement(<244561..>246210)
                     /locus_tag="CAGL0H02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446912.1"
                     /db_xref="GeneID:2888809"
     CDS             complement(244561..246210)
                     /locus_tag="CAGL0H02695g"
                     /note="some similarities with uniprot|P47011 Saccharomyces
                     cerevisiae YJL137c GLG2 self-glucosylating initiator of
                     glycogen synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446912.1"
                     /db_xref="GeneID:2888809"
                     /db_xref="GOA:Q6FS82"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FS82"
                     /translation="MGKENVAVATLLYSADYLPGVFTLGFQLRKLIDAGGCGCVKTCI
                     VVTKLLYNDILSDISKNLLNCLYDDIVLVDPLDYQHITQDMNKENLKMLERPELSFAL
                     IKARIFELTQYEQVLYLDADTLPLNSGIFDLFDQLADQTSEQVAAVPDIGWPDIFNSG
                     VMMIVPNRDVVAELNNYILNVVSIDGSDQGILNQFFNQNMRLNDFGRIANYSTKEWIR
                     LPYLYNVTTPNYGYECPPAMKFFGPHIRLVHFIGKHKPWSKWSQEQFQKSSYAAQWRA
                     AYLDFQIQYDLVDLLAHTTIKDEDEHIEPQQDECEEHIEENQPDEYHHEQTQYNERLE
                     KIDEINEDECDIIEEEQQPIEKPPTPIQLPLDFKEWLTTFISKEDEEQQHNEEPSVEE
                     SQGNEPEETHFRGVHYEEHMIQHHEEETINRQVSHPKEDAANEAAREIEQPKDRYDRK
                     VEIIEEEDIKDHELDDLIDDESSTNKQEDDDEIVDEQEESRLASELEVKDSKMDVQES
                     RSHNIHNQNNNNNYRFEWENTNYLNTVERSFPEDIFEYSVE"
     gene            <247359..>248030
                     /locus_tag="CAGL0H02717g"
                     /db_xref="GeneID:2888440"
     mRNA            <247359..>248030
                     /locus_tag="CAGL0H02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446913.1"
                     /db_xref="GeneID:2888440"
     CDS             247359..248030
                     /locus_tag="CAGL0H02717g"
                     /note="weakly similar to uniprot|Q06244 Saccharomyces
                     cerevisiae YLR165c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446913.1"
                     /db_xref="GeneID:2888440"
                     /db_xref="GOA:Q6FS81"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /translation="MSARLKVVYDGMHYMIVYKSAGVLSQPGLASDSRPVLMSELRGL
                     LSETLDLYSVQRLDACVTGGTVVAKNKRAAMMFSRYLKQGGGSGYGLTRRYLARINAQ
                     PVCDEGTIESPGMVTYYRRVRDDCVVVELKTGKKHQIRKHLALNLNCPIVNDTYYGGS
                     VVKGVNGQIALHSAFVRTRIGKNMQDHLVGIEPQEQTLWKSILTENGMLPDDIVRTLT
                     RDKLF"
     gene            <248511..>249908
                     /locus_tag="CAGL0H02739g"
                     /db_xref="GeneID:2888599"
     mRNA            <248511..>249908
                     /locus_tag="CAGL0H02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446914.1"
                     /db_xref="GeneID:2888599"
     CDS             248511..249908
                     /locus_tag="CAGL0H02739g"
                     /note="highly similar to uniprot|P10507 Saccharomyces
                     cerevisiae YLR163c MAS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446914.1"
                     /db_xref="GeneID:2888599"
                     /db_xref="GOA:Q6FS80"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FS80"
                     /translation="MFRQAVKGIRTLRNFSHCRPRLNALPQTRTSVLPNGLTVASEFI
                     PNKSTATVGIFVDAGSRAENERNNGTAHFLEHLAFKGTQNRSQTDIELEIENIGSHLN
                     AYTSRENTVYYAKSLEGDVPKAVNILSDILTRSVLDPKAIERERDVIIRESEEVDKMY
                     DEVVFDHLHEIAYKQQPLGRTILGPIKNIKSISRKDLKSYITENYKGDRMVLAAAGAV
                     DHEKLVDYAQKYLGHIPKSESPMPLGSPRGPLPVFQRGERLIPENTLPTTHIALALEG
                     VSWSAPDYFIALATQAIVGNWDRAVGTGTNAPSPLAVAVNKGNNTLANSYMSFSTSYA
                     DSGLWGMYIVTDSNEHNVQAIIDEVLKEWRRIKAGNITDDEVNRSKAQLKAALLLSLD
                     DTTAILEDIGRQIVTTGKRLSPEEVFEKVDNITKEDIVLWANYRLKNKPVAIVALGNT
                     KTVPSVDYIEKQLNA"
     gene            250359..250431
                     /locus_tag="CAGL0H02761r"
                     /db_xref="GeneID:2888802"
     tRNA            250359..250431
                     /locus_tag="CAGL0H02761r"
                     /product="tRNA-Ala"
                     /note="tRNA Ala (AGC) cove score=75.92"
                     /db_xref="GeneID:2888802"
     gene            <251169..>256526
                     /locus_tag="CAGL0H02783g"
                     /db_xref="GeneID:2888884"
     mRNA            <251169..>256526
                     /locus_tag="CAGL0H02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446915.1"
                     /db_xref="GeneID:2888884"
     CDS             251169..256526
                     /locus_tag="CAGL0H02783g"
                     /note="some similarities with uniprot|P47035 Saccharomyces
                     cerevisiae YJL076w NET1 required for rDNA silencing and
                     nucleolar integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446915.1"
                     /db_xref="GeneID:2888884"
                     /db_xref="GOA:Q6FS79"
                     /db_xref="InterPro:IPR018844"
                     /db_xref="UniProtKB/TrEMBL:Q6FS79"
                     /translation="MYKLQVLLVPPSIQNNNFSLNYNYGQANNSIADQSQQLPNKVNG
                     TFNNTFNGQSQPDSSIFPVLTRSNSSLLTPNYYAQRSMKKFLHFTKANNTLLDLSDEI
                     NDKCKAMYPSLEADLDILSLQDSNGCDLDPDFVVKDVFNVDNIVRVILNDELDISEIT
                     PVSSYRSIKRRRLNPESLADSKDQSDFGVESQSIKVVKKRGSTSNVIKGQSNINGRIS
                     TPLARQLYPPSAIFEPQNSDDEEVADRSFLPPPIQPGSPPIRISSGIDTNVRKITSRI
                     GEQDTVSRSATVDPDKSRQQRLLSGTPVMSTMTPNRVTLTGQRVISEQRPNDSVLTFT
                     NRHINEPSHSRRITSGMLQIPEPKIAEMEKELLEGPSSPSTILPPIPDKIPMKKPFIE
                     TERYYSEDSSETESNSGEINAKSSLHRQTSIADNNGSPLRTNFLNEAVHLADLPELQK
                     SEKASKPRKQVYGSITVNSSNLQPIPNNINNYVETNATKVRSTVNDFGISSSSDDETT
                     SETHSKMSDEDYESSDSNKTIFEDDDDDDDDDDEANSTVVHIPTKPVLTRKSNKKIFQ
                     RDELLRLMEGDRDGLPVSIKRELLKMYPDFPPQKHDKKLGPESKLHPSHNAIPKSPGS
                     DGDKQKNSAQIPHIEYSSEESSDSLSEIYVEEVDETTKGQKKKPNRRNKNSEEPLSEL
                     HPLKETVIDIKQNGNRSVKENITESLDSNKEHGESVGKNDFDVNNTEEMSRHQVNSNL
                     HELPIKVHSTDSLSETNARNESGDNAYNYKTSKSADQNDDLASTANNDIFKSLVDFRS
                     LVAKIKKDKSENNPNGSAMRDNSQGSSNSPVLNSTSFPNVVNNAAFGSTYTRKDTDKN
                     VSLKDNSKLVSSAVNASASQNEQGPPIYPPETERSGKELIESKIKGLPPSKLIQEKSS
                     TFRTPHSKSAQTTSPIAEVVSGHEVAVKQIEDMQQFKPLDVRKSTSTSLLKKIPAKDV
                     PVTQVKNTPSTKAVQDKETVGPATQHKSTQLEANSVPKKVPAKDVPVTQVKNTPSTKA
                     VQDKETVSPATQHKSTQLEANSVPKKVPAKDVPVTQVKNTPSTKAVQDKETVSPATQH
                     KSTQLEANSVPKKVPAKDVPVTQVKNTPSTKAVQDKETASPATEHKPSKRVDRKVLDS
                     TQKEISITQNNSVQSKKVVQDNTVDVASHKQQDPYVSARDTLYTKLTGGEQGDNHLST
                     SKATAKVDLPTKKLPNASNGNVVISQSPSDINASQTSTKNKVTPSSVENQSGSSKNPN
                     IASKNKQDITTSEKDNSISSQFTSEVDKHVEGNDSKSGIHVRSFDNVKSAPSEKDLNS
                     NTAPPVNNSQKTNGRNGLDEQLEQRVETVTRLPSPVKNKIREQQNRVNGKSQQLEAVT
                     SPETTAVIGRLDGNNSNVIGNQSKKQTGTKEETDKKIRVTHNNTKRDSATTADLGSMG
                     LGSRSKNEGLIDVSSNMDPISTSDNMNLNTKVAVGSSSPALVDTQMNRMNRNPDTDSV
                     NSVSSQLVNKAGIVRGISGHNHDTATEESSTDDSSTDESSDESSSSEDESKDYRKTRR
                     LIVDVPKGPVIDKKITSSSIDQEHQNNSVQQNDNKIEGKKIEATTSGSNSTKKEPFVG
                     VLQALPEKIRPSLSSLSDLVSRGIPDVRESTIKGRSTAHQIVGGKGNSSNVSFSLGVS
                     SSQQKSLGYKPTVDKQASGVTKQIPVKPLSNSESSSESSTSESSSGSESDSDSDSDSN
                     TSSDSDSDSSSDSDSNDGKSKKKSKAVDSFISAKSASSALKKKKKSTGFASLIRDSKK
                     R"
     gene            complement(<256682..>260341)
                     /locus_tag="CAGL0H02805g"
                     /db_xref="GeneID:2888562"
     mRNA            complement(<256682..>260341)
                     /locus_tag="CAGL0H02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446916.1"
                     /db_xref="GeneID:2888562"
     CDS             complement(256682..260341)
                     /locus_tag="CAGL0H02805g"
                     /inference="similar to AA sequence:UniProtKB:P47037"
                     /note="similar to uniprot|P47037 Saccharomyces cerevisiae
                     YJL074c SMC3 required for structural maintenance of
                     chromosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446916.1"
                     /db_xref="GeneID:2888562"
                     /db_xref="GOA:Q6FS78"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:Q6FS78"
                     /translation="MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAA
                     VRFVLSDDYSNLKREERQGLIHQGAGASVMSASVEIVFHDPEHSIIAPTGINSNGSSD
                     EVRIRRTVGLKKDDYQVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKD
                     KERLQLLEEVVGAKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKEL
                     EKYNSLERDRKVLRYTLHDRELQDIISQIESLDGDYNDTLGSSKKYILELEKRENMIK
                     EVNEEIKNLQKSLKLKATVDLEQAKAILEESLERSEAIKLQLKDIKEKIKQNKEQHDN
                     DRKNLKLITEIIDSKKSKRRKISPRFDQLQSEEKLIKHHLKECIEKQNNFLLKKGSYA
                     RFKSKEERDEWINSKIKELSESINTMKASTTELKEQKSSIDVKINESENNIEELEDSL
                     NGPGIKAEIEDIEKELINLRRKYTANIDARKEKWREEQKLQMISDSLVNEVKENERSL
                     NETMSRSLANGFKNVKEICERLNLGTESVFGTVGELIQVNEKYKVCAEVIGGNSLFHV
                     VVDTDETASILMNELFRMKGGRVTFMPLNKLKNGNQNIDYPSDPNIPCTPLIKKIKYD
                     MQFDCVVKQVFGRALVVKDLTNGLSISKQYKLSCITLDGDRVDGKGVLTGGYLEQSKK
                     SRLELLQTVALSKRQLLEISAKLTEIKNELTEMDNDIDSTNGSIRLVMNRKENMQSNL
                     NTWKHKLSHERNELLFLQQEKTNICEKIDSVDLNLGVSGEKLTQLKIDLTKTFNNELT
                     TEEKKEIEILSKEILENQNKLNLTSETLSHLSVEIDTITAELESKLIPQQNDIKQKLL
                     DSSDSIIEQLLLDSEELEGRASEADNQLTIQKRALQSIEKEIESTKAEITNKERILEK
                     ANNQQRLLLKKLDEYQKDVDKTMIKKTTLATRKKEIEQKIREVGIISEDTLDKFKTLS
                     SEDLLLKLNEANKEISGMRNINKRAFENYKKFNEKQSELRERATELDDSKQSIQDLII
                     KLKEQKLNAVDKTFDKVSKNFVMIFEKIVPRGTATLNIHRINLQGTDDNSELFTQSNE
                     HTTPYEGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEID
                     AALDKQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYENKQSSVIEVTKE
                     EAKRFIKGGNKLSEI"
     gene            <261006..>262976
                     /locus_tag="CAGL0H02827g"
                     /db_xref="GeneID:2888491"
     mRNA            <261006..>262976
                     /locus_tag="CAGL0H02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446917.1"
                     /db_xref="GeneID:2888491"
     CDS             261006..262976
                     /locus_tag="CAGL0H02827g"
                     /inference="similar to AA sequence:UniProtKB:P40358"
                     /note="similar to uniprot|P40358 Saccharomyces cerevisiae
                     YJL073w JEM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446917.1"
                     /db_xref="GeneID:2888491"
                     /db_xref="GOA:Q6FS77"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FS77"
                     /translation="MVVLRKLFGLVPLIGFTIAESTCEYKALSNEAQSLKNDIDSLNS
                     YDTLISIVEECLVADKHKDYDDLIKLSYQLYYKNGLIQLSAGRYHKAVALFERALGGN
                     TNTGDSYFLLIAKKLQQIYIDFGLWSNITSTTLPITEKIDPALKETYEERQRVYHDTL
                     NRIKETFSKNKNEQHLEELFDSLTEISPYNREVIYMAIDYYNANIITNNRVDLTRVIK
                     LKEKYETLLEVHSTSLTLNERLETHFKISVIQIFLLGQDPLIQGSSSHLRRCLNIDMD
                     YGPCKDLIKLSSRLNKVNPDMRLVKDPEAYKNGHIIIEDWKNVVDFYINNKPSLKLFT
                     LMKGAKFDTKTNYDLLKRLQFHLLSTLTGQQEQPEKLITMFFVNLDVILCQASSFLSK
                     KDKKETSKMCLHALSSIGLETKEAYRESLSNGSPLPAETVIDLWNSYPHMLIYTMTNI
                     VKKYGKKQRGSDNLVEQVSKFWNENNLRESKNPYVVNLNNLMEKVDKNKREQQFRQQQ
                     QQQQRFFQQQQQQQQRYQQQQASGLTDSQTAKNYYQILGIKPEASDKEIRKAYLSLTK
                     KYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDEEKRKEYDSIRSGSRQFQPRNNF
                     RTNQRRGGYQGFQGGFPGGFPGGFPFGSGFGF"
     gene            complement(<263305..>263952)
                     /locus_tag="CAGL0H02849g"
                     /db_xref="GeneID:2888574"
     mRNA            complement(<263305..>263952)
                     /locus_tag="CAGL0H02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446918.1"
                     /db_xref="GeneID:2888574"
     CDS             complement(263305..263952)
                     /locus_tag="CAGL0H02849g"
                     /note="highly similar to uniprot|P40359 Saccharomyces
                     cerevisiae YJL072c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446918.1"
                     /db_xref="GeneID:2888574"
                     /db_xref="GOA:Q6FS76"
                     /db_xref="InterPro:IPR007257"
                     /db_xref="InterPro:IPR016906"
                     /db_xref="InterPro:IPR021151"
                     /translation="MALPAHLQETFSPEEVQFLVEEETVKIFPRITTRQKRRDKNRGA
                     YGDVDTKWSMLTTENDNLNNMVAMRSTEVKLWIALLLKQQNKCSIVAPSWLTLRELNR
                     KIQQETNNSDRFCDLPWNWLVIANVLFAKAADDFHDPVHELRSKVQDLREIRQTKVLK
                     GLKQLNASHLQLDNLSLLEINELRPFIVRTMDKLREIHDSANTDGGVVDGDEEEI"
     gene            <264299..>265999
                     /locus_tag="CAGL0H02871g"
                     /db_xref="GeneID:2888569"
     mRNA            <264299..>265999
                     /locus_tag="CAGL0H02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446919.1"
                     /db_xref="GeneID:2888569"
     CDS             264299..265999
                     /locus_tag="CAGL0H02871g"
                     /inference="similar to AA sequence:UniProtKB:P40360"
                     /note="similar to uniprot|P40360 Saccharomyces cerevisiae
                     YJL071w ARG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446919.1"
                     /db_xref="GeneID:2888569"
                     /db_xref="GOA:Q6FS75"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011190"
                     /translation="MWAHLFKHGFKYEQQNSLSKSLILSVLNSTATKREAKDYLIKYA
                     NGSSNYHYLLLIRNIATQSERSLHRLSDSIRRLKFLGISPVCVLLPSGRIQTEVEKMD
                     KLITLSQLKPLVLDYGLSRAFDGSYESIMQTALDTEYCTTRGIVPIVKPYIYDQSTAS
                     RGLISDPVLFMDQLSRDSSLKFDKFFILNRSGGIPSGERNQNSHIFINLSQEYQKIHR
                     TLTSSIRTIVERQPRSEDLLDRLELYVRESDIISLEAEYKEHMENLQLMNTVLSNLSS
                     SATGVITTINAASSPSDTVNPLVHNLLTDRSIISSSLPRFKNKSGNFLSPSGQDWYEM
                     PVEIETDEETLQGEDSVFVTTVLKKGVDIKEFDYSHLTSENTVNLPKQFQIKLHDEST
                     YNNSCSKYKLDLVKFKNIIDKSFGRELDLNHYLNRINGKIASIIIIGDYEGIAILTYE
                     GPPDNKFVYLDKFAVLPHLKGSLGISDIIFNLMFKKFPREVVWRSRANNVVNKWYFQR
                     SVAVLDLSMELDEGDMQESEFKLFYHGDPESSLKSIVAIDRLRDLAKYVRNIKPSWVK
                     "
     gene            complement(<266139..>268742)
                     /locus_tag="CAGL0H02893g"
                     /db_xref="GeneID:2888894"
     mRNA            complement(<266139..>268742)
                     /locus_tag="CAGL0H02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446920.1"
                     /db_xref="GeneID:2888894"
     CDS             complement(266139..268742)
                     /locus_tag="CAGL0H02893g"
                     /inference="similar to AA sequence:UniProtKB:P40361"
                     /note="similar to uniprot|P40361 Saccharomyces cerevisiae
                     YJL070c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446920.1"
                     /db_xref="GeneID:2888894"
                     /db_xref="GOA:Q6FS74"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006329"
                     /db_xref="UniProtKB/TrEMBL:Q6FS74"
                     /translation="MAPSVLQRRPSLLHDDYEHAVTADSTAKIADSLKGKGIVPSANL
                     NKLVQTNKISIDDLDMISLGTAFDQQMEAGSPMYWDPQGEEEIRTKCSTISDNPMLNI
                     LKGIEHVSYNARPVRAREIDSADVDAENNPFNKIVMSRTKYVVNSYQNSASNVKFDDK
                     RAFVYPKPLPKFWKYENDKRLTLEEQKEEKQSYYVSARNEFDDEEDLINLPEAVKPNQ
                     TSAKFLGGVHHTGEFFDYDLYKKALKKHKKKIDDDNASDPSRKFCDFNFYQKIPDFAE
                     FREDFDFVVELLQNNHFDNLAKKRISYLNDKFELFQHLKSKTEILENKKVPYRDFYNS
                     RKVDCNFLLSGCITQRQLSEFIWEKLNKEPERIVYKFSTGETIKLSELFEIGCTSAEP
                     IALGLKIVDDDFLEWYETVYLQQFHLIPSREADVQLEGKELRFFLLAKTFLEFDNILE
                     GEYFAEVFIKYTVHTWEKSKYQLGQVSVDFQFYDSQEDNWWYKFSNWIKRWNLISYNI
                     RWNVQISRVYSKLFKLGRVTCFNDMLDMIFKPIFDHTNNSDNNPDFHYFITNICSLDL
                     VISENDDYLWKEFSDINQTPAEWVAQGDNPPVAYYMYYIYQRLGHFNYMMNRRSEPCI
                     TLRCYCSDLDNRSSQFTDRYITDQTESLICNLLLCNGGLMNAEYIWSAPALLTYLFYL
                     LQVPVIIAPLSSVTMPSMQLERQGRKYKSDLSSLTGFCQGEITKRDITVSDDHSYGSN
                     PFMRMFKLGMKTSLSSNSVLFNSSYTMEPMIEEYSVAASIYLLNAADLCELARNSVIA
                     CGYEGWYKAHWSGISVRPDKYFKENVGGVDVWYDTAEDTSIKHNVPMIRRQYRRDTLD
                     QEWDFLEELFN"
     gene            269346..269417
                     /locus_tag="CAGL0H02915r"
                     /db_xref="GeneID:2888549"
     tRNA            269346..269417
                     /locus_tag="CAGL0H02915r"
                     /product="tRNA-Cys"
                     /note="tRNA Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:2888549"
     gene            complement(<269645..>271477)
                     /locus_tag="CAGL0H02937g"
                     /db_xref="GeneID:2888885"
     mRNA            complement(<269645..>271477)
                     /locus_tag="CAGL0H02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446921.1"
                     /db_xref="GeneID:2888885"
     CDS             complement(269645..271477)
                     /locus_tag="CAGL0H02937g"
                     /inference="similar to AA sequence:UniProtKB:P40362"
                     /note="similar to uniprot|P40362 Saccharomyces cerevisiae
                     YJL069c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446921.1"
                     /db_xref="GeneID:2888885"
                     /db_xref="GOA:Q6FS73"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FS73"
                     /translation="MSKSAVDMKQVPPPDEEEELLAKLVFGDTTDFHSGLADFDTEFA
                     LNEEKKLNEEDNIADGESSSGSGEDEEGDAMEQLADDQLFYVDDGEGDGEEMDVDDNG
                     DSASDNDEGMTSDEEEEQAWVDSDDEKLSVPITSNNRTKKLRQNYQDSHISGADYVRR
                     LRAQFEKIYPRPQWADSISDSEGDLSDGDYDSNSEQLNSVINGDVNALSKILESTFTY
                     RDNITTKLLPEKSLDILRLKDANASHASHSAIQSLSFHPSKPLLLSGGYDRTLRLYHI
                     DGKSNPLVTSVYLKGTPVQTCCFYVSHNNTSSKLPQEQKIYTGGRRRYMHSWDLSASF
                     NNARSEKAASVAKIDKFSRMYGHEETQRSFEKFKVGYLYNFTTNSSQGIVVLQGGSGW
                     INIIDANSGVWITGCKIEGNLVDFCIDYQPISKGRFQTILIVTNTYGEIWEFNLSKNN
                     EIIRRWKDNGGIGITTIQVGGGTSSDHLLPMSSRKIRQNRWLAIGSESGFVNVYDRSA
                     IRSNADLKNAAISPIATLDQLTTSISSLNFSPDGQILCMSSRAIKDALRLVHLPSGKV
                     FSNWPTSGTPLGKVTSVAISSNGEMLAVGNEQGKIRLWRLNFYQ"
     gene            <277540..>278319
                     /locus_tag="CAGL0H02959g"
                     /db_xref="GeneID:2888891"
     mRNA            <277540..>278319
                     /locus_tag="CAGL0H02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446922.1"
                     /db_xref="GeneID:2888891"
     CDS             277540..278319
                     /locus_tag="CAGL0H02959g"
                     /note="some similarities with uniprot|P53147 Saccharomyces
                     cerevisiae YGL096w TOS8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446922.1"
                     /db_xref="GeneID:2888891"
                     /db_xref="GOA:Q6FS72"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR008422"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q6FS72"
                     /translation="MESVQTTLPSIRSIIDSLSKDTETTGGRGVYDSNPRNVNYTDYN
                     RQQNRLNLLDYQSLKDVPVKSSYSWGALPHEFKVTKPYHRSGKVNLVIRREESQPLSP
                     PYSPNGSIGLSAAIPMKLCSSTSSSVSTTSTTTLTSVNSPPSSVSSSPSASSPEVGQG
                     AVKKRANLPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRR
                     KVFADYYDITNQKRIVSAGVVKKQLPDASKRRTAMDRVHSS"
     gene            279537..279608
                     /locus_tag="CAGL0H02981r"
                     /db_xref="GeneID:2888547"
     tRNA            279537..279608
                     /locus_tag="CAGL0H02981r"
                     /product="tRNA-Glu"
                     /note="tRNA Glu (TTC) cove score=62.99"
                     /db_xref="GeneID:2888547"
     gene            complement(<279887..>281656)
                     /locus_tag="CAGL0H03003g"
                     /db_xref="GeneID:2888593"
     mRNA            complement(<279887..>281656)
                     /locus_tag="CAGL0H03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446923.1"
                     /db_xref="GeneID:2888593"
     CDS             complement(279887..281656)
                     /locus_tag="CAGL0H03003g"
                     /inference="similar to AA sequence:UniProtKB:P38932"
                     /note="similar to uniprot|P38932 Saccharomyces cerevisiae
                     YGL095c VPS45 vacuolar protein sorting-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446923.1"
                     /db_xref="GeneID:2888593"
                     /db_xref="GOA:Q6FS71"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:Q6FS71"
                     /translation="MNLFDVGHFYIDRMVNSKSKGGVADITERSRIKALLLDKNTKST
                     ISMCATQSELLHNEIFLIDTLENENRDPERHLRCIVYVKPTNDSIEFLSRELRDPKYG
                     DYHIYFSNSVSKAQLEKLAESDDMEAVSKVEEIFQDYFILNEDLFSFDINPAELTINN
                     SNVWGETSLTNCKDSLVSLLLSLKLKPDIRYEVNSKRCTKLANELAKIIEQNEKTLFH
                     FPNMDTPPLLVLLDRESDPLTPLLQPWTYQSMINEYVGLKRNVVDLSGMPGIDQDLQK
                     VTLSSMQDRFFYETMYMNFGELGDQVKNYVDSYKLKSQSTSQINTIEDIKNFIEKYPE
                     FRKLSGNVSKHMSIVGELDRQLKELNIWEISEIEQNLSVHRDNTEDFQGLQDMLRNQK
                     INNYYKVKLVCIYITKHFDLKDRINVLIKTISETVSPQEINFLHRFQKIIEEYNNHLN
                     SSANSAEGEGKRDDLLSELAKKFNTRMASKGFLNNTQKSNNNVYMQHIPEISTILSNI
                     SKSTLSKERYGFIGNNGVNSRLVDNNSARDVVIFVVGGVTYEEARFVHQFNETMKNKM
                     RVILGGTSVLSTRDFMDSMRNKV"
     gene            complement(<282101..>285382)
                     /locus_tag="CAGL0H03025g"
                     /db_xref="GeneID:2888907"
     mRNA            complement(<282101..>285382)
                     /locus_tag="CAGL0H03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446924.1"
                     /db_xref="GeneID:2888907"
     CDS             complement(282101..285382)
                     /locus_tag="CAGL0H03025g"
                     /inference="similar to AA sequence:UniProtKB:P53010"
                     /note="similar to uniprot|P53010 Saccharomyces cerevisiae
                     YGL094c PAN2 component of PAB1P-stimulated poly(A)
                     ribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446924.1"
                     /db_xref="GeneID:2888907"
                     /db_xref="GOA:Q6FS70"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /translation="MNNWQHSFNNARPLDEHLHKPYLQYDGIEKHLTKFIFDDHANLV
                     WTGDTYGCVSSYDVNFQPYVRQRAHIGGSPVKDLMSHSSGVLSLSSDSLHLQDRRGTT
                     LLNLTNIDIAAFNDLQTMCYMSADQTSKVYCAGTDIGTGLSLIDLQRGTLETNIPYFS
                     KVNFIKSSKKLAAIGKLSGSIDLFDPGSNQVIKSFISHSSCITSMDIQDYTLVTTGQS
                     NGFYNTFADPFVNVYDLRTMRQLPPISFSKSTSMGTVGADFVQLHPVLPTIVMIASSS
                     GAFDFVDMANPSLRTQFANPGNGIKCIRLSSNGDHLGVLESNDMFSTWKRPNSSVNFT
                     NMPELLTYPSYPNDGPLANISIDDYNYPLSTVGMPYYQEKLLSTWSTVIFRSPGTVPR
                     DIDKILTDLKNSKKSKKLVADGVNFYPYSVAKYGHKDALQPYISLRDKRYQRSTGSVP
                     DDVLITKSVDGELPPAFKNLPLVVTKYATDSFDFESVNKTPYCGLDNDVDNPFTNALI
                     QLYRFIPEISNFLISTLKHEHFESPLLTDMAYLFDMMRNTIDGICRTTNYQMSLNDVL
                     EKNNLSLHTISESNMLQKINSLSLNDDGGKKQLSIQELNDFLLSELCEEEVKFIDQNF
                     VLQHCYCCEFAVKTKGCMTYGQTSGSLYKPSITIGPNACTQKNGKVSYPHSILGYIEH
                     GLKNSIVLNKKCEQCGIKENLEEDISIQELPPILSLSLEFDDNAMKLAKTTKNWLPKE
                     FYASIMKNKPLVRGSVNDIRTNTMIYKYELHGYIARISDPDRGDHYVTFSRIYNEESK
                     MFRWYLFNDYLVTEVDESIVYDLGKHWLKPEVVIYGDAEELRKPFNYLKDVEIDDSIL
                     YKDYFSAAIRESIQKEYELLTRNEAPRPGSLIAIDAEFVTLKNEKYDIDCRGAKTVVQ
                     SKVSALARISVVRGNEEQFGVPFIDDYIIIEKNIDDYLTKFSGILPGDLDPKTSNKHL
                     VPRNVAYRKIWLLMQLGCTFIGHGLQNDFKHINISVPKEQIRDTAVYFLQGKRYLSLR
                     YLAYVLLDINVQEGNHDSIEDAYTALVLYKKYLELKSNGMMDQVLNKLYEEGRTTNYK
                     VPLKL"
     gene            <285868..>288093
                     /locus_tag="CAGL0H03047g"
                     /db_xref="GeneID:2888546"
     mRNA            <285868..>288093
                     /locus_tag="CAGL0H03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446925.1"
                     /db_xref="GeneID:2888546"
     CDS             285868..288093
                     /locus_tag="CAGL0H03047g"
                     /note="weakly similar to uniprot|P53148 Saccharomyces
                     cerevisiae YGL093w SPC105 spindle pole body protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446925.1"
                     /db_xref="GeneID:2888546"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="UniProtKB/TrEMBL:Q6FS69"
                     /translation="MKKSILKGSPTKIIRSEAETPDHNEGNESNKSNILQSQITQRVS
                     FLPDVTLHSFDISPTKNMATSTQKPAYENDGNASMDLTEPISLEVQAGASTTEPKEET
                     MEFTAPQNINNVENTLTAQLHSERTRKSQSELDLSTDIISQAMEMTQVLPNETNNLRK
                     ANNDANDAENEDGMEFTQIVPNIHEYSVKRRRLNDDTIEKLVSPATPPDNTSEQQIYG
                     SDSEIIEKMSPIKIIYATEQRPASVPKQLFDDKEPNLQSPHKSENHENEKTITHSFSL
                     KNFLSDIDYRLLENIKDIFKQKNTAITLNTLDYSIQQNLRLGQVNSVYHIDVPTWEIK
                     TFIINELRARINQSKSMDVLENDISKTLNINSIALKYTSQSEAGIDTSLKTILAVKEF
                     SEMETQRDWYEWRLKQLDGFREVLTDNLEILNEEYTNVKLELQKVKELKLKISDLKDT
                     LQREIRILTEVSYEKQKNGPSLDDKIKFAKIKKTLLHHQIEVNKHDEIQRKRQQLEDD
                     INSKTKQLIEINQSISKVTSKRKTINPMDIKKERTLLANFNLLQALSNIGCIRNSNDI
                     IVLEFKLLGGMKILIDNSIISANEPSGITLSPEFQREPLFRYLFEEIMKEIQVKVKQN
                     KKGNLFEMLISKVIDYIPIYNSFHLFSLIFNVKYEMENEVSKNLKISDIDYYSNANIS
                     YTIPINDILKCCRNNNSILSIKVRSESKISHDRVIKRITEKGSRIFPWLNNTNINLEI
                     L"
     gene            <288746..>292597
                     /locus_tag="CAGL0H03069g"
                     /db_xref="GeneID:2888637"
     mRNA            <288746..>292597
                     /locus_tag="CAGL0H03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446926.1"
                     /db_xref="GeneID:2888637"
     CDS             288746..292597
                     /locus_tag="CAGL0H03069g"
                     /inference="similar to AA sequence:UniProtKB:P49687"
                     /note="similar to uniprot|P49687 Saccharomyces cerevisiae
                     YGL092w NUP145 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446926.1"
                     /db_xref="GeneID:2888637"
                     /db_xref="GOA:F2Z6H6"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:F2Z6H6"
                     /translation="MFGKPSGAAFNFGNTSTPTNTPASSTTNPLGQSNPLNNNSINIG
                     TSTPSPSVGLFSNSSNNQQNGGLFGRTANGQQSSGLFGNNASAQQNSNLFGNSSSTQQ
                     NGGLFGNTNSTQQSGGLFGNKPQQQTGGLFGTSTAATNNVANSGLFGSSNTYKTQTTG
                     SLFDNKQGSLNIANSGTGLGLGNKTAGLFGNSSNTNNTSGLFGNNQPSGLFGNSSTSN
                     NILMNKPITNNLGANGQPQNNGILPTSNPYGFTMSSNTTPLTTMPEPLTGTLIKENSI
                     NTEKGASNNKRSASMSSAAPKNTSSYGQSTLISKLSSRLSSGQASKAIQGVFSPSSVK
                     PWLGEQTSKPNRPTDLKDNILGLTVIQNNSNKKIRDISNQRENLSELRKLKIDSSRSA
                     SKKLKLLSGGSHVTKSQNLDMTEGARKQNPSADTARNDFSPSSELKSYSIPKMPLNDE
                     NVNKNNSDYWCTPSPEQLRLLTSDQLSSVSNFVIGRRNHGYITYSMPVDLRKFSDNFE
                     INLFDNIVKFRSSKTVEVYPKNTEKPPVGYGINVPAVITLENVYPIDRKTKKYITDSS
                     RLTEFQKFAQKLRSLRDMEFISYNPFGGVWTFKVQHFSIWGLVNESDAEIDEDDDMED
                     ILDINKLSPQSNESQLNVSAINTGNLIDEKVYEPDIEEEDFEGLEQNEILDVAKNWDE
                     QLRLANQGRRSIFLLPTDRAENELDLLLSNFNDAKNKTREIEQERRLNTKKYNPCSFG
                     NGHLVIGDNRSRKILITNQVLVKDELPAVLTDRTIFDNELKTTLIHSRSSNNYPCVFK
                     KELIFKDVLQCILPTSESYKLWNFSSILFDPIQIDCPMEAKDATLKYKRRDNICNWIK
                     DHVRDNVYQKIKVSTTPLEKIFLHLLINEIETAAKIAIDSDNSHLSILISMLGSNDPR
                     LKALAHTQIEQWSGIGSNVEIYVAKIYKLLSGELFKGPFSLIENAEDVNWLVLVGAAL
                     HYGEVDELSLEDLIGNSMACLSDHCSGVFYLLLKLFCSTRNADQVLQEILKESNALGI
                     DFLWHCLQALESNGIADINNPFCDQITVQYAQNLELSGHIPEALYICAHIKDDHLAKK
                     LFESIIFSNIHHLTLDGKPLAIMSKLMVPNEVIYRSMAQYAKYRKCHQEELEYLLKSK
                     DTRLAKEVFITKVAPSYILGNDDSKLLSLTSMLEQFDRNSTQRNDLKVYDYYIQFKKN
                     SENSNIIKSLASELPQFYSKHQMFENVTACCNIISNNVLSAVLDLDNDSKTKEFSNLV
                     CNMPLGQPERKYATLHFCSRT"
     gene            complement(<292976..>293980)
                     /locus_tag="CAGL0H03091g"
                     /db_xref="GeneID:2888580"
     mRNA            complement(<292976..>293980)
                     /locus_tag="CAGL0H03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446927.1"
                     /db_xref="GeneID:2888580"
     CDS             complement(292976..293980)
                     /locus_tag="CAGL0H03091g"
                     /note="highly similar to uniprot|P52920 Saccharomyces
                     cerevisiae YGL091c NBP35 nucleotide-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446927.1"
                     /db_xref="GeneID:2888580"
                     /db_xref="GOA:Q874M2"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /translation="MSTEVISTSVVSEPTQEILPAEYSLDAPEPEHCPGPESEMAGKA
                     DACQTCENKDICESLPKGPDPDIPLITENLSGIKHKILVLSGKGGVGKSTFTTMLSWA
                     LSADDNLQVGAMDLDICGPSLPHMLGCTDEVVHESNTGWTPVYVAENLAAMSIQFMLP
                     EDDSAVIWRGNKKNLLIKKFLKDVVWDDLDYLVVDTPPGTSDEHISINKYMKESGIDG
                     ALVVTTPQEVALLDVRKEIDFCRKAGINILGLVENMSGFVCPNCKGESQIFKPTTGGG
                     EALCKELGIKFLGSVPLDPRIGRCSDEGESFLDEFPDSPATLAVLNVVEELRDAVGDV
                     "
     gene            <294578..>295441
                     /locus_tag="CAGL0H03113g"
                     /db_xref="GeneID:2888683"
     mRNA            <294578..>295441
                     /locus_tag="CAGL0H03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446928.1"
                     /db_xref="GeneID:2888683"
     CDS             294578..295441
                     /locus_tag="CAGL0H03113g"
                     /note="weakly similar to uniprot|P53150 Saccharomyces
                     cerevisiae YGL090w LIF1 DNA ligase IV interacting factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446928.1"
                     /db_xref="GeneID:2888683"
                     /db_xref="GOA:Q6FS66"
                     /db_xref="InterPro:IPR014751"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="UniProtKB/TrEMBL:Q6FS66"
                     /translation="MKGRIDPLYSHIEYISGNSSGLASNSGQLTMFQKTGEISRSIAV
                     LTVNEAKESEIDLFQVSKQLYCNLVKSNEDVKALNERIFQLEMNYDNLQSDFDEMVDN
                     IKRRDKLSRDVMIGLLNEKKARIRILTSLMERAGVSLPDGDKSDSELLNSHVQDAVSE
                     LNSPGKRRVAAWRDKKSIKRLEPVKKKLKIKEEESLPEIGSDFEDFEFFGISKSPEKK
                     HHLTTENHSGESSTSKDNSVAGGDTESDTSIKQETTNKVNTLALTNDVVAANSSEEET
                     DTDISTEKLTP"
     gene            complement(<295680..>296159)
                     /locus_tag="CAGL0H03135g"
                     /db_xref="GeneID:2888712"
     mRNA            complement(<295680..>296159)
                     /locus_tag="CAGL0H03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446929.1"
                     /db_xref="GeneID:2888712"
     CDS             complement(295680..296159)
                     /locus_tag="CAGL0H03135g"
                     /inference="similar to AA sequence:UniProtKB:P01149"
                     /note="similar to uniprot|P01149 Saccharomyces cerevisiae
                     YPL187w MFalpha1 mating pheromone alpha-1 precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446929.1"
                     /db_xref="GeneID:2888712"
                     /db_xref="GOA:F2Z659"
                     /db_xref="InterPro:IPR008675"
                     /db_xref="InterPro:IPR016326"
                     /db_xref="UniProtKB/TrEMBL:F2Z659"
                     /translation="MRFLRFISTVALLITGLATAQPVGEELGETVEVPSEAFIGYLDF
                     GATNDVAILPISNKTNNGLLFVNTTLYNQATKGEKLSDFTKRDANPDAEAEAWHWVKI
                     RKGQGLFRRSADASPEAEAWHWVRLRKGQGLFRRSADASPEAEAWHWVRLRKGQGLF"
     gene            complement(<297272..>297891)
                     /locus_tag="CAGL0H03157g"
                     /db_xref="GeneID:2888679"
     mRNA            complement(join(<297272..297680,297881..>297891))
                     /locus_tag="CAGL0H03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446930.1"
                     /db_xref="GeneID:2888679"
     CDS             complement(join(297272..297680,297881..297891))
                     /locus_tag="CAGL0H03157g"
                     /note="highly similar to uniprot|P53152 Saccharomyces
                     cerevisiae YGL087c MMS2 part of the error-free
                     postreplication repair pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446930.1"
                     /db_xref="GeneID:2888679"
                     /db_xref="GOA:Q6FS64"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:Q6FS64"
                     /translation="MSKVPRSFRLLEELEKGEKGLGPESCSYGLADADDITMTRWNGT
                     ILGPPHSNHENRIYSVSIECGPKYPDEPPTITFISKINLPCVDQSTGEVNKEKFNTLK
                     DWKRLYNMETILLDLRKEMASPANKKLVQPEEGSTFK"
     gene            <298166..>300139
                     /locus_tag="CAGL0H03179g"
                     /db_xref="GeneID:2888905"
     mRNA            <298166..>300139
                     /locus_tag="CAGL0H03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446931.1"
                     /db_xref="GeneID:2888905"
     CDS             298166..300139
                     /locus_tag="CAGL0H03179g"
                     /inference="similar to AA sequence:UniProtKB:P40957"
                     /note="similar to uniprot|P40957 Saccharomyces cerevisiae
                     YGL086w MAD1 spindle assembly checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446931.1"
                     /db_xref="GeneID:2888905"
                     /db_xref="GOA:Q6FS63"
                     /db_xref="InterPro:IPR008672"
                     /translation="MNNSGSGGSSPFVESPDLVSDGHLHTERKDTPIDVDNWKYKYDN
                     LLNQYEIEKVRWQKEQYDSEKSHEALHLQLEKARNEIDQLVESKRFLEAQLQSQHPQN
                     TQKEWSHEDNKVNNNSMNNDYMLLEEKYKSDVFHLDNSVNELKLELTSCRSLLKKYEE
                     VIEQQSEQIKEIKKTLKKKEQELDEIEVNRLKQAHNATNTEEIRQQTNENASFSNGYN
                     TLMSMKNSVNYWKNENQQLNQKLSEYSDIYQQLQEAQLEIMELKANLEEWNKFLSNKK
                     QQDNSNDYSIDHFIIEFESQRRELNMVTEELAEVKKSYYNSKILNDELALERNQLLKL
                     KDDYENNIINLEKLNHELEQQKVLLEEECSLLKNQIPTKENLNQQIRSTNRNDAEYDS
                     LLDNYKQETENLTNELKRLNDSLIEQNRNQGTEMKKRKLRNGDHININYSQRLNELQQ
                     NNLSLEKDNEKLRLVVEKLEGKLDDLRKTKPKNIRILQQRDSPLLKLQFVRRKENELL
                     REENQNLLTMIENITENRNESFDKIPLTSYNSLKYQYEISMDTNKKQEKKFSRLKQIF
                     NKKSLEFIDVVNSLLGFKLEFQQDGRVKIYSCYMPNKYLIANLVDNTLKSNLDTVISD
                     WDSLLNDWVVEKGQLPCFLASLTLQLWKMENDS"
     gene            <300358..>301131
                     /locus_tag="CAGL0H03201g"
                     /db_xref="GeneID:2888817"
     mRNA            <300358..>301131
                     /locus_tag="CAGL0H03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446932.1"
                     /db_xref="GeneID:2888817"
     CDS             300358..301131
                     /locus_tag="CAGL0H03201g"
                     /inference="similar to AA sequence:UniProtKB:P53153"
                     /note="similar to uniprot|P53153 Saccharomyces cerevisiae
                     YGL085w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446932.1"
                     /db_xref="GeneID:2888817"
                     /db_xref="GOA:Q6FS62"
                     /db_xref="InterPro:IPR016071"
                     /translation="MTNRSQDKHILVNRDALIDGTIVSVLVTGSAITLYKGYTCYLKQ
                     LTNASQIPTKVFRRKWLYGKVTSVGDGDNFHFFHMPGGVLGGWGWIRAVPKLTKNEKK
                     TASLSFHWGTNKLKQQNATYKNKRNLPTISVRACGIDAPECAHFGNPAQPYSEDALIW
                     LRHRILGKKLWIKPLKTDQYGRCVASIRIWTWLGYSDICLEMIKEGLAVVYEGKTGAE
                     FDGREGKYRRHEFIARAKKKGLWSQKRLQTPGEYKKRYQ"
     gene            complement(<301252..>302976)
                     /locus_tag="CAGL0H03223g"
                     /db_xref="GeneID:2888668"
     mRNA            complement(<301252..>302976)
                     /locus_tag="CAGL0H03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446933.1"
                     /db_xref="GeneID:2888668"
     CDS             complement(301252..302976)
                     /locus_tag="CAGL0H03223g"
                     /inference="similar to AA sequence:UniProtKB:P53154"
                     /note="similar to uniprot|P53154 Saccharomyces cerevisiae
                     YGL084c GUP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446933.1"
                     /db_xref="GeneID:2888668"
                     /db_xref="GOA:Q6FS61"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q6FS61"
                     /translation="MVLEKILPLVDVEHLDSRVLPRPVKGNKKSETTKTNTIIQNAGP
                     SRWGSMEFKFYYLMFVIVVPNMIWAGYRTSSEHNINYYKYQDLLSSGWLFGRKVDNSD
                     AQYRFFREHLIELAALLVLHTTIKRIVLALCPISKIRFDTIFGVLFLYGAYGVNSIRV
                     LAHVYIMFSIAHIFKNSKRLAILFTWVYGIGSLFINDKYYAYAFSNFSPSLRFLDEHS
                     KGLIPRWDVFYNFLLLRMISYNIDFLNRYNTTTSKSKEENIESKKENEMKEVLLYDDK
                     ARMNVILPVNDYNPLNHIAYITYAPLFIAGPIITYNDYIFQSRNKLPSLTKNFILWYA
                     ARFLCTLFLMELVLHFFYVVAISKRKAWEGDSPFEIAMIGLINLNIIWFKLAIPWRFF
                     RLWGLLDGIDTPENMIRCVYNNYSALAFWRAWHRSYNKWVIRYIYIPLGGSKSRIVTS
                     LAVFSFVAIWHDIELRLLLWGWIVVLFLLPEMFATQYFVQYSKKWWYRHICALGGALN
                     IYLMMIANLFGFCLGSDGMKKLLADMFGTCNGLTFLLLSFGSLFIGVQLMFEIREEEK
                     RKGIDLKC"
     gene            <303335..>305686
                     /locus_tag="CAGL0H03245g"
                     /db_xref="GeneID:2888890"
     mRNA            <303335..>305686
                     /locus_tag="CAGL0H03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446934.1"
                     /db_xref="GeneID:2888890"
     CDS             303335..305686
                     /locus_tag="CAGL0H03245g"
                     /inference="similar to AA sequence:UniProtKB:P53009"
                     /note="similar to uniprot|P53009 Saccharomyces cerevisiae
                     YGL083w SCY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446934.1"
                     /db_xref="GeneID:2888890"
                     /db_xref="GOA:Q6FS60"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FS60"
                     /translation="MVFWSSKSGINSKYTFSSSPTFTSDPWSVYTGRPKSSSALGRVS
                     LFQFDKKQFENYLLNYGIIKSKSSSQDKMLIQEAYQILKNQVNNLTKLKHPNILTVVE
                     PIEEHSKTFLFVTEYVTDCLESLYNNDSTNYGRFSDSGENILSSNGASLPDNILIQRG
                     ILQIVNALEFIHTRAGSVHLDLQPRSIFINENSDWKVSGLGHLVKLGDNLQGGMSTDF
                     FLPKYDPRIPSFMHINFDYSAPELIMDNTVSFKNDFFSLGLLIYFLYSGKSLLHIENS
                     ESQYKLEYNKFERKISTMSWDNVFSKVPPQLRVLIPKLMSRDIISRYDTLGDLLDSEF
                     FDNPLLKMLNFLDDLPTKNNSEKLVFLKGLDEYLDQFPSSLLQKKFLPILLDLLIQLC
                     QDKELDGECISHDISLIIKIASNLSQLSFHEKLYPIIVGNKENFNILLEKSNTILIEN
                     MKILQEKFKAADYDQNFLRPLLVYVLQTMQSESAVNSQEMLLNQLDLVLKTFDFPTVK
                     NFLLPLIAKLFVKTTSLTIKNSCVTSFQILIEKKSIDSYTVTEDLLPLFKTMKTRDPR
                     ILMKCLSLFKLVPSLVKDEVILVEQYLPLLWNYSMASTLNKSQFTEFTKVVNKISADI
                     QSIHINKLKEGSNENYEHDNSDKNKAFTKIIEAQSQPKREDRDTTLAKSIATPAIQPR
                     RKETPPKPSILDKRPITCSIPARRTNPSYNKSIPTASITSPPNDSQPQQSLDDEFDDF
                     VSAATTPKPHSINNNTSPVVTPSAPGLTSLPPGFSIPLQPKKN"
     gene            <306150..>308477
                     /locus_tag="CAGL0H03267g"
                     /db_xref="GeneID:2888823"
     mRNA            <306150..>308477
                     /locus_tag="CAGL0H03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446935.1"
                     /db_xref="GeneID:2888823"
     CDS             306150..308477
                     /locus_tag="CAGL0H03267g"
                     /inference="similar to AA sequence:UniProtKB:P38996"
                     /note="similar to uniprot|P38996 Saccharomyces cerevisiae
                     YPL190c NAB3 polyadenylated RNA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446935.1"
                     /db_xref="GeneID:2888823"
                     /db_xref="GOA:Q6FS59"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FS59"
                     /translation="MPESSETPIPDSNESVVNDVSHQTSVIEENSVNEHELENAMNQT
                     EDKQDEHRSNLEEYQSINQGENVHNKEGDSDEDENKDEDGDEDEDEDEEALARDLYSD
                     DQTIGNNGSSATTGNNEDQTVKEQDNENETSQEQYLQPSSEDEEELKNDDDDVVNNEP
                     TVLEDNLENTEFDGDHVNEQGTEDQNSSESKSTSNENETSGDVEQQQPANANIVAQIL
                     SESFEKENVDANLIEKQVKFIEDSHLLEKTQFQKLTDTEKITVVLKLLNSNTETKFQA
                     TNKKANAVVDSNGLRLFPKPDITKPMTPEESVRYNDYLKGENKITEMHSIPPKSRLFI
                     GNLPLKNVSKQDLFRLFSPFGHILQINIKNAFGFIQYDNPKSVRAAIECESQEINFGK
                     KLILEVSSSNNRPQYDHGDHGTNSSSTFISTSKRPFQHEDEEPVDMYAENNNAHKKPK
                     RRTPSCVIFVKRTADRNYANEVFNKFNNMTGLETDMVFLKPRLELRKLVNDAAYEGVW
                     GVILVNKTRNLDVQTFHPGPRGETKFDEYVSVSADDAAAIFNNLKVIKNRSGGMPPLA
                     GPQSGYPQQSVPNMMPQPQQGYYGNYNYGQQPKPQQQANFYPQMPTQNTSYGQPGMAP
                     AVQGYGAPTSQPPMNMGGGSYSRYDNSSMQQPMSNNQPMNQQQLLAAIQNLPPNVVSN
                     LLSMAQQQQQQPDSQQQILNMIQSMQTPQQNQQQQQQQQQPVNMPPQNSFGGNVQPSN
                     QPTNPVSPSAAANQQDQQPANNVQSLLDSLTQLQK"
     gene            <309091..>310248
                     /locus_tag="CAGL0H03289g"
                     /db_xref="GeneID:2888535"
     mRNA            <309091..>310248
                     /locus_tag="CAGL0H03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446936.1"
                     /db_xref="GeneID:2888535"
     CDS             309091..310248
                     /locus_tag="CAGL0H03289g"
                     /inference="similar to AA sequence:UniProtKB:P53155"
                     /note="similar to uniprot|P53155 Saccharomyces cerevisiae
                     YGL082w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446936.1"
                     /db_xref="GeneID:2888535"
                     /db_xref="GOA:Q6FS58"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:Q6FS58"
                     /translation="MDDYYSIKSIEFKGYHCRILLDQDEDYSALVALTNALVLSQGHN
                     RVTSQLKSIFDNCNEIAVEDLLDELANIGLQLGVMSNYGQDKEQLIATLKEFRKGLHI
                     NPKFNGSFTDSLETSVFSGFNVALVHGWVVDGDRDPTSYYHLSKYSYEEAQRVLVQAY
                     EIRKDQNGVALNTNAQQVLDDSAYIKSFLARSATQLTEYGLQHLKEILVEKSFAVLFR
                     NDRYFTLYKNAGELFILVTNPSQSRNNNIVWQSLHSVNGARDLYYNGVFVEINPDNDQ
                     NTFDDVVVPQSNPFSDPQTNQEFQNIDRNDTFDAQQVEDDELLARQLQEEEDRQAAGL
                     MQNAYRRNGPRNKYQIDDESKKKKKRNSIIPKMPSLGKKKKDGKDKNCIIM"
     gene            <310699..>311430
                     /locus_tag="CAGL0H03311g"
                     /db_xref="GeneID:2888480"
     mRNA            <310699..>311430
                     /locus_tag="CAGL0H03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446937.1"
                     /db_xref="GeneID:2888480"
     CDS             310699..311430
                     /locus_tag="CAGL0H03311g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446937.1"
                     /db_xref="GeneID:2888480"
                     /db_xref="GOA:Q6FS57"
                     /db_xref="UniProtKB/TrEMBL:Q6FS57"
                     /translation="MPSVIGIIRFQINKGGKKQKVALVGRSSKSRLVKFNGNNIPKIC
                     IDDPLISSLHALISAKLQTRKTNITQLDIIIKTISHSAILVDTISHRIVPKLVIRDGE
                     RFGLIPGPASNNQIEPKYMVQIHIILVDNEYGIYELQLFDVSSGIFSPIQLGIAAIKG
                     LEHHYDSSPNAYLYQKQTARLATKKMTKHVQKRIIKLRHQKNRNLLNKQMKHMFVGTL
                     VGTILGSCGVLGLIAYFGDEIESFL"
     gene            <312090..>312488
                     /locus_tag="CAGL0H03333g"
                     /db_xref="GeneID:2888843"
     mRNA            <312090..>312488
                     /locus_tag="CAGL0H03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446938.1"
                     /db_xref="GeneID:2888843"
     CDS             312090..312488
                     /locus_tag="CAGL0H03333g"
                     /note="highly similar to uniprot|P53158 Saccharomyces
                     cerevisiae YGL079w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446938.1"
                     /db_xref="GeneID:2888843"
                     /db_xref="GOA:Q6FS56"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:Q6FS56"
                     /translation="MSQPVQRAATRSIIQKYINKETLKYVFTTHFWGPVSNFGIPIAA
                     LYDLKKDPTLISGPMTLALVAYSGVFMKYALAVTPKNYLLFACHFINESAQLGQGYRF
                     IDFNYFKSDEEKNKIIEEYKVKAEQANEKK"
     gene            <312934..>313545
                     /locus_tag="CAGL0H03355g"
                     /db_xref="GeneID:2888863"
     mRNA            <312934..>313545
                     /locus_tag="CAGL0H03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446939.1"
                     /db_xref="GeneID:2888863"
     CDS             312934..313545
                     /locus_tag="CAGL0H03355g"
                     /inference="similar to AA sequence:UniProtKB:P53158"
                     /note="similar to uniprot|P53158 Saccharomyces cerevisiae
                     YGL079w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446939.1"
                     /db_xref="GeneID:2888863"
                     /db_xref="GOA:Q6FS55"
                     /db_xref="InterPro:IPR019371"
                     /translation="MSDEIEDRPRTRSRTPSVDTQSYTINEEAHHIITDSDSSSSENE
                     DGEGNETNSSDDSSESGSVERFLDEIVPTTSTSFIPNDTPDPATLFDITEYIFDSIVQ
                     STNACDFSEAFALQAKTSAVINSKSMELKNLIEQTKVRLPELQAKFKNGTQTLRTIRK
                     NLDNAKSRIQVMNDVLQTDYPIEFNQARDKILERTLDSDEEVI"
     gene            complement(<313755..>315377)
                     /locus_tag="CAGL0H03377g"
                     /db_xref="GeneID:2888822"
     mRNA            complement(<313755..>315377)
                     /locus_tag="CAGL0H03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446940.1"
                     /db_xref="GeneID:2888822"
     CDS             complement(313755..315377)
                     /locus_tag="CAGL0H03377g"
                     /note="highly similar to uniprot|P20447 Saccharomyces
                     cerevisiae YGL078c DBP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446940.1"
                     /db_xref="GeneID:2888822"
                     /db_xref="GOA:Q6FS54"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTVEESKKRKLTDDVAIKQNEKKIKKDKKVKDKKDKKDKKDKKD
                     KKEKKEKKEKKEKNDKKDKKDKKDKKAEQVDKLSETTEQPSKQVKIGAYVENEELSKQ
                     PQSVIDEFFKENEVSVEDPSKLNLRPLLAFNQISLDKEVQNEIAKFPKPTPIQAVSWP
                     YLLSGKDVIGVAETGSGKTFAFGVPAINNLLTSSSKPKGIKVLVISPTRELASQIYDN
                     LVLLTQKVGIDCCVVYGGVPKDDQRRQIAKSNVVVATPGRLLDLIEEGSVDLSPVDYM
                     VLDEADRMLEKGFEEDIKRIIGQTKSKDRQTLMFTATWPKEVRELASTFMKEPVKVSI
                     GNRDELSANKRITQIVEVVDPRSKERKLLDLLKKYQSGPKKNDKVLIFALYKKEASRV
                     ERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVIN
                     LTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDLIK
                     FGTHTKRKEHGAYGAFFKDIDMSKKPKKITFD"
     gene            complement(<316110..>317780)
                     /locus_tag="CAGL0H03399g"
                     /db_xref="GeneID:2888497"
     mRNA            complement(<316110..>317780)
                     /locus_tag="CAGL0H03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446941.1"
                     /db_xref="GeneID:2888497"
     CDS             complement(316110..317780)
                     /locus_tag="CAGL0H03399g"
                     /note="highly similar to uniprot|P19807 Saccharomyces
                     cerevisiae YGL077c HNM1 choline permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446941.1"
                     /db_xref="GeneID:2888497"
                     /db_xref="GOA:Q6FS53"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004756"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:Q6FS53"
                     /translation="MSPRDIERTSITSQQDSILDGQFEAKNGKKIIEQEQSIDGEVHL
                     RKSFSLWSILGVGFGLTNSWFGISASMVTGINSGGPMMIVYGIIIIALISVCIGVSLG
                     ELSSAYPHAGGQFWWSLKLAPTKHKRFAAYLCGSFAYAGSLFTSASTTLSAATELVGM
                     YVLTHPEFTPKRWHIFVCFELLHLFLMLFNCYGKSLPLISASSLYISLTSFFVITVTV
                     LACSSGKFNDAKFVFATFYNETGWKNSVIAFIVGLINPAWSFSCLDCATHMAFEVEKP
                     ERVIPIAIMGTIAIGFLTSFCYVIAMFFSIRDLDALLASNTGAPILNIYEQATNSKAG
                     AIVLGCLVLITSFGCIIACHTWQARLGWSFARDNGLPYSKYWSQVNPNAGVPLNAHLM
                     SSALIALIGVLYLASTTAFNSLITGCIAFLLLSYIIPVICLLMRKRQIRQGPFWLGKF
                     GLFSNIVLLGWTLFAIVFFSFPPVLPVSKDNMNYVSVVIVGYTVYAIAYWEFKGKKEF
                     HAVEEEESEDDIDVNESNIEIINDYHDSNSVNNIIHHHYDKVGLDTKH"
     gene            complement(<319316..>320386)
                     /locus_tag="CAGL0H03421g"
                     /db_xref="GeneID:2888827"
     mRNA            complement(<319316..>320386)
                     /locus_tag="CAGL0H03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446942.1"
                     /db_xref="GeneID:2888827"
     CDS             complement(319316..320386)
                     /locus_tag="CAGL0H03421g"
                     /note="weakly similar to uniprot|P53159 Saccharomyces
                     cerevisiae YGL075c MPS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446942.1"
                     /db_xref="GeneID:2888827"
                     /db_xref="GOA:Q6FS52"
                     /translation="MSEVDVPELLFERVWLQVDRDRDGFIYAKQMPSFITQCEQVIKD
                     TVNTNKTDFHMTRFKNRLKLPLLPKLHMDLIDAFAKETPYYKIYKESFSDMLNKLTGN
                     NFSTVINKIFEDCDGFPASFISALEVKADVKSSPRSKADSLGSPIKVDLLRNLKPQEE
                     PETPRRINRKYKSLELQLESMKRELEDKEKTIMNNERNLTELRSTISKLKEKYDLLSE
                     EYEQRHIHGGNNGTAIKHDVVIGELKSRLQEQNRLIRILQEQIQFDPQLKRETRVHDN
                     KSKNNTFNGAIAYVIPFLLFIFVIRSLITKEDIGDATMALPWWERNNLASRLAWYFRD
                     VFSNDSAKFLESDAYDKVFGIH"
     gene            <320888..>323008
                     /locus_tag="CAGL0H03443g"
                     /db_xref="GeneID:2888590"
     mRNA            <320888..>323008
                     /locus_tag="CAGL0H03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446943.1"
                     /db_xref="GeneID:2888590"
     CDS             320888..323008
                     /locus_tag="CAGL0H03443g"
                     /note="weakly similar to uniprot|P10961 Saccharomyces
                     cerevisiae YGL073w HSF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446943.1"
                     /db_xref="GeneID:2888590"
                     /db_xref="GOA:Q6FS51"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6FS51"
                     /translation="MSEHNNENLNLHEGLNLDDDDLENMLKNPNLFTTSPGIDVESIP
                     SATNQNSVNGQDDKSGIKSQNSDTNEVIEDIVNPSIDPYVSTPHNDEMASPEDDIDSI
                     NNKDSNKLMTSLVRQNYGPHLGRDNADINSSNFRSHYQNLFDDNYLKTDMGSPVNKNK
                     RKREDDDDDQLYSSQILRGPLSPGGNAHKVDNRLMSYGSNNLNSRQQTPGMENTPSVL
                     NRRFQNKTRPAFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHS
                     NFASFVRQLNMYGWHKVQDVKSGSIQSSSDDRWQFENEFFVRGREDLLNRIVRQKGTS
                     ANATPGTQSNMKYGNGNQIRGLPNVNGQTLRLMNEANMGNTMDITAVLGELEQIKFNQ
                     MAISKDLMRINKDNELLWKENMIARERHRTQQQALEKIFRFLRNVVPHADQKLLMDVA
                     EPVSSRIEEAQDISDAPSVSSKSFDFDDGKEDRSRYIPLQDEDGKRPLYLLKNRTMSE
                     NSNKSSGGRLASTHNDSSGRISEIPFEEDDLSPPRHEVTDVGHISGQKNVAIDKLKAD
                     LHEQEARIKYLEDMVENKTLDSHLNDSMTMPMMPSPSTMLMHDMVEPSTIALGKEATD
                     TSEGKHHGHDQQGQVQGQDQVQGQDQMHSQDQQNDMSAIGGLSELSPGLSPGLSSGLS
                     PGFDIGDYLNSSQNHMTPMYEDKK"
     gene            <323129..>323524
                     /locus_tag="CAGL0H03465g"
                     /db_xref="GeneID:2888840"
     mRNA            <323129..>323524
                     /locus_tag="CAGL0H03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446944.1"
                     /db_xref="GeneID:2888840"
     CDS             323129..323524
                     /locus_tag="CAGL0H03465g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446944.1"
                     /db_xref="GeneID:2888840"
                     /db_xref="GOA:Q6FS50"
                     /db_xref="UniProtKB/TrEMBL:Q6FS50"
                     /translation="MSCRCPSTLENQLLWHNFKLIGRPSHRLYLLPLLCVCLSLLLHP
                     SYGPSFPACEQGRKKARKKKFRALVNCSLSLGQADNAIYIEHIDLILEKYSGAGTYTL
                     KLLPPERREFVLFLSEERFVGYSASASYL"
     gene            <324020..>325627
                     /locus_tag="CAGL0H03487g"
                     /db_xref="GeneID:2888849"
     mRNA            <324020..>325627
                     /locus_tag="CAGL0H03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446945.1"
                     /db_xref="GeneID:2888849"
     CDS             324020..325627
                     /locus_tag="CAGL0H03487g"
                     /inference="similar to AA sequence:UniProtKB:P22149"
                     /note="similar to uniprot|P22149 Saccharomyces cerevisiae
                     YGL071w RCS1 iron-regulated transcriptional repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446945.1"
                     /db_xref="GeneID:2888849"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:Q6FS49"
                     /translation="MDSNQLIHLDSVPNFKDKNEIKPWLQKIFYPQGIEIVIERSDSL
                     KVVFKCKAAKRGRKSQEELTEEERLRQEALAREHEMKRKSMGNKRCVSRYNHCPFRVR
                     ATYSLKRKKWSVVVLNNTHTHPLKFNPLSEEYKKFKEKLRADNDVDAIKMFDELEYRT
                     QHNLPLPTSIIPCDCGLTNEVKSFDVVLPKTMVPDELSVKASEISLKKVLEEDENCTF
                     LTNLKKSSAISKNKGVKRLKPKHSLSGNTETLRKNLLWKSNQIYYSETAVNSPMLDSS
                     PNLFGNQLSLSTPDLVAADAGSNGSQISTKAFSDFIDDPFTVGTNGNGADFQPFTASN
                     TGNAITNLDEIDFTNIFARSTNNNHKHPYNSTAIDRNDSPTSNAPLSVKNAYDGLDDC
                     WSIYMSPNTTHDDTPVDISPASSKLHNKMPRIPEQRSDSLQPNVRFNDTALKHESLFT
                     DDLINKSSPRHDVGDEFLFDKMLNKELTSLNEFTENKHSDYPVNAGSFNLDVFGPSVD
                     NNDSLSTLDFTKPMNDNFVKLEEDHIM"
     gene            complement(<326276..>326644)
                     /locus_tag="CAGL0H03509g"
                     /db_xref="GeneID:2888695"
     mRNA            complement(<326276..>326644)
                     /locus_tag="CAGL0H03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446946.1"
                     /db_xref="GeneID:2888695"
     CDS             complement(326276..326644)
                     /locus_tag="CAGL0H03509g"
                     /note="highly similar to uniprot|P27999 Saccharomyces
                     cerevisiae YGL070c RPB9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446946.1"
                     /db_xref="GeneID:2888695"
                     /db_xref="GOA:Q6FS48"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /translation="MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYIEEAGSPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFV
                     CLACSHIFTSDQKNKRTQFS"
     gene            <327227..>327757
                     /locus_tag="CAGL0H03531g"
                     /db_xref="GeneID:2888542"
     mRNA            <327227..>327757
                     /locus_tag="CAGL0H03531g"
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /transcript_id="XM_446947.1"
                     /db_xref="GeneID:2888542"
     CDS             327227..327757
                     /locus_tag="CAGL0H03531g"
                     /inference="similar to AA sequence:UniProtKB:P53163"
                     /note="similar to uniprot|P53163 Saccharomyces cerevisiae
                     YGL068w"
                     /codon_start=1
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /protein_id="XP_446947.1"
                     /db_xref="GeneID:2888542"
                     /db_xref="GOA:Q6FS47"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:Q6FS47"
                     /translation="MSLRLVAKRSIAVPRVSRLVVRPMLTRFNSTAAEAGVSEVDPKI
                     SKIVEDISKLTLLETSALVTELKSKLNIPDISFPAAGSAPAAAPADGAAKAEEAEEAK
                     PEEKTVFGIKLESFDAKSKAKIIKEIKGLLGLSLVEAKKFVEAAPKILKENVAKDDAE
                     KIKTTLEGLGAKVSLE"
     gene            complement(<328668..>330155)
                     /locus_tag="CAGL0H03553g"
                     /db_xref="GeneID:2888610"
     mRNA            complement(<328668..>330155)
                     /locus_tag="CAGL0H03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446948.1"
                     /db_xref="GeneID:2888610"
     CDS             complement(328668..330155)
                     /locus_tag="CAGL0H03553g"
                     /note="highly similar to uniprot|P29295 Saccharomyces
                     cerevisiae YPL204w HRR25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446948.1"
                     /db_xref="GeneID:2888610"
                     /db_xref="GOA:Q6FS46"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FS46"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFSF
                     KTVIMLALQMICRVQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFN
                     THRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYMLIYFCKGSLPWQGLKA
                     TTKKQKYDRILEKKLCISVETLCAGLPLEFSEYMNYCRNLKFDERPDYLYLARLFKDL
                     SIKLEYHNDHLFDWTMLRYTKAMVEKQKDVLMLDTSSTANANKESGNNNNESNTTSNT
                     KDSKNDSFNKVKLLAMKKFASHFHYCKNDDKHYPTPEEIKQQTVQNNNAAASLPPELL
                     SAIDKGMENLKQQQNQQQQQSQQVQMQPLASAELNQDQLPPQGPEPLLQRQRKETQGQ
                     FVPTQEPVNRATHYPPNVQTNNMPQVQQQNISPQNPKPSGDNIWL"
     gene            <331303..>332847
                     /locus_tag="CAGL0H03575g"
                     /db_xref="GeneID:2888598"
     mRNA            <331303..>332847
                     /locus_tag="CAGL0H03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446949.1"
                     /db_xref="GeneID:2888598"
     CDS             331303..332847
                     /locus_tag="CAGL0H03575g"
                     /inference="similar to AA sequence:UniProtKB:P53541"
                     /note="similar to uniprot|P53541 Saccharomyces cerevisiae
                     YNL012w SPO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446949.1"
                     /db_xref="GeneID:2888598"
                     /db_xref="GOA:Q6FS45"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q6FS45"
                     /translation="MLLSTGFLRGLDAMGLYHYSDYIAGISGGSWSVMDLVVNKFQLG
                     KLISGWDLSTSMLPGMPDVDIGDDDTDFISDMHLDHLLQPNIATQKRSLFKRDNVVPS
                     PLLKIKQILFPNNTLASENLFEKLSKFKNALQFYIDLHLHIRSKRINGFPISFTDYWA
                     QALVQNIKYRQLPTHLTYSKSVRTSNYFKNYLVPIPIIVANCRNGFLKNVIFEFTPWE
                     FGSWEQVLGLFVNIEYLGSRIINGVSHQCYKGLDDLGFIAATSSSIFNNALIYVWKLA
                     SKSSKDAIAAVKTVLAVFGLGTTKFESALQTSSQITAALDTDYAVYRHNPFYKYSNIK
                     NELAQNDYLYLVDGGEDGENIPIRTLVPRNVDMIMIMDSSSDKKNYANGDKLKIVLNQ
                     MKEKEGIYYRYPTKIVTSQKRPTIIGCKPPRTSDTKLAPILVYYPNSERSSTQVTNTS
                     TFKMIYTSEEQQLLIDHGYTLVTGHGEHDYQKCMACILVKRSYDQASIIPPKQCSICY
                     SKYCDS"
     gene            <333100..>333801
                     /locus_tag="CAGL0H03597g"
                     /db_xref="GeneID:2888850"
     mRNA            <333100..>333801
                     /locus_tag="CAGL0H03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446950.1"
                     /db_xref="GeneID:2888850"
     CDS             333100..333801
                     /locus_tag="CAGL0H03597g"
                     /note="highly similar to uniprot|P39931 Saccharomyces
                     cerevisiae YLR250w SSP120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446950.1"
                     /db_xref="GeneID:2888850"
                     /db_xref="GOA:Q6FS44"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q6FS44"
                     /translation="MKFSRSVFALLAVLVSANADVKAKDDVNVEVEKPPNGMSWEEWH
                     MDHEHELKKYTPEQFFALHDVKKKGYWDENDILGLYGLNRDEVIGAGDGMGEHDNSEK
                     IDETTAKNVVKFIMKLLDVNDDTRILRDEYLEFARRGKKLPDLGVGVGHHSDFEREYE
                     IHHWNKYHKDKDVNVKNVHKEDIEHELLHHEHDIEHQEKIQRGAARGTVITDDQLEAR
                     IELKNIPSRFKNGYF"
     gene            complement(<334111..>335553)
                     /locus_tag="CAGL0H03619g"
                     /db_xref="GeneID:2888621"
     mRNA            complement(<334111..>335553)
                     /locus_tag="CAGL0H03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446951.1"
                     /db_xref="GeneID:2888621"
     CDS             complement(334111..335553)
                     /locus_tag="CAGL0H03619g"
                     /inference="similar to AA sequence:UniProtKB:P53980"
                     /note="similar to uniprot|P53980 Saccharomyces cerevisiae
                     YNL011c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446951.1"
                     /db_xref="GeneID:2888621"
                     /db_xref="GOA:Q6FS43"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="UniProtKB/TrEMBL:Q6FS43"
                     /translation="MKVVVFSGGTATNSLTPCFNELSINQGEDLTYVLPISDNGGSTS
                     EILRVLGGPAVGDIRSRIVRLIEDPALTKLFGYRLPQDTQAAKDEWNKIVEGTHIIWK
                     NIPVESRDMARPFLINVQSELLKKSKNSNPFHFGKASIGNFFLTGVRLFLGSVDASIE
                     LMMRIGRANTHLNVIPCINTNHTHHISALLTNGEVITGQSQISHPSKPQEPQDKVEAK
                     KNNENISEETLSSNRGSSVSITKDKFVQLLENNDESSSLNQDTTDSVEESGNTWTDIN
                     DTEEEEFANPIYILPALKESQINFDKMDDCTLPAPIKRILYINPYGEEIRPVGNPRAV
                     AEIKQADMLVYSIGSLMTSLLPIIILGNIADVISETKSMKKVLLINNKYDRETFFLSG
                     ISYIKMVVDSMRRAIEVYRTSKDPSKTERKSIHINWNDLITDVVYLSEGEIKFNEDQL
                     NMKGIRCHEVKGKQMENEILTNILQKIHKL"
     gene            <336494..>337219
                     /locus_tag="CAGL0H03641g"
                     /db_xref="GeneID:2888815"
     mRNA            <336494..>337219
                     /locus_tag="CAGL0H03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446952.1"
                     /db_xref="GeneID:2888815"
     CDS             336494..337219
                     /locus_tag="CAGL0H03641g"
                     /note="highly similar to uniprot|P53981 Saccharomyces
                     cerevisiae YNL010w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446952.1"
                     /db_xref="GeneID:2888815"
                     /db_xref="GOA:Q6FS42"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR006384"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FS42"
                     /translation="MVKAVIFTDFDGTVTKQDSNDYLTDTLGFGKEERLKVFEGVLDD
                     TKSFRQGFSEMLESIKTPFPECIEILENKIELDSGFKDTFHWALENNVPVVVVSSGMK
                     PIIKDLLTKMVGEDSIHKLDIESNEVEIKDNKEWRIIYKDESPFGHDKSRTINAYKKK
                     FEADLKDGEERPVYFYCGDGVSDLSAAKECDLLFAKRGKDLVTYCKRQNVPFHEFDSF
                     SDILARMKEVLAGEKTVTELMQN"
     gene            <337533..>338789
                     /locus_tag="CAGL0H03663g"
                     /db_xref="GeneID:2888820"
     mRNA            <337533..>338789
                     /locus_tag="CAGL0H03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446953.1"
                     /db_xref="GeneID:2888820"
     CDS             337533..338789
                     /locus_tag="CAGL0H03663g"
                     /note="highly similar to uniprot|P41939 Saccharomyces
                     cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
                     uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
                     uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446953.1"
                     /db_xref="GeneID:2888820"
                     /db_xref="GOA:Q6FS41"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6FS41"
                     /translation="MAGKIKVKNPIVEMDGDEMTRVIWGMVKDKLIYPYLDVDLKYYD
                     LSIQHRDETEDRVTVDAAEATLKHGVAIKCATITPDEARMKEFHLKKMWKSPNGTIRN
                     ILGGTVFREPIIIPRIPRIVPTWNKPIIIGRHAFGDQYKASDAVIKEPGKLELVFTPA
                     SGQGNPKTIKVYDYKSPGVALAMYNTDESITGFARASFELAIKRKLPLFFTTKNTILK
                     KYDGRFKDIFQKMYDEDYKGKFKELGISYEHRLIDDMVAQMIKSKGGFIIAMKNYDGD
                     VQSDIVAQGFGSLGLMTSTLLTPDGKIFESEAAHGTVTRHYRQYQKGKETSTNSIATI
                     FAWSQGIIHRGKVDQTPDVRLFGEILERSTIDTVQIDGIMTKDLALILGKTERKDYAS
                     TEEFIDAVARRLKREFNSHFNKPSKL"
     gene            <339203..>340627
                     /locus_tag="CAGL0H03685g"
                     /db_xref="GeneID:2888607"
     mRNA            <339203..>340627
                     /locus_tag="CAGL0H03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446954.1"
                     /db_xref="GeneID:2888607"
     CDS             339203..340627
                     /locus_tag="CAGL0H03685g"
                     /note="highly similar to uniprot|P33322 Saccharomyces
                     cerevisiae YLR175w CBF5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446954.1"
                     /db_xref="GeneID:2888607"
                     /db_xref="GOA:Q6FS40"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FS40"
                     /translation="MSEEHIIKPETTSPSTNASEWPLLLKDYDKLLVRSGHYTPIPAG
                     SSPLKRDLKSYISSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCIDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLENLTGALFQRPPLISAVK
                     RQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALSENDNMVTLHDVLDAQWVFDNTRDESYLRKIIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEEGIELYDEVVLMTTKGEAIAVAIAQMSTVDLATCDHGVVAT
                     VKRCIMERDLYPRRWGLGPIAQKKKQLKADGKLDKYGRVNESTPEDWKKSYVPLDKSE
                     ASESSSDAKKVEEQVKEEVEEPKKEEKEDEKEDEEPKKEKKEKKEKKEKKEKKEKKEK
                     KEKKEKKRKAEDEGEEKKKKKSKK"
     gene            complement(<341230..>342279)
                     /locus_tag="CAGL0H03707g"
                     /db_xref="GeneID:2888807"
     mRNA            complement(<341230..>342279)
                     /locus_tag="CAGL0H03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446955.1"
                     /db_xref="GeneID:2888807"
     CDS             complement(341230..342279)
                     /locus_tag="CAGL0H03707g"
                     /note="highly similar to uniprot|P25294 Saccharomyces
                     cerevisiae YNL007c SIS1 heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446955.1"
                     /db_xref="GeneID:2888807"
                     /db_xref="GOA:Q6FS39"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FS39"
                     /translation="MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK
                     FKEISEAFEILSDPQKREVYDQYGLEAARNGGPAFGGAGGFRGGGFSSAGGAHAFSND
                     DAFNIFSQFFGGSSPFGAADDGFSYSSFGGMPGGMGGMHGGMGGGMHGGMGGGMGGMG
                     GMPGGFRSASSPQPEEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQL
                     KPGWKAGTKITYKNYGDYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKES
                     LLGFNKTIQTIDGRTLPVSRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYP
                     ISLTDKQRQAIDENF"
     gene            <342948..>343859
                     /locus_tag="CAGL0H03729g"
                     /db_xref="GeneID:2888493"
     mRNA            <342948..>343859
                     /locus_tag="CAGL0H03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446956.1"
                     /db_xref="GeneID:2888493"
     CDS             342948..343859
                     /locus_tag="CAGL0H03729g"
                     /note="highly similar to uniprot|P41318 Saccharomyces
                     cerevisiae YNL006w LST8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446956.1"
                     /db_xref="GeneID:2888493"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FS38"
                     /translation="MSVLLVSAGYDHTIRFWEALTGVCLRTIQHPDSQVNRLEITNDK
                     KLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSFQQDNKWMVTSSEDGTIKVW
                     DIRSPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDV
                     PLQSLSVASDGSMLVAANNKGNCYVWEMPNHTDASNLKPATKFKAHPSYITRVLLSSD
                     VKHMATCSADHTARIWSVEDNFNLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRL
                     WDLSTRDIIRQYGGHHKGAVCVALNDV"
     gene            complement(<344104..>347169)
                     /locus_tag="CAGL0H03751g"
                     /db_xref="GeneID:2888903"
     mRNA            complement(<344104..>347169)
                     /locus_tag="CAGL0H03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446957.1"
                     /db_xref="GeneID:2888903"
     CDS             complement(344104..347169)
                     /locus_tag="CAGL0H03751g"
                     /note="some similarities with uniprot|P48743 Saccharomyces
                     cerevisiae YLR176c RFX1 repressor of DNA damage-inducible
                     genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446957.1"
                     /db_xref="GeneID:2888903"
                     /db_xref="GOA:Q6FS37"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FS37"
                     /translation="MRDSNEKAGSYVRYTGDDSIPSSNTQSTVNQQQQYQNRQRQQMN
                     ILTAGQPTPDYNSQQVMNANQGRIYDRSQMTQYIPNANIPYGVIDNQTQQQQQQQQHD
                     YTMIRHQIPQQQQQRPFLPSLISDQHKGIINTNPMAPSNIHYQRVPIQLPYILEQRQH
                     VPNRLPSTMQQQYINASQIQEQHLIDDSNARALAASEGSLALQHPNFLGQVNLGSSSS
                     SGSTSGYLRGISDSASITSVSTPVSSVSAVTPLSSTSTHSGKRSMRITKPHSGKSQDG
                     KPTKGKRGRKPNSKNAKSLLSNTDSGHHSEHNTTPEIVAKKIAEENIDKTVGEFAVQV
                     REAELQVLNLDNQNGSKLEKQSAEQARERSKQAFASLWLMKNCILQPGAYVRRGRIFA
                     QYVSSCAQNGLKPLSQATLGKLIRSLYPKLTTRRLGMRGQSKYHYCGLKLTTDDSLSM
                     LLEQQQKTSSSRPPQLKRNVVHRHYSDSSLPGGNRNSPSPTSIIPNDRDIKTKLKDDW
                     SQNGVDQINSRRHLATKSVTRYSAPTIIGPSRDSPRLSDSPMSLTGSATTVSSTAQSD
                     FHLPIGGSATYFENGNIFYNPLTKNLSSFISTPGSRFVVSDAHSHHDGDVASAQQTEK
                     FDLQQRESRRPGLFWSKSVERWLFISDLLKDWLPGGEEESSVSGENKNSSSATGNITE
                     TEDTRIEDKDGEPVSGVDVDHDEKPDVKSDSDSTLEAGIVVVSGRRLPEIPLGIIPAG
                     TDTDITAALQSLYHIHCNTLFENVRFLNFERLANNLFLSSSGAISPQMYNLLISEELY
                     DWIIECDTLTYVAILNYISRMLLQFKSIDQTTQDKWEILANTFYDIISKSTIDLPSTL
                     VNKKLETVTTFLRLLKQQLKLLQTLRSLDDKYFGANCNTEELERSWEEKILPNALESL
                     ELISGNENYNIGSNLVKFFRENILTLLPNADNSDQHGMQTFFNDLCAFYQSMDGVTTF
                     QLADCTSQLFGKTVGNLVIDEESYTPAWLLLGSFSTQLTGYLSDLSKFV"
     gene            <354848..>355801
                     /locus_tag="CAGL0H03773g"
                     /db_xref="GeneID:2888608"
     mRNA            <354848..>355801
                     /locus_tag="CAGL0H03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446958.1"
                     /db_xref="GeneID:2888608"
     CDS             354848..355801
                     /locus_tag="CAGL0H03773g"
                     /note="highly similar to uniprot|P40693 Saccharomyces
                     cerevisiae YNL002c RLP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446958.1"
                     /db_xref="GeneID:2888608"
                     /db_xref="GOA:Q6FS36"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /translation="MSDITNEKKPLNSDPEILLRKRRNADRTRLEKQELARQRQEQRK
                     KEQIKNKKKFIRAESLVANSLATSREKERIKRISKLEHKKLKGDVSHLPSEKNFFLKV
                     TEKPQSEETDDLIDEDEEDGFEREKVAYNGEEQLLFVLRVKGPVAASIPHKAYRILST
                     LRLEEVNTAVFIKLTETTFSLLKIIAPYVIVGKPSLKSIRSLIQKRSKIVYKREDEEE
                     AKEIILNDNNIVEEKLGDCGVICIDDIIHEIATLGENFTKCNFFLQPFKLNREVSGFS
                     SLNKLKKLEQREVEKKTRKVSNASTAPIVQIDIDALIAKIN"
     gene            <356535..>357632
                     /locus_tag="CAGL0H03795g"
                     /db_xref="GeneID:2888798"
     mRNA            <356535..>357632
                     /locus_tag="CAGL0H03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446959.1"
                     /db_xref="GeneID:2888798"
     CDS             356535..357632
                     /locus_tag="CAGL0H03795g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446959.1"
                     /db_xref="GeneID:2888798"
                     /db_xref="GOA:O14429"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /translation="MAVTKTIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDH
                     HLIGGAAIDATGVPLPDEALEASKKADAVLLGAVGGPKWGTGAVRPEQGLLKIRKELQ
                     LYANLRPCNFASDSLLDLSPLKPEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDS
                     EKYSVPEVQRITRMAAFMALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQL
                     TVQHQLIDSAAMILVKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLP
                     DKNTAFGLYEPCHGSAPDLPKGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVKKVL
                     DSGIRTADLKGTNSTTEVGDAVAKAVRELLA"
     gene            complement(<358071..>359525)
                     /locus_tag="CAGL0H03817g"
                     /db_xref="GeneID:2888644"
     mRNA            complement(<358071..>359525)
                     /locus_tag="CAGL0H03817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446960.1"
                     /db_xref="GeneID:2888644"
     CDS             complement(358071..359525)
                     /locus_tag="CAGL0H03817g"
                     /note="highly similar to uniprot|P25374 Saccharomyces
                     cerevisiae YCL017c NFS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446960.1"
                     /db_xref="GeneID:2888644"
                     /db_xref="GOA:Q6FS34"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:Q6FS34"
                     /translation="MMSAAGRHVRRYTPGATLGAAAAAAKAIKMTDNVSLETHTDIQA
                     AAKEQADVRASAQGQSGDEVLKSGETVLHHAYKEDSGYGTRPIYMDMQATTPTDPRVL
                     DVMLKFYTGLYGNPHSNTHAYGWETNKEVETARDHVAKVIRADPKEIIFTSGATESNN
                     LAIKGVGRFYKKTKKHIITTRTEHKCALEAARGMINEGFDVTFLSVDNQGLIDMKELE
                     EAIRPDTCLVSVMAVNNEIGVMQPLKEIGALCRKNKIYFHTDAAQAYGKVPIDVNEMN
                     IDLLSVSSHKIYGPKGIGALYVRRRPRVRLEPLLSGGGQERGLRSGTLAPPLVAGFGE
                     AARLMHEEYNADIAHIDKLSSKLVNGLLSLEHTSLNGSAEKRYPGCVNVSFAYVEGES
                     LLMALRDIALSSGSACTSASLEPSYVLHALGKDDALAHSSIRFGIGRFTTEEEVDYVL
                     KAITERVKFLRELSPLWEMVQEGIDLNSIQWSGH"
     gene            <359987..>360835
                     /locus_tag="CAGL0H03839g"
                     /db_xref="GeneID:2888468"
     mRNA            <359987..>360835
                     /locus_tag="CAGL0H03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446961.1"
                     /db_xref="GeneID:2888468"
     CDS             359987..360835
                     /locus_tag="CAGL0H03839g"
                     /note="highly similar to uniprot|P38921 Saccharomyces
                     cerevisiae YNL003c PET8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446961.1"
                     /db_xref="GeneID:2888468"
                     /db_xref="GOA:Q6FS33"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FS33"
                     /translation="MLNGFLISLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFRNGG
                     YRGVYRGLGSAVVASAPGASLFFITYDTCKAETRGFFRGLLPSSNVADVVTHMFSSSM
                     GEIAACMVRVPAEVVKQRSQTHASHSSWETLREILKNENGEGVRRNLYRGWSTTIMRE
                     IPFTCIQFPLYEYMKKVWAELDESDRVEPWKGAVCGSIAGGIAAATTTPLDFLKTRLM
                     LCKKSIPLGTLVSTIYKEEGFKVFFSGVGPRTMWISAGGAIFLGIYETVHSLLSTNKK
                     PTRNEA"
     gene            complement(<361189..>362520)
                     /locus_tag="CAGL0H03861g"
                     /db_xref="GeneID:2888871"
     mRNA            complement(<361189..>362520)
                     /locus_tag="CAGL0H03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446962.1"
                     /db_xref="GeneID:2888871"
     CDS             complement(361189..362520)
                     /locus_tag="CAGL0H03861g"
                     /inference="similar to AA sequence:UniProtKB:P38922"
                     /note="similar to uniprot|P38922 Saccharomyces cerevisiae
                     YNL004w HRB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446962.1"
                     /db_xref="GeneID:2888871"
                     /db_xref="GOA:Q6FS32"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FS32"
                     /translation="MSEAQRSRSRSPVRRSLSSYATRRGFERPSNDGRPPAERGPRPG
                     SSRGGRGHERRRFNGAGPSERGGVNKFRRDKEKAARTKGDFGPRLARELDSTYEEKVN
                     RNYTNSIFVGNLTYDCTPEDLKDFFSQVGKVVRADIITSRGHHRGMGTVEFTSGEEVD
                     EAIRKFDGAYLMNRQIFVRQDNPPPESSSTHSSGSNSGHTTNVTKPKKAVKPQKKGYE
                     LMILNLPYSISWQTLKTMFKEFGDVLKANVEVDSTGMSIGVGNVIFKNQEDMVKAYEH
                     FNGFEIEGKVLEVRGQIPDPTQISSTRKTDDLTVNQDNEDIEMDIDTAEGGDEKALKA
                     DVSSDGGARAQNKFSSDDYVKTEDKSKIILCDNLPGATTEGDLYDLFETLGKVKTAGF
                     INTDNAGETVSAIVIYNEQDDAEVCYGRLQGYNYGGCDLKISYVKDKNIDY"
     gene            <362859..>363965
                     /locus_tag="CAGL0H03883g"
                     /db_xref="GeneID:2888661"
     mRNA            <362859..>363965
                     /locus_tag="CAGL0H03883g"
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /transcript_id="XM_446963.1"
                     /db_xref="GeneID:2888661"
     CDS             362859..363965
                     /locus_tag="CAGL0H03883g"
                     /inference="similar to AA sequence:UniProtKB:P12687"
                     /note="similar to uniprot|P12687 Saccharomyces cerevisiae
                     YNL005c MRPL2"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /protein_id="XP_446963.1"
                     /db_xref="GeneID:2888661"
                     /db_xref="GOA:Q6FS31"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /translation="MFSGLHTSKYACQVVVQIRTATKRAAGSRTSMKDSAGRRLGPKK
                     YEGQDVKPGEIIMRQRGTKFYPGENVKIGRDHTIYAVEPGVVRYYLDPFHPYRKFIGV
                     ALSRDMKLPKPHFEPNVRRFGRIELDNPKAIAKEENALSRKEYLSRDTLLKDLTEREA
                     KRHEMMDNYWNFISSELKLNIIPERKEMASNYLLRYRTGLKNGFDLQEAQFNAKYYLQ
                     QMLKLKAKRKEWNEEKLSEQLHNLDETTALLNKSVSFSNKWVIIPYISEEEKLTRKDE
                     LIKKLTELGTAIKSKSDKKAVLELFKDASHFLTQAQEVRLRRQFMKPVQPEIMNVNVA
                     EKADKKTTVIRRFNYEKSKIDIIPRTKTAFFKRL"
     gene            complement(<364290..>365192)
                     /locus_tag="CAGL0H03905g"
                     /db_xref="GeneID:2888632"
     mRNA            complement(<364290..>365192)
                     /locus_tag="CAGL0H03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446964.1"
                     /db_xref="GeneID:2888632"
     CDS             complement(364290..365192)
                     /locus_tag="CAGL0H03905g"
                     /note="highly similar to uniprot|P25605 Saccharomyces
                     cerevisiae YCL009c ILV6 acetolactate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446964.1"
                     /db_xref="GeneID:2888632"
                     /db_xref="GOA:Q6FS30"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="InterPro:IPR019455"
                     /db_xref="UniProtKB/TrEMBL:Q6FS30"
                     /translation="MIRTVLSNSVKRSLVRHSSSSTSAMTYKQLHKHTARPPLPVVDT
                     PAWDANSAVSSILYETPAPSRQPRKQHVLNCLVQNEPGVLSRISGTLAARGFNIDSLV
                     VCNTEVKDLSRMTIVLKGQDGVIEQARRQIEDLIPVYAVLDYSNSEIIKRELVMARVS
                     LLGSEYFEDLLVHHHKSTANLEDSHEIVSEIREKKFHPSNLQASEVLRLKHEHLNDIT
                     NLAKNFGGKIVDIGETSCIVELSAKPSRISAFLKLVEPFGVLECARSGMMALPRTPLQ
                     TEVDEEDIDGKISDIVDISQLPPG"
     gene            complement(<365612..>367018)
                     /locus_tag="CAGL0H03927g"
                     /db_xref="GeneID:2888689"
     mRNA            complement(<365612..>367018)
                     /locus_tag="CAGL0H03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446965.1"
                     /db_xref="GeneID:2888689"
     CDS             complement(365612..367018)
                     /locus_tag="CAGL0H03927g"
                     /note="weakly similar to uniprot|P25604 Saccharomyces
                     cerevisiae YCL008c STP22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446965.1"
                     /db_xref="GeneID:2888689"
                     /db_xref="GOA:Q6FS29"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:Q6FS29"
                     /translation="MSTPLPESVVQWLFKVIQPIYKQPKLVFHDAVQTLTEFKNLRPR
                     TRVFTDEDGSPRLLLCLYGGIPIEQGLDVPVLIWIPESYPIAKPLLFIDLELLDKDLQ
                     LATNESVEPDGRVHTRLLRQWNPQSANLFNVIQDLADMCNAIAPIQPVTFSSTVAPGT
                     TDAEKSPPVPPKPALPPKTTDNAIKFAGQTSSIPGPNGIPKIPERMPLQNPTQETDTT
                     IRPSKASINPTGNGTMGPPPLPEKPQQSNALHDQLRQLNLQEPPHHDDHANPVQNTQR
                     TFVNAVPNEVPMVDLLDSMDEKPVSDAYTQSLEKLKMTIHELSTLDQNYKKEQIESRI
                     PQLQTAIKQFDDLYNHESEKLNWIKSSIIESRESLQKGIEDVDKETLLVEKFIAENGT
                     TLDSNTVYTTEVPALDQLYTLVARDRALTDTIQVLARLLNCGALEFDAFIKKVRELAR
                     DQFMARLHIRKIIALLQE"
     gene            <368426..>369616
                     /locus_tag="CAGL0H03949g"
                     /db_xref="GeneID:2888638"
     mRNA            <368426..>369616
                     /locus_tag="CAGL0H03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446966.1"
                     /db_xref="GeneID:2888638"
     CDS             368426..369616
                     /locus_tag="CAGL0H03949g"
                     /note="highly similar to uniprot|P33309 Saccharomyces
                     cerevisiae YNL001w DOM34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446966.1"
                     /db_xref="GeneID:2888638"
                     /db_xref="GOA:Q6FS28"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6FS28"
                     /translation="MKIISITKDSANKEGATIVLLPEDKEDLFTVHQIIDKDDEVIFK
                     KKFTTNLDEAGKKKSTDLVKLRLKIVSSEFEMRDEYLRYKGVTVADDNGNSNVDIPVG
                     KFLSFTVNYSFPFTIIKQNFDSFMEKTLQNAANPESRSDTAAIVLQEGIAHVCLLTAS
                     STILKQKIEYSMPKKKRATDVMKFDEKTEKFYKAIYESIKKYYDFSKIKLILLCSPGF
                     YAKTLLEKITQYAQEERNKSIIDHQSLFLVAHCSTGYLQGISEVLKNPLYSTKLSDTK
                     YAKDAAIMDEFMEHLNNDDFKAWYGEAEVEKAAEMGAIKYLLITDTMLHNDDIKKRKK
                     FLALYENVESSGGKGVVFSTLHSLGEELDRMTGVACILNYPLPDLDEDLEDEESENDN
                     EFEI"
     gene            complement(<369916..>370704)
                     /locus_tag="CAGL0H03971g"
                     /db_xref="GeneID:2888585"
     mRNA            complement(<369916..>370704)
                     /locus_tag="CAGL0H03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446967.1"
                     /db_xref="GeneID:2888585"
     CDS             complement(369916..370704)
                     /locus_tag="CAGL0H03971g"
                     /inference="similar to AA sequence:UniProtKB:P25349"
                     /note="similar to uniprot|P25349 Saccharomyces cerevisiae
                     YCR004c YCP4 or uniprot|Q12335 Saccharomyces cerevisiae
                     YDR032c PST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446967.1"
                     /db_xref="GeneID:2888585"
                     /db_xref="GOA:Q6FS27"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6FS27"
                     /translation="MVKVAIITYSCYGHITTIAREIKKGVEAAGGEVTLFRVPETLPD
                     DVLEQMNAAEKPEDFLIANGETLTDYDAFLFGVPTRFGNVPSQWAEFWDKTGAIWVQG
                     SLWGKPAGVFVSTGTYGGGQEATVKTCMNYLVHHGMVFVPLGYKYTFAELSNVEDIHG
                     GSPWGAGTLAGADGSRQPSSLELRMAKTQGKTFYETASKLCDKKPSTKSSKNMDSKPS
                     AKQNTSATGKAEVKTSGTTTQQKPTETRPKEKTKFNPSKNCVIM"
     gene            complement(<372155..>373573)
                     /locus_tag="CAGL0H03993g"
                     /db_xref="GeneID:2888584"
     mRNA            complement(<372155..>373573)
                     /locus_tag="CAGL0H03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446968.1"
                     /db_xref="GeneID:2888584"
     CDS             complement(372155..373573)
                     /locus_tag="CAGL0H03993g"
                     /note="highly similar to uniprot|P00890 Saccharomyces
                     cerevisiae YNR001c CIT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446968.1"
                     /db_xref="GeneID:2888584"
                     /db_xref="GOA:Q6FS26"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:Q6FS26"
                     /translation="MSLSSAARATPALRAQAYKALTSTRAFSATSISSEKTLKDTFAD
                     IFPKQAEEIKQFKKEHGKTVIDQLLLEQAYGGMRGIKGIVWEGSVLDPEEGIRFRGRT
                     IPEIKKELPTIGGSSEPVPEALFWLLLTGEVPTESQVKAFSADLASRSEVPEHVLKLL
                     DSLPKDLHPMAQLSIAVNALETESKFAKAYARGVNKKEYWSYTFEDSLDLLGKLPVIA
                     SKIYRNIFKDGKICQVDPNADYGKNLAHLLGYTNKDFVDLMRLYLTIHSDHEGGNVSA
                     HTTHLVGSALSSPYLSFAAGMNGLAGPLHGRANQEVLEWLFTFREEVKGDYSKETVEK
                     YLWDTLNGGRVIPGYGHAVLRKTDPRYTAQREFALKHFPDYELFKLVSTIYDVAPKVL
                     TKHGKTKNPWPNVDSHSGVLLQYYGLTEASFYTVLFGVSRAFGVLPQLIIDRAVGAPI
                     ERPKSFSTEKFKELVKSIESKK"
     gene            complement(<377281..>378264)
                     /locus_tag="CAGL0H04015g"
                     /db_xref="GeneID:2888600"
     mRNA            complement(<377281..>378264)
                     /locus_tag="CAGL0H04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446969.1"
                     /db_xref="GeneID:2888600"
     CDS             complement(377281..378264)
                     /locus_tag="CAGL0H04015g"
                     /note="weakly similar to uniprot|Q06704 Saccharomyces
                     cerevisiae YLR309c IMH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446969.1"
                     /db_xref="GeneID:2888600"
                     /db_xref="GOA:Q6FS25"
                     /db_xref="UniProtKB/TrEMBL:Q6FS25"
                     /translation="MTRKKTCSVQFNPRNTIVTYSDDDTIEILPLKLDGQRKTVNNIA
                     TSGGLRLKSILRNFPESSVSKTGMQDCGIFDTTEKAQAETRRVDTTQMEYYQTETDRN
                     EELEALRLLISRCFTLCNMDLEVPTDLDYDSVCKMFSLLSRAIPQNFKERTQEVKRRL
                     DEQQIASNREHIRLLSMLKEENGRLRKLLGYFAHQEEKRRGIKPIQESIRMLIEDSVS
                     KQEMELELSLLKEQYEEQKVKYLKLKESSLIPSINVAKEIDHTERNYVNIKRERELNE
                     IVERQQNNIQELESKCCILINERSSVQNQVNKLRRELREAKLLLSVQKDKR"
     gene            complement(<379169..>381916)
                     /locus_tag="CAGL0H04037g"
                     /db_xref="GeneID:2888649"
     mRNA            complement(<379169..>381916)
                     /locus_tag="CAGL0H04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446970.1"
                     /db_xref="GeneID:2888649"
     CDS             complement(379169..381916)
                     /locus_tag="CAGL0H04037g"
                     /note="weakly similar to uniprot|P28006 Saccharomyces
                     cerevisiae YOR178c GAC1 ser/thr phosphoprotein phosphatase
                     1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446970.1"
                     /db_xref="GeneID:2888649"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:Q6FS24"
                     /translation="MSVYISLNQNTEVQKNAKLKPSLKSYSSFDNAIRNDSKLGHTRS
                     LSNISTISSLSTASSLKNVRFATNLTTVKSFDSNSEPISISHENSPTLKPLRESESSN
                     VSSTSLNNVLYLSDYDDFTKHQDLNFLGIKSKSTISFFLDDEEDDEEDDGIHDDDLKN
                     FFGKIFPAAYNVNTSNKNLGPPDCSNTNQQRAGLLDSNNSSTCKIIPNFSTNVCQTDN
                     SAGHYFNDLNGSTNNQAQTSRRTSITHVADDNLQNCELASEVNWLLTFVDVNPGQHSF
                     ENSDGNIKLVSLAQDSTIDDKIVGKILVKNLNYEKFIEVKYTFNNWNDIHYITAYFTK
                     SISAEIDEFEFKINLSSLKYILQFKRILQFKSNDTYLNMELCCRYDVNGETYYDNNNY
                     RNYNCVLKASKEHTIANDVIVTAEEQEKKELARKESPKKISQNKKSSSPSRNNYSKNF
                     LKSRRRVISRKFSENTDYYNTSPLKHLYHSDPTSYIKPKRLNEVLYDSTSTIPTDLNQ
                     RIGINATCQSLHEPLTERERFISEFDYANLNDSMDTLTTVNLMNHSIANIELNSEPVE
                     PIVPSITNKIEENISNNPILQEVTDPITESFNEPITIEPVRSNENEVSDDKQSVVTDT
                     TIDIEALKLSGESPISFRTVDSPIEYYDCYSTSNNSVETITKPTPASPSGLTAKDLRS
                     IDAPKSFQDSISTSYNIPMENSEPEDDLSDRTTTIESTEDPVFNTKWDNIVVDTELED
                     TGNQILLPEVANSSQEAKDTETSRKSDTDQAPHSPDTDYQKFLNSNYFCRPSSSSSSV
                     STTDSSSSSSTSILTDNASSLASVPSSITTSDSELSSFIFNKATINAKVQGKLAGSTQ
                     LYSNLIFPLSDSHEARPINRIRTGRYSLEENKILSQFANERPANHDTDVMNTTLVNSG
                     N"
     gene            complement(<383247..>383690)
                     /locus_tag="CAGL0H04059g"
                     /db_xref="GeneID:2888592"
     mRNA            complement(<383247..>383690)
                     /locus_tag="CAGL0H04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446971.1"
                     /db_xref="GeneID:2888592"
     CDS             complement(383247..383690)
                     /locus_tag="CAGL0H04059g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446971.1"
                     /db_xref="GeneID:2888592"
                     /db_xref="GOA:Q6FS23"
                     /db_xref="UniProtKB/TrEMBL:Q6FS23"
                     /translation="MYKPFPVIIPFFSAPYFIVLPVASQYPFPHDEFEISAIPSEGCF
                     EDSDGWELVKGLVLSFFRIPVVSSLFCREGFPPPPIRSRCSIASNSTNAVPEIEDHSL
                     EISRRKIERCSGSSIDLNRSAHKKQPQRKFQEGIVTVNIRSARFF"
     gene            complement(<385778..>387163)
                     /locus_tag="CAGL0H04081g"
                     /db_xref="GeneID:2888529"
     mRNA            complement(<385778..>387163)
                     /locus_tag="CAGL0H04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446972.1"
                     /db_xref="GeneID:2888529"
     CDS             complement(385778..387163)
                     /locus_tag="CAGL0H04081g"
                     /note="highly similar to uniprot|P54839 Saccharomyces
                     cerevisiae YML126c HMGS 3-hydroxy-3-methylglutaryl
                     coenzyme A synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446972.1"
                     /db_xref="GeneID:2888529"
                     /db_xref="GOA:Q6FS22"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:Q6FS22"
                     /translation="MTEIKKQRTDFQAARPTNVGIKGIEVYIPSQYVSEAELEKYDGV
                     SQGKYTIGLGQTNMSFVNDREDIYSMCLTACSNLIKNYNIDTDKIGRLEVGTETLVDK
                     SKSVKTVLTQLFPGNGDMEGIDTVNACYGGTNAVFNSINWIESSSWDGRDAIVVCGDI
                     AIYDKGAARPTGGAGTVALWIGPDAPLVFDSVRGTYMEHAYDFYKPDFTSEYPVVDGH
                     FSLTCYVKALDQVYKAYSKKAIARGLVQEPISDEACNVLKHFDYNVFHVPTCKLVTKS
                     YGRLLYNDFRGNPSLYPDVDQSLATLDYEKSLVDKSVEKLFVNVAKPHHATRVAPSLN
                     VPTNTGNMYTGSVYASLASLLSYVDQEQLQGKRIGMFSYGSGLAASLFSLVVRGDISD
                     IVSKLDIDNKLQSRECLTPQQYEAAIELREKAHLQKSFKPTGSIDHLRAGTYYLTEID
                     DKFRRSYSTKE"
     gene            <388457..>390460
                     /locus_tag="CAGL0H04103g"
                     /db_xref="GeneID:2888830"
     mRNA            <388457..>390460
                     /locus_tag="CAGL0H04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446973.1"
                     /db_xref="GeneID:2888830"
     CDS             388457..390460
                     /locus_tag="CAGL0H04103g"
                     /inference="similar to AA sequence:UniProtKB:Q04511"
                     /note="similar to uniprot|Q04511 Saccharomyces cerevisiae
                     YML088w UFO1 involved in degradation of HO protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446973.1"
                     /db_xref="GeneID:2888830"
                     /db_xref="GOA:Q6FS21"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FS21"
                     /translation="MLLEELPSEVLINVFSYLDEKDLYTLQGLSRRFASLIGDEELWK
                     NLFITRLHTSYFPSFSKSQRYSHEYVARVSGVKQWQHNRLIKTRYNLSPTPLHVTHLR
                     NHPNQVAIEELIFQYPKLACYHDGIITLVQLQSKRSKIKNRMVYIPCTTPQGCSTMHF
                     NINSAVFGRFDGRVFGKLLTNKSYLQPVTEFDSSHSACVTAIATTNSTMIDSTTKDWS
                     VSGSENGEIIWWLETKKYKSLKFANSPILRLSLVNKNITIALDEKSIYVIEDMERVHT
                     LDIPHDPVTNKRISIHFFKIDYGAQTLCLADTQSIYMISFNLTKDFGQVKVLKLKDPS
                     ETITDVIMDEETAKREQDPQLAGGDGCFVALCTSNMRILVLNTRKSSFVTVNAEQLYQ
                     EVKPLREFQFNDHIYATQITNLVLVLALAGTIEIYDVLSGELIKTVQKTEKIPQFLRV
                     SQGRMIVSSGNTIHYLQYIPDEDDQSESHKKSHGSSRLRSNKWNETLHSEMEMYNEKL
                     KQEEERELENARLMEAYGGDMDGDDEELQLKIALLESQNLNSQSAEGTDDNARADPTT
                     EEEDEALRAAIEESLRMQRLQEEVRTAVSMEDDEEFLRAVEQSSRDDEERRTRRGQRR
                     TLTDLGHNEPTTEETSNVQHGDINDEELQLAIALSLSEINESQ"
     gene            complement(<390841..>392418)
                     /locus_tag="CAGL0H04125g"
                     /db_xref="GeneID:2888523"
     mRNA            complement(<390841..>392418)
                     /locus_tag="CAGL0H04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446974.1"
                     /db_xref="GeneID:2888523"
     CDS             complement(390841..392418)
                     /locus_tag="CAGL0H04125g"
                     /note="highly similar to uniprot|P54783 Saccharomyces
                     cerevisiae YML086c ALO D-arabinono-1 4-lactone oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446974.1"
                     /db_xref="GeneID:2888523"
                     /db_xref="GOA:Q6FS20"
                     /db_xref="InterPro:IPR006093"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /translation="MDLKTFGGRRNFVFRNWAGIYSSRPEWYFQPSSVDEVVEIVKAA
                     KLKNKTIVTVGSGHSPSNMCVTDEWMMNLDKMNKLLDFVENEDKTYADVTIQGGTRLY
                     KIHKILREKGYAMQSLGSISEQSIGGIISTGTHGSSPFHGLVSSTIVNLTVVNGKGEV
                     LFLDEKSNPEVFRAATLSLGKIGIIVGATVRVVPAFNIKSTQEVIKFETLLEKWDSLW
                     TSSEFIRIWWYPYTRKCILWRGVKTNEPQTKSRYSWWGSTLGRFFYQTLLFISTKIYP
                     PLTPYVERFVFRRQYGEVETLGKGDVAIEDSVTGFNMDCLFSQFVDEWGCPMDNGLEV
                     LRSLDHSIAQAAANKDFYVHVPVEVRCANTTLPKEQPETSFRSNTSRGPVYGNLLRPY
                     LDNTPSQCSYAPIHSVTNSQLTLYINATIYRPFHTNAPIHKWFTLFEDTMSAAGGKPH
                     WAKNFLGSTSFAQGQVKAEGQYQDYEMRGMATRVKEWYGSDLETFKKVRREQDPDNIF
                     LANKQWALINGIIDENE"
     gene            <392825..>393643
                     /locus_tag="CAGL0H04147g"
                     /db_xref="GeneID:2888902"
     mRNA            <392825..>393643
                     /locus_tag="CAGL0H04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446975.1"
                     /db_xref="GeneID:2888902"
     CDS             392825..393643
                     /locus_tag="CAGL0H04147g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446975.1"
                     /db_xref="GeneID:2888902"
                     /db_xref="GOA:Q6FS19"
                     /db_xref="UniProtKB/TrEMBL:Q6FS19"
                     /translation="MNETLTGRCSYTIAGWVSRSRFGHKEVLAQVPHQLLWEVYRYVV
                     NMGNDTLELYLLFLQLEARDMPQHFSQKLSIRDVSVVELSHLLGGSATKLPLDLQVHA
                     CRDVDDMRQLVDLQCLHGLSVMCPVGDLILSYWITRLKNLKGKWTQLKWLVVPTSVSA
                     MHVYKLLEAIPSLETIACGLDADHVRQVPQLRKRLHLTDPLIKTESQIQIALLTERFT
                     TSRPSYKATVNPVTISDTHSVYQVTPIDTVSTSNMRKRPRLNTKRISASQYFGI"
     gene            <394311..>396407
                     /locus_tag="CAGL0H04169g"
                     /db_xref="GeneID:2888540"
     mRNA            <394311..>396407
                     /locus_tag="CAGL0H04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446976.1"
                     /db_xref="GeneID:2888540"
     CDS             394311..396407
                     /locus_tag="CAGL0H04169g"
                     /inference="similar to AA sequence:UniProtKB:Q04533"
                     /note="similar to uniprot|Q04533 Saccharomyces cerevisiae
                     YML082w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446976.1"
                     /db_xref="GeneID:2888540"
                     /db_xref="GOA:Q6FS18"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FS18"
                     /translation="MKKWTGSASMKLEYSRPLPTWEDVLRYEKTSASAVFDNDEDLNG
                     YPRWCLHSSVKRLCDVLGNKYSKENEKCLCFPSYGVAKRCREYIKKKEGLNTKVRILQ
                     LATSKPLNSEEMKSKCEFKIAVVFVTKNLFHHVRQYWKLTGEIVSPRLADYILNELFI
                     AERSSFATISNGKNKDQQMQNKKSQINFTLANRALACVRKRLVTNVIDANDELGEDNY
                     HFQNDDDDDMEPTFLDTVRSNDNVNVNNHTRIDDQLLRNGFEFSDSEDEDTINHNNPF
                     GDSTDSEEDDAFVSLVPPEPIAIDISDTPIDSPLPDSSNNASATFIDPSAATIANDNI
                     PNDIDPEDEVFIFPSGIASIFTAQRVLQEYDLLRVNRIRYQTESSNGTGTQKRIVLLG
                     DICPDIVKMFQEFNDVIIINNQKGAFSTLNDLEVLLNSGEQILGVFLAIPTNPCLELT
                     NLQRLKELSDLFVFPIIFDISMGSGVLNYNILKYGDIICMSLLTRFTNIEVMAGAMIV
                     SKKRSPKFHEFFLSRMNEELLESQLQNTSQQTYSQNQFISPGATFWVEDAVLLDRGSC
                     KWHDRNIKINYTAEYLVKRVLRQHEGKVFKRVLYLNDEAWQENNYYNMVKYSREDCGY
                     GGIIAIEFEKENQLAKFYDSIEHIYKGTPVLGGNDITTVAAFREHNGRHLLRVCVGLE
                     NIKILTKVFQSALSKI"
     gene            complement(<396831..>397001)
                     /locus_tag="CAGL0H04191g"
                     /db_xref="GeneID:2888484"
     mRNA            complement(<396831..>397001)
                     /locus_tag="CAGL0H04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446977.2"
                     /db_xref="GeneID:2888484"
     CDS             complement(396831..397001)
                     /locus_tag="CAGL0H04191g"
                     /note="highly similar to uniprot|P81450 Saccharomyces
                     cerevisiae YML081ca ATP18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446977.2"
                     /db_xref="GeneID:2888484"
                     /db_xref="GOA:Q6FS17"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="UniProtKB/TrEMBL:Q6FS17"
                     /translation="MIKRFQFPVLKTYWPFFAAGAVVYYGVSKAATAMSNSEEFINDP
                     RNPRFHRGEKPL"
     gene            <398544..>402509
                     /locus_tag="CAGL0H04213g"
                     /db_xref="GeneID:2888818"
     mRNA            <398544..>402509
                     /locus_tag="CAGL0H04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446978.1"
                     /db_xref="GeneID:2888818"
     CDS             398544..402509
                     /locus_tag="CAGL0H04213g"
                     /inference="similar to AA sequence:UniProtKB:Q04545"
                     /note="similar to uniprot|Q04545 Saccharomyces cerevisiae
                     YML081w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446978.1"
                     /db_xref="GeneID:2888818"
                     /db_xref="GOA:Q6FS16"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FS16"
                     /translation="MMSVGSVPVDNGANFAPIPKKSRTIKTDKPRPHLCPICTRGFVR
                     LEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQYKLHPTLVSKNNEGSLDNSRNN
                     SVSPGSDNSSDALKAEAAINDNIIKVSGNRATILPTPSNPLAKTTAELRKAAKVAEST
                     GSSKESTPSTKYAKKVNKKRKTKNKEAGSNGNSSSTSPLVSPSIFPQPLNLNQKKDNN
                     LSVPASRNKRHASFSASSAFTYFPDNVSLNGNDQEHQRENIEDLGEGIPHLVGFSTPQ
                     LSAQELIRKVMQTGTMDFEPLDLPPSLFGDENGQQMLGMQNGDSDFGVSLFNSNGVTK
                     SNNERVGFINGKKKANTVDNTSTTNYIGDLPSSSMNNSNMKHANSSASLAAALSSMFA
                     IPNQSSTNLANSGPSHQILTDLVTMGSSFGGSNGFNKNLHNNTSELDLFNYKNWKNNS
                     YHDIFEAPSASKQKKRATFTTNDVTEIDDQIDGQNFKSPQSIPDSNQRGNTNTTSPDE
                     DWTTKFIKDSDLEKYFDMDADHFNDIGFFHSNINDANQNSIKSNLPSGIASSQNSSNE
                     TSAINSSSNLPRLGNSVASPINSLSNKSAVNTPPVNIEQPSVNKAKNVEFKEFRELFN
                     SHIDNYGLPNHMSKRTFEEEDIGAALERSVSSLFTSRQVELFRKNVNAANLSLFSNPS
                     SASSSLNGSPRNSSEPLQKKQKHIPPPLAFFTEKFREQIVTMNNLTQTMFPSVNVLNH
                     YVNLYQKEFHPYFSFIHLPSFVPSTENYPFLLSVAMIGALYAFHSNHAMILCKVARHN
                     IRVYLEQTVKNQKVTPLWLIQSLVLLTFVGIFSDDLNVARSMNTQLMTLIRLIKKTNL
                     NMPLENYCKPPIASNHALDYQNNPATFAKYKAQYTTPEQLEKDFQYFILAQTRIRTCH
                     VVLIISNLFTSLVGLECCFHSIDLNCGVPCYHESLFSCPSSNEWAGKLEKYNIVLDSK
                     FSLIELSNGEAKYANCMMYLSNGSQYVYDNTKVSKKTLLSLLITIHEKIFIERNNIRH
                     ENGDNIPLNDAKWRMSSRPMISVMVKHWESMYIKNGGLLVPTDENIKIINRDPAMRLI
                     VPLHSFALIRKCLDLTPVMKQIYMHNWVGMNETMQLICCDWESLRESTTYALNIIDFW
                     VITMDGLRNQSIGGTPIFTITCIFSAVLIVAEYMKHLEDWSNDVSSDINSQPNLKVSD
                     RILWFKIFKVLKKVEGHLSSRDVGSETYSQFLRTQANGALDIGSLDEAYIESATKPDR
                     EISETLEVIKNSRLSTRSLYFGVRILGDAPVWPIAILFALALQCRAIHMEKSADKTLL
                     H"
     gene            <403035..>404273
                     /locus_tag="CAGL0H04235g"
                     /db_xref="GeneID:2888808"
     mRNA            <403035..>404273
                     /locus_tag="CAGL0H04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446979.1"
                     /db_xref="GeneID:2888808"
     CDS             403035..404273
                     /locus_tag="CAGL0H04235g"
                     /note="highly similar to uniprot|P53759 Saccharomyces
                     cerevisiae YML080w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446979.1"
                     /db_xref="GeneID:2888808"
                     /db_xref="GOA:Q6FS15"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q6FS15"
                     /translation="MPEKKLPMKLKGRELFEKIGNPRHIVAPMVDQSELAWRVLSRRY
                     GATLCYTPMFHAKLFATSEKYRREMWCDLDGDSKLDRPLVVQFCANDPEYLLQAAKLV
                     EDKCDAVDLNLGCPQGIAKKGHYGSFLMEEWDLIHKLIKTLHENLNIPVTAKIRVFPD
                     RQKTLDYAKMVLDAGAQFLTVHGRLREQKGQQTGLADWDIIKYLRENLPDNTVFFANG
                     NILYPEDIDRCISQIKCDAVMSAEGNLYNPGVFNVHYIGDKDKTYPRVDVLLREYFEI
                     IRNECKESLASRKAMKSHFFKLLRPFLPHYTDIRSNIAALNAKSDLKEWEDKVVIPVE
                     EAVQELFKNPDIEDMIITHDKELWGGSYKTIPYWRCQPYFRPVNGVTGDKRIVQELES
                     KKRKAEFSLDSQKEKEFKTE"
     gene            <405073..>405231
                     /locus_tag="CAGL0H04257g"
                     /db_xref="GeneID:2888780"
     mRNA            <405073..>405231
                     /locus_tag="CAGL0H04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446980.1"
                     /db_xref="GeneID:2888780"
     CDS             405073..405231
                     /locus_tag="CAGL0H04257g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446980.1"
                     /db_xref="GeneID:2888780"
                     /db_xref="GOA:P15114"
                     /translation="MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQT
                     CKCQTCKC"
     gene            <406327..>406485
                     /locus_tag="CAGL0H04279g"
                     /db_xref="GeneID:2888781"
     mRNA            <406327..>406485
                     /locus_tag="CAGL0H04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446981.1"
                     /db_xref="GeneID:2888781"
     CDS             406327..406485
                     /locus_tag="CAGL0H04279g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446981.1"
                     /db_xref="GeneID:2888781"
                     /db_xref="GOA:P15114"
                     /translation="MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQT
                     CKCQTCKC"
     gene            <406981..>407532
                     /locus_tag="CAGL0H04301g"
                     /db_xref="GeneID:2888645"
     mRNA            <406981..>407532
                     /locus_tag="CAGL0H04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446982.1"
                     /db_xref="GeneID:2888645"
     CDS             406981..407532
                     /locus_tag="CAGL0H04301g"
                     /note="highly similar to uniprot|P25719 Saccharomyces
                     cerevisiae YML078w CPR3 cyclophilin or uniprot|P14832
                     Saccharomyces cerevisiae YDR155c CPH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446982.1"
                     /db_xref="GeneID:2888645"
                     /db_xref="GOA:Q6FS12"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR024936"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6FS12"
                     /translation="MLSRISMQKRFLSSTVAKLGKKVYFEPSVNGSRIGRIEFELYDD
                     VVPKTAENFRALCTGEKGWGYKGVPFHRIIPQFMIQGGDTDLTNGFGGKSIYGNKFAD
                     ENFTKTHDKPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVTKGMDIVKTIE
                     SYGTMSGQPRAKIVVEESGEIKE"
     gene            <407884..>409122
                     /locus_tag="CAGL0H04323g"
                     /db_xref="GeneID:2888673"
     mRNA            <407884..>409122
                     /locus_tag="CAGL0H04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446983.1"
                     /db_xref="GeneID:2888673"
     CDS             407884..409122
                     /locus_tag="CAGL0H04323g"
                     /inference="similar to AA sequence:UniProtKB:P47160"
                     /note="similar to uniprot|P47160 Saccharomyces cerevisiae
                     YJR125c ENT3 cytoskeletal adaptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446983.1"
                     /db_xref="GeneID:2888673"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q6FS11"
                     /translation="MSLEDTLANLSLYDAKKYFRKAQNVVYNYTDMESKVREATNNEP
                     WGASSTLMEQIAQGTYNIREREEILGMIFRRFTEKSGSEWRQIYKALQLLEYLIKHGS
                     ERFIDDTRNSISIVKLLESFHYIDSQGRDQGVNVRNRAAALTALLADDSSIRAERKKA
                     RETKKKYKGVAGGVTSMNTGLEANTRAGFNSSRSHGISVSADFDSDESDDGVYKSSNR
                     SGGFRDNVDDRENSNEGTTTTANVMQSNSDEDFFSSLKKPEVSQNNHANLDEDDEDDD
                     EFTDFQTAVPVNSTLNNTATSHGNTTNNNEFDLLGMNMNSTATYPKPSTNDVIPAIAQ
                     DKKKDDPFSSLFSSAKTLPAEPKKAQTQQNQPISSQTDKADEDEFNDLMSSGPTTTSA
                     QTSAPTPSQSNAGEIDLLSF"
     gene            <409583..>410062
                     /locus_tag="CAGL0H04345g"
                     /db_xref="GeneID:2888631"
     mRNA            <409583..>410062
                     /locus_tag="CAGL0H04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446984.1"
                     /db_xref="GeneID:2888631"
     CDS             409583..410062
                     /locus_tag="CAGL0H04345g"
                     /note="highly similar to uniprot|Q03630 Saccharomyces
                     cerevisiae YML077w BET5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446984.1"
                     /db_xref="GeneID:2888631"
                     /db_xref="GOA:Q6FS10"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q6FS10"
                     /translation="MGIHSFWIFDRHCNCIYDREWTLLSNSGSGTINSKQNDETAKLL
                     YGMVYSLRTITQKLSHGSMKNEIRTIATGKYLVHIFCTASGLWFILLSDFRQQSYSQV
                     LHYIYGHIYVKYVANNLLSPIDFAENKNETRGQGFRKITNRNFIKSLEAFLAPMVAK"
     gene            complement(<410256..>413093)
                     /locus_tag="CAGL0H04367g"
                     /db_xref="GeneID:2888538"
     mRNA            complement(<410256..>413093)
                     /locus_tag="CAGL0H04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446985.1"
                     /db_xref="GeneID:2888538"
     CDS             complement(410256..413093)
                     /locus_tag="CAGL0H04367g"
                     /note="weakly similar to uniprot|Q03631 Saccharomyces
                     cerevisiae YML076c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446985.1"
                     /db_xref="GeneID:2888538"
                     /db_xref="GOA:Q6FS09"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FS09"
                     /translation="MEENCVRADASHTYEPGPNDYVVNNKHLTVIVGVEPDDIRLSQP
                     SQLEVNENGNMKRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIFDLAKR
                     KRKRVRRSRHENSVGNNKYQKRKNSRNSESQSSSDNYEEPRVPLAIPNIQQTPISIIE
                     NPESIRNQNWPIVDSNQYPKTSITLGQPQSSNDLNAIMRTPTTISVSQRYPQTDINSL
                     LGSYPTRNNAYDESTVPLGSNIPLIPTTSNDVVRPSNNTLKTPNVGNVGSLFNNHIDT
                     ANPTILSPLQNNTYDRQQYAYSSNSNKGGSHFDSVKSPKNSHINRLTHSFKKQLQSLV
                     YHQKEKIETTSTLLGQWAKTWQDMIDRSDLLPVTGDPVSAGIITAEEAELRLERFSTD
                     ITFFAGLSFINTGNNTNVNIMRTEKPMLFSVVMSCSSILLAPHETNPVTTMRLDTFVL
                     KQITSNIFKRRVDAVQLVQSLLILCLWYNFLEWPSRTKYHFFNYVCSIITKELNHRPH
                     PGRVFDVFPEKEPQPEYPVYVYRLILLVYITSLNVCIFLRQPLHTPYNECIDIAWKQA
                     ARDSKLQITEDHKEDAHVLVVFTSLCRVLENIHVKLHELEKNDEFLLYDTSKMIQRYH
                     TQLDELYTEIPLNRDRVVAFFYSIKAYLYQYTLEDFIKKNVNSLKKGDPVPDDITAAF
                     KSCYNCCVQCLENFMKLDSKLIASLPLFHSSRMVYIVGLILLKLRFKVVTSAAFHHLL
                     HDTDKAVALVRRVADALEKASKLFPYNYPLYKLQYVVALFCQTYAKRVIEASESSTVK
                     AKSNPHTQFNTQLLRNEYASVTKTPVTDTENTVSADVLPFPADSAPTQGKLTRNSTDD
                     SNTPINNDISSGIVGYKTEKEDLNGTNNNPNNGLLNPQVKVNLESQTLNSSPSSSLNN
                     FNDYLTDMNSLLWGVNTLNDEFWSDLFLPGI"
     gene            <414418..>414975
                     /locus_tag="CAGL0H04389g"
                     /db_xref="GeneID:2888458"
     mRNA            <414418..>414975
                     /locus_tag="CAGL0H04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446986.1"
                     /db_xref="GeneID:2888458"
     CDS             414418..414975
                     /locus_tag="CAGL0H04389g"
                     /inference="similar to AA sequence:UniProtKB:P38812"
                     /note="similar to uniprot|P38812 Saccharomyces cerevisiae
                     YHR100c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446986.1"
                     /db_xref="GeneID:2888458"
                     /db_xref="InterPro:IPR010021"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027706"
                     /db_xref="UniProtKB/TrEMBL:Q6FS08"
                     /translation="MNFNATFNALRVIYNHSLCIPRLRIATFNQLPIPIKPHIKVVVV
                     DKDNCMALQDDDKVWHEYTAKWEELKRVYQDRVLIVSNSAGSSDDKGYLQAKTLEKNT
                     GVPVLRHKLKKPGCRDEIIEYFKERGLIEKPDEIAVIGDRLFTDILMANMMGSYGVWI
                     EDGVKISNSAFSKLEKNLYTRWTKN"
     gene            complement(<415101..>418124)
                     /locus_tag="CAGL0H04411g"
                     /db_xref="GeneID:2888705"
     mRNA            complement(<415101..>418124)
                     /locus_tag="CAGL0H04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446987.1"
                     /db_xref="GeneID:2888705"
     CDS             complement(415101..418124)
                     /locus_tag="CAGL0H04411g"
                     /note="highly similar to uniprot|Q08162 Saccharomyces
                     cerevisiae YOL021c DIS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446987.1"
                     /db_xref="GeneID:2888705"
                     /db_xref="GOA:Q6FS07"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FS07"
                     /translation="MSGGAEVLVRQSKRKKLSDGLAVTQKVFVRSRNGGATKIVREHY
                     LRNDIPCLSRACSKCPEIVAPDAHNELPKFVLSEKPEKGKLDGIGEHYAVLDTNIVLQ
                     AIDLLENPECFFDVIIPQIVLDEVRNQSYPVYTRLRTLCRDSDDRKRFIVFHNEFSEH
                     TFVERLENETINDRNDRAIRKTCEWYADHLKSSGISIVLVSNDRLNRVEANRSNAKEK
                     KYQTLNLVEYVEKLPNANEIKDLIPSSNSFDGQDKESISDFSYPEYYTNARIMGGLKN
                     GVLFQGSIQISEYNFLEGTISLPRFSKPVLIRGQKNLNRAFNGDQVIVELLPQSEWKA
                     PSTITLDSEHFDVNDNADDGNDEESGDVKGANSAVIMSDKQRRLLAKDAIAAQQSKKV
                     SPTGRVVGIVRRSWRQYVGQIAPNSVDLQNGGTQYVFVILMDKCLPKIRIRTRRAKEL
                     LDKRIVVSIDSWPETHRYPLGHFVRDLGGIETVQAETEALLLEHDVEYRPFSKKVLDC
                     LPSEGHDWKAPEKLSDSAAIAKDPLLPKRRDLRDKLICSIDPPNCVDIDDALHAKMLE
                     NGNWEVGVHIADVTHFVKPGTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPY
                     VDRFAFSVLWELDQDANIVNVDFTKSVIRSREAFSYEQAQIRIDDPNQTDELTQGMRA
                     LLQLSKKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLA
                     NISVARKIYDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALADSLDR
                     CVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYC
                     DVVAHRQLAAAIGYEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEYYVGQVMR
                     NNESVETGYVIKVFNNGIVVLVPKFGVEGLIRLENLTDDTDSADYDEVEFKLTFTQQG
                     TNAKREISVFDKVEVQVKSVLDPVTSKRKAELLLK"
     gene            418419..418492
                     /locus_tag="CAGL0H04433r"
                     /db_xref="GeneID:2888865"
     tRNA            418419..418492
                     /locus_tag="CAGL0H04433r"
                     /product="tRNA-Val"
                     /note="tRNA Val (AAC) cove score=68.42"
                     /db_xref="GeneID:2888865"
     gene            <419033..>421033
                     /locus_tag="CAGL0H04455g"
                     /db_xref="GeneID:2888672"
     mRNA            <419033..>421033
                     /locus_tag="CAGL0H04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446988.1"
                     /db_xref="GeneID:2888672"
     CDS             419033..421033
                     /locus_tag="CAGL0H04455g"
                     /note="weakly similar to uniprot|Q03824 Saccharomyces
                     cerevisiae YMR163c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446988.1"
                     /db_xref="GeneID:2888672"
                     /db_xref="GOA:Q6FS06"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /translation="MDSGATSFNVLGEWRRTVQSKLLGERHVGFVAEENKLHCGSIKD
                     RDSVVLTPIANIQQGTVNYNHMFDNLIWVSDVQFMEELQYTLISSPFLNDIHHHQMPL
                     SVANSIMDFHRDRRFHRESFIFSVPTKLGYLKARYGDKKLELRKNINFMDVHKTVYSI
                     LKHLRNNNKKCTWRILSVLMIILYLGYEQAHFHNQYPKYSFLTQLKAMMGKLQQFDSI
                     QRKYFENINITKEFDKTGNEIFQLLHSITHIASMKLYHLSEFLLRFTNIGKLSKYCGV
                     YGIDMNLAYLTNVRILTSTKQELHLLQDKIEFLRKFLLCCFLSVEHQDYNEKVKNIIF
                     STYLLKLFPGYTEDNNCKSLFSSQWSVLSTVIVKFNQDLSFLYSVLNENKELIYSTET
                     REESETDEMLKERYKFRYKDKNQSLMLKALSQIHLVEEQLISVQDADDNEETKCLIND
                     HIKNLQQLILCCNNKTNSGTNFSNRHTSLQGKGLFLDVLKSPEEKFTPIFQEMEVSRI
                     GIKNVSDNDDLESILTDNENYEHIEPAHFIDDRNNGGAFTIYEDSTCYADDCYKNASE
                     LRKLNDEQLRRKLNEKIQLFATENKKNRNQIRQQKSLELLRSNSTLTALNELKSNTNY
                     ESLDKGVKTKKRAHFMEQELYSEETIPFYYEINDFLYNQANQ"
     gene            <421857..>426737
                     /locus_tag="CAGL0H04477g"
                     /db_xref="GeneID:2888555"
     mRNA            <421857..>426737
                     /locus_tag="CAGL0H04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446989.1"
                     /db_xref="GeneID:2888555"
     CDS             421857..426737
                     /locus_tag="CAGL0H04477g"
                     /inference="similar to AA sequence:UniProtKB:Q12674"
                     /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
                     YMR162c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446989.1"
                     /db_xref="GeneID:2888555"
                     /db_xref="GOA:Q6FS05"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FS05"
                     /translation="MTEPDKKRKRSWSLRTQMFNKHLFENYHNDDNVEMNDIDEETEN
                     DEGHIGDFNSIDGQTKIRNHQSPRLVTKILDMLFDRRTQVHSVDGRHIPISLDHSSAI
                     SDIYPVDRHGNLVDERYGYAYCNNLITSSRYTIISFFPRQLYAQFSKLANVYFFIVAI
                     LQMIPGWSTTGTYTTIVPLCVFMAISMAREAYDDYRRHKLDKEENNKLTKVLQILHER
                     EDNDLDLENNAQHSANNPESISNLYFNNFDLLAKKYNVRIVEKKWKDIRVGDFVLLQQ
                     DDWVPADILILTSDGDNSEVFIETMALDGETNLKGKVPHPEINKLTKSASGLANINAQ
                     VTVEDPNNDLYNFEGNLELNSGSSSKKKYPLGPDNVIYRGSIIRNTRNCVGMVIFTGE
                     ESKIRMNALRNPRTKAPKLQRKINMIVVFMVFVVACMSLFSYLGHTIQIKRYVNNNKA
                     WYLLQEDAGTAPTIMSFIIMYNTIIPLSLYVTMELIKVAQSRMMEWDIDMYHAESDTP
                     CAVRTATILEELGQVSYIFSDKTGTLTDNKMLFRKLSFCGTSWVHNATQDISEFKPAQ
                     LSNKNDIDVISIDDQSFLSKLGYTSQSNPKRYMDINDFPDRRTSVEYKGNATVKYTGR
                     PSMRSLYVPPKKETNASNSQDASDIPEDIKSTFELIYYIQSNPKSLFAKKAKMFILSL
                     AICHICLPKRTEEGNDEDDIIEYQSSSPDELALVTAARDMGYIVYNRNANILTLKTFP
                     DGFDELPRFENFEILELVDFNSQRKRMSVIVRVPEEKDRVLLFCKGADNVILERLHNK
                     EMALDMLDQVENNTKYRKDAEAELVIQHRKSLERAVNDDLPRTSLRNSISRGPRESLS
                     LQAARKSMSRKSNQLQDPEMQLGTIDQFLDSVQKTDKEIDAVVSQARKSLAKQRLEKY
                     GPRLSMDSPQIVAAEKSPQVSNGNDVLLNYIGSDALISNEEYVLEKTLEDIESFSTEG
                     LRTLLFAHKWISNEDFEQWRTRYHEAKTSLSERKQKIDEVGAQIEDELYLLGATAIED
                     KLQEGVSEAIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIHDYSTVVILTTSDENII
                     SKMNAISQEVDSGNVAHCVIVIDGATLAMFEDNPTLMSVFTELCTKTDSVVCCRASPA
                     QKALMVSNIRNTDKSIVTLAIGDGANDIAMIQSADIGVGIAGKEGLQASRSADYSIGQ
                     FRFILKLLLVHGRYNYIRTAKFILCTFYKELTFYLTQLIYQRYTMFSGTSLYEPWSLS
                     MYNTLFTSLPVLCVGMFEKDLKPVTLLTVPELYSMGRLSKAFNWSIFAEWVFLGTANA
                     LIITFLNIVAWGETSLSDNTLYPLGFVNFSATVALINVKAQFIEMRNRNWLAFTSVIL
                     SCGGWLVWCCALPILNRSDGIYDVTYGLYHHFGRDITFWCTSLILAVLPIIVDVVYKT
                     FKIMLAPSDSDIFAELEQKSEIRKKLELGAYNEMKQGWTWTQDQSTFDKYKDIVFNRS
                     RSASSATEVNSMTNLAHGNSEDDQYLSSRFANDDIHTSYSGNSATSPPKPTRGNSLKL
                     LSLNITGNSRSSEEYEVLPSGKLIKRQSTELQKATNNSENMASKLTKKLRFKMKDEED
                     DEEIDRIIRDRMKDLE"
     gene            complement(<427509..>428207)
                     /locus_tag="CAGL0H04499g"
                     /db_xref="GeneID:2888828"
     mRNA            complement(<427509..>428207)
                     /locus_tag="CAGL0H04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446990.1"
                     /db_xref="GeneID:2888828"
     CDS             complement(427509..428207)
                     /locus_tag="CAGL0H04499g"
                     /inference="similar to AA sequence:UniProtKB:P48353"
                     /note="similar to uniprot|P48353 Saccharomyces cerevisiae
                     YMR161w HLJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446990.1"
                     /db_xref="GeneID:2888828"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FS04"
                     /translation="MSYNEEQEKVVLSVLSHDKHAFYDILNVERSSSDVDIKKAYRKL
                     AIKLHPDKNPYPKAHEAFKLINRAFEVLSDSQKRQIYDQIGRDPDDRSSGIPSSAAAG
                     GGRGAAAYGPGFEEFNPFQQFFFQQRQQQMFPQEDLFDFLFNGGMGGGPGASFSFGGP
                     GGFRMYTTGNGPFQRARFRRADPREAYRQQQQRRQGNQENELVNSELYEMLRILAPFL
                     LLFLLPLLERFIFG"
     gene            <429542..>429937
                     /locus_tag="CAGL0H04521g"
                     /db_xref="GeneID:2888848"
     mRNA            <429542..>429937
                     /locus_tag="CAGL0H04521g"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_446991.1"
                     /db_xref="GeneID:2888848"
     CDS             429542..429937
                     /locus_tag="CAGL0H04521g"
                     /note="highly similar to uniprot|P38061 Saccharomyces
                     cerevisiae YBL092w RPL32"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_446991.1"
                     /db_xref="GeneID:2888848"
                     /db_xref="GOA:Q6FS03"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="InterPro:IPR018263"
                     /translation="MAASLPHPKIVKKHTKKFKRHHSDRYHRVSENWRKQKGIDSVVR
                     RRFRGNISEPTIGYGSNKKTKFMSPSGHKVVLVSNLKDLETLTMHTKSYAAEIAHNVS
                     SKNRVTLLARAKALGVKVTNAKGRLALEA"
     gene            complement(<430462..>431010)
                     /locus_tag="CAGL0H04543g"
                     /db_xref="GeneID:2888895"
     mRNA            complement(<430462..>431010)
                     /locus_tag="CAGL0H04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446992.1"
                     /db_xref="GeneID:2888895"
     CDS             complement(430462..431010)
                     /locus_tag="CAGL0H04543g"
                     /note="weakly similar to uniprot|P40075 Saccharomyces
                     cerevisiae YER120w SCS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446992.1"
                     /db_xref="GeneID:2888895"
                     /db_xref="GOA:Q6FS02"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="UniProtKB/TrEMBL:Q6FS02"
                     /translation="MSYFKLIRFIVSNSSHLMLISTASTMYTRIDPEQLVFEDVVQCR
                     RVLRVRNVSDENIIYKVRTTAPDLYIVRPNVHTILQGQELELEFVYLGQETSHSGRDK
                     FMIITAPVGDTSYDKQVLETDWDKIVSGELKHRAVSKKIPVLMTSEEGVRGAREYIPT
                     RKYVIMLCVMLVIVAYILKKLF"
     gene            <431195..>431647
                     /locus_tag="CAGL0H04565g"
                     /db_xref="GeneID:2888776"
     mRNA            <431195..>431647
                     /locus_tag="CAGL0H04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446993.1"
                     /db_xref="GeneID:2888776"
     CDS             431195..431647
                     /locus_tag="CAGL0H04565g"
                     /note="some similarities with uniprot|P38175 Saccharomyces
                     cerevisiae YBL090w MRP21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446993.1"
                     /db_xref="GeneID:2888776"
                     /db_xref="GOA:Q6FS01"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:Q6FS01"
                     /translation="MLRFYRSFSACRAVLNNGKTINPFDKLADKQSLLTTGMMSGFGM
                     RQDKKSNILVSAEDMQLREEALETPIRGVQAGRTVGVINGDTATAVRRLTTKLIANGV
                     PMDKRKQRFHMKPGKAAELKRSQRHRRDFKKGFKRLIEIVKDARRKGY"
     gene            <431944..>433281
                     /locus_tag="CAGL0H04587g"
                     /db_xref="GeneID:2888829"
     mRNA            <431944..>433281
                     /locus_tag="CAGL0H04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446994.1"
                     /db_xref="GeneID:2888829"
     CDS             431944..433281
                     /locus_tag="CAGL0H04587g"
                     /inference="similar to AA sequence:UniProtKB:P40074"
                     /note="similar to uniprot|P40074 Saccharomyces cerevisiae
                     YER119c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446994.1"
                     /db_xref="GeneID:2888829"
                     /db_xref="GOA:Q6FS00"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6FS00"
                     /translation="MSTARSGVVTLLHTACGAGILAIPYAFRPFGLVPAIFMLLFCGL
                     CSMMGLLLQSRIAKYGPLKNVSFFSLAQVVNPASSILFDAAIAIKCFGVGVSYMIVVG
                     DLMPKIWSRVSSSGLLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLC
                     ILVIVHFAHQTTELRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKN
                     TGFTYVRYIAIVSILVAFVLYVVIGSTGYLTFGDNITGNIIALYPDTLSTTIGRIAIV
                     LLVMLAFPLQCHPARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRA
                     NDKEEECMDTKRFMIITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGYFG
                     WSLIGTEYTSNGNQLPLRKSTVIFKYIGLVMTIWGIIIMITSLIASLFFGASH"
     gene            complement(<433499..>441790)
                     /locus_tag="CAGL0H04609g"
                     /db_xref="GeneID:2888643"
     mRNA            complement(<433499..>441790)
                     /locus_tag="CAGL0H04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446995.1"
                     /db_xref="GeneID:2888643"
     CDS             complement(433499..441790)
                     /locus_tag="CAGL0H04609g"
                     /inference="similar to AA sequence:UniProtKB:P38110"
                     /note="similar to uniprot|P38110 Saccharomyces cerevisiae
                     YBL088c TEL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446995.1"
                     /db_xref="GeneID:2888643"
                     /db_xref="GOA:Q6FRZ9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /translation="MENYQIRTLQDQLTSSKLRDRNAGLQELQSILKDNPGFIANEQI
                     NGLLNTLLSLLENEAGKYIDSIEDDTDSRQRKENISISRFSNITYTLRLFIETVIEKF
                     KLSHLKLTISAVKDLFYNDARIIVPVINDVTYCILAIVKSEIFGNKIGPSQWLDVAEY
                     TLWLIKITSSNRSNIRALTNSLDTFYVLLIKGSISLSKVAKEALVIITNLIVFEKGET
                     ATTNVLLSISSNLVARLHCQHYYDTTSLIIECWKLYTRIGKTNNFNLLNDISKIDIFG
                     GGLLQNQIPIMPGQEIMGSRISHSVVLSTLQDYIPMKVKEMLDVDHSLTIGIYDDLNN
                     SNMDLTYNTFAKTHCKDLAWLRLFGLYDTLCLYYRLSNQERENNATQILKKIKYEGSL
                     QSNLNQCNSLLDYSQSLLESGDPLIQLLGCKLFFLLNLDHPIACNTELIDRLCINTNN
                     ISLTSWHLACIFTNISYDLWNFDETLYLKVLKYITPLLSTSEVNIMACLIFNKLLHSL
                     TREPIDELSSLVNSIIASPDSVLPIEISSVTCEAWQHIFVFAINNLKVDNSLLLDSFS
                     KWINHNITQTIHIEHLKLIFEFFLWSLDVVVGSTSHNKQHNTYNLLNLKTSDSALAIW
                     YFYENQRKFLTQTIQTSSQASVNTKSMVCPITSTNIKIQWLLNIIDNYFTTSKNHSLK
                     YTFAISLIYFINFIEKSGKVYTYLNQELNQRLNSILIELDFLSFDKWEEGKQFIEIIC
                     NQETFFNRLHNDVVFKDNILLSLINLFEKEYSHFLNADNGSTAKTGNDIYLNQRSILR
                     FRTDIKLMTQFFTCVDSNVPGKIGIYLDRLLLYSMGPNESLVLDELLSWVTNPSNNQY
                     YEVHSLEKLCQFLAKSLLNSKYQLSDFSMIRLGLFLTSTIELWVNVKYNILNSDCNDF
                     LIWITNNLVQNNFGETGTFVVLIRLFISVLKHNSTVNSSCAIKTQDLYSMLIFCMRNV
                     AYSTLGNIVDELKAYMSKKSHKNRKTILDDLVELFEPMPESVEKAASSCFVLFGLLDC
                     NDTNFVYTLDIFSNYGNIPHISFFLKKAVKNYVNNYYQGNKIQLLNVHILEVIRQWTK
                     RNDTDRQLYFNSVIGSLFGFGSIQEFERQYNREICALIFSRSDSESLERNFFSDRNTS
                     KCEMLRRSLYLLIPLSYYDNGVGDMVFNKLKDSFRGQLESVLSSNFIIVMRYALKLCD
                     CSDYTSVLNEMQRPNQSSSLLELFMDSEMKNAINRMNIYITVHSVIKIFKNCGRSRQT
                     LLLDLRTLILWIISDIQKSESSWEQNNHLRQLQLLVFLYEDTFLQSVLHIELMNWLSY
                     LLKIENIEADVFLLLNCLLSLIKPNSLDKPDSLTLFFLNVLHFYVRNKECLKIGDEDM
                     NMLSNNLSTVNSIALKLLTNGQVTDLIYNQVGDLTSQMYFAEEVELFALLMTFAPPMP
                     DYVSHKMNKKFIEYVYKSNNLIDIDNFSLWFSDYSTQYSSLILELEENSSFCEKDGFG
                     IDDMEIVYDFSDSAVSAMYSVLFRSLISIKPTIGFKSFALSNIICHLISINILKDKDL
                     LSKFLRATKMKIAFSAKEIDETIIEHFGKSNCGCVISEHYLESEFFDTNIPYKDWLVK
                     LCMFFISQISLNSKEIQWFIPLCYESMDFCKQNVCIFFLAAFSFDHRRMSSTWKHIFS
                     RLNDLTMASDCLAKLTLLLSFIRLIRSGALQGRKEYSNLYQKIEFKGVIDAALKIKDS
                     KFALQLFEEAYMCENGDYDVALLTSIYEQLDDVDMLYALPTPISLNGFIKNANRLSPH
                     SLKALQLNGAYFDANFNHLVDNGSHQLVNTLTGMGFNALADIADLRTSCDNPADAYLR
                     CLQLDKWDLPKPKAIDCKIVSFYNTAYDLRNTNIEFVDLLQNAEIQLYKAKANFSSKL
                     EWFETIREYVKTKRAIISLKTDTDISRFKIDHVINPDRYLENALISDIKINWQFRYLM
                     LKIYVEREKFANEAMKCIPILELIHQTELSVDFHIQQTSLSRILSMEAAMKRFHIADT
                     NLVEQLSRHVSYVTALALREFGETKAPLTILSKLLSDKSYKLNYNTFVSDDEVRAQLI
                     WDSYQAKVKSGIQIFENDVEHWDVSINNIRSAPDTIYKVANFLNLEISRLNGSDQLKE
                     KQKSYRRTRQELKDIESVVKSSNLSNEELLVGQKHYHNLKTHMENDRLAIENICLTRK
                     KLIKRALDYYVQILILTNNYDYDVLDRFCGLWFENDDDDDINTDLTSKLSQIPTWKFL
                     PWVNQFTSKLSLLKSKFQKQLWYIMKRLLYKLPFETGYAVINLQLYEKYSDKLDEKIS
                     EKIKAANLIFDQLQNSQISVKEGEYLRTIQEFCYATLEIAELKVKGKNAQISLETLNI
                     GRYWITELPKKNLPLPTVTRTINSSQYTLDSSRNIVKVIGNITITSTGLSLPKVMTLL
                     LSDGSRHKVVIKYGSDDLRQDAIMEQVFQQVNKIFGKDVEMRRSDLHMRTYNVVPLGP
                     KAGLIEFVNNSLSLHSILTDIHKDDNYSWLEARRSMKDVQSKSDKERILTYLDITKKI
                     SPKFRNFFFNSFIDANGWICAKRKYTKGVATSSMVGYILGLGDRHLNNILIDTTTGEP
                     IHIDLGIAFDQGRLLKIPELVPFRLTRDIIDGFGITGVEGIFRRTCEQVLNVLSRDSE
                     KVMCVLNILKWDPLYSWAVSPFKKHKYMYDDNLEGHMTTATNNSKVIERKLTPKLDSD
                     ENQQSYRALKGVQEKLDRNGLTIEATVEKLIQEAVDESNLALIFNGWSPFY"
     gene            complement(<442448..>444214)
                     /locus_tag="CAGL0H04631g"
                     /db_xref="GeneID:2888604"
     mRNA            complement(<442448..>444214)
                     /locus_tag="CAGL0H04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446996.1"
                     /db_xref="GeneID:2888604"
     CDS             complement(442448..444214)
                     /locus_tag="CAGL0H04631g"
                     /inference="similar to AA sequence:UniProtKB:P19880"
                     /note="similar to uniprot|P19880 Saccharomyces cerevisiae
                     YML007w YAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446996.1"
                     /db_xref="GeneID:2888604"
                     /db_xref="GOA:Q6FRZ8"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /db_xref="UniProtKB/TrEMBL:Q6FRZ8"
                     /translation="MAEVDNGGAQKSSASRKKRYQELDPETRMKRVAQNRAAQKAFRE
                     RKERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYL
                     EKHKGGAAGAGNGAATGSVSTSTRHTDLAASNANRVSKDSSILPGAKIIRQDLESFNE
                     NRHFNVTGQLTPPGNTSSSTTANSVAANAKKQSIPHSDSSDSNESKNTWNTDPTSSED
                     WLDDVMTSHKQISRGQSGSGIDFNNFFDEQVSEFCTKLNQACGTKACPIPQSKSAATT
                     PLPGTSSNGNSNSPMIINDTMGDVSLNMQGNEHGNATNNLVTDPAFLSNTWDDMSPAS
                     NQHSTGGAPGFGQLGFGDNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQKVVE
                     KENESKSVNFPFINSSLAFPGDYDNNFFRETTDLNFDDNDQDDNFTNSNDLVNDYFTT
                     NIPDTDNSDSALIANGLVKEEPSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTT
                     KDDNEDDDEDDENDNTVVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAK
                     CSERGVVINADDVQVALNKHMS"
     gene            <445529..>446647
                     /locus_tag="CAGL0H04653g"
                     /db_xref="GeneID:2888522"
     mRNA            <445529..>446647
                     /locus_tag="CAGL0H04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446997.1"
                     /db_xref="GeneID:2888522"
     CDS             445529..446647
                     /locus_tag="CAGL0H04653g"
                     /note="highly similar to uniprot|P25087 Saccharomyces
                     cerevisiae YML008c ERG6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446997.1"
                     /db_xref="GeneID:2888522"
                     /db_xref="GOA:Q6FRZ7"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSESELRQRQAEFTKELHGEGAESRTGLTALLSKNRNAQREAVS
                     KYLRHWDGKTDKEAEDRRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGENFQA
                     AMARHEQYLAYMAGIKKGDLVLDVGCGVGGPARTIARFTGCNIIGLNNNDYQIQKAKY
                     YAKKYNLQDHMDFVKGDFMNMEFEPNSFDKVYAIEATCHAPKLEGVYGEIYKVLKPGG
                     TFAVYEWVMTENYDENNEEHRKIAYEIELGDGIPKMFTVDVAKQALKNVGFEVEVSKD
                     LADEDDEIPWYYPLTGEWKYVQSLSDIATFFRTSYFGRKFTNCMVSIMEKVGVAPQGS
                     VEVTAALENAAVGLVEGGRKKLFTPMFLFVAKKPEDAK"
     gene            complement(<447256..>448080)
                     /locus_tag="CAGL0H04675g"
                     /db_xref="GeneID:2888472"
     mRNA            complement(<447256..>448080)
                     /locus_tag="CAGL0H04675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446998.1"
                     /db_xref="GeneID:2888472"
     CDS             complement(447256..448080)
                     /locus_tag="CAGL0H04675g"
                     /note="highly similar to uniprot|Q04067 Saccharomyces
                     cerevisiae YDR429c TIF35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446998.1"
                     /db_xref="GeneID:2888472"
                     /db_xref="GOA:Q6FRZ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /translation="MSQAAPEIIENPDGTKSIITYKTENGEKYKIIQKVRDVKITERV
                     HRSVAERRSWAKFGAEKNSPPGPNNSTTQFGETVELLLDRNWRKIIEARTQKLKASAS
                     KTITCRLCGNAHYTMNCPFKTILSEISALEDPAAAAAGPGLPEEVPAGKADSGITATG
                     AYVPPSRRAGARDPSSDAYRDARERDDSCTLKILQLNENADENTLRNELLFPFEPIQK
                     VVVVRNKETGRSRGLAFVTFINEDMAEKALHFLDGRGFMNLILRVDWSKPKVPAPQ"
     gene            <448407..>448619
                     /locus_tag="CAGL0H04691g"
                     /db_xref="GeneID:9488002"
     mRNA            <448407..>448619
                     /locus_tag="CAGL0H04691g"
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /transcript_id="XM_002999505.1"
                     /db_xref="GeneID:9488002"
     CDS             448407..448619
                     /locus_tag="CAGL0H04691g"
                     /note="highly similar to uniprot|P36533 Saccharomyces
                     cerevisiae YML009c MRPL39"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL39"
                     /protein_id="XP_002999551.1"
                     /db_xref="GeneID:9488002"
                     /db_xref="GOA:B4UN08"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:B4UN08"
                     /translation="MAKVKAKNTVVKLVSTALTGYSRFISVKKGAPLVTQVRYDPIAK
                     KHVLFKESKKRKVPERKPLDFLRTSK"
     gene            complement(<449219..>452251)
                     /locus_tag="CAGL0H04697g"
                     /db_xref="GeneID:2888499"
     mRNA            complement(<449219..>452251)
                     /locus_tag="CAGL0H04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_446999.1"
                     /db_xref="GeneID:2888499"
     CDS             complement(449219..452251)
                     /locus_tag="CAGL0H04697g"
                     /note="highly similar to uniprot|P27692 Saccharomyces
                     cerevisiae YML010w SPT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_446999.1"
                     /db_xref="GeneID:2888499"
                     /db_xref="GOA:Q6FRZ5"
                     /db_xref="InterPro:IPR005100"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR006645"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR017071"
                     /db_xref="InterPro:IPR022581"
                     /db_xref="InterPro:IPR024945"
                     /translation="MSDGSVEPVKADDAVVDSSKRTHEEMSAENTEPVSEQAHGTGSE
                     NGDGENSLENSLEKDNAEKDNAESEKGSPSVTETAADDDSSKTDGNGEENQDAEGLAE
                     DYDEEDFDEDEDDEDEEPAAKRRQQERNRFLDIEAEVSEDEEDEEDEEDSELVREGFI
                     THGEDEDDEEGVAGNRRGDRLHRQLDQDLNKSSEEDAQRLAKELRERYGRSSSKQYRA
                     AAQDGYVPQRFLLPSVDTATIWGVRCRPGKEKELVRKLLKKKFNLDRAMGKRKLKILS
                     IFQRDNYTGRIYIEAPKQSVIEKFCNGVPDIYISQKLLIPVQELPLLLKPSKSDDVAL
                     EEGSYVRVKRGIYKGDLAMVDQISENNLEVMLKIVPRLDYGKFDEIDPVTQQRKSRRP
                     TFAHRPAPQLFNPTMALRLDQANLYKRDDRHFTYKNEDYIDGYLYKSFRIQHVETKNI
                     QPTVEELARFGSKEGAVDLTAISQSIKKAQAAKVSFQPGDRVEILNGEQRGSRGIVAK
                     STTTIATVNLPEFPLKPLEFPVSALRKIFEPGDHVMVINGEHQGDAGLVLTIKQGQVT
                     FMSNQTREEVTITANNLSKSIDSTPTSSEYSLHDIVELSAKNVACIIQAGHDIFKVID
                     ETGKVSTITKGSILSKINTSRSRLTTVDSSGNEIKIGDSIVEKIGARREGQVLYIQSQ
                     QIFVVSKKIVENAGVFVVNPVNVEAIASKDNMLNNKLDLSKMNPDIISKMGPPKSSMP
                     SAAPVRTGREVALGKTVRVRSAGYKGQLGIVKDVNGDKATVELHSKNKHITIDKRKLT
                     YYNREGGEGITYDELVNRRGRLPQARMGPSYVSAPRHMASGASGVVADNNGALAGGMT
                     PGWGAFDGGKTPAVNSHGAGTSGATSAWGGASTWGGQGAGGSSTWGGQGGATSTWGGQ
                     GATSTWGGASAWGNKSSWGGASTWAASGEANGGVSTWGGGDRSTYGGASTWGNNATGG
                     TSTWGGNNQEQNNGGNRSAWKDQGNKSNYGGGSSWGNQ"
     gene            <452786..>453319
                     /locus_tag="CAGL0H04719g"
                     /db_xref="GeneID:2888495"
     mRNA            <452786..>453319
                     /locus_tag="CAGL0H04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447000.1"
                     /db_xref="GeneID:2888495"
     CDS             452786..453319
                     /locus_tag="CAGL0H04719g"
                     /inference="similar to AA sequence:UniProtKB:Q04231"
                     /note="similar to uniprot|Q04231 Saccharomyces cerevisiae
                     YML011c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447000.1"
                     /db_xref="GeneID:2888495"
                     /db_xref="GOA:Q6FRZ4"
                     /db_xref="InterPro:IPR014841"
                     /db_xref="UniProtKB/TrEMBL:Q6FRZ4"
                     /translation="MSSKVKLTYEQVKKFTEAKIPNEVEDEILTRYAEFSLEGDMVVK
                     DMVPYFESLELPRRFYKHVRKDQVVIEGTDIVDFDKLLKLTYHILVFMDNETLIDSLW
                     ELLIRSSGKDRNGSVRDIKDHVLSIKDFQKIENYLGDAQNISLIDMVSVATGGKRVYI
                     TYLDFAYVLGKLGYLRF"
     gene            complement(<453435..>454148)
                     /locus_tag="CAGL0H04741g"
                     /db_xref="GeneID:2888561"
     mRNA            complement(<453435..>454148)
                     /locus_tag="CAGL0H04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447001.1"
                     /db_xref="GeneID:2888561"
     CDS             complement(453435..454148)
                     /locus_tag="CAGL0H04741g"
                     /inference="similar to AA sequence:UniProtKB:P54837"
                     /note="similar to uniprot|P54837 Saccharomyces cerevisiae
                     YML012w ERV25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447001.1"
                     /db_xref="GeneID:2888561"
                     /db_xref="GOA:Q6FRZ3"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /translation="MFKLLFGGTRDQQGAASFFGDNNEIVKYVMKFLLLLLLAPFISA
                     LRFDLKAESKPEQMCIRDFVSEGELVVINIDTDGSLNDGNVLNLYVHDSNGNEYRRLK
                     NFVGEQRIAFTAPATTSFDVCFENTLDSNRGNRNAKRAIELDIESGSQARDWNKISAT
                     EKLRPIELELRKIEELTDEIVDELNYLKNREERLRNTNESTNERVRNFSVLVIIVLTS
                     LGAWQVNYLKNYFKSKHII"
     gene            <454589..>455740
                     /locus_tag="CAGL0H04763g"
                     /db_xref="GeneID:2888791"
     mRNA            <454589..>455740
                     /locus_tag="CAGL0H04763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447002.1"
                     /db_xref="GeneID:2888791"
     CDS             454589..455740
                     /locus_tag="CAGL0H04763g"
                     /note="highly similar to uniprot|Q01560 Saccharomyces
                     cerevisiae YDR432w NPL3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447002.1"
                     /db_xref="GeneID:2888791"
                     /db_xref="GOA:Q6FRZ2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FRZ2"
                     /translation="MDKPVEDQEVPQQEQEDVPPPPPAEAPQEQEQQQEQEQPQEQEQ
                     EQQQEQEQPAEEMNVEHQDAPVHHEPMPYESQFPEPPQPYYNQPPQGVPTFHQQEGEL
                     SNTRLFVRPFPLDVQESELNEIFGPFGAMKEVKILNGFAFVEFEEAESASKAIEEVNG
                     KTFANQPLEVMFSKMPVKRFRITLKNLPEGCSWQELKDLARENNLETTFSSVNSRDFD
                     GTGALEFPTEEIMNDALEKLNNIEFRGSVISVEIDDNPPPIRRSNRGGFRGRGGFRGG
                     FRGGFNGPRGGFRGGYGGPRGGYGGRGGFNGPRGGFRGGYNSGGFRGGYGAPRGGFGQ
                     GPRGGYGAPRGGYGGSRGGYGAPRGDYGAPRDSYRTRDAPPRERSPTRQ"
     gene            complement(<456705..>458723)
                     /locus_tag="CAGL0H04785g"
                     /db_xref="GeneID:2888775"
     mRNA            complement(<456705..>458723)
                     /locus_tag="CAGL0H04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447003.1"
                     /db_xref="GeneID:2888775"
     CDS             complement(456705..458723)
                     /locus_tag="CAGL0H04785g"
                     /inference="similar to AA sequence:UniProtKB:Q04228"
                     /note="similar to uniprot|Q04228 Saccharomyces cerevisiae
                     YML013w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447003.1"
                     /db_xref="GeneID:2888775"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FRZ1"
                     /translation="MPIINHAGEEFHLSHEEEEKLNNFQGITNFPEDDLPLVIKLLQN
                     HGWNLEAALSRYFDDEWKESVKLINSGAHSSAEFATGRVPENIAIPMRNDTPIDIPNV
                     ETPSFFHDEIMRNEASPGPFLGSHYVPSLPLIRKLPTNYRDNLKVVGLTTGVNVWDIY
                     NLTASGTTNELLGPLIVILLLVPKIVLRAGLSLFSLLWGIIAFGFTNNLNNDSKSKVY
                     HIPNAPLKKYFENPEQKTEQSYAEIVKGYMATHIDDDNKISMIESLLPNENKNFNDLL
                     EEAQSEFKYLLVLLLGNLDSYSPSQLEGKKLSKDVTDIDINSHRFLNRVLIDDAVLKT
                     LADYKDELLVYVGSVSDVEPWFISQELKLKYTPDSFLVANVLNSNGSVNGSTRLSILS
                     KIRMTSAKRFSSSLKNTIERYRPELLVSRTDVQELRLAREIKQKQEEAYQNSLMQDRN
                     KEEKRLQEEKERKELETMLAKKQREQALLTALHELRWLSKCIEKTTHLQQQNSISNGG
                     NKNIATLQIRTADGKRIIKKIAGDMTLRSLYEEIGCHLYLELQDEDQRKWLQQIQSKL
                     CDIRDNSDSSSILISLTETDENSIEKLMDIVHNEMHSIFDELPPNLRGVEDLEIKFEL
                     ISPFPRTNIPMDENKVISDIKDIWPKGNLLVEHIDEDLSTSESDDETN"
     gene            complement(<459074..>459883)
                     /locus_tag="CAGL0H04807g"
                     /db_xref="GeneID:2888502"
     mRNA            complement(<459074..>459883)
                     /locus_tag="CAGL0H04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447004.1"
                     /db_xref="GeneID:2888502"
     CDS             complement(459074..459883)
                     /locus_tag="CAGL0H04807g"
                     /note="highly similar to uniprot|P49957 Saccharomyces
                     cerevisiae YML014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447004.1"
                     /db_xref="GeneID:2888502"
                     /db_xref="GOA:Q6FRZ0"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FRZ0"
                     /translation="MADLKEEEYVHKVYNEIAPHFSETRYKPWPIVTDFLMTRPMGSV
                     GIDVGCGNGKYLNVNPNIYIIGSDRSSGLIQCAHEIDPINYNVLVADGMRLPHLDNRF
                     DFAISIAVVHHWTTRERRISAIKHILSKVRSGGQALIYCWALEQGNSRRGYHEGMEQD
                     VLVPWVLQEKKKKEPTKKQSSQRAKPDLTNVAPQDRAAFVANWKKEQEQLRLKEEEAK
                     QKNEEQKEDVKYRFYHLYKKGELEEDCEAAGAIVVRGGYEKDNWYVIAQKA"
     gene            <460201..>461295
                     /locus_tag="CAGL0H04829g"
                     /db_xref="GeneID:2888880"
     mRNA            <460201..>461295
                     /locus_tag="CAGL0H04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447005.1"
                     /db_xref="GeneID:2888880"
     CDS             460201..461295
                     /locus_tag="CAGL0H04829g"
                     /inference="similar to AA sequence:UniProtKB:Q04226"
                     /note="similar to uniprot|Q04226 Saccharomyces cerevisiae
                     YML015c TAF40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447005.1"
                     /db_xref="GeneID:2888880"
                     /db_xref="GOA:Q6FRY9"
                     /db_xref="InterPro:IPR006809"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY9"
                     /translation="MATTQGPLDTIPKANYPPLLTKANYMSTKQLINEVLSEDREYVT
                     WKLNQLRTGGNDAPGAKLLQTVAHHNNRQFHKKNAKVMKKRYPNQISGVPPNLTFVQD
                     LYEKEMKKESEDIDKSLREMHQPSIPADEQFKLLVTNLDEDQTNRFEVFHRTALSKTQ
                     VKKLATTVVNQSINENIRVFLQAIGKIFAGEIIEKAMEIKEKWLLSLMHREFDRKEET
                     AMRLKKLLKKLTKMVDKNGIVGDDEPGNGMELTAHDLNNEYPSSVDEEEEDIYLDDEP
                     DAMKKIQDVNSLLRSQENTAEIRLRLISHYNELVRQFNELDVSVEKYNSSPLLPEHIR
                     EAWRLHRLQSETIPPASWRTQGSGNGQMFR"
     gene            <462566..>464314
                     /locus_tag="CAGL0H04851g"
                     /db_xref="GeneID:2888684"
     mRNA            <462566..>464314
                     /locus_tag="CAGL0H04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447006.1"
                     /db_xref="GeneID:2888684"
     CDS             462566..464314
                     /locus_tag="CAGL0H04851g"
                     /inference="similar to AA sequence:UniProtKB:P26570"
                     /note="similar to uniprot|P26570 Saccharomyces cerevisiae
                     YML016c PPZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447006.1"
                     /db_xref="GeneID:2888684"
                     /db_xref="GOA:Q6FRY8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY8"
                     /translation="MGNTTSIESKIDFGQNRHVKPHLKNNNHVDDIYKRDTLPPSMAQ
                     MEPRSPILVVNGKHLTDIKEIANISSQIPETMMAANAEAASLQESLSNEERAAYLPTF
                     SKSSSYVSSLHSRKSSLLSNSTTLGTPATSPGLNESSSSLANDYFASKRRPSLPDQTL
                     GQHLTRPSLLDSHRSYSSDNCLSTINSNSTELQNTTTHHNDRLRDIFPFSRPKSPNGF
                     EIRIPLSSDDVSSSSESKLSLHRHHSSKDIPGDQTGYVMINGKRKKQVNIDEAIQRLL
                     DVGYSGKKNKAFCLKNSEIIQICIQAREVFLNQPALLELSAPVKIVGDIHGQFQDLLR
                     LFTKCGFPPSSNFLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTR
                     VYGFYDECKRRCNIKIWKYFIDTFNTLPLTAIVAGKIFCVHGGLSPVLNTMDEIRNMS
                     RPTDVPDFGLINDLLWSDPIDSPNEWEDNDRGVSYCYNKVAINKFINKFNFDLVCRAH
                     MVVEDGYEFFNDRTLVTVFSAPNYCGEFNNWGAVMSVSQELLCSFELLDPLDSNSLKQ
                     VMKKGKQERDLANSFD"
     gene            complement(<465069..>466424)
                     /locus_tag="CAGL0H04873g"
                     /db_xref="GeneID:2888854"
     mRNA            complement(<465069..>466424)
                     /locus_tag="CAGL0H04873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447007.1"
                     /db_xref="GeneID:2888854"
     CDS             complement(465069..466424)
                     /locus_tag="CAGL0H04873g"
                     /note="some similarities with uniprot|Q05937 Saccharomyces
                     cerevisiae YLR375w STP3 or uniprot|Q07351 Saccharomyces
                     cerevisiae YDL048c STP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447007.1"
                     /db_xref="GeneID:2888854"
                     /db_xref="GOA:Q6FRY7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY7"
                     /translation="MAVEGMVDFSKSPNDHQNITLPPISSFDNLIKAAEKQYMGERLT
                     PVPSGIFTALGNRVKSREVINPIGTRNNSGILSYQFLSESPLGPSRMHSKIDLNMIHS
                     DTTSEIDSISASKSTIRNSVFPIEAFNSEKRNSTGRVPLIKPTWCSLNDSEQSSTQSS
                     RTTSAEISRSNSSIQLPSLSFNKKNVVMSNSDNSTEAMQGNALTPNSIEYSHKPILEA
                     IDKMKALESLKEEPHPSIFSEEHTPPTLSVPSVKTDMKVTKKRRRKQCPICHGFFANL
                     TTHKAIHLEPDIKPFVCSVCQRGFVRQNDVMRHEKMHWKDKILSSAVKSEDNKSGVTG
                     SKLTIADKEHLKSLHCIKGTYECPYNSALIELDLELYPYKGKEVNFITTQCHKTGVFS
                     RCDTFKNHLKALHFEYPQGTRRSERSFVSGKCKHCNMSFANVDEWINEHVGKNCGHTY
                     H"
     gene            complement(<468101..>468802)
                     /locus_tag="CAGL0H04895g"
                     /db_xref="GeneID:2888678"
     mRNA            complement(<468101..>468802)
                     /locus_tag="CAGL0H04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447008.1"
                     /db_xref="GeneID:2888678"
     CDS             complement(468101..468802)
                     /locus_tag="CAGL0H04895g"
                     /inference="similar to AA sequence:UniProtKB:Q12318"
                     /note="similar to uniprot|Q12318 Saccharomyces cerevisiae
                     YLR376c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447008.1"
                     /db_xref="GeneID:2888678"
                     /db_xref="GOA:Q6FRY6"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY6"
                     /translation="MEILKHCRIYPISSFCATTETYFKIPEDLVNQHLALRTRKLGHI
                     HVVEHSFRLSKVKKKLITTNLDENSGLILLIDVISCWKQFARSLVNNGQSIAYLSSAS
                     LCQFDGLLNFLGQLIDSPDEALKRCIFTDSYSCLQQPLTGIIIDNLSYYQTPVAMREF
                     SALQKMLKSLRSTFGCWTMTTSYGLEYYNGVEGGTSTLYTSSGTSFTRLPVSYIKDTD
                     LVLMRDTEDTYHLVK"
     gene            <469160..>470116
                     /locus_tag="CAGL0H04917g"
                     /db_xref="GeneID:2888505"
     mRNA            <469160..>470116
                     /locus_tag="CAGL0H04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447009.1"
                     /db_xref="GeneID:2888505"
     CDS             469160..470116
                     /locus_tag="CAGL0H04917g"
                     /inference="similar to AA sequence:UniProtKB:Q02775"
                     /note="similar to uniprot|Q02775 Saccharomyces cerevisiae
                     YDR088c SLU7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447009.1"
                     /db_xref="GeneID:2888505"
                     /db_xref="GOA:Q6FRY5"
                     /db_xref="InterPro:IPR021715"
                     /translation="MHNKKVTKDEKKNTKTKDVNEHIPNYIKNLPWYYQDIDKNSKNN
                     SKEQDYLRHHRQRRDDKTIDIDNNDQAKIGTGIKDEFEVIVENKKTTIDGIIKRRKDE
                     KDWDARKDRWYGYSGKEYEEVLKKWEKSREDLNNTTEESAYDTDEEIEMMKLGLTPKD
                     LEQNIKGSSVRLREDKAAYLKDIYSSTTNYDPKSRLYKSDDLGSIDEHSNMFLRHLTG
                     EGKELNDLNKFARENAKESGIRDELVDADKVNHVLVANPTKLEVLRKQKELDSLKLTE
                     EQNRQEQRKLKRKAKLLKKKAKKPKGTPQSDSTKAQLMDMYG"
     gene            complement(<470386..>471423)
                     /locus_tag="CAGL0H04939g"
                     /db_xref="GeneID:2888566"
     mRNA            complement(<470386..>471423)
                     /locus_tag="CAGL0H04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447010.1"
                     /db_xref="GeneID:2888566"
     CDS             complement(470386..471423)
                     /locus_tag="CAGL0H04939g"
                     /note="highly similar to uniprot|P09201 Saccharomyces
                     cerevisiae YLR377c FBP1 fructose-1 6-bisphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447010.1"
                     /db_xref="GeneID:2888566"
                     /db_xref="GOA:Q6FRY4"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY4"
                     /translation="MPVATERRASMDDFDTDIITLPRFIVENQKTVKTARGDFSLVLN
                     ALGFAFKFISQTIRRAELVNLIGLAGASNSTGDEQKKLDVLGDEIFINAMKGCGFIKL
                     LVSEEQEDLIVFPTETGTYAICCDPIDGSSNLDAGVSVGTIVSIFKLLPGSTGSIKDV
                     LRSGHDMVAACYAMYGASTHLMLTMGNGVDGFTLDTNLGEFILTQPNLRIPQLRPIYS
                     VNEGNRLYWDELIVSFIDSLKEGQESNKGKPYSLRYIGAMVADVHRTFLYGGLFSYPG
                     DRLKPDGKLRLLYEAFPMAFLVEQAGGKAVNDQGERILDLVPKHIHDKSSIWLGSSGE
                     IDKFLKHIGKE"
     gene            <474182..>475621
                     /locus_tag="CAGL0H04961g"
                     /db_xref="GeneID:2888525"
     mRNA            <474182..>475621
                     /locus_tag="CAGL0H04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447011.1"
                     /db_xref="GeneID:2888525"
     CDS             474182..475621
                     /locus_tag="CAGL0H04961g"
                     /note="highly similar to uniprot|P32915 Saccharomyces
                     cerevisiae YLR378c SEC61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447011.1"
                     /db_xref="GeneID:2888525"
                     /db_xref="GOA:Q6FRY3"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /translation="MSDRILSLFKPFEAFLPEVISPERKVPYNQKLIWTGVSLLIFLV
                     LGQIPLYGIVSAETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQLLQV
                     SLDSKEDRELYQIAQKVCAIILTFGQALVVVMTGNYGSPSDLGIAISLLLIFQLMFAS
                     FIVLLLDELLTKGYGLGSGISLFTATNIAENIFWKAFAPTTVNSGRGKEFEGAVIAFF
                     HLLAVRKDKKRALVEAFYRENLPNMFQVIATVFVFLFVLYLQGFRYELPVKSTKVRGQ
                     MAIYPIKLFYTSNTPIMLQSALSSNIFLISQILFQKYPSNPVIRLFGVWGIRPGTNGP
                     QVPLSGISYYLQPIGSLKMALLDPIKTVIYTAFVLGTCALFSKTWIEISGTSAKDVAK
                     QFKEQGMVINGKRETSVYKELKKIIPTAAAFGGATIGALSVGSDLLGALGSGASILLA
                     TTTIYGYYEVAAKEGGFTKNLVNGFSEMM"
     gene            <477828..>478913
                     /locus_tag="CAGL0H04983g"
                     /db_xref="GeneID:2888449"
     mRNA            <477828..>478913
                     /locus_tag="CAGL0H04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447012.1"
                     /db_xref="GeneID:2888449"
     CDS             477828..478913
                     /locus_tag="CAGL0H04983g"
                     /note="highly similar to uniprot|P41940 Saccharomyces
                     cerevisiae YDL055c PSA1 mannose-1-phosphate
                     guanyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447012.1"
                     /db_xref="GeneID:2888449"
                     /db_xref="GOA:Q6FRY2"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR029044"
                     /translation="MKGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEA
                     GVTDIVLAVNYRPEVMVDTLKKYEKEYGVNITFSVETEPLGTAGPLKLAEKILKKDNS
                     PFFVLNSDVICEYPFKELAEFHKSHGGKGTIVATKVDEPSKYGVIVHDLGTPNLIDRF
                     VEKPKEFVGNRINAGLYILNPEVIDLIEMKPTSIETETFPKLVNEKSLYTFDLEGFWM
                     DVGQPKDFLAGTGLYLQSLSRRHPEKLSTGSNIVSNAIIDPTAKISPDAKIGPDVVIG
                     PNCVIGSGVRIVRSVLLKNCVVKENSLIKDTIVGWDSTIGRWCRLEGCAVLGHDVAVK
                     DEVYVNGAKVLPHKSISANVPSEAIIM"
     gene            <479837..>481195
                     /locus_tag="CAGL0H05005g"
                     /db_xref="GeneID:2888669"
     mRNA            <479837..>481195
                     /locus_tag="CAGL0H05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447013.1"
                     /db_xref="GeneID:2888669"
     CDS             479837..481195
                     /locus_tag="CAGL0H05005g"
                     /inference="similar to AA sequence:UniProtKB:Q06705"
                     /note="similar to uniprot|Q06705 Saccharomyces cerevisiae
                     YLR380w CSR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447013.1"
                     /db_xref="GeneID:2888669"
                     /db_xref="GOA:Q6FRY1"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY1"
                     /translation="MTTSKDTMSSNKKESHLPLEREVVLSPEKELLLKQAWVYLLQLW
                     GVSVNGDIVFKDAHHGDIDGLSTQMSALSTGSSEPKKKKTSLFGRLTGSDHHDTSKHA
                     THETEHHTRHTQIPYVKDGVHPEFTKLELDSKATYKEFWESLRLEPADPNILRFLKAR
                     KWHMDKTIHMIAKDMSWRTKSGYDINSILDGGEYEFVKTKKKGVIKNLELQKAIVAGK
                     DKDGKPYILARPKLHYSSDQTEEEIEKYALLVIEQAKLFLRPPEIAQCSIVFDLGGFS
                     MSNMDYGPVKFLITCFEAHYPECLAHLFIHKAPWIFTPIWNIVKNWLDPTVATKITFT
                     KNVEELARYIDIKQIPTYLGGELDLDMEHYEMPDGSKDELLRDEETRDKLLKEREQLI
                     QNFLKLTAEWIESDDNEKQSISIRNKRALASEKITQNYIQIDPYIRSRSAYDISGALV
                     LQ"
     gene            <481654..>483762
                     /locus_tag="CAGL0H05027g"
                     /db_xref="GeneID:2888453"
     mRNA            <481654..>483762
                     /locus_tag="CAGL0H05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447014.1"
                     /db_xref="GeneID:2888453"
     CDS             481654..483762
                     /locus_tag="CAGL0H05027g"
                     /inference="similar to AA sequence:UniProtKB:Q12748"
                     /note="similar to uniprot|Q12748 Saccharomyces cerevisiae
                     YLR381w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447014.1"
                     /db_xref="GeneID:2888453"
                     /db_xref="GOA:Q6FRY0"
                     /db_xref="UniProtKB/TrEMBL:Q6FRY0"
                     /translation="MEPLISTAIDNLLSANATVTTDFIKVQLEIIYHQTIKFGLTNLE
                     LRNIIHFITTTQLITDETKLYIIHNCLYPCEVIGKEVVMEILSKLGTTTIYSPYELTT
                     PKTVQTALCEWLVNAFFLVDIEQIREFDSFWIHLWKYSYLQKWLTYIIVWTANPHNVK
                     QWKIRMIHNIAINLGYSESSGYAVIILKKYQQICGYSAEINDILPTLRFPYRRIIKVQ
                     NIKLRNRFFKNTSDILITSTPDTFNMEKLENRMQMLINSLLIDEIKSSQGVKPSIIDK
                     NIDIELLIPKNSTQLIDRWNLMQPSDIVISSELFHPNNKINYYILAFISTKRSPQFVE
                     DYITDYFMRHLSDNEDNFGNAYKSFLAFVKLLLLIYPNISLSLTKTIGNGTQYDVKKS
                     VLMGVLPAILPKSKINIECIQKCIFNIISSNFNTQNLLSQKSLNLSVVTTRLYFDLYF
                     LIFLNSELAADLSSLFHRAGTLGFRRTIETTYNFGDISSSVYYLNLVTSIIDSNELYK
                     SVPGLIIKPNILKSLIMVFDPLLLNSCCKYLTQSKGALSVNIQDKDLIRCHNQLLLDT
                     TNYLWRNKILSSRSLFDISTKFIKQVVDNLYLPDCDKKDKNVFGLPGVPTTGFVFLQA
                     VRRLEGTHGARSHYNTDYTSSGFKKFKSNQEEKGDWLHDIEDFDEFRRVVLKEFTSID
                     CVKEIAVFLYTFLKSLTSNL"
     gene            complement(<483870..>486593)
                     /locus_tag="CAGL0H05049g"
                     /db_xref="GeneID:2888800"
     mRNA            complement(<483870..>486593)
                     /locus_tag="CAGL0H05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447015.1"
                     /db_xref="GeneID:2888800"
     CDS             complement(483870..486593)
                     /locus_tag="CAGL0H05049g"
                     /inference="similar to AA sequence:UniProtKB:P11325"
                     /note="similar to uniprot|P11325 Saccharomyces cerevisiae
                     YLR382c NAM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447015.1"
                     /db_xref="GeneID:2888800"
                     /db_xref="GOA:Q6FRX9"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002302"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR025709"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX9"
                     /translation="MLVKIWPSQRSIVRIAAAGLQNSRSVHSGQTISERLVEIGEKWK
                     SKTLEGVPRNARVPFIPIKENDKRDMYILSMFPYPSGMLHMGHLRVYVISDTLNRFYQ
                     QRGYNVIHPMGWDAFGLPAENAAIERGIDPSEWTKQNIKKMKEQMNDMLANFNWEREV
                     TTCDPEYYKFTQWLFLQLYKNGLAYRKDAEINWDPVDKTVLANEQVDANGRSWRSGAI
                     VEKKKLTQWFLGITKFVDQLRDDLKYLEEWPNKVKTMQNNWIGSSTGMEVNFKLNKKI
                     GKFENVTVFTTRAETLFSVEYVVLATDHPITQHYAKQKSDLREFLHKLPELPEDTKTG
                     YRISDLTVENPITHEVIPVFVAPYVISGYGDLPAAVMGCPAHDLRDYEFRKINLNTNE
                     EPFGCIIPDLSRLGQDSIPYTSKSGTMNERCGKYVGWDVNATRDAISTELENKNLGKR
                     TTRYRIKDWLISRQRYWGSPIPIIHCNNCGIVPVPEEDLPVTLPYVQGLHQKGNPLSN
                     ISDFVNTECPRCHNSAKRETDTMDTFIDSSWYFFRYIDAHNKVLPFSPEKANKSMPVD
                     IYIGGVEHAILHLLYSRFISKFLSSIGMWDRGISHGEPFKKLVTQGMVQGKTLIDPET
                     GKFLTPNDIDYLSSSSTPKIKGKNIAPILKYEKMSKSKYNGADPNECISKHGPDATRA
                     HILFQSPISDALRWDEEKIVGIERWLDKILQLCMSFASNPDKIVGMTGIPPDQYNTDE
                     ITLYNNVSKMVNSITKSFSENLSLNTVISDYMKLTTLLENAKKNTKIRDTVTINYVRD
                     LIKCIYPVVPSIAEEASCILQTHLNVNVNIYEWPTAREVIKSSLMNLKIFINGKMRFM
                     YATDQSISKLDDMSLLKLLSKTEDGARLIPAKKLKQIIRKKDLISLIFEKQ"
     gene            <486899..>490231
                     /locus_tag="CAGL0H05071g"
                     /db_xref="GeneID:2888697"
     mRNA            <486899..>490231
                     /locus_tag="CAGL0H05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447016.1"
                     /db_xref="GeneID:2888697"
     CDS             486899..490231
                     /locus_tag="CAGL0H05071g"
                     /inference="similar to AA sequence:UniProtKB:Q12749"
                     /note="similar to uniprot|Q12749 Saccharomyces cerevisiae
                     YLR383w RHC18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447016.1"
                     /db_xref="GeneID:2888697"
                     /db_xref="GOA:Q6FRX8"
                     /db_xref="InterPro:IPR027132"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX8"
                     /translation="MTQELRKRSFEHVDELLNQASNEVNYDSNKRVRRHEYSAMTQYS
                     SMPNSRVDTEADAALGRRVDCAHRDIGLISPPPGYIKKLTLHNFMCHRNFDVELGPGL
                     NFIVGKNGSGKSAILTAITIGLGAKASETNRGSSLKDLITAGCNSSRITIYLSNSGIG
                     AYVPKGKQYGDTIIIERTISRTSTAGFSLKSENGTEISNKKRDLQEILDYFAIPISNP
                     MCFLSQDSARSFLTASTPTDKYNHFVKGTLLQQIKDYLERATEVHNESAAAMELHTES
                     LRELQERYDKAKTDLRQISKTSDLNERLKLLTGKSLWLNVDENVMNINKLKNKISHYE
                     NEISKLTEKSDSRMNQIDSLKSEITIIEQGLSGKLSKMVEKEEQFQLMNEKIREAKSK
                     YEQEENNEKEILDNIERCKSIIKKLNKSISELQEKQEKEQGGDKDNMLQEIEKLTASN
                     SELKKDIEAYMTKIQDINAKLRTVKMESLKTIDSIDTQIREKQNEVKDIKHGRTNFLR
                     NFDNNMEHLIKEISNNKSKFDNLPIGPLGNYVSIKSGYEKWAPSIQRYMTTTLSSFVV
                     SSHRDNGLLRQLMKKCNVRSSNFSIINYKLQNAHFFDNNKLNQKYPTILDALDFIDGN
                     LAAVFVDMNKIDRVLLIENMSEARKFLLENGGDTKVALSIRDNNYGYQLTGGTRIDSV
                     KYQDKIRVKVGTSSEDNIAYINTVIRNLQEEKQSTQSRYKDRLQIINNELKECETALV
                     HTKDTYRANNEKIKSFKTNITREVDTGKLNMQIEEKKNQEVAVESYLETRKSIQLHLA
                     DMVEDIKPLQEQYMIYKNELDQSKTEIENDRELLRRSKDKILKYQDHIKELLESVKNI
                     EKNIPKIADNIRVLEDGVGLQKQKAQEICPRAELSNDLPHSQEEIKQEITNIQQKLQE
                     AEKMMGMSQQQIVDNYNNAKTKFIDASKKYKVIEEVLGKLTRTIKIREQNLERTQQIT
                     FFEADNDFKASMRIRKFAGHLDFDKKEKKLSILILTPNDDRYREVSTFSGGEKSYSQM
                     ALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLIVKKLKDIPNTQTIIITPQDIGG
                     IAEIDDSVRILRMRDPKRTTIN"
     gene            complement(<490310..>494308)
                     /locus_tag="CAGL0H05093g"
                     /db_xref="GeneID:2888528"
     mRNA            complement(<490310..>494308)
                     /locus_tag="CAGL0H05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447017.1"
                     /db_xref="GeneID:2888528"
     CDS             complement(490310..494308)
                     /locus_tag="CAGL0H05093g"
                     /note="highly similar to uniprot|Q06706 Saccharomyces
                     cerevisiae YLR384c IKI3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447017.1"
                     /db_xref="GeneID:2888528"
                     /db_xref="InterPro:IPR006849"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX7"
                     /translation="MRNLITLNKGRLLPVATSELSENETVFTVLDSTFDTMTDSITCV
                     LGSLEMGAIEVQQFMKDGSRNVLASFNIQNFNDRLLSFIHFGDINQLVFIFEMGDIIT
                     ATYDSVTFDPAQTIVEIAGSIDNGIYAAQWSPDEETVVLITKDRNVVLLSRLFEPIAE
                     YHLETDDLKKSKHVTVGWGKKETQFRGKGARAMEREALASLKASGLVGNELRDPTMPY
                     MVDSGEITSLDSKEVTITWRGDCEFFAISTIENVELPEEPGHEIQRRAFRVFSRDGVL
                     DSASEPVDGMEHHLSWRPQGSLIASIQRKSFLEEESSLELIFFERNGLRHGEFDTRLP
                     VDEFVKELCWNSNSDVLAIVLSNRIQLWTSKNYHWFLKQEIYSESISFAKWHPEKDLT
                     LMFESGNGVNIVDFAYKMTNGPTLEPFDNGTVMVVDGSTVNITPFALANVPPPMYYRD
                     FDAPGNVLDVACSLSNEIFAAITIDELVVAYVPSIDDMKKGQHPTVVSELSKATFASA
                     IDSLRQVAFINDNVIGILLDSENLSHIVLVDVQDVSQPVLLKTVEIFDKIVLMKTSFD
                     YNHIVYETRDGSVFEVDVEGELKQITKFPQLVIDFRVKRVHNMLEGKEDNWESESSEV
                     IAFGLTSFGKLFANNTLLTTAVTSFEVTDKFLMFTTAQHRLQFVHLNNTNFKQLPIVP
                     DQVEDERIRAIERGSLLVTSIPSRAAVVLQADRGNLETIYPRIMVLSEVRKEIKDQKY
                     QEAFLTCRTHRISLDLIHDYDPDSFISNLDNFILQVEKVDHLNLFISCLTEDDVSSTK
                     YKETLTSDMALPYAVAAEPLTEMQEYMKKKMFDPATSKVNKICKAFLDTLLSKDEYMK
                     KYINTILTAYATQNPQDLESALLLIASLSTEEDKDSSVTYLCFLQDVNVIYKSALATY
                     DVKLALLVAQKSQMDPREYLPFLQSLYEETENRRKYMIDDYLGNYEKALGHLISTESD
                     STIVSDEIINYVETHNLFLNALATFRYETNKQNMIYKSYAKDLQSKQEYKDAAIIFEM
                     LGEYQNAVNAYKSAKSWKPALSIAELKFPDDVQELANDLVSSLTFEHKYEDAAQVELI
                     YLKNVREAVKYYCKSYKYDTAILTATNTNNIKFIEEIVDTELADGFGVIAELLADCKG
                     QINSQLRRLRELRTKKEEDPYAFYGQETEQADDVSIAPSETSTKESFFTRYTGKTGGT
                     AKTGASRRTAKNKRREERKRARGKKGTIYEEEYLIQSIGRLIERLNQTLSDSYNLVEA
                     LCRRNKREQAYQIQKNFLEVIQLLNENVKEIYSISEKDRERIDENGEVYLIPEMKIPE
                     IPVFTINRAVSF"
     gene            complement(<494729..>495118)
                     /locus_tag="CAGL0H05115g"
                     /db_xref="GeneID:2888481"
     mRNA            complement(<494729..>495118)
                     /locus_tag="CAGL0H05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447018.1"
                     /db_xref="GeneID:2888481"
     CDS             complement(494729..495118)
                     /locus_tag="CAGL0H05115g"
                     /inference="similar to AA sequence:UniProtKB:Q06707"
                     /note="similar to uniprot|Q06707 Saccharomyces cerevisiae
                     YLR385c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447018.1"
                     /db_xref="GeneID:2888481"
                     /db_xref="GOA:Q6FRX6"
                     /db_xref="InterPro:IPR020195"
                     /translation="MTESEYSSKVRLLILQILLQHQQSLVMKNKDLDIKKLLVEPVID
                     IEVMNNCQSNTFLKLNAPTVSKLTVRNLRFLVEEWLSEGIPNVPKEETTIITLANYYY
                     SKRINELEEKELPTIRSEAKELFDRLK"
     gene            complement(<495715..>497208)
                     /locus_tag="CAGL0H05137g"
                     /db_xref="GeneID:2888474"
     mRNA            complement(<495715..>497208)
                     /locus_tag="CAGL0H05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447019.1"
                     /db_xref="GeneID:2888474"
     CDS             complement(495715..497208)
                     /locus_tag="CAGL0H05137g"
                     /note="highly similar to uniprot|P54115 Saccharomyces
                     cerevisiae YPL061w ALD6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447019.1"
                     /db_xref="GeneID:2888474"
                     /db_xref="GOA:Q6FRX5"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX5"
                     /translation="MAYKTAATKTIKLPNGLTYEQPTGLFINNEFVESSDGKTMTIEN
                     PSTQEPIVDVFSATKEDVDYAVDCAERAFEKSDWATQDPKVRARYLSKLADLMEEQLE
                     LIASIETLDNGKTIALSRGDVQLSINCIRDAASYADKVDGRSIDTGDGYMNYTIREPI
                     GVCAQIIPWNFPLMMLSWKVGPALAMGNCIVLKPASATPLNALYFSSLCKQVGIPAGV
                     VNIIPGPGGMVGTALTTHPKVRKVAFTGSTDIGKDIAVKASASNLKKITLELGGKSAH
                     LVFNDANLEKTLPNLVNGIFKNAGQICSSGSRIYAQAGIYDRLLKEFKAYIEKNIKVG
                     NPFDESNFQGAITNKEQYNTILKYINIGKEEGAKVLTGGETAAEKGYFIKPTVFYDVK
                     EDMRVVKEEIFGPCVTISKFEEIEDGVAMANDSEFGLGAGIETENLSTALKVAKMLHS
                     GTVWINTYNDFDSRVPFGGYKQSGYGREMGSEVYECYTQTKAVRIKL"
     gene            complement(<501094..>502551)
                     /locus_tag="CAGL0H05159g"
                     /db_xref="GeneID:2888680"
     mRNA            complement(<501094..>502551)
                     /locus_tag="CAGL0H05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447020.1"
                     /db_xref="GeneID:2888680"
     CDS             complement(501094..502551)
                     /locus_tag="CAGL0H05159g"
                     /inference="similar to AA sequence:UniProtKB:Q02776"
                     /note="similar to uniprot|Q02776 Saccharomyces cerevisiae
                     YPL063w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447020.1"
                     /db_xref="GeneID:2888680"
                     /db_xref="GOA:Q6FRX4"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027111"
                     /translation="MLSLFRCAVTRAPHIASKGISVQISRNLANSLIVQNKRRLNTKS
                     YFLQEQKKDDKKAQSILTDDLLFKAGIDVEEGKKEGQQKQHETEEGNEEQQSENSSNK
                     KRKRRMTSADKKKERYANYFYIFTFSSLAGLGLYMCRDWEENEDDEMKKDIDNGYTPD
                     LMYKRFRARFNSVFTYFQEPPFPDLLPPPPPAPYQRPLTLVITLEDFLVHSEWDQKHG
                     WRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMDPIHAFISYNLFKEHCVY
                     KDGVHIKDLSKLNRDLKKVMIIDTDENSYKLQPENAIPMDPWDGKADDKLLRLIPFLE
                     YMATQQVEDVRPILKSYHNKRELPAEFEQRVQKLKNKFEQDQKKKNDSNWLLKLLGLA
                     PVINGIGGGNKFPLDMIREEGEKNYVRFMKLIEEEKEKMRIQQEQMSGQTFTLKDYVE
                     GNIPTPEEQMKMQLEKQKEIDALFEQKKKEQQANK"
     gene            complement(<503256..>503948)
                     /locus_tag="CAGL0H05181g"
                     /db_xref="GeneID:2888616"
     mRNA            complement(<503256..>503948)
                     /locus_tag="CAGL0H05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447021.1"
                     /db_xref="GeneID:2888616"
     CDS             complement(503256..503948)
                     /locus_tag="CAGL0H05181g"
                     /inference="similar to AA sequence:UniProtKB:Q02767"
                     /note="similar to uniprot|Q02767 Saccharomyces cerevisiae
                     YPL065w VPS28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447021.1"
                     /db_xref="GeneID:2888616"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="InterPro:IPR017898"
                     /db_xref="InterPro:IPR017899"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX3"
                     /translation="MNQIPTALNEEVPLFENSSSSQDKETLEGVADVYSIIVALDYVE
                     KAYLRDSISSTHYTQSVNKLLAQYKTYMSMPDISEYVGDLHDFKEKYNIIASNAITRL
                     ERGIPVTVEHAIDIDTNNDGSNGSLESKSQGGKYNAKNVAEATGNFITIMDALKLDYK
                     AKDQLHPLMAELLLSINRVTNHDFENRSKLVEWIVKINKMKVEETLDEHEVRELLFIL
                     NQAYKSFYSLLG"
     gene            complement(<504258..>505685)
                     /locus_tag="CAGL0H05203g"
                     /db_xref="GeneID:2888892"
     mRNA            complement(<504258..>505685)
                     /locus_tag="CAGL0H05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447022.1"
                     /db_xref="GeneID:2888892"
     CDS             complement(504258..505685)
                     /locus_tag="CAGL0H05203g"
                     /inference="similar to AA sequence:UniProtKB:Q12194"
                     /note="similar to uniprot|Q12194 Saccharomyces cerevisiae
                     YPL066w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447022.1"
                     /db_xref="GeneID:2888892"
                     /db_xref="GOA:Q6FRX2"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX2"
                     /translation="MTVPIISLMPSYNSMIRGCPGISDTLPRIECQLRVRSNNGSEFR
                     IAKIEVILKSVETVFPQSHVSYSFTPIGKSKSKPRKNESISYHYKKSFYLANDEKCKA
                     AKNKNTQRISKPLIGVDFPLTISLPADINDTNFNSRFGTCVTYLECNLLYYDLEKVGP
                     SFDSVPPELKNFITTVNVERYTNLPLKKLFPAIEKNFYSPDKKLKAKVYVENPCITTD
                     DLLKIKLKVMPNQHSSSTAPEYENSVLFKKKLKVKSVTFQTKEIFQCHSETYESKEYV
                     LDTETKNYNEIITMNGFETANDIHICTKDVLFKEFENTMLEPELLYKLPKQPEGNMTN
                     RNVPTKLLQNKVDAIPFRYHCSISTNGKYYSIGHAIDIKIKIGSGKDFEFSIPITISQ
                     WLKSHTKYIQQAIIQEREIASHAKRFYSGYGGLQKHSNGMIEYPTLPPIIYDSREHNN
                     SKNFHIFQLTSGNGKSQLKKLPIID"
     gene            <506003..>506608
                     /locus_tag="CAGL0H05225g"
                     /db_xref="GeneID:2888652"
     mRNA            <506003..>506608
                     /locus_tag="CAGL0H05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447023.1"
                     /db_xref="GeneID:2888652"
     CDS             506003..506608
                     /locus_tag="CAGL0H05225g"
                     /inference="similar to AA sequence:UniProtKB:Q02754"
                     /note="similar to uniprot|Q02754 Saccharomyces cerevisiae
                     YPL067c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447023.1"
                     /db_xref="GeneID:2888652"
                     /db_xref="GOA:Q6FRX1"
                     /db_xref="InterPro:IPR022036"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX1"
                     /translation="MALQPMNWASIKQNIESGELQNLKRSPIETEKYHEHKRILAEKN
                     IEIGDYILNKLGWTLNELASVNDISEEEKLSLSFSRKDLYKLSVNDFPYNFEPQVSHL
                     LIWSKINLPLYNKNESSTDMNPEMKTKIETFIHNNLSKYLDLDMKDDYCWFINYRNLQ
                     SIKGIAHVHLLIRCVDENGPQGNRCQRIKNEILNEGFEPIS"
     gene            <506947..>507891
                     /locus_tag="CAGL0H05247g"
                     /db_xref="GeneID:2888663"
     mRNA            <506947..>507891
                     /locus_tag="CAGL0H05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447024.1"
                     /db_xref="GeneID:2888663"
     CDS             506947..507891
                     /locus_tag="CAGL0H05247g"
                     /note="weakly similar to uniprot|Q02749 Saccharomyces
                     cerevisiae YPL068c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447024.1"
                     /db_xref="GeneID:2888663"
                     /db_xref="GOA:Q6FRX0"
                     /db_xref="UniProtKB/TrEMBL:Q6FRX0"
                     /translation="MELRKRKKVNYSESKGRIGGLKTVVVQPDSPPHNFNKDVKPKGL
                     PQKIVRYTPMINKRKASKRINKPTSKKVPHVMGNYDNSCRIKKLTFERPSFNDYSNYK
                     QPEPALTGLIHSDARIDWINAKKFLANHREKLRKLAKFQYELYYKDITKPEYKGPQAF
                     ASLKLPDDMVSYSNIIKSIGSLLHEVENLETNKNSQKLYKPTIEISAEALKTIREQTS
                     NNDRIERTAELHDIDIEDIKQILRKNEINTTLHQMNMLKSSDFQIMHTLMEKRYFPYD
                     DSSLLWPTKYKKELKRYSSSELDQNDPLQLSIPLFTDF"
     gene            <508560..>509558
                     /locus_tag="CAGL0H05269g"
                     /db_xref="GeneID:2888789"
     mRNA            <508560..>509558
                     /locus_tag="CAGL0H05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447025.1"
                     /db_xref="GeneID:2888789"
     CDS             508560..509558
                     /locus_tag="CAGL0H05269g"
                     /inference="similar to AA sequence:UniProtKB:Q12051"
                     /note="similar to uniprot|Q12051 Saccharomyces cerevisiae
                     YPL069c BTS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447025.1"
                     /db_xref="GeneID:2888789"
                     /db_xref="GOA:Q6FRW9"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW9"
                     /translation="MTLEKLKTLIESPPAWSQSDENSINQPYNHIASNPGKNFRAKLI
                     HLFNQFYLLDENIIQTLTQIVEILHNSSLIIDDIEDNSQLRRGVVASHMLYGVPMSIN
                     TANYMYFVAMDLLRNLSHDAVTSNDLMKIFNEELLYLHRGQGLDIYWRDSLPKVVPTE
                     EMYFNMVMNKTGGLFRLTLKIMERLSEYWQGQKSLVPLGNLLGIIYQVRDDYLNLTDS
                     SMIETKGFADDISEGKLSFPIIHGINYAKIHDPNNTLLLDILCLKTKDENLKKNAIRY
                     LSDCSKSFEYTSSVLKKLTTLLHSNSYFPDVTNDSTNSQTEAIKQVYNIMEKLANV"
     gene            complement(<509813..>511519)
                     /locus_tag="CAGL0H05291g"
                     /db_xref="GeneID:2888503"
     mRNA            complement(<509813..>511519)
                     /locus_tag="CAGL0H05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447026.1"
                     /db_xref="GeneID:2888503"
     CDS             complement(509813..511519)
                     /locus_tag="CAGL0H05291g"
                     /inference="similar to AA sequence:UniProtKB:Q02866"
                     /note="similar to uniprot|Q02866 Saccharomyces cerevisiae
                     YPL070w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447026.1"
                     /db_xref="GeneID:2888503"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW8"
                     /translation="MTHLFTPPINSSKFDPSLSIKESYKGHSAQGSIASNISSTESSN
                     SELGKDDSKGSKSPKLSKEEIDQISQIGELPDELSAMIDAFIDDLKQPKYERPLSVPQ
                     LSSLFQAFYIRFDKHSFHYLQSKKTTSSSTNVSTFFNARETLTSGIGGLFSRSRSSSA
                     STNVSTRRNRRSSSIFSNESGSNNVTQMLSPEEIQRQLKTDALNNLKIEKYKDLCERD
                     LFNRILQVGTSVPISSPSKSANVNGNSTLANSTMTRDVHAKKNESFSIVSLFRNSPEF
                     GEYDKLIDERVNLLYRFDKEEFFSLSDFLDIPKGNDEFDSIQSIANIKMVLDDFANNV
                     IAPGEKCKCLLKMYEIMENSKAMSNDDFLSLLIYYVIKCPMLHIFLNMEFVRLFRIKK
                     KLVDSELFAITNLEAALVFIEGLTLDDLPQLLRDNLTDREKSLFAVPISRKVKLPELG
                     RHEIDIEKDAELTKRIEVSRTASYEGFRSVFDSSLRNIIDRIRAYPISNGTESSPWIN
                     TDLKKEVPTQLSSFKQAPISNYTPSIPENWKQFKDYAFEDLTISNLREIFEIYKEMVD
                     EN"
     gene            <512084..>512563
                     /locus_tag="CAGL0H05313g"
                     /db_xref="GeneID:2888861"
     mRNA            <512084..>512563
                     /locus_tag="CAGL0H05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447027.1"
                     /db_xref="GeneID:2888861"
     CDS             512084..512563
                     /locus_tag="CAGL0H05313g"
                     /note="weakly similar to uniprot|Q02864 Saccharomyces
                     cerevisiae YPL071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447027.1"
                     /db_xref="GeneID:2888861"
                     /db_xref="GOA:Q6FRW7"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW7"
                     /translation="MGFSRNFKGDSRKRPHSPDLYAIGEFKKSKLIEDLERLSLNDDV
                     VSENNGLQIVDHNKFRRPHKDDTSHPGDRKWVITQIVDLMRAESLQVIPWIDYKQFAY
                     NEWLKWYKIKLLSDDTLMIDIDNLLENDFYMRVEPTSNYRGQIEGNNETEDMDIDID"
     gene            complement(<512683..>514134)
                     /locus_tag="CAGL0H05335g"
                     /db_xref="GeneID:2888532"
     mRNA            complement(<512683..>514134)
                     /locus_tag="CAGL0H05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447028.1"
                     /db_xref="GeneID:2888532"
     CDS             complement(512683..514134)
                     /locus_tag="CAGL0H05335g"
                     /note="weakly similar to uniprot|Q02863 Saccharomyces
                     cerevisiae YPL072w UBP16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447028.1"
                     /db_xref="GeneID:2888532"
                     /db_xref="GOA:Q6FRW6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW6"
                     /translation="MLLVPILQTNKDLFKTIIDQLFYGFRRSNSFKAGVGLIGLLVSY
                     IVYPSVKNILFSKNINGSLASRPDKYTTGLVNKGNYCYANSVIQALSSIDYFSDYINK
                     FVIGIDENEISSAGLEKTDTEALLLHRALADLLRKLQMVIFEPTNADIKHLVSVLEWK
                     VSGRLSRAQNDAHEFLQVLLEQLHVELSNSHKTSSCKFPFAGTIIESYKCLQCQHETA
                     PKKSTFNIFEAPLPQKYEIDLNDVLMRNSNEIIDDYKCMVCLIRSVITLERAHGFSGT
                     AESIKGKLLALEKKLPDITINEEFDIELQNYLDTYCKYGFKNNVARRSILKQCKFVNA
                     PDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVRYRLKSIV
                     IHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRMKSTTIYP
                     FWLISDTNVKEKRISDIVNEQKSVYMLFYERIL"
     gene            complement(<514513..>516825)
                     /locus_tag="CAGL0H05357g"
                     /db_xref="GeneID:2888658"
     mRNA            complement(<514513..>516825)
                     /locus_tag="CAGL0H05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447029.1"
                     /db_xref="GeneID:2888658"
     CDS             complement(514513..516825)
                     /locus_tag="CAGL0H05357g"
                     /inference="similar to AA sequence:UniProtKB:P40328"
                     /note="similar to uniprot|P40328 Saccharomyces cerevisiae
                     YPL074w YTA6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447029.1"
                     /db_xref="GeneID:2888658"
                     /db_xref="GOA:Q6FRW5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW5"
                     /translation="MIGPEKFAIPSGFSLEQSLNLLHSIARDQYQNLRNNLNIAIEKK
                     DNIELPRLSKSLESLLYYVNDGMKRIEKAFKLKTNILTVGENDSTLKESVEDLQLLGY
                     DIRLARRDAQLTLNGIEDQANGRSLTKLWRRNSTRKIKNESLDDSTAIKEAERILENR
                     KRKLAEKQELERKRLLELENQRKKLMDLQVRQQVDLEVASKLEEEELKRKELELLERE
                     REERLAREKALKEQEEAKLKEMEEQERLRKEVQRQIELHKEQERKERERQEKLERQKE
                     VELTSVSNRGKKQVSSSNDRSDIVMNRRSIDMGSANRDHDRQTERKNNGFHIGRAAQV
                     AWTQFQPDDIRKRYPVSTATTMLKKPVSTIPKLQSYHAPKKRYEYTKPVINRVHIKAP
                     KKAQTSVATDSNSREVFTKAIRRTKSQSAPSSPVLADQPRRSVDSKRPAKSSESPKRY
                     MNERIQSVMDTLEGVDKMACEHILNDILVVDEKVYWDDIAGLRNAKNSLKEAVVYPFL
                     RPDLFKGLREPIRGMLLFGPPGTGKTMIAKAVATESNSVFFSISASSLLSKYLGESEK
                     LVRALFYLAKRLAPSIIFIDEIDSLLTARSDNENESSRRIKTEVLIQWSSLSNIVAQN
                     ENSGGLSDNRVLVLAATNLPWAIDEAARRRFSRRVYIPLPDYDTRLMHITKLLSKQPN
                     NLTISEYEEVARMTEGYSGSDLTALAKEAAMEPIREVGDRLMDIKNETIRGVTFEDFK
                     NALATTKKSVSQQSLKQFDDWSTEYGSTGV"
     gene            complement(<517605..>520658)
                     /locus_tag="CAGL0H05379g"
                     /db_xref="GeneID:2888664"
     mRNA            complement(<517605..>520658)
                     /locus_tag="CAGL0H05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447030.2"
                     /db_xref="GeneID:2888664"
     CDS             complement(517605..520658)
                     /locus_tag="CAGL0H05379g"
                     /inference="similar to AA sequence:UniProtKB:P07261"
                     /note="similar to uniprot|P07261 Saccharomyces cerevisiae
                     YPL075w GCR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447030.2"
                     /db_xref="GeneID:2888664"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW4"
                     /translation="MNFLGLSPITKGDTTNVSKTNKADEESVSNLNRGMSAPSLSTSI
                     FAMPRTIPTTNNDKQKQNWNVISENQTNPAQETIDARKFNEDATSPKQVDITNNKLKS
                     LLLKQEEHSNINSADTTTNFYAISQYILQSYFKANSSDLASLKLVDLIVDQTYQDSLT
                     LRKLNETTAMQPYQYFNTVSRNPDISRCPIFALAVYFVIRWSHPNPPITINNYHLISL
                     LDSNFIDPNAKLVNNENPDHQQLSQNTKILRSEIFHPSPDMIELVFPWLPALKQDMLL
                     IDRTNYKLFSLCELFEFMGKVIIQDLRYLSQHSMLLPKIVEFISKFIPELFENEQFKS
                     SSEDEFMMERQGSDFQPNSYDTNLQSISREGTQNGYINNSVLEKMIESQFVSLSKKLT
                     TENIRLSQEITQLKSDLNSVTSMCNQILQLQRKIANGENQTRDRSMGNSVNGEGNIII
                     LDKNALNSQLINQLVHSADDTSQQKGLESSQLAPIGTFNSLQSKLQNSEAQKRKLPFP
                     SHQAATSNIVNVPMNNANGGASPYSPSINMQPDSPYNKRYRLEDKSTPSQNALDSLLS
                     KSVASPRVGGSSVNGSNIMDSPRSNRNNSIDKKFFMTGQYNSPGGNQGTFTDGSFNRI
                     LSDIPYKAASREETIIKPLSPNVPILPVNTTISHRRQQGALKKLVERPTLPITESTTS
                     LPPSPDAQSAIDSNQLPKPQLASRASTIVDPDLSVEVMHTIPAPGHSNLQHTLEKGYE
                     GKSSRDDIEKNKKMETQKRRKGDGASKPEHLPPLKYKLSRDNKTIWDLYAEWYIGLNG
                     QPSIRKLIEDYGYRRWKVSDDSHFFPTRRVIIDYIETECDRGIKLGRFTNPNQPREDI
                     RKIIVGDLERFRINNALTLNSLSVYFRKLIKENNEICIFENFNNWQVRAMTEEEKIRY
                     CKRQHGPADRNVTTTNESHSSVTDSQRPNMIAKQTFNNPIENPTTTSIERESSSSSEK
                     NSSPRQEDAEVGNTLPKNADADDDRNNEHNDNVTNNEFNDKDETA"
     gene            complement(<523211..>524047)
                     /locus_tag="CAGL0H05401g"
                     /db_xref="GeneID:2888500"
     mRNA            complement(<523211..>524047)
                     /locus_tag="CAGL0H05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447031.1"
                     /db_xref="GeneID:2888500"
     CDS             complement(523211..524047)
                     /locus_tag="CAGL0H05401g"
                     /inference="similar to AA sequence:UniProtKB:P46961"
                     /note="similar to uniprot|P46961 Saccharomyces cerevisiae
                     YPL076w GPI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447031.1"
                     /db_xref="GeneID:2888500"
                     /db_xref="GOA:Q6FRW3"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW3"
                     /translation="MSKAPWERKLWKQQDYPDNHTDSEFYVLLKEIQASKYNNADRQI
                     IDQRIIRQDFLSFYHLVMNTSFVYVVFCYLYYYERDPLPPCIGMTALVTLLYVVNQRS
                     HRLLTFKSSMLITFTMLILSPVIKSLSRTSASDSIWTLSFWLSVSYLYVNSSSKTENN
                     TPTNLSTNILLANVAVLASRLPTTTEVFCFMLLCVEINIVLPTLVSPHNILFSLGTHI
                     TVYTFVTTTLGITYMVSTLAVAIAFQLLFPKWFIYWKLHYHRYDNALLSGWDPAKPII
                     DR"
     gene            <524310..>525314
                     /locus_tag="CAGL0H05423g"
                     /db_xref="GeneID:2888455"
     mRNA            <524310..>525314
                     /locus_tag="CAGL0H05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447032.1"
                     /db_xref="GeneID:2888455"
     CDS             524310..525314
                     /locus_tag="CAGL0H05423g"
                     /note="some similarities with uniprot|Q02831 Saccharomyces
                     cerevisiae YPL077c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447032.1"
                     /db_xref="GeneID:2888455"
                     /db_xref="GOA:Q6FRW2"
                     /db_xref="UniProtKB/TrEMBL:Q6FRW2"
                     /translation="MDGIERVNSVRQHYNDDVPSFVIDNVSDIDTESAGTEPYLNAFD
                     NKDHNNTEFETGRSDNFFNFNYNDNDNDIDNYNDNEIGNDNDVELDLVEDSKDNFMMM
                     VPRTLPTSGISEHLWQKRIRANPSDGAQTLEPPSGPVDLLSSADTSQRLKWAGAGPGP
                     NALTMTTSLLNGEKLLRAATYPETEQEQKQARRLHELETPRLVVPPNVDSQERLWQEV
                     GELEQIKSFARQVNMFESMFPHGFESNLNELRKLQNGLVHELRNYNAELEEQERKEIA
                     KQAAASILTFTPPASIHSTDTALLNHSSSDIRLGGFSGANLKAEKYLRQLFEKITDMG
                     "
     gene            <527157..>528824
                     /locus_tag="CAGL0H05445g"
                     /db_xref="GeneID:2888511"
     mRNA            <527157..>528824
                     /locus_tag="CAGL0H05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447033.1"
                     /db_xref="GeneID:2888511"
     CDS             527157..528824
                     /locus_tag="CAGL0H05445g"
                     /note="highly similar to uniprot|P12709 Saccharomyces
                     cerevisiae YBR196c PGI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447033.1"
                     /db_xref="GeneID:2888511"
                     /db_xref="GOA:Q6FRW1"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="InterPro:IPR018189"
                     /db_xref="InterPro:IPR023096"
                     /translation="MASSNTYSNFKLATELPAWSKLQKLYDAQGKSLNVKEEFQKDSA
                     RYNKYAKTLTNYDGSKILFDFSKNLINDEILATLIELAKEAKVTDLRDAMFAGEHINF
                     TEDRAVYHVALRNRANKPMKVDGVDVAPEVDAVLQHMKEFSEQVRSGEWKGYTGKKIT
                     DVVNIGIGGSDLGPVMVTEALKHYAGVLDVHFVSNIDGTHIAEVLKVVDPETTLFLVA
                     SKTFTTAETITNANTAKNWFLSKTGNDQSNIAKHFAALSTNETEVAKFGIDTKNMFGF
                     ENWVGGRYSVWSAIGLSVALYIGFDNFEAFLKGAEAVDKHFVETPLEDNIPLLGGLLS
                     VWYNNFFGAQTHLVAPFDQYLHRFPAYLQQLSMESNGKSVTRGNVFSTYSTGSILFGE
                     PATNAQHSFFQLVHQGTKLIPSDFILAAQSHNPIENNLHQKMLASNFFAQAEALMVGK
                     DEAQVKSEGATGGLVPHKIFSGNRPTTSILAQKITPAALGSLIAYYEHVTFTEGAIWN
                     INSFDQWGVELGKVLAKVIGKELDNTEKITAHDASTNGLINQFKEWL"
     gene            531206..531289
                     /locus_tag="CAGL0H05467r"
                     /db_xref="GeneID:2888681"
     tRNA            531206..531289
                     /locus_tag="CAGL0H05467r"
                     /product="tRNA-Leu"
                     /note="tRNA Leu (TAA) cove score=69.31"
                     /db_xref="GeneID:2888681"
     gene            <532144..>532872
                     /locus_tag="CAGL0H05489g"
                     /db_xref="GeneID:2888579"
     mRNA            <532144..>532872
                     /locus_tag="CAGL0H05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447034.1"
                     /db_xref="GeneID:2888579"
     CDS             532144..532872
                     /locus_tag="CAGL0H05489g"
                     /note="highly similar to uniprot|P05626 Saccharomyces
                     cerevisiae YPL078c ATP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447034.1"
                     /db_xref="GeneID:2888579"
                     /db_xref="GOA:Q6FRW0"
                     /db_xref="InterPro:IPR008688"
                     /db_xref="InterPro:IPR013837"
                     /translation="MSFRALTMRSAVARTALNNTIRSARVATPYLGIRHSSSTPTPDP
                     KTKAASLIDALPGNTALTKTGILGTSAAAIIYGISNQLYVINDESILLLIFLGFSGLV
                     AKFLAPLYKDFADARIKKIGSILNSSRERHVDAVKDRIESVSELQNVSETTKVLFDVS
                     KETVELEAKAFELKQKVELAHEAKSVLDSWVRYEASLRQLQQKQIAEGIISKVESELT
                     NPKFQDRVLQQSIAEVEQVLANIK"
     gene            complement(<533744..>535108)
                     /locus_tag="CAGL0H05511g"
                     /db_xref="GeneID:2888571"
     mRNA            complement(join(<533744..534321,535102..>535108))
                     /locus_tag="CAGL0H05511g"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_447035.1"
                     /db_xref="GeneID:2888571"
     CDS             complement(join(533744..534321,535102..535108))
                     /locus_tag="CAGL0H05511g"
                     /note="highly similar to uniprot|O13516 Saccharomyces
                     cerevisiae YPL081w RPS13B or uniprot|P05755 Saccharomyces
                     cerevisiae YBR189w SUP46"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_447035.1"
                     /db_xref="GeneID:2888571"
                     /db_xref="GOA:Q6FRV9"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV9"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAP
                     TSPFGGARPGRVARKNSGKASEGGEDAADEADEE"
     gene            <538045..>543759
                     /locus_tag="CAGL0H05533g"
                     /db_xref="GeneID:2888821"
     mRNA            <538045..>543759
                     /locus_tag="CAGL0H05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447036.1"
                     /db_xref="GeneID:2888821"
     CDS             538045..543759
                     /locus_tag="CAGL0H05533g"
                     /note="highly similar to uniprot|P32333 Saccharomyces
                     cerevisiae YPL082c MOT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447036.1"
                     /db_xref="GeneID:2888821"
                     /db_xref="GOA:Q6FRV8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022707"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV8"
                     /translation="MTSKVSRLDRQVILLETGSTQTIRNVAADQLGELAKQHPEDILS
                     LLSRVYPFLSSKKWETRVTAARAMGGILSNASVWDPNEGEVKEEEESHMNSEIKKENQ
                     NNDHAEMENTVIKEEPDQDNGVSVPNHTNNDNNIETVNAKVKLEQDIQLKLEELIKED
                     SSLLDDNKNADNCLTLSNWHLNELFKSGKVFLASSINDYDDKKVASNSPSTLSSDIED
                     ASMKKENDAENHCSKSSNIEGGNSSKKSARMLAMAKRKKKMQKSKTTTTMEVNLSESS
                     LSKKLMDDPSAVKSDAVKMENPKLAITDQADPNAIMVEAVVPKILEKHEKVAGLVWQF
                     QGVFELLLQNLMHDNWEVRHGATLGLRELMKKHAYGINRIKGKTRKENNDRNYQGLED
                     LATRLLTIFALDRFGDYIYDTVVAPVRESAAQILAALLINLPDDLALKVYMKLEDLVF
                     QNPEVTGLPNKIWEATHGGLLGIRYFVSIKQEFLIEQNLLDKVVQTVLYGLNQNDDDV
                     KSVAASILTPITAEFVKLDTDTLDIVLTTIWNSLIHLDDDLASSVGSVMDLLANLCQY
                     KEVLDVLKHKATEQPLEWSFKSLVPKLYPFLRHSISSVRKSVLNLLQSFLSIKDESTK
                     HWLNGKVFRLVFQNILFEQNPDILNLSYEVYTSLLTHYQLKHTEKTLDHAFCKHLQPL
                     LHLLNTPIGEKGKNYSMESHYILKPSPRYQLHPEKKRSISEANNASDIPNPRPNENIN
                     IDIPMINGDVTLLGEQKIMNTRVLAAKAFGFTLAMFQEATVQSFFANVLVRCLDLPYA
                     TPRMLTAIIVNRFCKFWVDRHDDVPEVPKFVSEIFGATMNEQLNNPSKLPVFRELIPS
                     LKALRTSCQNLFATFVDVGMLPQHKLPSVAIVVQGESEAGPEAFGLETAEKVYHDYYD
                     KMYKNLGNSYKLLAKKPLEDAKHRVKQSIESAKESKQKRICSILSNYASSVLMFSELP
                     PKLNPIIRSLMDSVKEEPNEALQKMSCESVIYLIHELLKCNKAPVANKIVKNLCGFLC
                     VDTSEVPDFQQNLSYQDRLYTFIKEPDAFVINENVELMKVAEEARLKRKGGIYAMGTL
                     LEICGSSALDDIPQLKKVFLEPLENISDVSSIDVIKGQAVTDYFGIVRVLFPYMDQSL
                     QESVVIAKFPRMLDFLKCPYSVIRYSVARTFADLAKYKPIKVMPFLIKNVLPMINDAG
                     SLFNRQGATELIFHLSVSMEADILPYVIFLIVPLLGRMSDPNEDIRNLATTTFASIIK
                     IVPLEEGIKDPEGMPEELMKGRERERDFIKQMMDPSKAKPFKLPVAIKATLRKYQQDG
                     INWLAFLNKYHLHGILCDDMGLGKTLQTICIIASDQYLRQEEYKLSGNIECRPLPSLI
                     VCPPSLTGHWENEFEQYSPFLKIVVYAGGPSVRQPLRKQLSSADIIITSYDVARNDLD
                     TISSYDYNYCVLDEGHLIKNAQSKLAKAVKLIKANHRLILTGTPIQNNVVELWSLFDF
                     LMPGFLGTEKSFQERFAKPIAASRNSKTSSKEQEAGALALEALHKQVLPFMLRRLKED
                     VLSDLPPKIIQDYYCELSDLQKQLYEDFAKKQKNVVEKDIQNTADVDSKQHIFQALQY
                     MRKLCNHPALVLSNDHPQLKQIQNYLKQTGCDLHDIRNAPKLTALRTLLFECGIGEAD
                     MDKKVTGEQLLTGSVISQHRALIFCQLKDMLDMIENDLFKRYMPSVSYMRLDGSVDPR
                     DRQKVVRKFNEDPSIDCLLLTTKVGGLGLNLTGADTVIFVEHDWNPMNDLQAMDRAHR
                     LGQKKVVNVYRIVTKGTLEEKIMGLQKFKMNIASTVVNQQNSGLASMDTHQLLDLFDT
                     DNVPSNNAGEVAESGDKLPDDVANETGLSGKAKEALGDLKELWDPSQYEDEYNLDNFI
                     KTLK"
     gene            <544199..>545527
                     /locus_tag="CAGL0H05555g"
                     /db_xref="GeneID:2888708"
     mRNA            <544199..>545527
                     /locus_tag="CAGL0H05555g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447037.1"
                     /db_xref="GeneID:2888708"
     CDS             544199..545527
                     /locus_tag="CAGL0H05555g"
                     /inference="similar to AA sequence:UniProtKB:Q02825"
                     /note="similar to uniprot|Q02825 Saccharomyces cerevisiae
                     YPL083c SEN54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447037.1"
                     /db_xref="GeneID:2888708"
                     /db_xref="InterPro:IPR024336"
                     /db_xref="InterPro:IPR024337"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV7"
                     /translation="MEKLDITDGFADREDIIEAEDEEEDMVQDWTEISRMVLSNNPIS
                     LPRRGDKEYEPDGSNIQEVQLSKAKDIMFDTLRNSIRGSVIKSQVKAYYNIDKHKAYV
                     PHPKGSFLQTMGWADSNGVFWLDFHELVYLSERGTVTPYWGSDDSNDDDGNLDIPLSI
                     EDLYLLFKSQEDYDNFLVYSQLKRLGFIVLLEKDNRYHATSFFPPVSEHTSMMTAIGS
                     NIRSSISSVFVLNKALFSGTFLYSKWNYILRRFTTNDQLYNSIGSLIPTQTVPKSDTE
                     LREYNGILNGNPPSNLKIVFKLWKPQVNFKKKSPALPDYQIVVYNKNNKNQQFPSYLS
                     LKNIFSKLDYKFDFLQEIDDDFWDKNTFTNGVPRLEYLTSIGRNLDKKNSKGKKSGQV
                     SSTPFNNKKKKPKGRSKLSAIKQGYRSFLLAVVDNGLVSFIRISETEFRY"
     gene            complement(<545740..>552456)
                     /locus_tag="CAGL0H05577g"
                     /db_xref="GeneID:2888609"
     mRNA            complement(<545740..>552456)
                     /locus_tag="CAGL0H05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447038.1"
                     /db_xref="GeneID:2888609"
     CDS             complement(545740..552456)
                     /locus_tag="CAGL0H05577g"
                     /inference="similar to AA sequence:UniProtKB:P48415"
                     /note="similar to uniprot|P48415 Saccharomyces cerevisiae
                     YPL085w SEC16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447038.1"
                     /db_xref="GeneID:2888609"
                     /db_xref="GOA:Q6FRV6"
                     /db_xref="InterPro:IPR024340"
                     /db_xref="InterPro:IPR024880"
                     /translation="MTPEAKRKKNQKKKLRQKQKKAAEKATDLPATDQSVNISGAEDA
                     LTSNSNVSTPDYTSNFEISVTSTQEVNVDSQLSQNQNSDNFINEQKENDPQSETVFDS
                     HEDIESEMKDNYHNDIKNTTEAITFDTAQNIIGGSIDSSNTVKSEDKINESSSKISDP
                     DCQEDILKLELEGQPLESSCNDDKESVVEGNNENDNNDDLVNDHPTAEDGSDFFDNLA
                     SNNTEVELSSTQNSNLLTENRLESEEFGKPEKLDYPKELSYSEEVDLVEEVDHVEEVD
                     HVEEVDHSEEEDLVEEVDHVEEVDHSEEVDHSEEVDHVEEVDHSEELLTSSVSTQTGM
                     AENTIRHVDESNLGQQKMEERNINSDTHKDATARVSDFHANDEFETGPAAQINSLIEM
                     NDDEQSVNDLQDESSLLQEETTFSQIPKNEVNTENQENIGSESVSKINVANENSMESA
                     IEDLFPSMHNTNEQNPWELPQQGENVVENEVSHEENQRITETTKDDSDNIDRILCDRE
                     DKKEDSFDDLFGNNEVGDDVPWLQESMKSEEGEKHHQSSTAKEESPANVRTSDNTASQ
                     DNDTLPSESVKSNQQQNVESSSDRQQTSADTVKKFSFLEEDDDLLDDDDSFLESEEEI
                     EELESNETVQINELTQEMSTSAESKKLNHNPYRPSSHSSINTQMDPKYNNYQTVPNSS
                     TAPTGIVRPQQITTFLPTNNAQTNTPGTILSPIQTTNEKVKKLTEEKKKSDAYDFPIN
                     LVSSTVKKGHAKPVGVFTNQFSRNGSTPTTPKINPHSRNSSVNPAQIIPKNPYASIQQ
                     PNPVIAPTTNMINNPINMMPTARMRGNSAVSTTSGKSVGTSVATKQNPYSPQITKSPR
                     ASISQPAGIPNNSKYGPISPSTSQFNSLGQVLDSGLVHSSTTPMGSTLSPISTKLNAN
                     NQPSPQSKQYPGNSSYLPSQNDSRSKYAPAFSTGQYAGYSSHSKPAVNQPALPFPRKQ
                     SESAGDANPPINTVLPPGIRKTNVLLESQQNLRQNANYPTYAEHSHEQTNSYNVHGAS
                     NKKIVNNNALLVKQFPIFNWGSNNKVIYGIPLGQNDSVMMPTNSPLQNLRMIGAEILI
                     KPTQLIKSFPGPLCGSKVKKSDVEQWLLTASKDADVDEEAALLLSLLKLKLSTTSTFK
                     DMATLLYDTATLHEYLAQPLTSLNQAPNAFSLDPESQFRVLSFLQVGAHDDALRFSLE
                     KKDYSISLLIGSLLGKDKWCEVVQRYLSEQFTAIANNSNLWAHLLPLIFQVFVGSSKT
                     AVSRFYKNQEEANWAAENWRGIVAAVLINITDHSQPKQTASIQTPPAVVTEFLIEFGI
                     FLKKLGMNLPASILFVIANVPLSNVPILPDSDVHFRSIGSTNNVLGAILSETYEYTIS
                     QDLKFKGYPATLPLKLFHAYCLQEEGLTSLAYKYVDYLSSATKSMTKKDAESLNLSHH
                     LSILTNRLAGSSSSWLGKPKLSSVWGQIDKSFNKYIGGDDDLPKPATEKKVFDSYTPS
                     SSTNSSMIDLSHSVSNFMPAQINQLSRNNLNSENKMSTVPDLTAFGEKNAFEPPTNTW
                     TGMSLQGSPQRAVSNMKPPLSNRPNLRRIKTELPSGEDELLSMTVKQGKKSYAPDNLN
                     RASNSSNETLKSSQSANNSVPYHQSTPNLIGMQSVEQKKSYYPSNQRAMRKSAMPTQP
                     ENLEISRNARSYEPHTKTKKVYKPNQTLEEEPPIQSYNDDVVSQNQFEEAPNLQNDQE
                     KILQPTASPEGLSQTRISNYSPERPPLPVYSEDSKNMDPKNISDLVKEQQITDKSLEH
                     ELEQLPTENDADYKISNANEDNAINEEEREIGNGEVELNVDQSQSHLSASIPQTQNDR
                     ESTTVSISPGLGLEMDVDKEDSNAPAPKLFSEKPNPSPYAPPTVGKKGTKKTSYMPKG
                     KTESFIAEPEISSYESSPLDMYAYSGYRPQEKEKSTSSIVEESSQISNEDAPDKSSIA
                     ARQAVELKQDEVSKKPITTKLSTPKSLPIPPSPFANPLANNNTTGVLPTENFEPVIKV
                     SRNTTARAFTPVPPASDQYDDVVEEDSDDSDDSEDDSPMQSNNSNNGNSERNENKQND
                     NYSDDEMPTKKKSHDNNDAGSGWFGWLKKDTNEKKAVKAKLGNQNSFYYDEQLKRWVN
                     KNASEEDKQQLATPAPPPPIVKRKDTEPKTKPRSISGVTPHLDTGIGSSIPPISGNAP
                     PKPKSGPSLAAKTNGLDDLLNLTAAAPATSTRRKKKGGRGYVNVMENL"
     gene            complement(<553388..>554332)
                     /locus_tag="CAGL0H05599g"
                     /db_xref="GeneID:2888496"
     mRNA            complement(<553388..>554332)
                     /locus_tag="CAGL0H05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447039.1"
                     /db_xref="GeneID:2888496"
     CDS             complement(553388..554332)
                     /locus_tag="CAGL0H05599g"
                     /note="highly similar to uniprot|Q02896 Saccharomyces
                     cerevisiae YPL087w YDC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447039.1"
                     /db_xref="GeneID:2888496"
                     /db_xref="GOA:Q6FRV5"
                     /db_xref="InterPro:IPR008901"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV5"
                     /translation="MQFSWPYPDPETIDGYWGKPTALIDWCEENYVVTPYIAEWCNTI
                     TNAAFLVVAFYCTYSAYTNKLEKRFIFIGLGFSLVGIGSWLFHMTLQYRFQLLDELPM
                     LYATVIPSWSIFVENQENLIKNVDERKAKSLRIQFIYSALLFGFVSILTWLYIVVRVV
                     EIFQILYGVLTVMVVIASGILTYRDVHDPVAKRNLFTTMCLGIVPFVLGFICWQLDIH
                     LCSLWIHIRRTYLELPLGILLELHGWWHLLTGTGVYIYVVYLQYLRVMTQGRGDDYIF
                     IYRWSFFPELVKKGLTVRTPYSLEFWGPRADVKATKKE"
     gene            <556498..>558378
                     /locus_tag="CAGL0H05621g"
                     /db_xref="GeneID:2888539"
     mRNA            <556498..>558378
                     /locus_tag="CAGL0H05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447040.1"
                     /db_xref="GeneID:2888539"
     CDS             556498..558378
                     /locus_tag="CAGL0H05621g"
                     /note="some similarities with uniprot|Q12224 Saccharomyces
                     cerevisiae YPL089c RLM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447040.1"
                     /db_xref="GeneID:2888539"
                     /db_xref="GOA:Q6FRV4"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV4"
                     /translation="MGRRKIEIEPIRDDRNRLVTFIKRKQGLFKKAHELAVLCEVDVA
                     VIILGSNDTFYEFSSVDTNQLLDAYQNKPELHHDCCDPSAFGDFKKNKTTILHHSRST
                     ARPTNTTTKDISMSQIEDTTGDEDEDESNTKDEDTNNYTYHNKEPDNRYNSSISDISK
                     TRDNSQFISNNNRGFPKRPFVQTMDSFDNNSSDNSSSDTNNTKRMRFDNQNSSGRFSV
                     NQNSTTALHDSNQNPTQLEQQSLQQQGLPQPPQLQQQSLEQQQQQQPQEFQPGNSTGL
                     SNNLQQHVQKQFQNLFMMTKGARQMPKPIGLSQSFSSMNGGQPSDEDSLTPVMNPNSS
                     GSSDQNNGSENISNEMMSENKENSTIQEDLSAESNERNDTPSEGGPPKPNLTVDIPSN
                     QFVNSATIHDDTSSVSTNGQRQYQIQLNGINSNDNLLKNLSPISSNPLSAFDRSNQSK
                     LIWKTPSGLTPGLPAVLSFSPTTTQFQGTTPINTMLPTRNSIASENQLESLNNPNFLQ
                     SQSSSLGDASAMKKPSLQPLHTITGNGNDVPAMGPPTGSMPSKYIQDLMVSSPNNPSM
                     PMFPDWSLGPTNRGAQQPQENTYDPSHGNTGLTPFLQTGQTPTTRFFSFNSDMSEERS
                     TK"
     gene            <559430..>560855
                     /locus_tag="CAGL0H05643g"
                     /db_xref="GeneID:2888475"
     mRNA            join(<559430..559435,560151..>560855)
                     /locus_tag="CAGL0H05643g"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_447041.1"
                     /db_xref="GeneID:2888475"
     CDS             join(559430..559435,560151..560855)
                     /locus_tag="CAGL0H05643g"
                     /note="highly similar to uniprot|P02365 Saccharomyces
                     cerevisiae YPL090c RPS10B or uniprot|P02365 Saccharomyces
                     cerevisiae YBR181c RPS101"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_447041.1"
                     /db_xref="GeneID:2888475"
                     /db_xref="GOA:Q6FJH3"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDE
                     FKGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIV
                     GPDLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRR
                     EVTKGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAE
                     RKAEKAETRKRRASSLKA"
     gene            complement(<561332..>562762)
                     /locus_tag="CAGL0H05665g"
                     /db_xref="GeneID:2888553"
     mRNA            complement(<561332..>562762)
                     /locus_tag="CAGL0H05665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447042.1"
                     /db_xref="GeneID:2888553"
     CDS             complement(561332..562762)
                     /locus_tag="CAGL0H05665g"
                     /note="highly similar to uniprot|P41921 Saccharomyces
                     cerevisiae YPL091w GLR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447042.1"
                     /db_xref="GeneID:2888553"
                     /db_xref="GOA:Q6FRV2"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006322"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /translation="MIVKRLFRTMAPVAKHFDYLVIGGGSGGVASSRRAASYGAKTLL
                     IEGKALGGTCVNVGCVPKKVMWYASDLATRLTHAHEYGLAQNVPLSKESITFNWPEFK
                     KKRDAYIHRLNGIYENNLKKEGVEVVFGWAKFNKDGNVEVTKHDNTTEVYSADRILVA
                     TGGKPVYPEKVPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSDSHL
                     VIRGKTVLRKFDEIIQNTVTDYYVEEGINVHKETNVDKVEKDEKTGKLSVHLTNGQVL
                     EDVDELIWTMGRRSLLGIGLENVGVKLNDKEQIITDEYQNTNVPNIYSLGDVSGRVEL
                     TPVAIAAGRKLSNRLFGPEQYRNDKLDYTNVPSVVFSHPEAGSIGLTEDEAIKQYGKD
                     NIKVYTSKFTAMYYAMLEHKSPTRYKIICEGPNEKVVGLHIVGDSSAEILQGFGVAIK
                     MGATKADFDNCVAIHPTSAEELVTMR"
     gene            complement(<563698..>565053)
                     /locus_tag="CAGL0H05687g"
                     /db_xref="GeneID:2888906"
     mRNA            complement(<563698..>565053)
                     /locus_tag="CAGL0H05687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447043.1"
                     /db_xref="GeneID:2888906"
     CDS             complement(563698..565053)
                     /locus_tag="CAGL0H05687g"
                     /inference="similar to AA sequence:UniProtKB:Q2VQ77"
                     /note="similar to uniprot|Q2VQ77 Saccharomyces cerevisiae
                     YPL092w SSU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447043.1"
                     /db_xref="GeneID:2888906"
                     /db_xref="GOA:Q6FRV1"
                     /db_xref="InterPro:IPR004695"
                     /db_xref="UniProtKB/TrEMBL:Q6FRV1"
                     /translation="MRRLMKQLVRDFEPFMFVMVMASGISSNLLYDFAFPSHWMRVCS
                     YIMFGIACAIFIVLQIYVFVHAYYSIKKDSFKVYFKRYYAGVTYGPFWGAYPMGLATI
                     INYISFLANNEAAGTGNAKRLIVLAYALWWYDQLISLLTAWGVSFLIWQKYDFDKNDI
                     SPHVTPNQKSAAETLKSVLLLGVIPLVVASSSLGGFTMSPIFIKYFGRHIQLLNIFVC
                     ALSLFHALIFVFFIITIYIWSLYVNKIPPMGQVFSMFLILGPLGQGSYSFLLIGENVE
                     KYTHLYYRPGHPYYNELLVEIIPWCFKIIFLLLVLALVSLGYFFTFLCFISILSYSKT
                     KDATGPKVKRIYTFHKGWLGMTFPMGTMSLANKEIYVIYNNYVPVKTFRYIGAIYGGV
                     CICWTIICLTLTLLQSIIKPVYFRYSKWKETEENTSTEKSLESSNDIQESCQDDFTRL
                     V"
     gene            complement(<566262..>568199)
                     /locus_tag="CAGL0H05709g"
                     /db_xref="GeneID:2888702"
     mRNA            complement(<566262..>568199)
                     /locus_tag="CAGL0H05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447044.1"
                     /db_xref="GeneID:2888702"
     CDS             complement(566262..568199)
                     /locus_tag="CAGL0H05709g"
                     /note="highly similar to uniprot|Q02892 Saccharomyces
                     cerevisiae YPL093w NOG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447044.1"
                     /db_xref="GeneID:2888702"
                     /db_xref="GOA:Q6FRV0"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR010674"
                     /db_xref="InterPro:IPR012973"
                     /db_xref="InterPro:IPR024926"
                     /db_xref="InterPro:IPR027417"
                     /translation="MQLSWKDIPTVAPANDMLDIVLNRTQRKTPTVIRPGFKITRIRA
                     FYMRKVKFTAEGFEEKFDDILKGFPNINDVHPFHRDLMDTLYEKNHYKISLAAVSRAK
                     TLVEQVSRDYTRLLKFGQSLFQCKQLKRAALGRMATIVKKLKDPLVYLEQVRQHLGRL
                     PSIDPNTRTLLICGYPNVGKSSFLRCITKSDVEVQPYAFTTKSLYVGHFDYKYLRFQA
                     IDTPGILDRPTEEMNNIEMQSIYAIAHLRSCVMYFMDLSEQCGFSVEAQVKLFHSIKP
                     LFANKSVMVVINKTDIIRPEDLDEERAKLLQTVTELPGVEIMSASCQLEDNVMNVRNK
                     ACEKLLASRIENKLKSQARITNVLNKIHVAKPQARDDVERTPYIPEEFKKLKKYDPED
                     PERRLLARDIEAENGGAGVFNINLKDKYILDDDEWKNDIMPEIMDGKNVYDFLDPDIA
                     AKLQALEEEEERLEKEGFYDSDEDESYGGFDQEEIDEIREKADWIRNKQKKMIAEARN
                     KKSLRNKAMMPRSKLVKSFGDMEKHMATLGHDMSSLQDKHRAAAEKSRYVETGADVVF
                     GQNDSMASGSNGGKLRQSDRLLDGVADGSMRSKADRMAKLQRRQRNRDARQGEADRHA
                     TASLPKHLFSGKRGIGKSDFR"
     gene            <568634..>569407
                     /locus_tag="CAGL0H05731g"
                     /db_xref="GeneID:2888597"
     mRNA            <568634..>569407
                     /locus_tag="CAGL0H05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447045.1"
                     /db_xref="GeneID:2888597"
     CDS             568634..569407
                     /locus_tag="CAGL0H05731g"
                     /inference="similar to AA sequence:UniProtKB:P21825"
                     /note="similar to uniprot|P21825 Saccharomyces cerevisiae
                     YPL094c SEC62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447045.1"
                     /db_xref="GeneID:2888597"
                     /db_xref="GOA:Q6FRU9"
                     /db_xref="InterPro:IPR004728"
                     /db_xref="InterPro:IPR011553"
                     /translation="MDQSAVLAIASFVRNRSELKARKGLFQDKPTDFFRYKRFVRCLK
                     SDAYKKKSLKQPDLYPPLPEDEEKFAELARGIFVEFIKNQLVVPGQKLHSYECKEHGL
                     KPSKDYPHLIMSTKATLDDNEYYLWHYNPKTLTDYLIVFGVIGVILAFVCYPLWPASM
                     RRGTYYLSLAAFGFLGVFFGVAIIRLIVFLISMLFIREKGGFWLFPNLFEDCGFFDSF
                     KPLYGFGDKETYTYIKKMKKQKKRQAKKEKLKKLKEKAN"
     gene            complement(<569862..>570908)
                     /locus_tag="CAGL0H05753g"
                     /db_xref="GeneID:2888806"
     mRNA            complement(<569862..>570908)
                     /locus_tag="CAGL0H05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447046.1"
                     /db_xref="GeneID:2888806"
     CDS             complement(569862..570908)
                     /locus_tag="CAGL0H05753g"
                     /inference="similar to AA sequence:UniProtKB:Q02890"
                     /note="similar to uniprot|Q02890 Saccharomyces cerevisiae
                     YPL096w PNG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447046.1"
                     /db_xref="GeneID:2888806"
                     /db_xref="GOA:Q6FRU8"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR018325"
                     /translation="MVDPIYVEVADMFLKRYKDYVINLFKEPVPLNRVQKLLQENKFA
                     GELFDMSNRLCTMYENGTWHSQVLETLDLDKIYANVDMMPLEDDSQYSDNLVKELLRY
                     FKQDFFTWCNKPVCKSCGASGDDINGAAIQAPTNEEAKFNCGSVEVYHCQKCNSEVRF
                     PRYNDPIKLLETRTGRCGEWCNLFTLVLKSFGLESRYIWNREDHVWCEYYSPYLKRWI
                     HVDSCEQSFDEPFIYSKNWNKSMSYCIGFWRYGVVDVSKRYILQNQLPRDIIKEDDLQ
                     FLCHALTKRLRTGLSDDESYKMYCRDDLEQLELNPSATPTKEMQKLKISKTGNKGRIS
                     GSAEWKESRGENGK"
     gene            complement(<571450..>572838)
                     /locus_tag="CAGL0H05775g"
                     /db_xref="GeneID:2888900"
     mRNA            complement(<571450..>572838)
                     /locus_tag="CAGL0H05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447047.1"
                     /db_xref="GeneID:2888900"
     CDS             complement(571450..572838)
                     /locus_tag="CAGL0H05775g"
                     /inference="similar to AA sequence:UniProtKB:P48527"
                     /note="similar to uniprot|P48527 Saccharomyces cerevisiae
                     YPL097w MSY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447047.1"
                     /db_xref="GeneID:2888900"
                     /db_xref="GOA:Q6FRU7"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR024088"
                     /db_xref="InterPro:IPR024107"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU7"
                     /translation="MIRCRMINLRKGRLFVSNFRRSYNVLRELRDRGLVSQVSAPEEK
                     LEEQLESGQKVKLYCGVDPTAKSIHLGNLVPLMVLLHFYVRGHDIVTLVGGATGCVGD
                     PSGRTTERSLMEDKTRLSNVSSISGQLEKFFINGLAYYNTKNKDRNETLPGKHIKENN
                     YNWWKDVKMLDFLANYGRHIRVQSMLARDSVTARLNTQNSLGFNEFTYQILQAYDFFH
                     LNKTYGVSIQVGGNDQWGNITAGIDLISRLSSRTKQAYGVTVPLLQTASGEKFGKSAG
                     NAVFIDPSISTPYDIFQFFLNTLDEDVPRFLKTFSFLTIEEIESMTKRHNEKPHLRLG
                     QKMLAKEITDMLFGVGNGDKAQSISNIIFGTMEDKEMKLSGLELIDMFREARILQQAK
                     RGESLVALVSRLTHSSKSEARRKIEQGSIYLHTSRVKITKDINDYNDYLIDDKVLLLR
                     IGKQKCFVIEMQ"
     gene            <573153..>573494
                     /locus_tag="CAGL0H05797g"
                     /db_xref="GeneID:2888711"
     mRNA            <573153..>573494
                     /locus_tag="CAGL0H05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447048.1"
                     /db_xref="GeneID:2888711"
     CDS             573153..573494
                     /locus_tag="CAGL0H05797g"
                     /note="highly similar to uniprot|Q02889 Saccharomyces
                     cerevisiae YPL098c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447048.1"
                     /db_xref="GeneID:2888711"
                     /db_xref="GOA:Q6FRU6"
                     /db_xref="InterPro:IPR018450"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU6"
                     /translation="MPPMPQGLAQQQPSNWDKFKMGLMMGSTVGVCTGVLFGGFTILT
                     QGAGPDGIMRTLGKYIAGSAATFGLFMSIGSIIRSDSEMPMSLQQTQDLQRRARLEVW
                     KVRNLYGLSRN"
     gene            <573761..>574255
                     /locus_tag="CAGL0H05819g"
                     /db_xref="GeneID:2888642"
     mRNA            <573761..>574255
                     /locus_tag="CAGL0H05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447049.1"
                     /db_xref="GeneID:2888642"
     CDS             573761..574255
                     /locus_tag="CAGL0H05819g"
                     /inference="similar to AA sequence:UniProtKB:Q02888"
                     /note="similar to uniprot|Q02888 Saccharomyces cerevisiae
                     YPL099c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447049.1"
                     /db_xref="GeneID:2888642"
                     /db_xref="GOA:Q6FRU5"
                     /translation="MIKTAKISTLRLAITRNARNLSFTTLVRSPEVDNSKIKTLEDLT
                     RLETLEGVDPELIKRLINEKTQEFNTQDELKLLKSMQMEQDRLNEVPLKRFTRPLWIF
                     ILMASTFYLGAHLVWWKLAYEKKEVELKHKVDSLETTLKDVMKEKATGPTPCNNKKSW
                     YKFW"
     gene            complement(<574382..>575743)
                     /locus_tag="CAGL0H05841g"
                     /db_xref="GeneID:2888594"
     mRNA            complement(<574382..>575743)
                     /locus_tag="CAGL0H05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447050.1"
                     /db_xref="GeneID:2888594"
     CDS             complement(574382..575743)
                     /locus_tag="CAGL0H05841g"
                     /inference="similar to AA sequence:UniProtKB:Q02887"
                     /note="similar to uniprot|Q02887 Saccharomyces cerevisiae
                     YPL100w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447050.1"
                     /db_xref="GeneID:2888594"
                     /db_xref="GOA:Q6FRU4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MKVLRFNQDASCCVVNSGANELTVYNCDPFGKCFEFNISNVNGD
                     SNDNGIGYDSLEAGSSSIESQVIAEMLFSTSLLAVVDKGQGINTGKKLKIVNIKKRSL
                     ICEIAFPSLIVDVVMNRKRICVLLDNDQIFIYDISCMKLMETLDLWESNNEGNLNDHI
                     KVGERASNMINENLKNGNELDRIRSKSNNNNDQTNSDNGRSRTYSINGSHKIKPQLTL
                     SGNDNSILCYSKYSSSKQNPARILNDIVVYDALNLKPINYLNSVHKGCVLKTSVSIDG
                     KLLATASEKGTIIRIHKTGVDSDFASGPLLYKEFRRGSRPSHIHQLLFNKDSTLLVCV
                     GDSDTIHIFRTDDDGLALDGIDGDIGSDSGGSLELIKNRIPHEQVKKFFSRKIKSHIP
                     NQNLHRDFAHINMDRIVHTVVGFPEEFDNKIYVASDDGSFKTYTIPSKHGQCVLNKTS
                     HFI"
     gene            complement(<576149..>577549)
                     /locus_tag="CAGL0H05863g"
                     /db_xref="GeneID:2888622"
     mRNA            complement(<576149..>577549)
                     /locus_tag="CAGL0H05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447051.1"
                     /db_xref="GeneID:2888622"
     CDS             complement(576149..577549)
                     /locus_tag="CAGL0H05863g"
                     /inference="similar to AA sequence:UniProtKB:Q02884"
                     /note="similar to uniprot|Q02884 Saccharomyces cerevisiae
                     YPL101w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447051.1"
                     /db_xref="GeneID:2888622"
                     /db_xref="GOA:Q6FRU3"
                     /db_xref="InterPro:IPR008728"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU3"
                     /translation="MSFRKRGEVLAGGRLPNRAPLVPGRTPGGTPSTPGDAGVNRLSG
                     RMEQLNLRGGVRANISGRPLADGRTAASGPNKEPISAFGVNHPGIRPSPASSQPATST
                     GCFDLDKVLGHMGLPLGTSLLIEERNFTEFNSVLVKLMCSQGIIHNRVEDNKEKNGNT
                     HLIILSASQSLGKELPGVYKGSKKDIKKSKISEEQKKLSVQNLNEEKSTPSRYKDLKI
                     AWKYKFVDEQRGVKNAEAGDSLSSEYPNYNHQFDITSRLLPAPTSNELTFINPTEPVA
                     SIINKLDRTIQQHSNKLIRIVIPSLLHPATYPPRMFLSSEVLLLMHGLRGILKKYSSR
                     CVLMGTISTDIIDSFLLAQLENFFDSVLNLEPFGQDMMQFLERIYKTQPGKIQQGLLH
                     IMKLPVFSERGEMHVMKSELAFKNGRKKFEIEEWGIPVDDVEDDKPEKQNNPNETDMS
                     NTIAAPKKSTKVSLEY"
     gene            <577874..>579214
                     /locus_tag="CAGL0H05885g"
                     /db_xref="GeneID:2888803"
     mRNA            <577874..>579214
                     /locus_tag="CAGL0H05885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447052.1"
                     /db_xref="GeneID:2888803"
     CDS             577874..579214
                     /locus_tag="CAGL0H05885g"
                     /note="highly similar to uniprot|Q02883 Saccharomyces
                     cerevisiae YPL103c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447052.1"
                     /db_xref="GeneID:2888803"
                     /db_xref="GOA:Q6FRU2"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR024884"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU2"
                     /translation="MFCSVGRIPFQRCRLHARSLSISPLTKKEKRRIGYGSLAVLSFL
                     VPYTAYAVFVTVSAYSEIDTRLDLSEVVEKKDGLNYQGTLIKYSPLQVLGRYENPFAE
                     YRIQTIYEFFINRVVELFQRNRGGIPAERAHMNQLMPVHKPTWSEDKIKIEDEQLIKY
                     QLLTEHDDLKTMNVNVDSKDDNIPVYSTWLGQSCNFVSYNGLKVLTDPLFSDYLIHKK
                     LGPKRITDMPANIEDVPKPDIIMVSHNHPDHLDQESIEHWKNSETLWIVPKGLKSYMD
                     KNKIKNYIELSWWETCELEKDNEIYHISCTPAMHWSGRSVLDTNQSLWCSFLLSHNKK
                     PILFHAGDTGYVKDLYVRIKDRFGAGCKLALLPCGQYCPEWHQKPRHINPREVIKIMK
                     DMEANQVLGVHWGTFVLSGEYFLEPKERLEMLAEFDGIRDKCYCPELGKTIKIE"
     gene            complement(<579444..>581423)
                     /locus_tag="CAGL0H05907g"
                     /db_xref="GeneID:2888785"
     mRNA            complement(<579444..>581423)
                     /locus_tag="CAGL0H05907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447053.1"
                     /db_xref="GeneID:2888785"
     CDS             complement(579444..581423)
                     /locus_tag="CAGL0H05907g"
                     /inference="similar to AA sequence:UniProtKB:P15179"
                     /note="similar to uniprot|P15179 Saccharomyces cerevisiae
                     YPL104w MSD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447053.1"
                     /db_xref="GeneID:2888785"
                     /db_xref="GOA:Q6FRU1"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU1"
                     /translation="MFAKGVNSKLLRRWYQLPAKELIRDKFEFETSNLRVRELVTGAD
                     IVLNGWIDSKPKRISKSLIFGQLRDSNGDRVQLVDTNSLLRKCKVEDVVQVRGKVQLK
                     RETGSSNLDNKKFEVVVDHVKTLNAANKKPSELKELRDTSPELVPPEFRYIQLRTARY
                     QNYLRTRYEVSKTLRQILDQDGFTEIETPTLFKATPEGAREFMVPTRVSAKIKQVDKI
                     VPMFYALTQSPQQYKQLLMASGVPKYFQFARCYRDEDLRADRQPEFTQLDMEMSFASQ
                     KDVMSVIEKCITSVWKKFRTKESTGLLTLDRNHSLTPTDASNLYRMTYKEAMTNYGID
                     KPDLRAPSLRILNMKELGAYSNINPAFPIFEIMIIKKAFTDKNDYKKKWSFLSNDDNY
                     NYRKPIVVPISTDLETKNWYEKFMRIASFENTHMLNKAIRLEVGDIVVGSNREIDTRI
                     FENPTPLGRARQLILQNNETKDIVRETNKDVAVWVVDFPLLSPKETEIKNTKHKEMYP
                     IYEDRTVISTHHPFTMVQLQDYDKLTTNPIDCLGQHYDLVMNGIELGGGSTRIHDPEL
                     QKFMFENVLKISNYQILFGHLLSAFETGTPPHAGFAIGYDRMCAMLCGTDSIRDVIPF
                     PKSITGSDLVVQSPSTIAEDILRDYKIEYLSRNSE"
     gene            <582132..>584999
                     /locus_tag="CAGL0H05929g"
                     /db_xref="GeneID:2888667"
     mRNA            <582132..>584999
                     /locus_tag="CAGL0H05929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447054.1"
                     /db_xref="GeneID:2888667"
     CDS             582132..584999
                     /locus_tag="CAGL0H05929g"
                     /note="some similarities with uniprot|Q02875 Saccharomyces
                     cerevisiae YPL105c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447054.1"
                     /db_xref="GeneID:2888667"
                     /db_xref="GOA:Q6FRU0"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:Q6FRU0"
                     /translation="MSYSNMDSLAYNLRSLDVNTVQNSTDGINLTGFNPHDPGHKTGN
                     TAADNGNASIGTPATPSTPGNYPLGMQGPNPNQYQMQFQPLQQLNRTSSLIENMGVQR
                     ASSPFLARSQSNLSVFQNSTPVNSSVGNNILSPSGDVPSMNPNMNMNMNMNMNMNMHM
                     NSATPTNAQALEKDWFQQQYPQRSQLQRPNVLPQQSNLYSPLSQQHTPVAFNNSAQIQ
                     QPNMAIGSQSSIGNHMGMAPPPPPHFVITESQWKYIDPSGQLQGPFRSSEMTTWYHLG
                     YLASTLEIARVPTSPEPLDINDKFIKISDLIEKVHNAQEPFQTFDFIVAQSSNISKPP
                     GLATNANFLNTINPDPALNVGQQLNVSQNIRQQQQQQQVPTQPLVPLPQTIKVKKQAV
                     DAIDRIESPDYNFEELLNLRSTEKDNEYYYRETTIRVPVNRHLIKKLDPNENVNTTQY
                     NVFPPITYDLGILEQLKLQGEYDAAQKKQHAEKQENKPMVEEDMKSNTTTEKVKSKDV
                     SKPADSDTKIVSNTSEDNADQIDKHKLEEKRRIEKANEMARKLLEEQEKENESKKRKE
                     QKQSKKQKKKAEQKLVPTTETETISDNKNEELIEVPNRQNEENNQSEPQITTKPAPWA
                     NKNTAVQVDSIPTIEELQKLKQSKKKASSKDPDVRNKLLQLHEEIMQEERSKEKMTSV
                     LKWADKSSNSQPSSSIDLKEQVKNSKKNRNSPAPIANKLPTLGSGLEELKNPTFIEEQ
                     KQIWEQIQKAPQKGKKTDITSSLLSSNSSTRSATSTGSNPWKTVASQSSQAVNTSAGT
                     PPVKPVVSKANSTSTSSVNSLNRGKQIGSSTVNPIMKARQPVNLYPGNSSISARQEFI
                     KWCKTQLKLKQGVNAKDVLEVLLSLPAGLEAKEIIADTIYSYSATMDGRRFATEFISK
                     RLECESQIKDPLNWSEVLALPEGSSDDWEFQVVTKKKTRKY"
     gene            complement(<585256..>585942)
                     /locus_tag="CAGL0H05951g"
                     /db_xref="GeneID:2888703"
     mRNA            complement(<585256..>585942)
                     /locus_tag="CAGL0H05951g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447055.1"
                     /db_xref="GeneID:2888703"
     CDS             complement(585256..585942)
                     /locus_tag="CAGL0H05951g"
                     /inference="similar to AA sequence:UniProtKB:Q02873"
                     /note="similar to uniprot|Q02873 Saccharomyces cerevisiae
                     YPL107w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447055.1"
                     /db_xref="GeneID:2888703"
                     /db_xref="GOA:Q6FRT9"
                     /db_xref="InterPro:IPR019180"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT9"
                     /translation="MMITMRATMRANMTMRRFSSCRKISMTFEGNTRGIAATPEERMQ
                     RIFGGRLKGEPPKSTSRILTGGSKLIAGVEVPEKPGQPDNCCMSGCVNCVWELYNDDV
                     RYWKQKRNEAALKIRDSTEVWPSNWDPPLDKLEMKNLPPTLHGKKMKLEEDLAKQHQT
                     VANLFPKRTNPLPKSVQQAKQRNLAKKIHTPVEENDGWDDIPVYIKAFAEFERQRKLK
                     KNKIQPQTSH"
     gene            complement(<586329..>586826)
                     /locus_tag="CAGL0H05973g"
                     /db_xref="GeneID:2888901"
     mRNA            complement(<586329..>586826)
                     /locus_tag="CAGL0H05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447056.1"
                     /db_xref="GeneID:2888901"
     CDS             complement(586329..586826)
                     /locus_tag="CAGL0H05973g"
                     /inference="similar to AA sequence:UniProtKB:Q02872"
                     /note="similar to uniprot|Q02872 Saccharomyces cerevisiae
                     YPL108w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447056.1"
                     /db_xref="GeneID:2888901"
                     /db_xref="GOA:Q6FRT8"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT8"
                     /translation="MQVVQLTEEFTRLNGVKDQAITKPVSLDDNTGEVVVRTSTGKSK
                     IRKGQTEEEYRHQLKLYFEDERGPQVTEIGWLDEYIVDQDKIFSEESLFHDLSIKHNR
                     QTVSGICHKLYYQRDYENCVSLAQKLRDLFEPYNTKNKIHRELEELDYMISKCNERLG
                     SKEFQ"
     gene            complement(<587125..>587868)
                     /locus_tag="CAGL0H05995g"
                     /db_xref="GeneID:2888563"
     mRNA            complement(<587125..>587868)
                     /locus_tag="CAGL0H05995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447057.1"
                     /db_xref="GeneID:2888563"
     CDS             complement(587125..587868)
                     /locus_tag="CAGL0H05995g"
                     /inference="similar to AA sequence:UniProtKB:P39721"
                     /note="similar to uniprot|P39721 Saccharomyces cerevisiae
                     YAL049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447057.1"
                     /db_xref="GeneID:2888563"
                     /db_xref="GOA:Q6FRT7"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT7"
                     /translation="MASKMLGQCCFKGFYRKGETKGLHKDIFGVDSYVVGLENPSDKV
                     VVIMTDVYGNRLNNVLLTADQIAESGYQVYVPDILFNNPALDLNVPLDIPAWMASHPV
                     DRAHNLVTKYLSDLRKHVNPKFVGIIGYCYGAKFAIKQIDSASGIVDACAIAHPSLVT
                     IEDVAAIGKPLLISAAEEDAIFPEEMRHMTEAKLKEIGARYEIDLFSGVEHGFASRGD
                     VSNPVVKFAMNKALADQLYWFDHFASGGQ"
     gene            complement(<588556..>590229)
                     /locus_tag="CAGL0H06017g"
                     /db_xref="GeneID:2888640"
     mRNA            complement(<588556..>590229)
                     /locus_tag="CAGL0H06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447058.1"
                     /db_xref="GeneID:2888640"
     CDS             complement(588556..590229)
                     /locus_tag="CAGL0H06017g"
                     /inference="similar to AA sequence:UniProtKB:P38124"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008c FLR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447058.1"
                     /db_xref="GeneID:2888640"
                     /db_xref="GOA:Q6FRT6"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT6"
                     /translation="MNYLHNFKDTLFVDLLEVLNIVTIGEEHVNQLNLSGDASLSASS
                     ESSNMSFNSGSEENSQEKSVEDLEKQNCEINIHKNSDKEADTKKDPFLVTFNGEDDPL
                     MPYNWSTNKKALIIIQTMLLTCVNYMGSSIYTPGQLEIQNEFHVGHVVGTLNLSLYVL
                     GYGLGPIVFSPLTEISSIGRLPVYMITFFLFTMLQIGCALAPNFAGLVILRFITGVLC
                     SPALSTGGATLGDIVSQNYLALVLGLWSIGAVAAPVLAPLLGASMVVAKDWRWIFWLL
                     FFCCCATMLLLTFFFPETSSDTVLHRKAARIRKLTGDNRYYTEKEREEAQLPKKQFLI
                     ETLYRPFSMMITEPIVLAFDLYIALCYGAFYLFFEAFPIVFGGIYHFTLVEQGLAYFG
                     FCVGCIFAYIILLVFSIKVAAKRFANNTFTPETTLILAMCIGWCIPLALFMFGWTAKV
                     HWILPIISEVFFVLGCFNIFQASFSYLAICYPKYVASVFAGNGFARSSFAAAFPLFGQ
                     AMYNNLGTKNYPVAWGSSLVGFFTIGLWVIPFVLYKYGPSLRSMSKYNR"
     gene            complement(<592526..>594295)
                     /locus_tag="CAGL0H06039g"
                     /db_xref="GeneID:2888685"
     mRNA            complement(<592526..>594295)
                     /locus_tag="CAGL0H06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447059.1"
                     /db_xref="GeneID:2888685"
     CDS             complement(592526..594295)
                     /locus_tag="CAGL0H06039g"
                     /inference="similar to AA sequence:UniProtKB:P38124"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008c FLR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447059.1"
                     /db_xref="GeneID:2888685"
                     /db_xref="GOA:Q6FRT5"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT5"
                     /translation="MYIGAFQDTLFVDMLEYFGWVTVGKEYLDIYRPNGVPVAPNAVA
                     ASISGKEEMKQDNQTSTDSMSTSTQQETDASNEDIERAMDTDNGLDKAMSGGQGVFGT
                     EEDDSSTKDASKPEEADPFLVEFLGEDDPRKPWNWSFSKKTFVIVQLMVLTCINYMGS
                     SIYTPGQEQIQHEFHVGHVVGTLNLSMYVLGYAIGPIIFSPLSEVSSIGRMPLYLWTF
                     ILFTILQVACALVRNIAGLVILRFITGILCSPVLATGGASVGDVCFPRYVPRFLGAWA
                     VGAVAAPVMAPILGAAMVVAKDWRWIFWLMLFMCGATLLSIIFFFPETSHECILHRRA
                     KRLRKLTGDDRYYTKKEKQEEALPVSVFIKNTLWRPIKMIALEPIILAFDVYIALCYG
                     AFYLFFEAFPIVFAGIYHFTLVEVGLAFLGFCVGCVFAYTALIIFQEKVIRKKFLEGK
                     FRPELFLILAMCLGWCLPFSLFFFGWTARIHWILPIIAELFFVLSVFNLFQATFSYLA
                     VCYPEYVASVFAGNGLCRGAFAAAFPLFGKAMYDRLSTKKYPVAWGSTLIGFITVVLS
                     LIPFVLYKYGPALRARSRFSPDS"
     gene            complement(595642..595750)
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0H06061r"
                     /db_xref="GeneID:2888436"
     tRNA            complement(join(595642..595686,595712..595750))
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0H06061r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2888436"
     gene            <596149..>597021
                     /locus_tag="CAGL0H06105g"
                     /db_xref="GeneID:2888898"
     mRNA            <596149..>597021
                     /locus_tag="CAGL0H06105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447060.1"
                     /db_xref="GeneID:2888898"
     CDS             596149..597021
                     /locus_tag="CAGL0H06105g"
                     /note="highly similar to uniprot|P21242 Saccharomyces
                     cerevisiae YOR362c PRE10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447060.1"
                     /db_xref="GeneID:2888898"
                     /db_xref="GOA:Q6FRT4"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT4"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFND
                     GVVFAVEKIITSKLLVPNKNLKIQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKM
                     YGSAIPVDAFAERVGQYVQAHTLFNSVRPFGVTAIFGGCDKNGPHLYMLEPSGTYWGY
                     NGAATGKGRQTAKAELEKLLDKTPEMSAKEAAKHAARIIYMAHEDNKEKDFELELSWC
                     SVSETNGVHKLVPKDILNEAIEYAKNEVNGDDDDSDSDSDSDNDNDNEKKDKDSDDED
                     VDTKKDADGDIQLE"
     gene            <597557..>597820
                     /locus_tag="CAGL0H06127g"
                     /db_xref="GeneID:2888851"
     mRNA            <597557..>597820
                     /locus_tag="CAGL0H06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447061.1"
                     /db_xref="GeneID:2888851"
     CDS             597557..597820
                     /locus_tag="CAGL0H06127g"
                     /note="highly similar to uniprot|O74700 Saccharomyces
                     cerevisiae YEL020wa TIM9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447061.1"
                     /db_xref="GeneID:2888851"
                     /db_xref="GOA:Q6FRT3"
                     /db_xref="InterPro:IPR004217"
                     /translation="MDQLNAKEQQEFQKLVEQKQMKDFMRLYSGLVERCFTDCVNDFT
                     SSKLTSKEESCILKCSEKFLKHSERVGQRFQEQNAALGQGLGR"
     gene            complement(<598643..>601264)
                     /locus_tag="CAGL0H06149g"
                     /db_xref="GeneID:2888713"
     mRNA            complement(<598643..>601264)
                     /locus_tag="CAGL0H06149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447062.1"
                     /db_xref="GeneID:2888713"
     CDS             complement(598643..601264)
                     /locus_tag="CAGL0H06149g"
                     /inference="similar to AA sequence:UniProtKB:P31384"
                     /note="similar to uniprot|P31384 Saccharomyces cerevisiae
                     YAL021c CCR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447062.1"
                     /db_xref="GeneID:2888713"
                     /db_xref="GOA:Q6FRT2"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /translation="MNDISMMGYPGMGQQQPQPQQAQQPQQQPISMQPHTMMNMMNTN
                     LPPPGMMMGGAGSNTGNENMINHGLMSGNPVSGIPNNNSHQLLDQLINKNPNNMGIPQ
                     QQQDSLAAQMQLPMGGMPMGNGSAHNGNVGMNNNNTGGNNNIPMGNANVLRNNNIIGN
                     LGGSSLAGGNMNSGMPGISTFGNTPGQLAAPPIQPNANANNPMYHPHLEDPSLMNNPI
                     WKLQLQLATVSAQSVGQPNIYARQNAMKKYLATQVPPQNQTQQQAQAQSQIAETSKSL
                     VDCTKQALMDIMAPDDSKLKGMSAPNTASTTTNSTISTPTTSKIDMNNSREQPSTPSL
                     LLQHKKLSQYSIDEDDEVENRMVAPKDTKYNDQIWHAIDLSNLQIFNISPNLMKYDFL
                     TRLYLNGNGLESIPSSIRNLKNLRVLDLSHNKLKELPKEIGNCYQLKYLYFFDNQITT
                     LPWELGNLCNIQFLGCEGNPLDKELLKILTEKSFTGLIFYLRDNRPEVPYPHDRKFIE
                     INADGEPEKEYDTVQEAERNLSSDMQKKSFTMLSYNTLCQHYATPKMYRYTPSWALSW
                     DYRREKLKEQILNFNTDIICLQEVEAKTFEDFWQPLLEKHGYTGLFHAKTRAKTMQSK
                     DSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKHKKFQRTEDYLNRAMNKDNVAIVMK
                     LQHIQSGEIMWLVTTHLHWDPKFNDVKTFQVGVLLDHMETLLKEQNPKQDVKKYPLVI
                     CGDLNSYLSSSVYELFSTGRVQHHHDGKDRDFGYFSEDNFSHNLALKSSYNCIGELAF
                     TNFTPSFTDVIDYIWFSSQALRVRGLLGEVDSEYVSNFIGFPNDKFPSDHIPLLGRYE
                     FLKSNNTQNSNSGSRKV"
     gene            complement(<602526..>603590)
                     /locus_tag="CAGL0H06171g"
                     /db_xref="GeneID:2888515"
     mRNA            complement(<602526..>603590)
                     /locus_tag="CAGL0H06171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447063.1"
                     /db_xref="GeneID:2888515"
     CDS             complement(602526..603590)
                     /locus_tag="CAGL0H06171g"
                     /inference="similar to AA sequence:UniProtKB:P31386"
                     /note="similar to uniprot|P31386 Saccharomyces cerevisiae
                     YAL020c ATS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447063.1"
                     /db_xref="GeneID:2888515"
                     /db_xref="GOA:Q6FRT1"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT1"
                     /translation="MIPIKSLDLPTDIDVTKISCGGNHTVILLSTGRVLGCGDNSLGQ
                     LCSDDQAKQIIGWKEICSGYNVIDVTCCWDSTTIVTADGKVYSRGSGLKGELGLGSSN
                     LENKSNFELVMDCSKYAGYRVYSSFQNCILVLDKKEDNGSIVYAWGNNTKCQINEPKS
                     RRLASPIVMYETFEIRVANVVMGKDFNLLMTPQGKIIHVNGKTPEDFTKDFETRWKFA
                     KELEVKSMWSSIHIRDKSDPNKIHSYGNNIHGQVFDQSQLSPSECIANFTTGSEHGIL
                     VSKDRDHNDHELYQLSCWGWGEHGNCGSVQDHEEKQWVNDKHNVTSPLNPVAKAISRP
                     MVYGGCATTWIVSNDTLAIL"
     gene            <604422..>607802
                     /locus_tag="CAGL0H06193g"
                     /db_xref="GeneID:2888691"
     mRNA            <604422..>607802
                     /locus_tag="CAGL0H06193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447064.1"
                     /db_xref="GeneID:2888691"
     CDS             604422..607802
                     /locus_tag="CAGL0H06193g"
                     /inference="similar to AA sequence:UniProtKB:P31380"
                     /note="similar to uniprot|P31380 Saccharomyces cerevisiae
                     YAL019w FUN30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447064.1"
                     /db_xref="GeneID:2888691"
                     /db_xref="GOA:Q6FRT0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRT0"
                     /translation="MSGNEGTEGQPGNNLSPVQYKTVSSSPLKPEASTQDAQKLREQF
                     VFKPNNNLSSAITSTGQTASSATSGTAAPVNPNAFESLVAEFPDFSQTLVQAVYKSNS
                     FDLSLARERLTRIRNQRKNWVSSKNLNSNVARGSRAASTGTGRLSGINNTSDSSKIVL
                     EKQKKSIFDRYSSAVNSNAQNSGINSELFEKMQRNGSHKKRKLVRGDKLAGDESYVDS
                     SNSQLAKAKQQLLKSRNKKFNLSDDEEEVGNDNGDFSDASGDEYEEHTPVANIDDQIL
                     EFLNNSEIDDIMDLGEVSYERAKIIQSARPFTSLYSFSQQEFLTEEEKEKQAKLLAQP
                     KKRGRRGAAQRKEGEKVLDRVSQAMRGYNAIESVIKTCSQYGKLVSSQIKKWGVKVDA
                     ENGDDGELDFINVGSETEGDAIVEDFSSSAQTPAPEMSDSEGSEEIKLEDVNKKLEST
                     TDNNNKDDGATLETASEPKLDTMEEKDKTTDTSVEKTEENTANVKVEDTDKANDDPDS
                     DFQADEEMEFIDEDEEDEEYDEELPVTRRTRNTGGNFRKEVVKKNSVVKFFRGRPKLL
                     NPDVSLKDYQQTGINWLNLLYHNQISCILADDMGLGKTCQVISFLAYLKQIGQPSPHL
                     IVVPSSTLENWLREFQKFCPSLKIEPYYGTQQERADLREILERNDGKYDVIVTTYNLA
                     AGNKYDVSFLKTRNFNVVVYDEGHMLKNSMSERFNKLMRIHANFRLLLTGTPLQNNLK
                     ELMSLLEFIMPNLFVSKKESLAAVFKQRAKTSDDNKGHNPLLAQQAITRAKTMMKPFI
                     LRRRKDQVLKHLPAKHVRTSYCAMNDTQREIYNREVKLVMEHKQMIRDGTLPEDKKER
                     SKIENNSSKNLIMSLRKASIHPLLFRHIYDDAKIDKMCDAILDEPAYAENGNKEYIRE
                     DMSFMTDFELHRLCCNFPNTLGDYQLKNDEWMNSGKVDALKKLLDDIINKKREKVLIF
                     TLFTQVLDILEKVLSTLNYKFLRLDGSTQVNDRQTMIDKFYDDNTIPIFMLSTRAGGF
                     GINLVCANHVIIFDQSFNPHDDRQAADRAHRVGQTKEVTVTTLITKDSIEEKIFQLAK
                     TKLALDSQVSSSEDQSDLIDNKVSDLLEDIIYTEAQKK"
     gene            <609128..>612415
                     /locus_tag="CAGL0H06215g"
                     /db_xref="GeneID:2888816"
     mRNA            <609128..>612415
                     /locus_tag="CAGL0H06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447065.1"
                     /db_xref="GeneID:2888816"
     CDS             609128..612415
                     /locus_tag="CAGL0H06215g"
                     /inference="similar to AA sequence:UniProtKB:P19659"
                     /note="similar to uniprot|P19659 Saccharomyces cerevisiae
                     YOL051w GAL11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447065.1"
                     /db_xref="GeneID:2888816"
                     /db_xref="GOA:Q6FRS9"
                     /db_xref="InterPro:IPR003101"
                     /db_xref="InterPro:IPR008626"
                     /translation="MSSKETIPMHQRSQNVAELLTVLMDINKINGGDSTTAEKMKVHA
                     KSFEAALFEKSSSKEEYQKTMKSKIDAMRSTRDKRKRESVGSASMMANLGQDGTNNNN
                     NNNNNNNNNLNMAASFMGGDMFGRNQSPAQNSNANTNLNTNVGPGVNGPNGNDGTANP
                     QMFMNQQAQARQQAAARQLKNRQMGGSSAQQQQLTQQQQQLLNQMRVAPIPKELLQRI
                     PNLPPGVTTWEQVTALAQQNRLSAQDMSIAKDIYKIHQQYLIKAKLQQQQQRQQQQRQ
                     QGNPDVNNNMAGSNNNNNNNLPMAQQQMQQRQQQQQQSQQQQNRNPNQRHNVLSQINQ
                     MFTADEQRALLQEAMEACKNFQKTHFGGQMSDANKQAFIKKFINSKALKKLEAMRMAQ
                     GGNNNANLNKGQADMLQRQQANMQMNQQQQRAAQNQRRGPVMNDAVSQGYNNQMNSAA
                     DSTMNNSNQPMNIGNNGVNMIPNQSQQQQQTNRPKEQTPQQPQQRIQSNRSVPMLNPT
                     PEDVEVVRRISAEAAKTQLRLTDLTNSLTPQERDEIKKRLQKNQQLFAQVSSYAPQVY
                     LFTKSESFLKEVLQLRIFIKEILEKCSKGIYVVKLDTVDKLVIKYQKYWESMKIQLLR
                     RQQLLQQQQQQQQQGMDPNRAQNSQQQQQQNQANMQQARNRKPTKNQTTPAIAASVAM
                     NMNDKGASMSPALQKAGSAVPNFAQQMSPNMTPGTIPPTNVLSPHSQSHIPMVSPTMA
                     KAASAAALKNDTASSSRRGSTKPRGKSTAPVTGKKTSNAPTPQVVPATVPSTTNLSAA
                     GTPNIRNKSATPLTAGLSPKSTIRSNSNTALASAKTPSPMTVSIPQPGNSSVFKKEEE
                     YLSKLQLRKEEIRFRQKQRLDILSSSPVDLFLTTVADCLGINDEEIELINKIPETTAD
                     NINNTGKKKLTKAAQKLRDKEILNVSIQVGEKDKLIMSSKAPDKVMDYSISAMSLAAV
                     FKNLSSTGSLNNIALSGSNATTSKDIGNIYSHTGGVKRKFDEVEISPNSNGSPSASIM
                     SESKKIKIDSPEDMFVTHSSEAAKGTNNSSLMDSGKEGSCKSMAGSATEVNDTSIWDW
                     NFWTSIE"
     gene            complement(<613054..>613962)
                     /locus_tag="CAGL0H06237g"
                     /db_xref="GeneID:2888814"
     mRNA            complement(<613054..>613962)
                     /locus_tag="CAGL0H06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447066.1"
                     /db_xref="GeneID:2888814"
     CDS             complement(613054..613962)
                     /locus_tag="CAGL0H06237g"
                     /inference="similar to AA sequence:UniProtKB:P31379"
                     /note="similar to uniprot|P31379 Saccharomyces cerevisiae
                     YAL018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447066.1"
                     /db_xref="GeneID:2888814"
                     /db_xref="GOA:Q6FRS8"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS8"
                     /translation="MSFAGSLILTGLGGVYYKFSRDQHFKPLEIAQKATIQDATSIYQ
                     RQLVKLATRSAQVSAVIADDLFTGNMFVYPFKGMYELYSNFRDYAASTTALFSLYLVS
                     YAIVTMVYWATITPVYTALFIVLGPFGILIAWIHSILHTNMLTMMFLRVSHLNEGLVK
                     NCVDANGYQSLFRHTPIKYQVSPSTPYFWYFHLTKKLSEYLTGLIILVFLLIISSIPI
                     VGPFTFHFLVSPALSRVYFSKMLRLKGLSNIERYERIYQHPGQYTMFGITAGFLDSFP
                     FLAGISLSTNILGATLLGIDQLTTYR"
     gene            <615045..>619055
                     /locus_tag="CAGL0H06259g"
                     /db_xref="GeneID:2888836"
     mRNA            <615045..>619055
                     /locus_tag="CAGL0H06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447067.1"
                     /db_xref="GeneID:2888836"
     CDS             615045..619055
                     /locus_tag="CAGL0H06259g"
                     /inference="similar to AA sequence:UniProtKB:P31374"
                     /note="similar to uniprot|P31374 Saccharomyces cerevisiae
                     YAL017w FUN31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447067.1"
                     /db_xref="GeneID:2888836"
                     /db_xref="GOA:Q6FRS7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS7"
                     /translation="MPYIGASNISQNSFVSLKEKHAIRDKGSPSGSEISLVPDSPIKD
                     VAPSRLNNVTNASSLSNNSDSAPRSNNGVGTDSSSVPKTRPREQSFNGPLPEHILKDD
                     KNFFGLERPPRLARNVSLDSSASTISEVDAKELFMLPNESTHAYSYNPLSPNSLAVRL
                     SILKRSLEIIIGNPEMLREPELDLPEELKGENVSQRRKSLNNLYNPHFESFSMDRSVM
                     RKANQKAMPHTATLNAFVANSTTNFGNLAISEKKKANNQLSKSSFGNINVGNIAGIHR
                     AASMAFLPSSFGRSDSRTDRSLADFNRKFGRKPNPQINFREPFKKIPEQGTSSMEECS
                     STKTLSGDNTSKDLDHSISAISEEGDTVVNEMDYFVDEQRANLMSLLDLLNETLEKNT
                     SPKASDLHMISLFNLDKLSLNNDECNGKSSSESQKRTVALKKTLLDSLAEPFFEHYGG
                     ADEIRHDDGELVNELEDISAMADDSVSLGEFRPQQDYGRILRTFTSTKNSAPQAIFTC
                     SQNDPWQFRAANDLACLIFGISKNALRALTLLDLIHTDSRNFVVNKLSSTEGQELVFT
                     GEIIGIVQPGGDNTNLIWASFWAKRKNDMLVCVFEKVPCDYADIMLSLDDFSVTSVLD
                     RCGLLEAAKKKEPENKHPTFHLGLNEEDSEEEDDESSDSKVAEPAKKSVKFADEITNI
                     SMISTSLAQTIEDVCNGKLHNLDDDLLPLQLRVSNRINFTRYFTLNHLSHSIPCAVSA
                     TILENEMKLKIHGIPYQAGLFVVDSHNYQMISFNKSIVKNMFGYHFSDMVGKPITDII
                     PSFSELLKFTSLRYPALTVTNHRNRGLVLTEHFFRKLRAEMMGRKDEFYTSIGIDAVH
                     RDGGMIKVDFQVRVMSSNVILVWITHSRDVFFNDYTTTPSQLHMLKENDLAVVSSEGS
                     STCSSSKSSPHISSRPLRELTKLSDVDRDNQPERFKSSSVSSKDSTLFDKDTHKDVSM
                     DEVFDDLEIEKDIEDPELKRKLALTKIYHKDKSQFVKEENFKVNQSFIMSKISIQHSS
                     DSLANNRSATTTPINLQEGNIAPTTFLTMNPNPIGAKKHTKKLSDFIILQNMGEGAYG
                     KVNLCLHKTERYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATISKEPHENILT
                     LLDFFEDDDYYYIETPVHGETGSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLHDQ
                     GIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGPFDVFVGTIDYAAPEVLGGSPYEG
                     KPQDIWAIGILLYTIVFKENPFYNIDEILEGELKFNSSELVSEQCTTLIAKILNRNVQ
                     KRPTIDDIYNDEWLVI"
     gene            <620236..>622056
                     /locus_tag="CAGL0H06281g"
                     /db_xref="GeneID:2888671"
     mRNA            <620236..>622056
                     /locus_tag="CAGL0H06281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447068.1"
                     /db_xref="GeneID:2888671"
     CDS             620236..622056
                     /locus_tag="CAGL0H06281g"
                     /note="highly similar to uniprot|P31383 Saccharomyces
                     cerevisiae YAL016w TPD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447068.1"
                     /db_xref="GeneID:2888671"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS6"
                     /translation="MAQADQDLYPLALLMDDLKNDDISNRVEATKKIDQIAIALGPDR
                     TRNELIPFLTEVAEDDEDEVFTVLAEKLGSFVPYVGGAEHASTILPVLDILAGAEETI
                     VREKAVDSLNIVAEQMPDDELFKYFVPLLQRLASETWFSSKVSACGLFKSVFLRVKDV
                     QSRVDLWNLFMTLVNDETPMVRRAVGKNLPILIDLLTENPEFCTDKDLEFISTTFQTV
                     INDQQDSVKFLAVDCLISIVKFFNKKGYDTHSRDLLNSALSLAGDEAWRVRYVVADKF
                     GELTEGFSSNPSYIEELLDPFLKLCEDSEGDVRKAIAKQVSYFSKFVNDSHVVLNKIV
                     PVLQNLSMDENEDVRASLASGISDIVLLLPKEQVIEYVFPIFLNMLRDEIPDVRLNII
                     GKLKVVNEVIGIDMLTDSLLPAISELAKDSSWHVRLAIIEYIPILAEQLGVDFFNSQL
                     SDLCLSWLWDAVYSIREAAIKNLQKLTNIFGSEWCNNEVVPRLLNLDSHMLENFIYRI
                     TLLQTFKALVSVLSPEFVANQILPHVMELANDQVPNIRFNVANTYPIIVEVLSKGGDQ
                     YKLLVTDTIYPSLKDLCEDPDFDVRYFANKSMKKCKEIIS"
     gene            complement(<622232..>623638)
                     /locus_tag="CAGL0H06303g"
                     /db_xref="GeneID:2888786"
     mRNA            complement(<622232..>623638)
                     /locus_tag="CAGL0H06303g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447069.1"
                     /db_xref="GeneID:2888786"
     CDS             complement(622232..623638)
                     /locus_tag="CAGL0H06303g"
                     /inference="similar to AA sequence:UniProtKB:P31378"
                     /note="similar to uniprot|P31378 Saccharomyces cerevisiae
                     YAL015c NTG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447069.1"
                     /db_xref="GeneID:2888786"
                     /db_xref="GOA:Q6FRS5"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS5"
                     /translation="MLRSTSRFRPRSTLGVIQWHTMAVLRKRKSSAKEIAVKNENSEV
                     TKSKYFKERVKVKKEREVDISHDRDYVDINWVKSLDSENYFKWIVSRNGNVPNRWSQP
                     FDDTIFTDLDEESFKLLPKNFPEIYKKMRWMRSFIRAPVDLIGGSSIPMTVGEICGIK
                     KSEILPRNYRLQVLVGVMLSAQTKDEVTAMGMYNIMKYCIEELKDAQGITLDALLRID
                     EQVLDELIHSVGFHKRKANFIKRTAAILNEKYDQDVPDNVTDILGLPGVGPKMGYLTL
                     QKAWGKIEGICVDVHVDRLCKMWKWVDPDKCKTPNDTRKQLQKWLPPRLWTEINGLLV
                     GFGQVIGKSRGANFNIFRVNIDESKQRQLTEKTFTTLSNLNESIRSNITSYSKWMGFL
                     MKLDLKKLENDMKEELDVSIVEGEQNSIELKKEPHSSIDNKLDVGVKLEESCAINVDT
                     SLKSEILIKKEPDTSLFV"
     gene            complement(<624076..>624903)
                     /locus_tag="CAGL0H06325g"
                     /db_xref="GeneID:2888790"
     mRNA            complement(<624076..>624903)
                     /locus_tag="CAGL0H06325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447070.1"
                     /db_xref="GeneID:2888790"
     CDS             complement(624076..624903)
                     /locus_tag="CAGL0H06325g"
                     /note="some similarities with uniprot|P31377 Saccharomyces
                     cerevisiae YAL014c FUN34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447070.1"
                     /db_xref="GeneID:2888790"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS4"
                     /translation="MDLKVSYELDKLKDIVEERTRLIDELSMEPSKSDTISLKSQLST
                     VLDLLNSVGGHGTDEIKAYIDEYNKVLAQLGDDTAVDVGLYTFSPKQDIASKPGESRA
                     NAGDIDEEEIEDDETRKRVRFNDDLETFPNEDTEQDAPASAPMTFQPYHDYEEDTTNS
                     SSSTSDKRVNAGHMISNDELFARQQQQLLEQDTHLDSLATTIKNTHGISIDINQELTD
                     QNEHILDDMENLLDTSSRNLERARRRLDSFQRTARENGPCSIIVMLTIILIFLLIIL"
     gene            <625360..>627138
                     /locus_tag="CAGL0H06347g"
                     /db_xref="GeneID:2888700"
     mRNA            <625360..>627138
                     /locus_tag="CAGL0H06347g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447071.1"
                     /db_xref="GeneID:2888700"
     CDS             625360..627138
                     /locus_tag="CAGL0H06347g"
                     /inference="similar to AA sequence:UniProtKB:P31385"
                     /note="similar to uniprot|P31385 Saccharomyces cerevisiae
                     YAL013w DEP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447071.1"
                     /db_xref="GeneID:2888700"
                     /db_xref="GOA:Q6FRS3"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS3"
                     /translation="MENRELEKEPMEDRIPGNEAIEEDQESVLSNIDFNGQDGEVITM
                     RSELNLSEYCVSSDADTEKMDDDDDDGKHPPLKELVVDAETLSRKRSLDDDATEDVFE
                     DKKPKLEQVEASEVNNENQGNDNHTETNDSVPVEPISSPLNTMEGVKPPVIPSENTTE
                     LRTADQASNEISVPDKETEESTPMGTEERLNEEKDTLEHQSNEKPKSAEPVPQPEEVS
                     NDLADTDTVIGTESKQSEDQLHDVVPEEPTDPNSAPDNVEAPVEAPVKADITKENTDA
                     DENGPEESEVKEGEKEEEGNDEEAANNIDEDEGAVGDADDDEDEDDDIDEDEEDEEDS
                     QTVDNVETSDSSKKKKRKKSSILPMVLEERRQQALKDITEIEHSFAELRQKLYENKLR
                     RLETELQMCVEGSHPELHEYYEKISKLRDFKLHRTYQRQKYELKCIDIETRATRTMIH
                     QNFLRCVNELRSQLLQDTTTKWYDINKERRDMDIIIPDINYHVPVKTANKTLSCITGY
                     AGPAQPRRYLGEPLSEDLECENISYRYNGNPVDKLEVIVDRMRLNNELSDLEGLKKYY
                     HAFPGAPSLSTLRDSEIQDDFNYLRQ"
     gene            <627708..>628883
                     /locus_tag="CAGL0H06369g"
                     /db_xref="GeneID:2888813"
     mRNA            <627708..>628883
                     /locus_tag="CAGL0H06369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447072.1"
                     /db_xref="GeneID:2888813"
     CDS             627708..628883
                     /locus_tag="CAGL0H06369g"
                     /note="highly similar to uniprot|P31373 Saccharomyces
                     cerevisiae YAL012w CYS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447072.1"
                     /db_xref="GeneID:2888813"
                     /db_xref="GOA:Q6FRS2"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS2"
                     /translation="MGLLESDKFATKAIHAGAHEDIHGSVIEPISLSTTFKQSEPAKP
                     IGTYEYSRSQNPNRENLEAAIASLEGGKYGLAFSSGSATTAVILQSLPQGSHAVSIGD
                     VYGGTHRYFTKVANAHGVDTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQL
                     VAENVKKINKDILLVVDNTFLSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATN
                     SKDIYERLQFLQNAIGCIPSPFDAWLTHRGLKTLHLRVRQASLNATKIATFLESNENV
                     VAVNYPGLQSHPNYDVVKKQHREALGGGMISFRIKGGAEAAAKFSSSTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQKATA"
     gene            <629481..>631460
                     /locus_tag="CAGL0H06391g"
                     /db_xref="GeneID:2888819"
     mRNA            <629481..>631460
                     /locus_tag="CAGL0H06391g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447073.1"
                     /db_xref="GeneID:2888819"
     CDS             629481..631460
                     /locus_tag="CAGL0H06391g"
                     /inference="similar to AA sequence:UniProtKB:P31376"
                     /note="similar to uniprot|P31376 Saccharomyces cerevisiae
                     YAL011w FUN36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447073.1"
                     /db_xref="GeneID:2888819"
                     /db_xref="GOA:Q6FRS1"
                     /translation="MAVALRARNAVKVEDGIDTSNIIEEVDDNTKGTRSRASRRRRRR
                     GDEEEKHSEEETYNEFNDDGTLKTEGTLQTGNGSGRPFELVAGLPCSLDVPQYNSALT
                     FPLSVRDSGVLYSSLLSSRRTWISGEMFEVYWTRANKVPSLAIKDESIIKELESSKEQ
                     DASGKDRMQRMCDCELMAGPHTFSIKLFIVKDDEKEKKWQEEQEYKKKEKEEQKKLES
                     EQRKKRAEEKKQMLQLKKQEREKQMQLQKEARARAKKEQAEARQRQKEEERQRKLMNK
                     ERVKEQKASTSKPKKDQNKKNSDQHMIANLNIMAQRDPELKKLMAKVANGQANMQEIE
                     EFKRVIELAKNLPPPGTPPAKPEVQKAQSKPTDSNETSADSSKSEILQESKTNESDKK
                     ATAEQATEPKTHSEENKPESENQSRDNSEKSASSHNQEASIKKEADANSVIKKESSDG
                     DGNKSQQPKRKYNKAPKVADELTEKEKEMQLTAFQQKYVTGAELVLEFAENTNFRFLL
                     PKKAIIQYIPESNRYKMSWLQIHNQSDITRFYKRQVKELTRRIHNAEEKQRVTDEYNV
                     FRDKKCPSPLFSSMTVTFSGIHVKFNSIMMNSFDPKEEVRGYMEDVLAVGTRLSGYNL
                     WYQLDGYDDRELAERLRSELNEYEQSLKPKRQKKQ"
     gene            complement(<631794..>632432)
                     /locus_tag="CAGL0H06413g"
                     /db_xref="GeneID:2888857"
     mRNA            complement(<631794..>632432)
                     /locus_tag="CAGL0H06413g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447074.1"
                     /db_xref="GeneID:2888857"
     CDS             complement(631794..632432)
                     /locus_tag="CAGL0H06413g"
                     /inference="similar to AA sequence:UniProtKB:O13547"
                     /note="similar to uniprot|O13547 Saccharomyces cerevisiae
                     YLR390wa CCW14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447074.1"
                     /db_xref="GeneID:2888857"
                     /db_xref="GOA:Q6FRS0"
                     /db_xref="InterPro:IPR008427"
                     /db_xref="UniProtKB/TrEMBL:Q6FRS0"
                     /translation="MRAAVVSAVVLGLFSQVLATPPACLLACVAQVSKQSSQCHTLNQ
                     VGCFCENENTAIKNCLDSICPNGNSDAAYTAFKNSCGDVGKAVASVSSSMSSSMSSSA
                     SSSMSSSMSSSSSSSSSASSSISSVSSSTSSVVTTGSSSAPKVSESTTSTPSSTASST
                     FTITSSKPSSVSSTKTSQKPSSSHAISTFSAGANAINAGSGLAVIAAAALLI"
     gene            complement(<633080..>633391)
                     /locus_tag="CAGL0H06435g"
                     /db_xref="GeneID:2888675"
     mRNA            complement(<633080..>633391)
                     /locus_tag="CAGL0H06435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447075.1"
                     /db_xref="GeneID:2888675"
     CDS             complement(633080..633391)
                     /locus_tag="CAGL0H06435g"
                     /note="weakly similar to uniprot|Q06011 Saccharomyces
                     cerevisiae YLR390w ECM19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447075.1"
                     /db_xref="GeneID:2888675"
                     /db_xref="GOA:Q6FRR9"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR9"
                     /translation="MSRIRGFDLVTIGVVSLVGIYTGARFFEPIVLGQLEKDGHLRKD
                     VAVPKYDEDGNLVVPQGTFAGATAPANISTGTGTTTSTSTPNPGNLGNLGNSGTPGDS
                     T"
     gene            <633721..>636747
                     /locus_tag="CAGL0H06457g"
                     /db_xref="GeneID:2888706"
     mRNA            <633721..>636747
                     /locus_tag="CAGL0H06457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447076.1"
                     /db_xref="GeneID:2888706"
     CDS             633721..636747
                     /locus_tag="CAGL0H06457g"
                     /note="highly similar to uniprot|Q06010 Saccharomyces
                     cerevisiae YLR389c STE23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447076.1"
                     /db_xref="GeneID:2888706"
                     /db_xref="GOA:Q6FRR8"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR8"
                     /translation="MLVAQSTLYRSVLPSGVRIALQFKKLTSYYYKKNYTTVANKSTM
                     PYKDLKVQFLKPDLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENL
                     PGLAHFCEHLLFMGSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFEVNADHLHGA
                     LDRFSGFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFS
                     TGNLETLGDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKD
                     VKNSDRALPVYDAPILKENDLKKIIKVKPVKDLRKLDISFVVPDYEKKWEAKISHIFS
                     HLIGHEGSGSLLAHLKSLGWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDIVVL
                     IFQYLEMLKTSLPQEWIFKELQDISNATFKFKQKGSASQTVSGLAKQLEKDYYFPVEN
                     ILATNLLVKYEPELIKHFMKSFTPENSRITFISRSIVADSKEQWYGTEYSVEDYSPEF
                     LKSIENPGLNPNLSVPRPNEFIATNFDVEKFDVKEPLNEPLLLKDDDVSKLWYKKDDR
                     FWQPRGYIYVTLKLPNTHSSIISSMLTTLYVQMVNDALKDLQYDAACANINLSFVKTN
                     QGLDITISGFNEKLLILLKRFVEGVQGFEPKKERFEVFKDKTVHHLKNQMMEVPYSQI
                     SGLYNSVVNERTWPTKEKLEVAEKLKFEQLDNFVRAIYDGMYYESFVHGNLESKEARE
                     VDSLVSTFLKKDDIKNIDVQSNRLRSYIIPKGKSYAYETDLYDENNVNSCIQHVVQLD
                     VYNEKLSALSGLFAQMLHEPCFDILRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTT
                     PYLEWRIDEFYKTFGEKLRNMDEEDFNKHKEALCKTLLQKFKNMKEESLRYVAAIYLG
                     DYNYLHRQKKADMVKDLTKEDMIAFFENYIESDDATKLVIHLKSKKATEKDESQLDTT
                     KYPSGEKIEDVGQFRSQLYLAPLRQPTKKFEIHEEL"
     gene            <637775..>639010
                     /locus_tag="CAGL0H06479g"
                     /db_xref="GeneID:2888835"
     mRNA            <637775..>639010
                     /locus_tag="CAGL0H06479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447077.1"
                     /db_xref="GeneID:2888835"
     CDS             637775..639010
                     /locus_tag="CAGL0H06479g"
                     /inference="similar to AA sequence:UniProtKB:Q06709"
                     /note="similar to uniprot|Q06709 Saccharomyces cerevisiae
                     YLR387c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447077.1"
                     /db_xref="GeneID:2888835"
                     /db_xref="GOA:Q6FRR7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR7"
                     /translation="MSSTFTCNSCDIQFQTSDSQRYHMKTEWHRYNLKRRVANLPHIS
                     ASMFAEKVQMSEREKREHMVDEFGFEILKAPDHGRKHKKRGSAAKPTSKEDKSEVPSN
                     NIKSSANALHRTISPTESVASEMSALTTGSEYNTTDFGEDTASEYGFTSDSNYDYGST
                     TDESSDEEDHKLSVKHNHDDFKTTTCIYCGVENKEVERNIRHMFKSHGLYIPERSYLI
                     DLDGLLKFLINHILVENKCMCCNYQGSSVESIRAHMDSKRHCKLPYETREERAVVGEF
                     YDFSSLYSDEENEESENADDVEEAAGDSNGINSNYTVATIDDSGAELTLPTGVRLGHR
                     EGQRYYRQNLPLPPNHGESRRTVTAADRRMISGVTEKQYKKGMKKMQLLEQKAASEQI
                     RKEVKRVNFQPHFRDPLLQ"
     gene            complement(<639130..>641736)
                     /locus_tag="CAGL0H06501g"
                     /db_xref="GeneID:2888853"
     mRNA            complement(<639130..>641736)
                     /locus_tag="CAGL0H06501g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447078.1"
                     /db_xref="GeneID:2888853"
     CDS             complement(639130..641736)
                     /locus_tag="CAGL0H06501g"
                     /inference="similar to AA sequence:UniProtKB:Q06708"
                     /note="similar to uniprot|Q06708 Saccharomyces cerevisiae
                     YLR386w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447078.1"
                     /db_xref="GeneID:2888853"
                     /db_xref="GOA:Q6FRR6"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR021841"
                     /db_xref="InterPro:IPR026825"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR6"
                     /translation="MDKSIEKGLNDKLYDKRKASALELEKLVKQCVLENDYARVEQII
                     DHLCKDYAYALHQPMARNAGLMGLAATAIALGPNQVGTYLPQILPPVLACFGDQNDQV
                     RFYACESLYNIAKIAKGEILLYFNEVFDVLSKISADTENSVKGAAELLDRLIKDIVAE
                     KASNYVSLVNNDPNNVPPATRTDSVTGNVYQESYEQDDALAFSLPKFIPLLMERINAI
                     NPDTRIFLVDWIRVLLDSPDLELISYLPSFLGGLFNFLGDSHKDVRVVTNSLLELLLQ
                     EVVRVATIHRKIREYKLAKEKQPSLNKKNDGSLIAEKKKSLLNALGSLSIESVSNNSS
                     ITENPESIRTSENEQKFIEDNDGEEYIPGQDIHIDFPELINILLSNLASSEIDIQLIA
                     LQWMDKLLVLADSDFIPFLPRILSVLIKLLGRSEENIIELAKEVNSKLVTLCTENTTG
                     LDEEGEDAINYGSIVNSLSLQFFDSSTTSRIASFDWLMLIYQKAPEKIMEHSEGLFLI
                     ILKSLTNKDATLLDKALSLLNNLCLDTNDQYLRKFLKAFIEGLKRDPKQLKVRANYVL
                     KQISIKLATERVYKLISSILEEDFDVVFVRMMIQIMSTNLMTAPELFNLRKKLRNNDD
                     IMFFNIIFKSWCCNPVSAISLCLVAENYELAYLVLQSYANHELKINDLIQFDILIQLI
                     ESPVFSRLRLQLLEQDRYPYLYKCLYGILMILPQSEAFNLLNKRLKSVNVWFAQGSQN
                     KNSFYKQSNRSGLSDVSNTSDISQQRSVSNSKLHFIDLLDHFNKSMETDYYSQREGLG
                     LKEAQLNFLDGFHNVENENSSFRSEVSTKESISNRDNASEKRDDASSVIIRNNNRSGI
                     TRKISGKLKKFT"
     gene            <642001..>642915
                     /locus_tag="CAGL0H06523g"
                     /db_xref="GeneID:2888687"
     mRNA            <642001..>642915
                     /locus_tag="CAGL0H06523g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447079.1"
                     /db_xref="GeneID:2888687"
     CDS             642001..642915
                     /locus_tag="CAGL0H06523g"
                     /inference="similar to AA sequence:UniProtKB:P40459"
                     /note="similar to uniprot|P40459 Saccharomyces cerevisiae
                     YIL145c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447079.1"
                     /db_xref="GeneID:2888687"
                     /db_xref="GOA:Q6FRR5"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR5"
                     /translation="MRVFHTIKEVVNWRRNDVGDRRALSIGFVPTMGALHEGHATLIR
                     ESKSQNDYTVVSIFVNPSQFAPDEDLDKYPRTLEKDIELLESLGCDALFAPNAREMYP
                     QGIPLDVQQQRGPFVSVLGVSEMLEGKTRPNFFRGVATVVTKLLNIVSPDVAYFGQKD
                     IQQFIVLNTMVTELFMNTRLVRMPIARAPSGLALSSRNKYLCEETLEISSSIYKGLNK
                     AADIVKTEKSVERSELVNAIQSIWQPHIDSADFKVDYISIADYTTLHELNKVDLPKKQ
                     DQVVISCAVYVTDRASKSVVRLIDNIVL"
     gene            <643447..>644925
                     /locus_tag="CAGL0H06545g"
                     /db_xref="GeneID:2888646"
     mRNA            <643447..>644925
                     /locus_tag="CAGL0H06545g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447080.1"
                     /db_xref="GeneID:2888646"
     CDS             643447..644925
                     /locus_tag="CAGL0H06545g"
                     /inference="similar to AA sequence:UniProtKB:P40458"
                     /note="similar to uniprot|P40458 Saccharomyces cerevisiae
                     YIL146c ECM37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447080.1"
                     /db_xref="GeneID:2888646"
                     /db_xref="GOA:Q6FRR4"
                     /translation="MLRFQRGTVKESSSAKLASTSRNGPESSILDPHHSVMELLQRQM
                     EGSEVPSESGVLGESWQQIRESDVGDGGDSNFDQQSNTSAILSSSSEASEDEDLDIQQ
                     QLLGGQQEYKNFHMTAEEQLQEQAQGQGFGRPSLLKGTQSRLSEQDSNRSGSVRTIVD
                     KGSCSSSLDEHELNSIFTSDSMSLTKSTGSSSTSFVMPKLSLTYKPSQAKKLLVVGRL
                     SKRFHQDIPREYRQYFHISQSSDPSEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKP
                     IIPICQPGQRIRVKNILKSFLKNDAITLWYPPVTIANEKSMEKLFKHTVKLVNKLENE
                     EDVLSLSTSDKSLSDETSGYRKNNRRKKHGGKPSTNYSKWITWGISLTIGVSIGYYAT
                     YMITTTLLYGKAESHHANEAKGFSITNGNSGSSSISHSTEYYESTISQKGLLRNTIVF
                     IKRTIHNLNGKVGTFFASITQVIKQTPVREDNQFYTLGYMLS"
     gene            <645707..>649216
                     /locus_tag="CAGL0H06567g"
                     /db_xref="GeneID:2888762"
     mRNA            <645707..>649216
                     /locus_tag="CAGL0H06567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447081.1"
                     /db_xref="GeneID:2888762"
     CDS             645707..649216
                     /locus_tag="CAGL0H06567g"
                     /inference="similar to AA sequence:UniProtKB:P39928"
                     /note="similar to uniprot|P39928 Saccharomyces cerevisiae
                     YIL147c SLN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447081.1"
                     /db_xref="GeneID:2888762"
                     /db_xref="GOA:Q6FRR3"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR3"
                     /translation="MDSTESAPRRRRFLKPPFRIGIRAQLTALVSIVACLSLIILAVT
                     TGVYFTSNYKNLRSDRLYIAAQLKSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAG
                     NKTEENWEESTNVIQKFLSSSNLFFLSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLF
                     PLSTDVPLPSSLMTNGMLTDPVLNGTDYLMSMSLPIFANPSIIFSDLKVYGYITVVMS
                     AEGLRSVFNDTTALEKSNVAIVSARYSNYTKIDSYRFVFPPYGVSPSILNRTFELDDS
                     SFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCSFNFVNWVAVVSQAESVFLSPSTKL
                     TKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKATELIAEGRGLRPAGAGSGSRSG
                     SRTSSMKKDINDLNFISRLSLSEKNHRPAYDSASDSNYATDGSLSHDLQTSQASNRPS
                     DNDRSSSRSRFLTTSTNLNEARLPDYRRLFSDELSDLTNTFNAMTDALDQHYALLEDR
                     VRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRN
                     SLKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQH
                     VRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEE
                     ATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYD
                     EDDDEHSITNISDHSDDLSSLVSSSTSSYDNALFNTQFKKTPDLYEDSNDGLGTELAD
                     QKTWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMH
                     GTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRS
                     LHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISEVKDEDIEQSPEPDNLPKVGDENDS
                     KASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSSRNVPTMADVTMRFKILVAEDNHV
                     NQEVIKRMLNLEGINNIDLACDGQDAFDKVQSLVEQNDSYDMIFMDIQMPKVDGLLST
                     KMIRRDLNYKGSIVALTAFADDSNIKECIEAGMNGFLSKPIKRPKLKMILEEYCPNWI
                     EMKKSKENKDGDKKVEENKPKKE"
     gene            <649740..>651491
                     /locus_tag="CAGL0H06589g"
                     /db_xref="GeneID:2888773"
     mRNA            <649740..>651491
                     /locus_tag="CAGL0H06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447082.1"
                     /db_xref="GeneID:2888773"
     CDS             649740..651491
                     /locus_tag="CAGL0H06589g"
                     /inference="similar to AA sequence:UniProtKB:P32354"
                     /note="similar to uniprot|P32354 Saccharomyces cerevisiae
                     YIL150c DNA43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447082.1"
                     /db_xref="GeneID:2888773"
                     /db_xref="GOA:Q6FRR2"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR2"
                     /translation="MVHIIDNDPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQ
                     DLISRLKENKRKLLSKQLDPNMKNINSRGRVEVPRSPKRESLPAQENLQHNVPQVTHN
                     QAANNKKANPNEEDIVRKELDVVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTF
                     NGSTSLSDNKTIQCDELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPS
                     FSEPQYSNWVAIGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYY
                     NLRVGDIIAVLNPEILPWRPSGCVNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNH
                     GQSKICNSPINTKTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIYKDN
                     NKSRNTNPAKHKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLA
                     NLESKRRKIKASKMDRNLLKALNGEDASQSKNKQQVKEITEKTLQTGVIQRLGFDPSG
                     GQIAKVLDKSRGTKTDDPTISKKMGLINDLIHFKKDKIKLKPSREIQLEKRHRREAIW
                     KKHFQDTNDSDSDLEIV"
     gene            <653472..>657320
                     /locus_tag="CAGL0H06611g"
                     /db_xref="GeneID:2888660"
     mRNA            <653472..>657320
                     /locus_tag="CAGL0H06611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447083.1"
                     /db_xref="GeneID:2888660"
     CDS             653472..657320
                     /locus_tag="CAGL0H06611g"
                     /inference="similar to AA sequence:UniProtKB:P36168"
                     /note="similar to uniprot|P36168 Saccharomyces cerevisiae
                     YKR096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447083.1"
                     /db_xref="GeneID:2888660"
                     /db_xref="GOA:Q6FRR1"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:Q6FRR1"
                     /translation="MGSSPIEHSIKGKHVYDRKSKLTDNNFNSNNFINNNNSIPGFTQ
                     GLHQKRHNSSANNHTRDTIVKRRLPVQSDENPIGNFLDSFSKNSSPLQQCRTPGSRPH
                     SVTKKTSNIDNTDMVGRSNAIGGYSDNANMSNKSPAEFNAGPVNKNHTGNSLLDNIAN
                     SANRVDIPGSPFYLPTRTHSNILETTQADAPLHPVNSSEVEQESIGPELNLIEEQYNS
                     NLENGEINYNTEVSDFESLPTKDANSVTSTEYEKGTRTAMTSHQSILPTTWNRSTQAL
                     ISKLQDIYKSILVQEVELQNCCSAITSSQTTDLKKIWEVYKINVELVNNYVIFITTAL
                     LPSQSQTDLLIGQEIIDVYKIERRLWVYGTITFLDVLKHFSNFMDPEICCQFIIHVFI
                     SIANMSDYIPKKFSIPWFSRLGDLSRMATALYPPGATDWKLSAEYWYGEAMKYTYGVG
                     KLYYHMATVQQNSLAAFINLGKSVFCRDAFVPTQQYLQLVIDNIYQRAYISRGEESSS
                     NVQILDYLKHNEIMVLPNFMENFELQRMAYVYFSEKFGQDFVGNNFFDTRSMFVQNLE
                     SVKFYFRHSPLFAQAHILQVVGYGNIGNAFALLYELPKFIKDNEISRQRKKSKTGVDN
                     MSIDTLSFQVSGNEIHDVGEYFNSLENIDKEFTLPPNVDIWIQSLQYTNTTGIFCGMM
                     VLQKFLQGPFVTALPHLLPWVYFLISVAFKIETLRDTNSQYFWKLFIRRIFPWNTIIN
                     FLNVLIAFLKDNSDSCSLVNQLCETYSQLSLDEILTNFSENEELPEVWNCWGSLWFDT
                     IKNKSETSYSGLKTAGIKDVNFLDAPYDGIVFDEEDDNGNKFWKRACRILFLFKGYAE
                     KFDQGLRLTNINSLNSEEENIFTKKQEKRNIDFLFKFDPTYDLLPIDEASNKYFQVYS
                     LFTEKLPAFESISENNIILDAVPQLSVIDGESIFDYVGYKKLLPCYYYYDKNGNVNKG
                     AIYSNWEAFNQLGNGLKPRMENGSSFIIDGLDDSKNFEIREKRLFAKYLECDESQESS
                     DHLAEVEREGDETEDETEETNSRKVDKYYTNQRDLDTIFKTIKINGEMRVAYYSTYFI
                     FDATTWLRHFAHIYKIAYSGLLNFVICLTTFQELRFLRRSRDENVMEAATRAVIVIRL
                     LYKLKKVIPLRFNGKIASHIEEHLEFEEQITWRSHVNEFVIEAVAKSQENGMFDELHN
                     ESAKADFDAENMDTADSADTKQRGNSNASTNSKVLSVLVTDDRNMDSKAKERGIRTCS
                     TRFIFSICSQLGMKYGICTN"
     gene            <659326..>660960
                     /locus_tag="CAGL0H06633g"
                     /db_xref="GeneID:2888554"
     mRNA            <659326..>660960
                     /locus_tag="CAGL0H06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447084.1"
                     /db_xref="GeneID:2888554"
     CDS             659326..660960
                     /locus_tag="CAGL0H06633g"
                     /note="highly similar to uniprot|P10963 Saccharomyces
                     cerevisiae YKR097w PCK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447084.1"
                     /db_xref="GeneID:2888554"
                     /db_xref="GOA:Q6FRR0"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /translation="MPSKSSVSGNSVEERIRSELGLSKEVTLIRRNAPAAVLYQDALK
                     EKKTVISSAGALIAYSGEKTGRSPKDKRIVEEETSRDNVWWGPVNKPCSERTWAINRE
                     RAADYLRTRETLYVVDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELANFG
                     EPDFTVWNAGQFPANARTQDMTSKTTIEINFKAMEMVILGTEYAGEMKKGIFTVMFYL
                     MPVHHNVLTLHSSCNQGIKNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDEGV
                     FNIEGGCYAKCINLSREKEPEIFDAIRFGSVLENVIYDSESHEVDYDDSSITENTRCA
                     YPIDFIPSAKIPCLAPAHPKNIILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAG
                     TEQGVTEPEPTFSSCFGQPFLSLHPMRYATMLAEKMHEHSANAWLINTGWTGSSYVSG
                     GKRCALKYTRAILDAIHDGSLAKAEFESLPIFNLQVPKAVEGVPSELLNPARNWSEGE
                     AKYQSAVSKLAGLFVENFKTYQDKATSDVLAAGPQL"
     gene            complement(<661713..>662987)
                     /locus_tag="CAGL0H06655g"
                     /db_xref="GeneID:2888483"
     mRNA            complement(<661713..>662987)
                     /locus_tag="CAGL0H06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447085.1"
                     /db_xref="GeneID:2888483"
     CDS             complement(661713..662987)
                     /locus_tag="CAGL0H06655g"
                     /inference="similar to AA sequence:UniProtKB:P40454"
                     /note="similar to uniprot|P40454 Saccharomyces cerevisiae
                     YIL153w RRD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447085.1"
                     /db_xref="GeneID:2888483"
                     /db_xref="GOA:Q6FRQ9"
                     /db_xref="InterPro:IPR004327"
                     /translation="MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVA
                     DLELSGVVGGVVKVLDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLI
                     SSHFPSELQCVVELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGASFDGDQVL
                     YIFDRYYSLVHRLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDL
                     SDPVLVEQYSRTNIFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMY
                     KDEVLNKFPVIQHFWFGTGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMDGT
                     RVVESRFLSPGNETFVRRPQLPQDSGVGTMRSSTPESRLMNVTTRSTRSTAGPGQGRM
                     GPPTSMGIVQTRMPSSTTSQAHASRLMNTPRQ"
     gene            <663303..>664319
                     /locus_tag="CAGL0H06677g"
                     /db_xref="GeneID:2888457"
     mRNA            <663303..>664319
                     /locus_tag="CAGL0H06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447086.1"
                     /db_xref="GeneID:2888457"
     CDS             663303..664319
                     /locus_tag="CAGL0H06677g"
                     /inference="similar to AA sequence:UniProtKB:P32351"
                     /note="similar to uniprot|P32351 Saccharomyces cerevisiae
                     YIL154c IMP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447086.1"
                     /db_xref="GeneID:2888457"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ8"
                     /translation="MQKGILVPSGSERGPTEIQFDSEIGRGRSRDKRTGGNGAGRLSL
                     SRSRSRASSRVREEEFLKWTVLRRDPSMRLTTLKKNKKSGSGTGGDDDDDDDEDDDDE
                     DDDDEEESDEERVSDIENDAEIDEEFHFDLGTKVLPNFSTSINDVLENSKPWIQKYLS
                     TLDMEKERAGVNFETLEGGYSRALELVRKGKGAEAHPETSKNYILCTDLSSESTYALT
                     YVMGSLVSNGDTLYIVHWDGDSTTSTKDSFIDNALRVKKHVRHLMDCVSVIVDDLDVV
                     IISLTHPYPKHLLNEMIHGLKPVTLACSLSLILSSLQNFVCSVPTLVIRKKLKRSRKK
                     GISE"
     gene            <665295..>667247
                     /locus_tag="CAGL0H06699g"
                     /db_xref="GeneID:2888527"
     mRNA            <665295..>667247
                     /locus_tag="CAGL0H06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447087.1"
                     /db_xref="GeneID:2888527"
     CDS             665295..667247
                     /locus_tag="CAGL0H06699g"
                     /inference="similar to AA sequence:UniProtKB:P32191"
                     /note="similar to uniprot|P32191 Saccharomyces cerevisiae
                     YIL155c GUT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447087.1"
                     /db_xref="GeneID:2888527"
                     /db_xref="GOA:Q6FRQ7"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ7"
                     /translation="MFARVAASTRAHSRLLAGTVAAGATLAVANHYNNNNKLISNDVS
                     LISPVEKPDVKLPTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEK
                     NDFASGTSSKSTKMAHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLL
                     PIIIPVYNYWQVPYFYAGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGL
                     VYHDGSFNDTRMNATLAVTAIENSATVLNYMEVKQLVKDKDGKVAGAVVEDRETGKTY
                     SVRAKVVVNATGPYSDRLLQMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKP
                     NMVVPSAGVHIILPSFYCPKEMGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPE
                     NPTATEADIQDILKELQPYIKFPVKREDVLSAWAGIRPLVTDPRKKSKADGSTQGLVR
                     SHFIFTSDHGLVTIAGGKWTTYRAMAEETIDEVVKNGKFDAKPCITRKLKLAGAENWD
                     PNLPALLAQKYHLSQKMSHYLAENYGTRAPLICEMFHEDPENRLPLLLADKEQTPVLG
                     HVDFDSFRYPITIAELKYAIKYEYARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMG
                     DSLGWDEQRRQDEIRYSTEFIKTFGV"
     gene            complement(<667816..>671061)
                     /locus_tag="CAGL0H06721g"
                     /db_xref="GeneID:2888620"
     mRNA            complement(<667816..>671061)
                     /locus_tag="CAGL0H06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447088.1"
                     /db_xref="GeneID:2888620"
     CDS             complement(667816..671061)
                     /locus_tag="CAGL0H06721g"
                     /inference="similar to AA sequence:UniProtKB:P40453"
                     /note="similar to uniprot|P40453 Saccharomyces cerevisiae
                     YIL156w UBP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447088.1"
                     /db_xref="GeneID:2888620"
                     /db_xref="GOA:Q6FRQ6"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ6"
                     /translation="MDRFTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQ
                     CMLEDYMGCVDVDTSKAVRVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQ
                     LNMTNVIAMVKEEVAQIQEQCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRS
                     AYSISSPSGMSTLSLHDELPEHRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNP
                     ITNINQPRKSLDVTLNANNEIPTLSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEH
                     GSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYETVSKGDDVSYRGKD
                     FEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYFDGSNAFIQGLERLQKQSIITAPEL
                     FSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILE
                     QRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTSGKHLSSVPTALLGG
                     YEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNNAQIPDVPTWKPPPVPVMVRK
                     RPPPPVPVSIPIPPETPPPLPQKIKLESIEESAPSDNSQYIRPPAKLPIHALHSPRNQ
                     TLTRKFSIPTIEKNSNPYVAYSVTGLRNLGNTCYINCMLQSLFATNELKNLFISGKYR
                     EYQMKPNDNKESAISNTFANLFNKMYMNGGCTVVPSGFLKICNFLRPDLRIPDDQQDT
                     QEFLLFILNRLHDELSNQVNVINDYPNLLLYDDDKMMVDKEKYKKWFDKTVVANGLSP
                     VDGVFQGQMENALQCQRCGYESVNYSTFYVLSLALPKPSAPAFYKSGRVKLEDCINMF
                     TSDEVLTGENAWDCPKCGSKAVEPRFTSRTSTQTILPNSPHHHKKSKFFGLPTGKAIS
                     RSKSPFRKLGLLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLII
                     HLSRFYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNK
                     DPHHNLGNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERVD"
     gene            complement(<671272..>671645)
                     /locus_tag="CAGL0H06732g"
                     /db_xref="GeneID:9488003"
     mRNA            complement(join(<671272..671481,671637..>671645))
                     /locus_tag="CAGL0H06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999506.1"
                     /db_xref="GeneID:9488003"
     CDS             complement(join(671272..671481,671637..671645))
                     /locus_tag="CAGL0H06732g"
                     /note="highly similar to uniprot|Q2V2P4 Saccharomyces
                     cerevisiae YIL156wb"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999552.1"
                     /db_xref="GeneID:9488003"
                     /db_xref="GOA:B4UN09"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:B4UN09"
                     /translation="MTLIGKAVHLSVDLVLVSTCLAAVKRNTGLVPRTELIPNTTARD
                     YFEKYLAFGESTYDYTVATCGTSSYFKR"
     gene            <671849..>672391
                     /locus_tag="CAGL0H06743g"
                     /db_xref="GeneID:2888556"
     mRNA            <671849..>672391
                     /locus_tag="CAGL0H06743g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447089.1"
                     /db_xref="GeneID:2888556"
     CDS             671849..672391
                     /locus_tag="CAGL0H06743g"
                     /note="some similarities with uniprot|P40452 Saccharomyces
                     cerevisiae YIL157c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447089.1"
                     /db_xref="GeneID:2888556"
                     /db_xref="GOA:Q6FRQ5"
                     /db_xref="InterPro:IPR014807"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ5"
                     /translation="MMSMLPSRMLRQRTALAAVRGLRTGSRVMVELKDKERPMTVNAE
                     LPDPMAGRRKRIAAFAAFSLATGSALAVIFNYEKTESAIVSNTMYYMRRSGQTIDALG
                     ENIEFAGVIPWVWGELNPVAGKINITFSVKGKKGVTGIVKLVADRENRREEFRIHEWS
                     LTVPDKKIDLLAENPHSSFD"
     gene            complement(<672619..>676503)
                     /locus_tag="CAGL0H06765g"
                     /db_xref="GeneID:2888896"
     mRNA            complement(<672619..>676503)
                     /locus_tag="CAGL0H06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447090.1"
                     /db_xref="GeneID:2888896"
     CDS             complement(672619..676503)
                     /locus_tag="CAGL0H06765g"
                     /inference="similar to AA sequence:UniProtKB:P40450"
                     /note="similar to uniprot|P40450 Saccharomyces cerevisiae
                     YIL159w BNR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447090.1"
                     /db_xref="GeneID:2888896"
                     /db_xref="GOA:Q6FRQ4"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ4"
                     /translation="MPADGEAVDRLFEELIRDGGYYWGEELVDELRRGPCSKRWEFIC
                     KVHGLETSHQGAGKSSDNVGGTLNGPVDAGGQAEADEEISGILQKLESVKDTVLASES
                     GGETVLRFLYNLEKLLRQSRLREVFVYYDYVTALLEPLVTVILDLEQMHGHNSKFLYI
                     HLRCIKTIMNSSEGRLLVLKNDVLVTYLRDIVTTDLEFSINFVKNKCQAMEVLLLLSY
                     LDMDRGFQVIYETFEPYMDEWMDSTLCNCDELQHYESSSSLINPTKILVEYCTLFMFM
                     VNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKYRDVKLEIMT
                     RNSCVPSILEDVSYSQVLTDLVIQTKNTALESGLGNLFTLVFQVIHTKKLNECIKFLK
                     LIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSEDLTRRAMVEIKTLEKNIT
                     ELNSHIAELENEAHMDKRTIIQQLKQAEHMLEEKTIENESSIRLINQLKGQLREKQKK
                     YDQLLVHQRMAPKDTRSISGGKIFENVNSGKVNQRSFSTSSAKMIYKSKGFRSLVSVV
                     QSNEDFHNQKENISGYKPGLNMVYNENGKGSSLTTFDTGKGYPQNVFNTGIKSQQGDV
                     KHGQYLLKSAQYSSDISSDIAKQEFNGAASNGKPYILPQNSVMTLNMNTSVDSVVSTE
                     FDQPSIQPEHGNVQIAGLPPPPVPPFLKLGGGSKLSVTSSNDDKDGPTIPDSPIMEFP
                     GILTNIDIKKNEDASTKIGVTNDNLPPPPPPPPLPPNLTKNKASADTSDEASGDVVVA
                     PPPPPPLPSNFNVPSSTPKSTIRLKQIHWEKVDDVGGTLWEDVSGIPLDHLKDEGVFS
                     QIEKYFKILEPVKKTKVLAENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKV
                     LKCEDDLIQNVSVLGFFTKEDLTQIPSGLERKFAPYSTNYLTDDSPEKDPRELERADH
                     IYLELFYNLRSYWSARSHCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLL
                     IIREIGNYMNKGSVTGIKLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTE
                     DIAKVEDLGKVTLEHVELECEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYK
                     INRAKSKSELLINQHELTKRSLNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAK
                     ENIEREEVTRLYEQRKHLLEQRNKKIEEQEHSDDEINAVDDLITKLRDAKKQHPAPLR
                     RRRSTKAVLNEKRAGEPLLERTQALLSDIQNI"
     gene            <676925..>678154
                     /locus_tag="CAGL0H06787g"
                     /db_xref="GeneID:2888768"
     mRNA            <676925..>678154
                     /locus_tag="CAGL0H06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447091.1"
                     /db_xref="GeneID:2888768"
     CDS             676925..678154
                     /locus_tag="CAGL0H06787g"
                     /note="highly similar to uniprot|P27796 Saccharomyces
                     cerevisiae YIL160c POT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447091.1"
                     /db_xref="GeneID:2888768"
                     /db_xref="GOA:Q6FRQ3"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ3"
                     /translation="MAERLKNIGSHLLGGSQGPSVKEQHPDDVVIVAANRSAIAKGFK
                     GSFKDVNTDYLLTVFLKEFIDTFPPQLRDNLDLIGEVTCGNVLNPGAGATEHRGAMLA
                     AGLPYTTPFMALNRQCSSGLTAVNDIANKIKAGQIDVGLAAGVESMTQNYASSNPLGR
                     ISDELKSDKNARKCLIPMGITNENIAKGFEITREMQDEFAAASYQKASNAVQSGVFKD
                     EILPITLPDGKVVDVDEGPRANVTAKSLGGLKPAFIKETGTTTAGNASQVSDGVAGVL
                     LARRSVANKLKLPILGRYVAFQSVGVPPEIMGVGPAYAIPRVLQDVGITVDDVDVFEI
                     NEAFAAQALYCINKLGINLKKVNPRGGAIALGHPLGCTGARQIATILRELEKGQVGVV
                     SMCIGTGMGAAAVFVKE"
     gene            complement(<678341..>678784)
                     /locus_tag="CAGL0H06809g"
                     /db_xref="GeneID:2888582"
     mRNA            complement(<678341..>678784)
                     /locus_tag="CAGL0H06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447092.1"
                     /db_xref="GeneID:2888582"
     CDS             complement(678341..678784)
                     /locus_tag="CAGL0H06809g"
                     /note="some similarities with uniprot|P36116 Saccharomyces
                     cerevisiae YKR020w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447092.1"
                     /db_xref="GeneID:2888582"
                     /db_xref="GOA:Q6FRQ2"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ2"
                     /translation="MAEQISHKKSLRVGKNKRSLLKEYYHLEDGATKTDEPVTGEVHE
                     QDNNTLQTDTGNEEVVKEVLEDSDSQPNVDRPINEQTLKELVATHNTLLGKETATNSS
                     IKNTIYENYYDLVKVNDKLKELSGDKLQQSMDSLKKAVEESLRSA"
     gene            <679307..>679924
                     /locus_tag="CAGL0H06831g"
                     /db_xref="GeneID:2888770"
     mRNA            <679307..>679924
                     /locus_tag="CAGL0H06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447093.1"
                     /db_xref="GeneID:2888770"
     CDS             679307..679924
                     /locus_tag="CAGL0H06831g"
                     /inference="similar to AA sequence:UniProtKB:Q96VH4"
                     /note="similar to uniprot|Q96VH4 Saccharomyces cerevisiae
                     YCL026cb"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447093.1"
                     /db_xref="GeneID:2888770"
                     /db_xref="GOA:Q6FRQ1"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="InterPro:IPR029479"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ1"
                     /translation="MTKHSPTSHEASASNPVLEAIVARRSIHYLKPELPEGVTFDDIY
                     HIVQECVKHTPTSFNSQVNRAFIVRGALHYKIWDQVVNKIKEPEYRARPLRIRDGAYG
                     SIFFYVDENVTERNKVEHPEWAPVCEAYADQAMGAASIAAWTVMHNMGIGCNMQHYGK
                     YMHDPNVLPEDIPSHWTMKCQLVFGVPDKDPNEKKFIENIVKVYE"
     gene            complement(<680184..>681266)
                     /locus_tag="CAGL0H06853g"
                     /db_xref="GeneID:2888763"
     mRNA            complement(<680184..>681266)
                     /locus_tag="CAGL0H06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447094.1"
                     /db_xref="GeneID:2888763"
     CDS             complement(680184..681266)
                     /locus_tag="CAGL0H06853g"
                     /note="highly similar to uniprot|Q04894 Saccharomyces
                     cerevisiae YMR318c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447094.1"
                     /db_xref="GeneID:2888763"
                     /db_xref="GOA:Q6FRQ0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FRQ0"
                     /translation="MSSEDKFQGIAVLDHKDWKNPKKVEFPAKPFYDHDIDIKIDACG
                     VCGSDIHCAAGNWGKKQTPLVVGHEIIGKVVKIGPKCNTGLKVGDRVGVGAQVFSCLE
                     CDRCKNDNEPYCPKFVTTYSQPYEDGYVSQGGYANYVRVHEHFAVKIPENIPDHLAAP
                     LLCGGITVYSPLLRNGCGPGKKVGIVGIGGIGHMGLLFAKAMGAEVYAISRSNAKKED
                     SLKLGADHYIATKEEPNWGEKYFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVSIS
                     IPDEDQTLTMKPFGLLGVSIANSALGSIKEIEQLLKLVSEKDIKIWVETLPVGEAGVK
                     EAFERMDKGDVKYRFTLVDFDKEFGN"
     gene            complement(<682518..>684626)
                     /locus_tag="CAGL0H06875g"
                     /db_xref="GeneID:2888437"
     mRNA            complement(<682518..>684626)
                     /locus_tag="CAGL0H06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447095.1"
                     /db_xref="GeneID:2888437"
     CDS             complement(682518..684626)
                     /locus_tag="CAGL0H06875g"
                     /note="some similarities with uniprot|P05085 Saccharomyces
                     cerevisiae YML099c ARG81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447095.1"
                     /db_xref="GeneID:2888437"
                     /db_xref="GOA:Q6FRP9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP9"
                     /translation="MDKKSTRSVKTYSGCWTCRARKVKCDLVRPSCLRCRRSKVQCGG
                     YKIKLRWSPLLHFDLYGVPMPSNESITTTEGDDVETSTNLRRNVERVRYEEEYEYHED
                     MDEELSELHAPPEDKIANNKTWIIKKFGVFRAIEREAIIAAKRGKTDKRPVQKKIANE
                     LNSNNSNNHINNEPLMKKPRLAPSVATSTMTTPISLSPTSPMMIPDTLGLTFDGNPAF
                     MSPLPMELLQPDFIHDHSHLVSLSTESCSIVHNNVRFLLTHYLEKVPDLMTIAPIPNK
                     NKNPWAKIYFPRAIAALGELIAFPNSQNYARISLLNGCLSVSCFNLKDLLKYDPVSTD
                     FYLNLAVELRTRASHFLNLALEQEEEYEEYRDILEDDDIAEDYNKHFCDMLIAILTMN
                     SIDIVWGTMVDCDNYLRICEQLISKNKKRVVVSKKIKSLYTIYAFLKLMQNSTAMETI
                     TSEPSLDFHNPDIIPYKYLRETYENDIKTIFTDHYGSTKMNTLGADALNALPNSLVLL
                     FYDCVSLTRYYFYHKKKSEGIELPTEFFMKTREFEDKLSNWKSEWDFFDSTGRNFLSP
                     TIEGIYHHTMSFYYGLCVYYYNFIKNQDYESLNVEVWKVIYHLQQIEFLKDSSAGKEG
                     IKLIPLIWQGFIAGCLCSDPEVQSEFKTWFDTVSLTGAGSYRGAIQIMFEVWRRRDNN
                     ELGDDWLSVSRDWEMNIMLT"
     gene            <685058..>685549
                     /locus_tag="CAGL0H06897g"
                     /db_xref="GeneID:2888636"
     mRNA            <685058..>685549
                     /locus_tag="CAGL0H06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447096.1"
                     /db_xref="GeneID:2888636"
     CDS             685058..685549
                     /locus_tag="CAGL0H06897g"
                     /inference="similar to AA sequence:UniProtKB:P11747"
                     /note="similar to uniprot|P11747 Saccharomyces cerevisiae
                     YML098w FUN81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447096.1"
                     /db_xref="GeneID:2888636"
                     /db_xref="GOA:Q6FRP8"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP8"
                     /translation="MSRRRLKKTNLFHKDINSLLYAYGDVAQPLNKTVQCLDELVSSY
                     LVDICAEAAHVANSSSRNKIRLEDFKFVLRKDPIKLARAEELISTNALITEAKKQFNE
                     NENQNLKRYKEDEDDDDDEDDDEDDDEDSKPKEAPVTVETQESTVPVKEKKKRTKKAK
                     VKS"
     gene            complement(<685736..>687619)
                     /locus_tag="CAGL0H06919g"
                     /db_xref="GeneID:2888767"
     mRNA            complement(<685736..>687619)
                     /locus_tag="CAGL0H06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447097.1"
                     /db_xref="GeneID:2888767"
     CDS             complement(685736..687619)
                     /locus_tag="CAGL0H06919g"
                     /inference="similar to AA sequence:UniProtKB:Q03103"
                     /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
                     YML130c ERO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447097.1"
                     /db_xref="GeneID:2888767"
                     /db_xref="GOA:Q6FRP7"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP7"
                     /translation="MKLSYLLLAGIVAGEGNSTNNQTNWTTENHFCAMDKDLMISPSC
                     NVTFTELNVINKSIRKNLVSLVRTDFFKYFKIDPDKQCTFWDNNDGLCFSRDCMVDVV
                     TDWDSLPEIWQPEVLGGLDEAQDASGSDEKEWTFLDDLCAESQQQSKPKPLLDVDDNN
                     YCDINDFSGENAVLVDLTKNPERFTGYGGQQSSQIWTSIYGENCSPLGKDLVKSGKAS
                     QDEVSMARDVFFRFVSGLHASIGTHLSNDHLNTENGKWEPNLDLFMLRVGNFPDRVTN
                     IYFNYAVIAKSLWKIKPYLSRIEFCNDYDDPVKSKILSIVSKLDSSIFNEDLLFQNDL
                     SSSLKNEFRARFKNVTKIMDCVHCDRCKLWGKVQTTGMATSLKILFDLDEADESSKQK
                     FVDKLTKYELIALFNTFDKLSESVEYINNFEKLYKRREGGDSYTNFFQNNFFKILEKM
                     KKGWSTINDSVSNNKEYNNSAQNSESISDPSEESMTSLVKDAVEEVKNTTKSSLSDND
                     EFLTAKLSENNENIEENKLEDKLNEQEAFADLKMPIRKKKLTKKKSNGTLDIWINAWH
                     TETHNVMEAIKFILRSYIDLPRNLWRLTIVTVNKLWNNFVGVANYVSEEPGEEIIYDL
                     DFQ"
     gene            complement(<688276..>689640)
                     /locus_tag="CAGL0H06941g"
                     /db_xref="GeneID:2888629"
     mRNA            complement(<688276..>689640)
                     /locus_tag="CAGL0H06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447098.1"
                     /db_xref="GeneID:2888629"
     CDS             complement(688276..689640)
                     /locus_tag="CAGL0H06941g"
                     /inference="similar to AA sequence:UniProtKB:P54787"
                     /note="similar to uniprot|P54787 Saccharomyces cerevisiae
                     YML097c VPS9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447098.1"
                     /db_xref="GeneID:2888629"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP6"
                     /translation="MESSHIREPKGQASDRDMNSNKTSQASEELQSNFKPELNEQLES
                     HNQVVNALQSPEHEEEDVNETYYNFQLFLDQIQDARCAPLIKYTRSFLRNFVTQRAIW
                     SATEQDKLIKDFKTFIYSKYKDFKPFSDLNKTELRNAEEGMEKLLTGKLYHHLFSPLL
                     AERAKAAGIEADKEHLDDIEKDKMFIKKVAEFKFIEPTNLDISFQNVKRVKKFTSFAS
                     IELNKMNNFKAPRDKMVCILNASKILFGLMKHSEETGADCFVPLLIYTLLSGKIENLV
                     SNINFIERFRYSSLFRGEEAYYLSSLQAASNFILKLDKKSLTIENEKDFDTKYEQNIE
                     NVKQDQLQKEKLLKETKQEESSNMLDDVSNMVMNKLNEFFIQDEPQKEKKKEVHHKAN
                     SKNEDGEVASMIKQLEAKEHQETVETLTSMFPDLDVEIIEDVCIAKKHRIGPCVDVLL
                     TLSN"
     gene            <689948..>691501
                     /locus_tag="CAGL0H06963g"
                     /db_xref="GeneID:2888447"
     mRNA            <689948..>691501
                     /locus_tag="CAGL0H06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447099.1"
                     /db_xref="GeneID:2888447"
     CDS             689948..691501
                     /locus_tag="CAGL0H06963g"
                     /inference="similar to AA sequence:UniProtKB:Q04489"
                     /note="similar to uniprot|Q04489 Saccharomyces cerevisiae
                     YML096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447099.1"
                     /db_xref="GeneID:2888447"
                     /db_xref="GOA:Q6FRP5"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP5"
                     /translation="MCGILLCYGPSFKAENDRLLEFYEDEVPRLGYDDNIESIVKLVR
                     CRGPNYCSMRQIKDVNSIWISSVLSLRQPFTKQSIVIGNKYVLQFNGELYNDEIIESG
                     NDTQFLSGLLKKCISEDDIFNILHGLDGEFAFTIQDLENNLIYFGRDTIGKRSLSYSL
                     NYNISELIVTSVSGSDNGSRIFNDCVAGVIYKYDIDRNILDTTSTLRKPWSITREHDD
                     DMTHIDTCTKNLYDLLSGATRKRVESIHPLHIENSPISILFSGGLDCSVITAIVCETL
                     ISRNMHDHATIELLNVAFENLRTGMMPQDAPDRQLAVKSYSELCEKYPNINIKLIEVD
                     VSYAEYMKHRPEVVDLMYPKNTEMDLSIAIAFYFASRGDGFITDENGVRKEYKRKGLV
                     LFSGLGADELYGGYYKLSNKHEDELANELTTQINNIYRRNLNRDDKVIASNGVEVRYP
                     FLAEEVVEFSTASIPLNYKRDKMILRNIASSILGLHGLSAEKKRAIQFGAKSAKMTKN
                     GNKNGTDLL"
     gene            <691854..>694490
                     /locus_tag="CAGL0H06985g"
                     /db_xref="GeneID:2888841"
     mRNA            <691854..>694490
                     /locus_tag="CAGL0H06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447100.1"
                     /db_xref="GeneID:2888841"
     CDS             691854..694490
                     /locus_tag="CAGL0H06985g"
                     /inference="similar to AA sequence:UniProtKB:Q04500"
                     /note="similar to uniprot|Q04500 Saccharomyces cerevisiae
                     YML093w YMJ3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447100.1"
                     /db_xref="GeneID:2888841"
                     /db_xref="GOA:Q6FRP4"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP4"
                     /translation="MAKRKGNTRSKSSKRALNALELAEREVGGQDSEEEEEFYDRNKK
                     NGTVVNLLKMVNGGDDEDVEDGGDSFEDEELDSDEALGSDDDYDILNSKMSQTIRDKK
                     KRGEYNSEEEEENYTSIDEDELMPLSQIWDMDTKGGDDTKGSTTRDESLQLASDVDSS
                     SEGSSSSDEESSDDESQESEDPFDEISDDEEDIDLANVTSKLVKETEMHVPKKLSNYG
                     HGEANDFALPSLTSESGIQKLSMEEMMGAIDDKHAVTQASLLKGKSLATAVPLPQRIQ
                     QRNERKAAYEISKEEMNKWTEVVQQNRRAEHLVLGSNKEKVHNDASAFTRMTEKPTSE
                     LQSKVDELLGESNLVDPQKESTFEELATAKMTPEEMKKRTAEMRLMRELMFREERKAK
                     RLKKIKSKTYRRIKKKEAMKNRELAGLSDESDTEHDIRRAKERMTLKHKTSSKWAKDM
                     IKHGMANDKETREEMEEMLRQGEKLRDKIIDRQSGDSDNNISDIEQDSEQDIDVEKVG
                     KTGVMNMAFMKNAEAREKAENKQFIEKLREFEKTGDDDLFESDDEKPVIEGKDTVTSI
                     NKGRRTYAPGDLEMRHEMKKIKEEVRKEKEIDESRTLVNRLKRRNENNEEEIIDVVEE
                     VVPPKEEKTAPKSKTKSESSNPWLDGSDDEDVNVKQSSKVHIIDKDSSKLSKSANKIE
                     KAKAKSKKSNKRENDSDELLLTTDKSNSLKIVDPYGGSDDEGQEFMFKQQDVIAEAFA
                     GDDVVAEFEQEKTRVADDEGDKEEDVTLPGWGDWAGSGVNPRKKRKFIKKIKGVVDKD
                     KRKDKYLKNVIINEKVNKKNMKYQSSAVPFPFESREQYERSLRMPLGQEWTARSTHQK
                     MIKPRVITKPGQVIDPLKNPFS"
     gene            complement(<694778..>695530)
                     /locus_tag="CAGL0H07007g"
                     /db_xref="GeneID:2888578"
     mRNA            complement(<694778..>695530)
                     /locus_tag="CAGL0H07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447101.1"
                     /db_xref="GeneID:2888578"
     CDS             complement(694778..695530)
                     /locus_tag="CAGL0H07007g"
                     /note="highly similar to uniprot|P23639 Saccharomyces
                     cerevisiae YML092c PRE8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447101.1"
                     /db_xref="GeneID:2888578"
                     /db_xref="GOA:Q6FRP3"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP3"
                     /translation="MADRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVV
                     IATEKKSSSPLALTETLSKVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYG
                     EYPPTKLLVSEIAKIMQEATQSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWK
                     ATSIGKGSTAAKTFLEKRWNNELELEDAIHIALLTLKESVEGEFNGDTIEIAVIGEPN
                     TDLLGYKGVEKDKGPRFRTLSTQEINDRLEAL"
     gene            <696225..>696497
                     /locus_tag="CAGL0H07023g"
                     /db_xref="GeneID:9488004"
     mRNA            <696225..>696497
                     /locus_tag="CAGL0H07023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999507.1"
                     /db_xref="GeneID:9488004"
     CDS             696225..696497
                     /locus_tag="CAGL0H07023g"
                     /note="highly similar to uniprot|P81449 Saccharomyces
                     cerevisiae YDR322ca ATP21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999553.1"
                     /db_xref="GeneID:9488004"
                     /db_xref="GOA:B4UN10"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="UniProtKB/TrEMBL:B4UN10"
                     /translation="MSTVNVLRYSALGLGLLVGLKTDFSLRGAAAKKLEEEEFSKRQQ
                     LIADAKAEWAKLHPPKTKATTKEINFDDPNLDFGELIVNAVNALDA"
     gene            complement(<696804..>697874)
                     /locus_tag="CAGL0H07029g"
                     /db_xref="GeneID:2888765"
     mRNA            complement(<696804..>697874)
                     /locus_tag="CAGL0H07029g"
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /transcript_id="XM_447102.1"
                     /db_xref="GeneID:2888765"
     CDS             complement(696804..697874)
                     /locus_tag="CAGL0H07029g"
                     /inference="similar to AA sequence:UniProtKB:Q06678"
                     /note="similar to uniprot|Q06678 Saccharomyces cerevisiae
                     YDR322w MRPL35"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /protein_id="XP_447102.1"
                     /db_xref="GeneID:2888765"
                     /db_xref="GOA:Q6FRP2"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP2"
                     /translation="MFRRGFHSSVKAAERTRVWSDFSNRSKSLGINNVLVKKNVLEGS
                     SAVKGGPVTIGRKSNRLKYNSPEHIDEAFAVSYKYLEDHASKLYEKAKGQENELEREK
                     LIAKAESGNPEVLYNFQYHEKIENDPRIIDYTQPVYRHLGRKHWESYSQMLLMQRLES
                     LQVIPDTMPTLVPKAEVNIRFPYSTGVNKWVEPGEFLSSNVTSLPPAVKIQEYDLVDP
                     SKQLYSVLIVNPDEPDVENDTFKTTLAFGLVNIKIDYNDNVVDPRRYTDENVLAEYVP
                     PVPEKNVPAQRYSVWVFRQTEPIAKGDVVRDNFNIRDFASKNNMEAIGAHVWRSEWDL
                     NVSKVREMYNMPTGRVFSRVRR"
     gene            complement(<698202..>699338)
                     /locus_tag="CAGL0H07051g"
                     /db_xref="GeneID:2888476"
     mRNA            complement(<698202..>699338)
                     /locus_tag="CAGL0H07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447103.1"
                     /db_xref="GeneID:2888476"
     CDS             complement(698202..699338)
                     /locus_tag="CAGL0H07051g"
                     /note="highly similar to uniprot|P38986 Saccharomyces
                     cerevisiae YDR321w ASP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447103.1"
                     /db_xref="GeneID:2888476"
                     /db_xref="GOA:Q6FRP1"
                     /db_xref="InterPro:IPR004550"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR020827"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="InterPro:IPR027475"
                     /db_xref="UniProtKB/TrEMBL:Q6FRP1"
                     /translation="MVNDSVEITTICPDVENSQFLLSSSVQDLRKVSQTPLGTVHRSL
                     PRIKILGTGGTIASKGSDSSQTAGYHVDLTIQDMLSAIPDISGICELEYEQLCNVDSK
                     DIDEALLFKIYKGISDSLQSFDGIVITHGTDTLAETAFFIESTIDAGDVPIVLVGSMR
                     PSTSVSADGPMNLYQAICIASDKKSRGRSVLVSLNDQISAGYYITKTNANSLDTFNVR
                     QGYLGNFFNNEIHYYYPPVKPMGCHKFKLKFDDVEEKYTGFNFPKVAILYAHQAFEPE
                     LFDLVSDKYDGIVIATMGAGSLPDNVNQKALTLKVPIVYSKRSMDGMIPVANLPKAAD
                     GTHNYVIASGYLNPEKSRILLQLCLAGKYSLHEIRHVFAGVYGG"
     gene            <699630..>699851
                     /locus_tag="CAGL0H07073g"
                     /db_xref="GeneID:2888581"
     mRNA            <699630..>699851
                     /locus_tag="CAGL0H07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447104.1"
                     /db_xref="GeneID:2888581"
     CDS             699630..699851
                     /locus_tag="CAGL0H07073g"
                     /inference="similar to AA sequence:UniProtKB:P69851"
                     /note="similar to uniprot|P69851 Saccharomyces cerevisiae
                     YDR320ca DAD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447104.1"
                     /db_xref="GeneID:2888581"
                     /db_xref="GOA:Q6FRP0"
                     /db_xref="InterPro:IPR013959"
                     /translation="MVENPYEEVQVNVLSRIIANVEKLNQSVRTLNQELENVNKRNKN
                     LEVMGQICENYHRSVQFNLEATGNKKPPL"
     gene            <700262..>702247
                     /locus_tag="CAGL0H07095g"
                     /db_xref="GeneID:2888839"
     mRNA            <700262..>702247
                     /locus_tag="CAGL0H07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447105.1"
                     /db_xref="GeneID:2888839"
     CDS             700262..702247
                     /locus_tag="CAGL0H07095g"
                     /inference="similar to AA sequence:UniProtKB:Q06677"
                     /note="similar to uniprot|Q06677 Saccharomyces cerevisiae
                     YDR320c SWA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447105.1"
                     /db_xref="GeneID:2888839"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015228"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN9"
                     /translation="MSDPFGHLLASLKEGNVPSSKPGSKENSVTPGALTPQKKKLTPL
                     HTESIVHGNGNVVSNTNIHDDLDDLFGSIPKKEDVVQDNHTSIDGLDLFQSSSHVVSK
                     TEPDNQEINPFDNPFETEHKSESPTEEVIDEVRDMELAKLMSLGLNIDKASSYYERGI
                     TFEDVLRKRKQKASNGYQQRSNIDRKQGGGEIRNIFDTRGSGSESLFSGILNKGKELV
                     NQLSTYTEEENERMNKFKGYEEYSMSETYLEKENSMDPGVFSRSSQEKIPQRAARPSH
                     EKSNSSRSKINKRMTTEAPHKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHA
                     SSPVVNTSNQNTVSITQIPISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTL
                     PMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSY
                     NDIWPKIILRQAESYEAIEKYKLALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKP
                     KSNPPSKSATPAPAPRRAPTVNRQTEVVNKKSVNAEKLKKENERLAKLEDQKVALYDK
                     VEGIINSWKNGKQDDIRYLLSNLQAVITWTQWKPVQSSELVLPRKVKITYMKAVAKLH
                     PDKLPSSLTLEQQMIAESVFSTLSDSWENFKKSNDIN"
     gene            <702520..>703302
                     /locus_tag="CAGL0H07117g"
                     /db_xref="GeneID:2888513"
     mRNA            <702520..>703302
                     /locus_tag="CAGL0H07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447106.1"
                     /db_xref="GeneID:2888513"
     CDS             702520..703302
                     /locus_tag="CAGL0H07117g"
                     /inference="similar to AA sequence:UniProtKB:Q06676"
                     /note="similar to uniprot|Q06676 Saccharomyces cerevisiae
                     YDR319c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447106.1"
                     /db_xref="GeneID:2888513"
                     /db_xref="GOA:Q6FRN8"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN8"
                     /translation="MFVPTRKQVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNS
                     KNVFNQILAYKGNWVWLFLFMGVAAVQYNLRTKSQSLLPTDTRALVVSNKTKLQIIKE
                     YFCKYFLKLFILDVIFLVIDGVFIMTGGSCTVPNRSISAELCKSLGGKWIGGFDISGH
                     FCFLVNISMILWMELIAIAEHVCGYDTVISLSSLQKHVITVAVVVLVAWMGMLLVTAT
                     YYHTIAEKLIGCVFGYICPFVMYGLIPNSHDLNKLFYATMSD"
     gene            complement(<703350..>704426)
                     /locus_tag="CAGL0H07139g"
                     /db_xref="GeneID:2888557"
     mRNA            complement(<703350..>704426)
                     /locus_tag="CAGL0H07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447107.1"
                     /db_xref="GeneID:2888557"
     CDS             complement(703350..704426)
                     /locus_tag="CAGL0H07139g"
                     /note="some similarities with uniprot|Q06675 Saccharomyces
                     cerevisiae YDR318w MCM21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447107.1"
                     /db_xref="GeneID:2888557"
                     /db_xref="GOA:Q6FRN7"
                     /db_xref="InterPro:IPR018464"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN7"
                     /translation="MDTVTVEELLQDVEALTSEINGLQEKSKKLREQLKHPEQFIKFD
                     KAFGDFNDIFEKNPGLRDLLLGYEIDKSATDVDDTNIIPVTPQKKSRSSVVNEKLHSL
                     PEHEWVLKTQPLVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEPIQ
                     YENIYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYIL
                     LKKSAKSDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIR
                     SELFLQLEKDGIIDDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTIKSKIMSDDE
                     KERLAMMLQGSLHDLKYKLISLRN"
     gene            complement(<704823..>706097)
                     /locus_tag="CAGL0H07161g"
                     /db_xref="GeneID:2888611"
     mRNA            complement(<704823..>706097)
                     /locus_tag="CAGL0H07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447108.1"
                     /db_xref="GeneID:2888611"
     CDS             complement(704823..706097)
                     /locus_tag="CAGL0H07161g"
                     /inference="similar to AA sequence:UniProtKB:Q06674"
                     /note="similar to uniprot|Q06674 Saccharomyces cerevisiae
                     YDR317w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447108.1"
                     /db_xref="GeneID:2888611"
                     /db_xref="GOA:Q6FRN6"
                     /db_xref="InterPro:IPR014843"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN6"
                     /translation="MITTNLENTSGSLSREKTFEKNILLFGSTGLTGSLVFEYLLDPC
                     FYLNSAVELRELLLEAIEEGLENVTIKTCLYCFNRKIGEPLDKYLKSPSANSFGPFCF
                     NGSQYHYNKGTCVPLDIDQDIETSNDATFDGFLYYKDKGKNVTGKNPISGEYYGKEYM
                     YYLEYMSAEGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFSDEVEAISFREKMPLKRY
                     FPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDDKSVIIVTSFN
                     NTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVGRHSDIYPTNDSILKNS
                     SLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIPGSKLLGYCIPAQK
                     VAYAISIAAVDKYLHEEPLTRVVTSEEMDNMK"
     gene            complement(<706436..>707932)
                     /locus_tag="CAGL0H07183g"
                     /db_xref="GeneID:2888482"
     mRNA            complement(<706436..>707932)
                     /locus_tag="CAGL0H07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447109.1"
                     /db_xref="GeneID:2888482"
     CDS             complement(706436..707932)
                     /locus_tag="CAGL0H07183g"
                     /inference="similar to AA sequence:UniProtKB:P38793"
                     /note="similar to uniprot|P38793 Saccharomyces cerevisiae
                     YHR070w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447109.1"
                     /db_xref="GeneID:2888482"
                     /db_xref="GOA:Q6FRN5"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR025792"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN5"
                     /translation="MHRFFSWFPKYRLVRNWSTMSTQHNMYKYSPPVNRSMKELDRSF
                     FTKKIPLVVVKFKDPRNISEFAKNYKESILRIPRIPHVIKLEYKDGHAPSKTVACDNE
                     LVTKGVLLTDKITNVQDVSKVLSQGAVDYLNEKQAELLPYEYTLDYNFWKAEEILRSV
                     LPEEFLDEVPTGFTITGHVAHLNLRNEFKPYDSLIGQVILDKNNKIECVVDKVSSIAT
                     QFRTFPMKVIAGDSTNLVVEQKESDCTFRFDFSKVYWNSRLHTEHQRLVTDYFKDGEI
                     VCDVFAGVGPFAVPAGKKPSFVLANDLNPESFKYLQENITLNKVSDFVKPFNHDGAEF
                     IKQSANILDNFREESNGVVRHAIKLRGKKRRKGNENEPQPKQLEQQYKEYIIPKNISH
                     YVMNLPDSALTFLGNFNGVYNNIDPEIYKEMPYVHVHCFEKYENGEEVSMEELHKRVF
                     NRILKEMDCSADILPFEAVAFHLVRKVSPTKPMFCCSFKLPKEVAFKQ"
     gene            <708198..>709307
                     /locus_tag="CAGL0H07205g"
                     /db_xref="GeneID:2888769"
     mRNA            <708198..>709307
                     /locus_tag="CAGL0H07205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447110.1"
                     /db_xref="GeneID:2888769"
     CDS             708198..709307
                     /locus_tag="CAGL0H07205g"
                     /note="highly similar to uniprot|P38792 Saccharomyces
                     cerevisiae YHR069c RRP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447110.1"
                     /db_xref="GeneID:2888769"
                     /db_xref="GOA:Q6FRN4"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR025721"
                     /db_xref="InterPro:IPR026699"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN4"
                     /translation="MSSVISVVKRTGGFQSNSIESDFESDEDMSYGSDVEEGQDADGD
                     MEMKEEKGKGNSDIVTPGELITDDPVWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVI
                     PLRGRYAPETGDHIIGRIAEVGNKRWKVDIGSKQHAVLMLGSVNLPGGILRRKSESDE
                     LQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRDGIFCQVPSSLIIRSKNHT
                     HNLPGNVTVLLGVNGFVWLRKTSKMDLTRDAPPGGSTGAGRESSVGPTGATHVNTNTN
                     ISITRLEEESSWQIYSDENDPTIKNSERKTISRYANVIKALAFCEIGITQERIISAYE
                     ASMAFPNIGSLIEKETMESIGRDVITVERMRGTEQ"
     gene            complement(<709402..>710760)
                     /locus_tag="CAGL0H07227g"
                     /db_xref="GeneID:2888524"
     mRNA            complement(<709402..>710760)
                     /locus_tag="CAGL0H07227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447111.1"
                     /db_xref="GeneID:2888524"
     CDS             complement(709402..710760)
                     /locus_tag="CAGL0H07227g"
                     /inference="similar to AA sequence:UniProtKB:Q06668"
                     /note="similar to uniprot|Q06668 Saccharomyces cerevisiae
                     YDR316w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447111.1"
                     /db_xref="GeneID:2888524"
                     /db_xref="GOA:Q6FRN3"
                     /db_xref="InterPro:IPR027034"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN3"
                     /translation="MLLMRCVAQTRNRFPVVRPILQVHYSARYKSDANSNTKTYIPQP
                     TAKVRRPKTKEEIAKEKHEKALQSPYRLVRWAAIASSEKFNKSMTKYMVGIYAIFLIY
                     GVYFSKKLFQKEKELEKLEGKAKTSGINEYESLRIKELRGKLRRRDELKLEQYQQMID
                     KGITDFDGITLENNDQNRLNESIVPAHDTTEFYDHKAEEYDKAINSEERAILMGRKRK
                     WLMKHCEGDVLEVACGTGRNIKYLDIERVNSLIFLDSSENMLEIANKKFRDRFPTYKK
                     VAFVKGRAEDLLDLAGDDPDKKEQKKFDTIIEAFGLCSHEDPVKALKNFQELLKPGGR
                     IVLLEHGRGSVGLINKILDKRAKRRLETWGCRWNLDIGEILDDSGLDVVEEYTSHLGT
                     TWCVVAKKKSDVRKKKEISFIEKYFRSGLREKIQHMNEENNRTTSNVNSNNAEIPSNT
                     SK"
     gene            complement(<711240..>712397)
                     /locus_tag="CAGL0H07249g"
                     /db_xref="GeneID:2888516"
     mRNA            complement(<711240..>712397)
                     /locus_tag="CAGL0H07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447112.1"
                     /db_xref="GeneID:2888516"
     CDS             complement(711240..712397)
                     /locus_tag="CAGL0H07249g"
                     /note="highly similar to uniprot|P38791 Saccharomyces
                     cerevisiae YHR068w DYS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447112.1"
                     /db_xref="GeneID:2888516"
                     /db_xref="GOA:Q6FRN2"
                     /db_xref="InterPro:IPR002773"
                     /db_xref="InterPro:IPR029035"
                     /translation="MSAANDKLPDILQDAVLKASVPVPDDFVQVKGIDYSAATATDMR
                     ASDLVNSMKTMGFQASSLGKACDIIDEMRSWRGKHIDELDEHDRKGQFDDAGYQKTTV
                     FMGYTSNLISSGLRETLRYLVQHKMVDALVATAGGIEEDIIKCLAPTYLGEFSLEGKS
                     LRDQGMNRIGNLLVPNDNYCKFEEWIVPIFDKMLEEQEEYVAKHGKDCLDANTDVDSP
                     IWTPSKLIDRLGKEINDESSVLYWAHKNKIPIFCPAITDGSIGDMLFFHTFKASPKQI
                     RLDIVADIRKINSMSMEASKAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEFD
                     GSDAGARPDEAVSWGKIKAEAKSVKIYADVTIVFPLIVAATFANGKPLPKN"
     gene            <712654..>713490
                     /locus_tag="CAGL0H07271g"
                     /db_xref="GeneID:2888465"
     mRNA            <712654..>713490
                     /locus_tag="CAGL0H07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447113.1"
                     /db_xref="GeneID:2888465"
     CDS             712654..713490
                     /locus_tag="CAGL0H07271g"
                     /inference="similar to AA sequence:UniProtKB:Q06667"
                     /note="similar to uniprot|Q06667 Saccharomyces cerevisiae
                     YDR315c IPK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447113.1"
                     /db_xref="GeneID:2888465"
                     /db_xref="GOA:Q6FRN1"
                     /db_xref="InterPro:IPR009286"
                     /translation="MLVAEGGANILLELDHRGVLYRCNVRDKSLKVNNEYTYKNYRYI
                     NQVVRPLLGDCIPEMELVDIPYDRISGIIGDFVGDPDSDHVSALTIKNLRPTNVYGEK
                     IRYDDHFTKVYHDDTMEHILVEIKPKWLHHAKFCRNCTHNNLKNRKIPYCYALMVVDP
                     SHVSDMLLHTGIAFPRKFLIKFVDYFSKSDNILAKLHDIQKNLDSNVSMNDIKSIDDV
                     SDAFLLNMTLKDVSCFIEWTREPDSLEVNVVDVDMKLVSKLDHWVNTHIQLSNSSNLV
                     HH"
     gene            <713669..>715675
                     /locus_tag="CAGL0H07293g"
                     /db_xref="GeneID:2888568"
     mRNA            <713669..>715675
                     /locus_tag="CAGL0H07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447114.1"
                     /db_xref="GeneID:2888568"
     CDS             713669..715675
                     /locus_tag="CAGL0H07293g"
                     /inference="similar to AA sequence:UniProtKB:Q06665"
                     /note="similar to uniprot|Q06665 Saccharomyces cerevisiae
                     YDR314c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447114.1"
                     /db_xref="GeneID:2888568"
                     /db_xref="GOA:Q6FRN0"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:Q6FRN0"
                     /translation="MNNKRDREDELADLSAKRQSLNTGEETELFYDESSSSEESDIED
                     IDWEDIDLAGDITVKLKAPLHQNATNKRRRKDNFYHRLRYGLHIIAIPILVATLIKRT
                     NWTQDERLRRRLKRSVPKQITKKVKNWSKSSQDIRISSIRTLLLGLVMWFRANYQINS
                     NGFRQNFYRLHYIFRLDDGNVMKPYREACLRDQHKYYGERPDIAGNIEDIRTFVRNKK
                     ANRDYLTLFFITILREILPADQIKSLRLCFSLPLHNFQISPRNITKLASRDAGKVPNR
                     FDTDLLQPYFWIELHTIDEPDKLYVIDPVVHIEEGNIVKKYNIDEPVDIFEPIKDLNL
                     NVNQWFQYVISCDAKDMTIRDVSARYIPDIYYRYYDRTRGSVLETTRQSKSHHFFMRV
                     LKSTSRYRNDNTVLMKTIAAKNYKLPKSISELKRSPNFKGLRILKQSETVSSKAKPVG
                     KVQYGGKKDKIYRISDILPLKTRQHWYLLGRTVKEDAKPIRTKTIPLRKRNAISSAQE
                     LNFARELFSYEQTDLTPKYPSSYKDVYGIYHVVCDVDFYKNKYKNVEIYSKSVIPTGF
                     RLMRTFDKDYKFDLRRLIKNANVEKGKKGQKLIKYLDVVSGFDFRKGQATPIKTHILV
                     NYMDYRKILSLQKDYIELLRLESWSNFITRLKIKCELEDKYGKL"
     gene            <715930..>716766
                     /locus_tag="CAGL0H07315g"
                     /db_xref="GeneID:2888630"
     mRNA            <715930..>716766
                     /locus_tag="CAGL0H07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447115.2"
                     /db_xref="GeneID:2888630"
     CDS             715930..716766
                     /locus_tag="CAGL0H07315g"
                     /inference="similar to AA sequence:UniProtKB:Q06651"
                     /note="similar to uniprot|Q06651 Saccharomyces cerevisiae
                     YDR313c PIB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447115.2"
                     /db_xref="GeneID:2888630"
                     /db_xref="GOA:Q6FRM9"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM9"
                     /translation="MTRRCSVVNAGAIWKPDDDSKVCDKCGVRFTFLYRRHHCRCCGN
                     IYCHNCTHNFILYDTTRVRVVKNPESYWEYPPYRTCDTCFETLRSQNLISSKYHYEEI
                     PDADSNEPDDTSTDIADSTAGTTTTDTTDTTNTDSSMNHDSHAYEMNHCPLCNQDLRT
                     FPTEEDAQQHVERCITSAEQTQQHQEQESEEPPRCPTLQNRMLVYKIPTTTAPENEPQ
                     GYQECPICFEEMVPGEKVGRLECLCVYHYSCIKSWFRKKRKEMSVATARNFCPIHDAI
                     TL"
     gene            <718141..>718590
                     /locus_tag="CAGL0H07337g"
                     /db_xref="GeneID:2888576"
     mRNA            <718141..>718590
                     /locus_tag="CAGL0H07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447116.1"
                     /db_xref="GeneID:2888576"
     CDS             718141..718590
                     /locus_tag="CAGL0H07337g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447116.1"
                     /db_xref="GeneID:2888576"
                     /db_xref="GOA:Q6FRM8"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM8"
                     /translation="MTRVDPVSAMRLAEEIAKRQEVLIYTRYQNNIEYYRELQRQADE
                     MSVSDEVQSQISGVDDYLATTAKLYELSGNCKENKTHTNTNYDSNTQDKIARSPMPNV
                     NCIDGGCAIDKPHSDSKSTFTPSTYVSCPFPLQDPRFKVIDVFLNEN"
     gene            complement(<718943..>720580)
                     /locus_tag="CAGL0H07359g"
                     /db_xref="GeneID:2888510"
     mRNA            complement(<718943..>720580)
                     /locus_tag="CAGL0H07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447117.1"
                     /db_xref="GeneID:2888510"
     CDS             complement(718943..720580)
                     /locus_tag="CAGL0H07359g"
                     /inference="similar to AA sequence:UniProtKB:P11491"
                     /note="similar to uniprot|P11491 Saccharomyces cerevisiae
                     YDR481c PHO8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447117.1"
                     /db_xref="GeneID:2888510"
                     /db_xref="GOA:Q6FRM7"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR018299"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM7"
                     /translation="MIRNTERESLLTSQNKRHKKYFKYGLKYILTTVLVFFTFLHIWY
                     PDVISESLHWNSHAKKKNVIFFVTDGMGPASLSLTRSYRQYVQGLDIDDILELDRHLI
                     GSSRTRSYNSLVTDSSAGATAFSCGMKTYNSGTGVGPDKTPCGTLLEAAKLKGYLTGL
                     VVTTRLTDATPAAFSSHVDYRFQEDQIAEQQLGNYPLGRMVDLMMGGGRTHFYPSGTN
                     DPRYGRRGLRQDDRNLIEEAIENGWQYAGNRNDFDDLKMGKNVTLPLLGLFADFDIPF
                     EIDRSDKEYPSLEEQTITALTALNDASKHSDKGFFIMIEGSRIDHAGHQNDPAAQVRE
                     VMAFDKAFKAALEFAKESDTETVIISTSDHETGGLVTARQVTVSYPEYVWYPEVLFNS
                     KHSGEYLKHKIANYKGNDKKRFIEKEVFEKIMNIGDYSDSDVEDLSNMTNVEDIQYKL
                     NDMISFRAQIGWSTHGHSAVDVNIYAYSNRPKSWQYLLSKLQGNHENIEIGHFMRDYL
                     ELDLEEVTKRIKDTDHSPRKQGNIYIDEYHPASTVGI"
     gene            complement(<721553..>721984)
                     /locus_tag="CAGL0H07381g"
                     /db_xref="GeneID:2888541"
     mRNA            complement(<721553..>721984)
                     /locus_tag="CAGL0H07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447118.1"
                     /db_xref="GeneID:2888541"
     CDS             complement(721553..721984)
                     /locus_tag="CAGL0H07381g"
                     /inference="similar to AA sequence:UniProtKB:Q03375"
                     /note="similar to uniprot|Q03375 Saccharomyces cerevisiae
                     YDR482c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447118.1"
                     /db_xref="GeneID:2888541"
                     /db_xref="GOA:Q6FRM6"
                     /db_xref="InterPro:IPR013170"
                     /translation="MGRGVGLQSAKGSSTSGYVQRSLAHDNRDDKTGIVRLKNKNYEL
                     RKITKRSQKVDKPANESKDNGLKKVLVEHDKRREIEVQVSELRDSLEDKQDRNPDEWP
                     DKRIDEECEKLRSTLLADLQEKEKYQKAYTPRSKRSSESSK"
     gene            <723340..>724731
                     /locus_tag="CAGL0H07403g"
                     /db_xref="GeneID:2888463"
     mRNA            <723340..>724731
                     /locus_tag="CAGL0H07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447119.1"
                     /db_xref="GeneID:2888463"
     CDS             723340..724731
                     /locus_tag="CAGL0H07403g"
                     /inference="similar to AA sequence:UniProtKB:P27809"
                     /note="similar to uniprot|P27809 Saccharomyces cerevisiae
                     YDR483w KRE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447119.1"
                     /db_xref="GeneID:2888463"
                     /db_xref="GOA:Q6FRM5"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM5"
                     /translation="MAIFLSKRLIRLCAMVTVLLLLLATLNTHQSSSQYVSGYLPSQL
                     RLPDSSNFGFPSGGASDVTVGQTTELEDPTKELEAARAKADKDTDAGNISNPDEKAPG
                     DSGKALEQAANAEAAVKDMTKKDIEEYLAPSFANKGKRPKAAFVTLIRNRELNDILEP
                     MNMVEKRFNKNYHYPWVFLNNEPFTEEFKETVKKHASGEVIFDLIPKEHWGYPDYVDQ
                     DKAAIERKKMADKNIIYGDSESYRHMCRFQSGFFWREKALEDFDWYWRVEPSTKIYCD
                     IPYDPFQYMQDNKKAYGFTITIHEYRSTIESLWKTVKNFIKDFPQYLAKDNLEKFVSE
                     DNLEEYNLCHFWSNFEIANLNVWRSPAYRDFFDYLDKTGNFFYERWGDAPVHSIFVSL
                     FLPKSYLHYFNDFGYYHPPYNHCPIDNEIFRDRNCDCTQKDDFTFKGYSCGIQYHNAQ
                     GIKKPSNWEDYSD"
     gene            <725307..>726449
                     /locus_tag="CAGL0H07425g"
                     /db_xref="GeneID:2888766"
     mRNA            <725307..>726449
                     /locus_tag="CAGL0H07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447120.1"
                     /db_xref="GeneID:2888766"
     CDS             725307..726449
                     /locus_tag="CAGL0H07425g"
                     /note="highly similar to uniprot|P33313 Saccharomyces
                     cerevisiae YBR155w CNS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447120.1"
                     /db_xref="GeneID:2888766"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM4"
                     /translation="MSSTKKEYKKPQKYVPGINDPILPPQLAEFQDKSTDEVLTELNR
                     MPFFMTKLDNSDGDGGENVELEALKALAYEGEPHEIAENFKKQGNDLYKVKRFRDARE
                     LYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIA
                     KAFTALERLDEALESIEFGEKIDNTNKSLKTLKLHIETKQLEIEARRLKLENEKKERE
                     NYQFILNSAIELRNITNIKTSKPAELLREASIKLENPLELESQLIIPAVVLFPLSDEF
                     DFIAEVGELSTVQDVIDILMERPPEWFERPEHKGYSSKSLLAFMETEGGGLVKAGKKL
                     TFHDILRKEKPNVPLFDSALKVFLVPKDQSDDWLSKWDKEKALARR"
     gene            complement(<726654..>728834)
                     /locus_tag="CAGL0H07447g"
                     /db_xref="GeneID:2888434"
     mRNA            complement(<726654..>728834)
                     /locus_tag="CAGL0H07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447121.1"
                     /db_xref="GeneID:2888434"
     CDS             complement(726654..728834)
                     /locus_tag="CAGL0H07447g"
                     /note="weakly similar to uniprot|P38283 Saccharomyces
                     cerevisiae YBR156c SLI15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447121.1"
                     /db_xref="GeneID:2888434"
                     /db_xref="InterPro:IPR005635"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM3"
                     /translation="MDWAINAAKKKTKAIPGGSRSIIESLNKLNNISCDGQDAINEIL
                     SDIDFSLLGISILPADKNRSLIIKTKNIEHLDTKPDSKDDNSTRNELKSIEVNPLSED
                     NSTVFNVKATLSSAAPKKNKDLVNTPIKRESGIPSITPKSMSIEKKDENGLTSNDVTI
                     ANSSSLKEKDSKSGSPTKSEWSPFKSNKSFSNLSSNINETLKHQNHNIIDTHNQTTTK
                     EGEDTSILSNNDKNKAESETKISSKSFTNKERVLRKRSNMFIPLPTKETYVIKSSPDK
                     QSNNQEVSKLGSMSKSNKLHNLKSEMPLTIKDVRLDSSKQNLNESSEKNRKISASDNV
                     FERLAKVPTKSFEKKITKTYKPYSDSKSMYSPTRKRNSLAGKGIIKTTSGQVDTSMNE
                     TLKGIFELNSPKTLLSNDSKAQIVSSSTSIATNKGMRKSLQPRIDVKSLSTVTSRLIP
                     NGRSELNDGNNKVNLHSNKSSHGIYLNKMKPTERLTPIRIKSGNTITSPTESSLLKLS
                     NRGSPKRVAKLHHKLDSKDPAKHKNDRLTNFQLLPSLESKKNELKKKLNKRLSEVMRS
                     QQDHHRRRTELQKRKSQIYEDLKKRTKPASEIKDSNKKNVDTSLDGSNFIRYRDKTHN
                     DTNSEMKGILDTINTVDHRIIIGESTRNQEENVGDATLPEIYSDSEADDTLVLATWAE
                     TANLKKALVDQAGLDPNDIFGPAYPLKPEEIFSPTRMAKLKSKH"
     gene            complement(<729381..>730061)
                     /locus_tag="CAGL0H07469g"
                     /db_xref="GeneID:2888774"
     mRNA            complement(<729381..>730061)
                     /locus_tag="CAGL0H07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447122.1"
                     /db_xref="GeneID:2888774"
     CDS             complement(729381..730061)
                     /locus_tag="CAGL0H07469g"
                     /note="weakly similar to uniprot|P34756 Saccharomyces
                     cerevisiae YFR019w FAB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447122.1"
                     /db_xref="GeneID:2888774"
                     /db_xref="GOA:Q6FRM2"
                     /db_xref="UniProtKB/TrEMBL:Q6FRM2"
                     /translation="MKSYLPQFSFESKEKSPSESKRRNRGIVDRLKKFNFPQVQSNDK
                     SQNLGNSHPPDDRVTIRTISNDSADDHRVFSNYTYSTRDSFPSSHSENYELPKTPPPI
                     TPSGSPRRYKHRKSNAISVSTPEELYLPKTPDHNSDIYREDEGVFYLSSPTSDIISYK
                     HQLSPETTIRDTKEQLRRNTVVGVANSLTEFAEKNRLDISGKVFADINDTPPPLIDLG
                     KITENLNE"
     gene            <732854..>734389
                     /locus_tag="CAGL0H07491g"
                     /db_xref="GeneID:2888591"
     mRNA            <732854..>734389
                     /locus_tag="CAGL0H07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447123.1"
                     /db_xref="GeneID:2888591"
     CDS             732854..734389
                     /locus_tag="CAGL0H07491g"
                     /inference="similar to AA sequence:UniProtKB:P38285"
                     /note="similar to uniprot|P38285 Saccharomyces cerevisiae
                     YBR158w CST13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447123.1"
                     /db_xref="GeneID:2888591"
                     /db_xref="GOA:Q6FRM1"
                     /translation="MVLPDSNIMKNGSIKRLRDSQIENSPYSRPIKKITPNSSHEDLS
                     ATISNEGSLNFTPRTSRQESLYNMKKIFQKTYSQTKLGLFSSKKQVNTLETAIPTTPK
                     QQLPTPTTSPEKNNILWSTPNSLTSLRTISNDLDDCRNRNLITDFSELSIINSSSSSI
                     YSTQQSHPIFEIPEIVDNIVKQLYLIENEQDLLNGHHKKDVNRENTSTVVSCLAVSKT
                     WNKVSKGYLMRDLKFTKSTSLTNFLSQCSTKKTTPQSLILHKMSDINNNNSRGLEIII
                     DPKQLRHLEYYVCPNILPPVNWFQSLTKLEKLILPGNKLINDSYLIQICRYLPNLKVL
                     DLRACDNITDAGIVAVGTHCKQLVSCNIGRHRNGSSITGLSVVALAKNTMIRTLGLAG
                     CDITDASMWELAQKCGKNIERLSLNNCNKLTNFSLPMLFAFNYFPNLNVLEIQNIAKI
                     TDVRHMVRYKIWKRSQRIPILIKGCDRITKLIHEEERQIKAQSLKTARKDMTLWVNQL
                     ENE"
     gene            <734835..>735893
                     /locus_tag="CAGL0H07513g"
                     /db_xref="GeneID:2888772"
     mRNA            <734835..>735893
                     /locus_tag="CAGL0H07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447124.1"
                     /db_xref="GeneID:2888772"
     CDS             734835..735893
                     /locus_tag="CAGL0H07513g"
                     /note="highly similar to uniprot|P38286 Saccharomyces
                     cerevisiae YBR159w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447124.1"
                     /db_xref="GeneID:2888772"
                     /db_xref="GOA:Q6FRM0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR027533"
                     /translation="MTFVRELEVASQNSRAFNVTLWFIFIFGLLKLVPFALRFLSMVF
                     DLFVLPPVNYAKYGCKAGDYAVVTGASDGIGKEFASQLASKGFNLVLISRTESKLVAL
                     KDELEGKFNIKAKILAIDISADSKDNYNKIYSLCDDLPISILVNNVGQSHSIPVPFLA
                     TEEEEMRNIITINNTATLMITQIIAPIIIRTVKKHRESGDKKLKSQRGLILTMGSFGG
                     LIPTPLLATYSGSKAFLQNWSSSLAGELAADNVDVELVLSYLVTSAMSKVRRTSMMIP
                     NPRTFVKSTLRNIGRRCGAQDRYGTITPFWSHAIYHFVIEELFGVYARVVNEINYKFH
                     KSIRIRAVRKAVREAKQN"
     gene            <736241..>737137
                     /locus_tag="CAGL0H07535g"
                     /db_xref="GeneID:2888771"
     mRNA            <736241..>737137
                     /locus_tag="CAGL0H07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447125.1"
                     /db_xref="GeneID:2888771"
     CDS             736241..737137
                     /locus_tag="CAGL0H07535g"
                     /note="highly similar to uniprot|P00546 Saccharomyces
                     cerevisiae YBR160w CDC28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447125.1"
                     /db_xref="GeneID:2888771"
                     /db_xref="GOA:Q6FRL9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL9"
                     /translation="MSSELANYKRLEKVGEGTYGVVYKALDLRPGKGQRVVALKKIRL
                     ESEDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVLEFLDLDLKRYMESI
                     PKDQPLGVNIIKKFMVQLCKGIAYCHAHRILHRDLKPQNLLIDKEGNLKLGDFGLARA
                     FGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIGCIFAEMCNRKPIFSGDSEI
                     DQIFKIFRILGTPSEAVWPDIVYLPDFKPSFPQWRRKDLAEVVPSLDPHGIDLLDKLL
                     AYDPINRISARRAANHPYFHEQ"
     gene            <738086..>739516
                     /locus_tag="CAGL0H07557g"
                     /db_xref="GeneID:2888469"
     mRNA            <738086..>739516
                     /locus_tag="CAGL0H07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447126.1"
                     /db_xref="GeneID:2888469"
     CDS             738086..739516
                     /locus_tag="CAGL0H07557g"
                     /note="some similarities with uniprot|P32805 Saccharomyces
                     cerevisiae YGL254w FZF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447126.1"
                     /db_xref="GeneID:2888469"
                     /db_xref="GOA:Q6FRL8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL8"
                     /translation="MSYNQGKEFITELGKTPMKYIIEPTVGLANNLTPHGDTVVDEAK
                     KAKKGRTKSGRKYVCQIDGCKREFSVPSLLAQHRNAHTDERPYVCDEPNCGKRFLRPC
                     HLRVHKWTHAQVKPLKCSYCERRFITNQQLKRHTNTHERRIAASKKKETEAAMRMMVG
                     LPPKNNKPKKSPTTTLLNEANETNGTVNGAANGTTNGVINGTDGVANGTANDTANGVT
                     NGVTNGVTNGVANGVANSITNGNDIVNGNNYNTDKFDDNGLNGLATGIHTINLQDLGF
                     SDINGYRLNNTSLLSDPVIDVDGNGLRFRIKCPYFDCDAILGPNEDIMNHLLEMHLVS
                     RLEKDPTVDGELFYSPNSVVNNSLSLSDTATSPSSDGKSDTSYLLDGRIQDKTDDKCF
                     SETIPNDISYYRNNETVLNISDHEEASSWNDLRCREAHCKDLPKFNNVFVLIEHYDQD
                     HAFIPESLVKFGYLHLYAPDVQDGVL"
     gene            <740607..>742067
                     /locus_tag="CAGL0H07579g"
                     /db_xref="GeneID:2888498"
     mRNA            <740607..>742067
                     /locus_tag="CAGL0H07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447127.1"
                     /db_xref="GeneID:2888498"
     CDS             740607..742067
                     /locus_tag="CAGL0H07579g"
                     /note="highly similar to uniprot|P04807 Saccharomyces
                     cerevisiae YGL253w HXK2 or uniprot|P04806 Saccharomyces
                     cerevisiae YFR053c HXK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447127.1"
                     /db_xref="GeneID:2888498"
                     /db_xref="GOA:Q6FRL7"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL7"
                     /translation="MVHLGPKKPPARKGSMVDMPKDLLDEIKKFEDMFSVDAATLQKV
                     TKHFISELSKGLSKEGGNIPMIPAWVMENPTGKEKGDFLAIDLGGTNLRVVLVKLGGD
                     RTFDTTQSKYKLPGPMRTTKDPEEIWSFIADSLETFIKEQFPEGCNETLPLGFTFSFP
                     ASQDKINQGVLQRWTKGFDIPNIEGHDVIPMLQKQIEKRNLPIDIVALINDTTGTLVA
                     SLYTDGETKMGVIFGTGVNGAYYDVVSDIPKLEGKLADDIPSSSLMAINCEYGSFDNE
                     HVVLPRNKYDIAIDEESPRPGQQTFEKMSSGYYLGELLRLALLDLYNQGLIFKGQDVQ
                     KLKEAYIMDTSYPSRIEDDPFENLEDTDELFQADLGIQTTVQERKLIRRLCELIGTRS
                     ARLSVCGIAAICQKRGYETAHIAADGSVFNKYPGFQQRAAEGLRDIYGWKEDKPQNYP
                     IVIVAAEDGSGAGAAIIAALAQKRIAEGKSLGVIGA"
     gene            complement(<742499..>745768)
                     /locus_tag="CAGL0H07601g"
                     /db_xref="GeneID:2888441"
     mRNA            complement(<742499..>745768)
                     /locus_tag="CAGL0H07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447128.1"
                     /db_xref="GeneID:2888441"
     CDS             complement(742499..745768)
                     /locus_tag="CAGL0H07601g"
                     /note="weakly similar to uniprot|P51979 Saccharomyces
                     cerevisiae YGL251c HFM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447128.1"
                     /db_xref="GeneID:2888441"
                     /db_xref="GOA:Q6FRL6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL6"
                     /translation="MEYTLLANCFYNRLKNSKRDVYLKYKTENSIREKFKFSTYNPIL
                     DDSDNDQDLGDDYNMNSLFGQSNLSVGTEDTFTTSNDRLNTNDITALKPIKRGRVTVR
                     RSVNGKSGNPPGQIPEKWREYFDFDEFNKIQSICANKLYEKNNSFVINTPSNSGKTVL
                     LEISILKALETYEQQNNTGLKVIYISPMKSICLEKYNRWKAKFTNLKVQLITSDMNHF
                     EKNTIGNANIIVATPEKIDLICKKWGDYLTFLKFVNLLLIDDIHFLKEERGAVLEVVI
                     TRITQNASNLRVIALCTNTGNIDDICCWLNSTHLINKANSLDFSASHGHIRERTKVIG
                     IRSYTPWKETNNSKFNKALFDIIKAQCESKPTIIFCPTKSSAARTAISLCGMSVTTIK
                     KSSTNISFRNTDLQNCYKNSILFYHAGLHIDDRKEVEKNFANGDIQILCCTSKLDIGN
                     NLPVYLVVINGTSTWKDDRLSEYSSFEILQMIGRTEGFKYDGIGGKAIILTDDSRIKF
                     YQNLIDKNITVESSLHNKIIDFILAEVSLGNIKSVNDIGEWINATFMVQRYCKNVDHY
                     MPALQRQGLISLGNISSPIFYEKIIQSLQTLSLIFVNKGNISSTLIGSAMSRHCIDFK
                     TMKSLITAAPKNTVKAILKIVSKVEVFSIYRVRLNEKATLKELNNSQIWFRLLTEGGK
                     PQIIDQPWQKIFLLIQYNLSKPKSQLLVRLTPKLIYELCSIERHFIRVLKCLIDIFIA
                     KNDGISLKNALFVLRSLNVGCWESTPYILKQVKGMSINAVEKLSKMGINSLQQLTSMN
                     REQLELYLGLKPGAGTKLLDEIRRLPILSFHYQAFIDDKNSLNISPYISAKVAKPIGK
                     SNEISVNFLALDKNGHLIDFRRFPMILLNKEQSFTIMVDLTRVNEYIELILNVEEIPG
                     IGLSRILKLESITENISGTKQQIITNSNKIIANSNDELEMDSNLSDLEILELVPSDPN
                     NEDLSLPEEQHQKESNNQQVNNFDGIASKNFKQHPYHNKSKQFYKQTHWDAPYEGKSF
                     STADMNTIKNDVSNHKRHRIFPSSQSNDFDSDMEDKNFVELSRDIQTELAFLGSDIDL
                     Q"
     gene            <746280..>747146
                     /locus_tag="CAGL0H07623g"
                     /db_xref="GeneID:2888487"
     mRNA            <746280..>747146
                     /locus_tag="CAGL0H07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447129.1"
                     /db_xref="GeneID:2888487"
     CDS             746280..747146
                     /locus_tag="CAGL0H07623g"
                     /note="some similarities with uniprot|P53060 Saccharomyces
                     cerevisiae YGL250w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447129.1"
                     /db_xref="GeneID:2888487"
                     /db_xref="GOA:Q6FRL5"
                     /db_xref="InterPro:IPR018822"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL5"
                     /translation="MSIEEMNGQRMIVELEESKSPSEQGQQEEAGSLNVELGGDSDGV
                     DVRDSVLVEDADDDLLSSSGSDDRRLFVQDPRDDDYLRTIAEGLVQRKENPYVEVRYE
                     RDVYPLFDDHSSLEHDVAIENYRQCVCKDPAMLQRSFSEFMAHLRSFLESRHGRLKFA
                     SQEILLSIVPLDLVVCEDNVYNSQISLADVVNIFEILQTRSREAEEREIPKHLDMEVS
                     TRPRFVSRYNTLVELTEGKATLSNVRPFSNDESHPLVLDDDQPVKVINSKQNTSTVDN
                     NDSDELLEILSE"
     gene            <747508..>749538
                     /locus_tag="CAGL0H07645g"
                     /db_xref="GeneID:2888864"
     mRNA            <747508..>749538
                     /locus_tag="CAGL0H07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447130.1"
                     /db_xref="GeneID:2888864"
     CDS             747508..749538
                     /locus_tag="CAGL0H07645g"
                     /note="weakly similar to uniprot|P53061 Saccharomyces
                     cerevisiae YGL249w ZIP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447130.1"
                     /db_xref="GeneID:2888864"
                     /db_xref="GOA:Q6FRL4"
                     /translation="MCIPENMWTPPTLPLPLQSFPKENIPIDKRTQKCLLQIKKLCST
                     QFSLNKEYKSTFNLIDYKLQRIIQPHNLSVNPINSFWPHTVERLVVPPIYYEMLSNQQ
                     IYTLDYLQINPQYHIPIKSVQKSKQKAFQLNLLPLPRQKFRQIQLESYMPSKLESKMT
                     SICEESLPKTVIFDYHGYFDLKQKLLTSNTLLTARLNPISTSAGCRQKLKFTTHWPSW
                     TIEINTDISNISRLHKVLFDENFNKIELFKLASCNLKVERSTRIKKNHIATWKLDKLQ
                     LKELDWDPLKKLKAYSVQKKINCDEVHAQATFIITPLKLVLMPINSSEIHILQNNYGN
                     IVISAKSFGNLQPKNTIESSQVSNNNTKLLKEARTTGSSMSDRSTSITSYKCSSLVPE
                     KRSLLDSNLISIVQLKKLRTSYPQSTESHSGEMSLLRLLHSNSCKTEIQQIDTWYDTA
                     KLNTTPKTTSFKLEGQDIKKKVSIIANEYDISTTYQITRLLRERQYSNIEEYRIKLPC
                     HFILSFSSCLLLVEISKVFQCITAGELFLERTLSILIKHFRVVHVFIEYEPNTELYDK
                     DIFWKAKLILNNPQVRTIFIPKFSNNLTTWMLRVTTIQGQKFQEMVKDNTLSHFNINP
                     YQEYLIQEKLRESSPSRLIETLVFGDHVLDGILTPIHINSLKIFARENWHLT"
     gene            <750319..>751419
                     /locus_tag="CAGL0H07667g"
                     /db_xref="GeneID:2888509"
     mRNA            <750319..>751419
                     /locus_tag="CAGL0H07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447131.1"
                     /db_xref="GeneID:2888509"
     CDS             750319..751419
                     /locus_tag="CAGL0H07667g"
                     /note="weakly similar to uniprot|P22434 Saccharomyces
                     cerevisiae YGL248w PDE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447131.1"
                     /db_xref="GeneID:2888509"
                     /db_xref="GOA:Q6FRL3"
                     /db_xref="InterPro:IPR000396"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR024225"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL3"
                     /translation="MTFTFEVTILGGSGGPIENDCQSFLIRPYGSDVVDSICVDAGTG
                     LGSLYNLVAQIGTSDEAKVNDYYNQNVTTRKVFNDVNVAYTNGFSSSLKKVLSEKYQN
                     LNHWETTILLYNGIRDYYITHPHLDHIAGLIINSPLAYEISFGTSKNVYGLTSTKEAL
                     TDHIFNDTIWPSLNKLKYPKINLNALKQCRTHDIANFPWTTTPFKVNHGCGACNGEPN
                     HSTIYCIRHNRTSEAIVVCGDLENKASIDTLDSYLQTFTNWLTNNILAENFKGILIEC
                     SSQTVPDGTPLFGHLSPPHLISLLKLLLKKYNDIDQTISELNVIVTHVKYTCGNEDPR
                     LTVLSELRNLAKFNNLHNLNFSYASQGTTYYL"
     gene            <751810..>752349
                     /locus_tag="CAGL0H07689g"
                     /db_xref="GeneID:2888462"
     mRNA            <751810..>752349
                     /locus_tag="CAGL0H07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447132.1"
                     /db_xref="GeneID:2888462"
     CDS             751810..752349
                     /locus_tag="CAGL0H07689g"
                     /note="weakly similar to uniprot|P53062 Saccharomyces
                     cerevisiae YGL247w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447132.1"
                     /db_xref="GeneID:2888462"
                     /db_xref="GOA:Q6FRL2"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL2"
                     /translation="MPLAELDKSCDSKGTPLHGSTKKNGNARRGILNKPVYLIACMVV
                     AIGSICLIIAFMKEIRKDVDVKLEIEMLQHLRKIDQCKYNYRINECDPGVRVRALDKL
                     CEEWYECMTVGDALSKNSKFTKKRAALWAETLGEILNAFMNSIKIKTWGLLMISITMS
                     ILAINVSAAVIKNLTNSEQ"
     gene            <752900..>754600
                     /locus_tag="CAGL0H07711g"
                     /db_xref="GeneID:2888764"
     mRNA            <752900..>754600
                     /locus_tag="CAGL0H07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447133.1"
                     /db_xref="GeneID:2888764"
     CDS             752900..754600
                     /locus_tag="CAGL0H07711g"
                     /note="highly similar to uniprot|P53064 Saccharomyces
                     cerevisiae YGL244w RTF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447133.1"
                     /db_xref="GeneID:2888764"
                     /db_xref="GOA:Q6FRL1"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL1"
                     /translation="MSDLDEDLLALAGADEEDEEEVLTTTNKRTKGSSNSQVKKRRIE
                     VDSEDEEDDYNPDDGYEPVDVSDKEEEEEEENPFPLEGKYKDTADRDHLESLPEMERE
                     TILFERSQVMRKYQERKLFRERGRNLKQQKIQAGEDSQKTRSSNRSTRATGHSDIKAS
                     KLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEFKDDFIEEDSDYKENDDDEEGYDP
                     YARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKIRIGRSFVAKYCFYPGFNELIQ
                     GCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMN
                     FFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEFISQPLTEKLTDEIVRN
                     RMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLRNFEKRMAMYEKHHE
                     NDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFSRLKTRTKVYYQE
                     IQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKIIGSINVDIKLDI
                     "
     gene            <754933..>756090
                     /locus_tag="CAGL0H07733g"
                     /db_xref="GeneID:2888459"
     mRNA            <754933..>756090
                     /locus_tag="CAGL0H07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447134.1"
                     /db_xref="GeneID:2888459"
     CDS             754933..756090
                     /locus_tag="CAGL0H07733g"
                     /inference="similar to AA sequence:UniProtKB:P53065"
                     /note="similar to uniprot|P53065 Saccharomyces cerevisiae
                     YGL243w TAD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447134.1"
                     /db_xref="GeneID:2888459"
                     /db_xref="GOA:Q6FRL0"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:Q6FRL0"
                     /translation="MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAV
                     IASDTRTDKHSILTITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKR
                     SMEGIESNLIHNTPNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEED
                     DNQQYITPEIKTILRGRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNS
                     LTSYMMPTPLYISNYVIPNINSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDL
                     SPETPPSSMSALKILFNDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSL
                     FITMHREFKDLTYLEFKRRYCAERAELIRSIKSSLSSDGWLSTAEDDCQLP"
     gene            complement(<756294..>756812)
                     /locus_tag="CAGL0H07755g"
                     /db_xref="GeneID:2888559"
     mRNA            complement(<756294..>756812)
                     /locus_tag="CAGL0H07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447135.1"
                     /db_xref="GeneID:2888559"
     CDS             complement(756294..756812)
                     /locus_tag="CAGL0H07755g"
                     /note="highly similar to uniprot|P53066 Saccharomyces
                     cerevisiae YGL242c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447135.1"
                     /db_xref="GeneID:2888559"
                     /db_xref="GOA:Q6FRK9"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK9"
                     /translation="MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINT
                     SKDPLGNTALHLCCKYGSWEVLDTILDQEGGIDIDPQNVDGDTPLHVTVRYCDEEPEH
                     GLFIARNLIEVGADPRIKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDGDEGDE
                     PELIDDDDGEED"
     gene            <757134..>760199
                     /locus_tag="CAGL0H07777g"
                     /db_xref="GeneID:2888545"
     mRNA            <757134..>760199
                     /locus_tag="CAGL0H07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447136.1"
                     /db_xref="GeneID:2888545"
     CDS             757134..760199
                     /locus_tag="CAGL0H07777g"
                     /inference="similar to AA sequence:UniProtKB:P53067"
                     /note="similar to uniprot|P53067 Saccharomyces cerevisiae
                     YGL241w KAP114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447136.1"
                     /db_xref="GeneID:2888545"
                     /db_xref="GOA:Q6FRK8"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK8"
                     /translation="MVSPEFQLLIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLI
                     ELGENNQTPLASRLFSLLSLRKFITMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSL
                     DDQQSNKVRNSSSYCVVQISAVDFPDEWPQLLSTLYNAITQNHSLNAMSLLNEIYDDV
                     ISEEMFFEGGIGYETLQIIFTLLTNAQVRLASKTSALKLFGACISQMSVLDNNSSQKR
                     KLLVSECLGQALQTIKLLLEQCEIIQSDLTSINETLEFKDNLYDDINSIKENFPRKFF
                     PEDVNLYVTNIAVRDLDQLAGLYQESFKDNFDEQSMSIFENCVIHLLDFLANPISPLN
                     NELISNILTASITLCEQSALTKDSWESDFNEFASKETGLSASFTIRDEVAELVNAFEI
                     PQLETSFELIVGYLSNNSSHLSADKIESALYLLQCLMNVEDDFSNTSLVPSLIEFIKS
                     MLSQQNNLDQMSQIRLLLLIPKTLAKFMDILPNVKQLTAETLNEILSMATNSNSHLII
                     ISALISFTYFASYAEILSVLGNDQTLLVQNKTLHLIQEISEESTEDTNGLLMEVLNCV
                     IDCNDKNVANMELFKFEFKLILVISGKDPANIQVSIESQECLEKLLLNVNTNDYLSFV
                     DICIPSFINIIKSSEVTNYSYSPLLSLVLEFITVFMKNKPQEALLPSSVSEYVFDPLV
                     SCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKLETIVNILDRLLSSNISDSAAMNV
                     GTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNITTQQNLVTLLCFLVCHDPKQTV
                     DFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIKENIVALSQLFLLGDDRVNE
                     VKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMFLGELGFQGRNKNPEELL
                     TTDDMKGMGLKPNQQSNNDEGDDDWEDVDDVVDYEKLQEYIDDEDDLDDNSVGELETI
                     TGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERKCISELIL"
     gene            <760514..>761302
                     /locus_tag="CAGL0H07799g"
                     /db_xref="GeneID:2888467"
     mRNA            <760514..>761302
                     /locus_tag="CAGL0H07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447137.1"
                     /db_xref="GeneID:2888467"
     CDS             760514..761302
                     /locus_tag="CAGL0H07799g"
                     /note="some similarities with uniprot|P53068 Saccharomyces
                     cerevisiae YGL240w DOC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447137.1"
                     /db_xref="GeneID:2888467"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK7"
                     /translation="MISEYNRREEQSKNSNNSKWKDFLQRLGPDSAIKPVKLPHQQKK
                     LVLDEALFNQNPNVYVNGILNETNQEGEQHADTIADRYRVGLQLLNNNDYTNVTSLAY
                     WKASSCKTGNPITNAIDDSFENYWQSDGIQPHTVDAYFSKRMDIVLIGIFFTITADES
                     YTPRVIHIFAGNSPSDAVFYKTLIVNNMNGWAALTFEDNLPVEKLLKCQYLRFKFPVN
                     HENGKDTHLRGIRVYTASNNQCKPQLETIKLQPVLPELDSFGLR"
     gene            <761870..>764755
                     /locus_tag="CAGL0H07821g"
                     /db_xref="GeneID:2888710"
     mRNA            <761870..>764755
                     /locus_tag="CAGL0H07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447138.1"
                     /db_xref="GeneID:2888710"
     CDS             761870..764755
                     /locus_tag="CAGL0H07821g"
                     /note="highly similar to uniprot|P33307 Saccharomyces
                     cerevisiae YGL238w CSE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447138.1"
                     /db_xref="GeneID:2888710"
                     /db_xref="GOA:Q6FRK6"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK6"
                     /translation="MSDLETVSKYLAESVVASTSKIAEKNLKQLENEDGFGLTLLHIV
                     ASSNLPIATRLAGAVFFKNFIKRKWIDENGVHLLSPSNVELIKNEIVPLMIALPGNLQ
                     VQIGESISVIADSDFPERWPTLLDDLVSKLSTDDMVTNKGVLTVAHSIFKRWRPLFRT
                     NELFLEIKLVLDKFTEPFLNLMKSVDEQITHKKDDKASLELLFDVLLLLVKLYYDFNC
                     QDIPEFFEDHIREGMGMWHRYLSYENPLLEDNFDTETASTLIKVKTSIQELVQLYTTR
                     YEEFFEPMINEFIQITWSLLVSTPNQPKYDILVSKSLSFLTAVARIPKYFEVFNTDSA
                     MHSITEQIILPNYTLREEDVELFEDDPMEYIRRDMEGSDSDTRRRATADFLGELKEKN
                     ENLVTSIILEHVKKFHDQYSTNPQEFWKYKDLYINLFTSLAVKGNITNSGVSSTNPLV
                     NVIDFFTIQILPDLMAGSLPHPILRVDAIKFVYNFRNQLNKQQLIEILPILANFLLNG
                     EYLVFTYAAITIERILAIRETPSSPVFIFNKNDLSGSADVLINNLLTLIKKQGSTPEQ
                     LAHNEYLIRAVYKVIQTAEETISPMYPELINQFISIVDIVAKNPSNPRFSHYLFESIA
                     VILNYNPNSTLPQIIDHIMPSFMHILSEDIQEFIPYIFQIIAYAVESMPQISESITAL
                     SQPILAPAVWELKGNVPAVTRLLKAFIKKNYKIFPDLIPVLGIFQRLIASKAYEIYGF
                     DLLECIFLSIDLEVLKPFMKQIAILLLQRLQSSKTERYVKKLTVFIGLILYKFGPDFL
                     ILFIDEVQDGLFGQIWGNFIITTLPNIGNLLDRKISLLGMNSIIGTQSNFQSKYSSLI
                     TPTLASVVKTITSDSAANAGNNFVDLDNIEEVSTFGSHFSKLGSISEKTFDPAPEIDN
                     NDGVKVFVLQTLKKFNDSSNNLVINSISTELSEETQNKFNQLWSQSQ"
     gene            complement(<765236..>766126)
                     /locus_tag="CAGL0H07843g"
                     /db_xref="GeneID:2888858"
     mRNA            complement(<765236..>766126)
                     /locus_tag="CAGL0H07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447139.1"
                     /db_xref="GeneID:2888858"
     CDS             complement(765236..766126)
                     /locus_tag="CAGL0H07843g"
                     /note="some similarities with uniprot|P06774 Saccharomyces
                     cerevisiae YGL237c HAP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447139.1"
                     /db_xref="GeneID:2888858"
                     /db_xref="GOA:Q6FRK5"
                     /db_xref="InterPro:IPR001289"
                     /db_xref="InterPro:IPR018362"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK5"
                     /translation="MSRREVIYSETMNLQNVHPPSSIVGGTSNASPAGTDLYTSNPDD
                     NESQAPTNEELYLYNELKRVSENVDSDNLEGKQQEDTGVPQNIITKQYVQTIPRTALD
                     NESNNGNIKMESEPPINSTTRVPDNKNTHINGKEKNYKFDGPQRSSTNDNVRKSVPKN
                     YENPSNKFSTEIPESNLPKEESTSEQPYYVNAKQYYRILKRRYARAKLEESLRICRER
                     KPYLHESRHKHALRRPRGEGGRFLTAAEIKELKEKGELKDTEKTKSQSDAEKSIDTNA
                     DIVNSQKSGASTGDLDTKKD"
     gene            complement(<766917..>768908)
                     /locus_tag="CAGL0H07865g"
                     /db_xref="GeneID:2888796"
     mRNA            complement(<766917..>768908)
                     /locus_tag="CAGL0H07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447140.1"
                     /db_xref="GeneID:2888796"
     CDS             complement(766917..768908)
                     /locus_tag="CAGL0H07865g"
                     /inference="similar to AA sequence:UniProtKB:P53070"
                     /note="similar to uniprot|P53070 Saccharomyces cerevisiae
                     YGL236c MTO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447140.1"
                     /db_xref="GeneID:2888796"
                     /db_xref="GOA:Q6FRK4"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK4"
                     /translation="MLRCLGNRSAHRTVIVARRRLMVDSQIREYLRTLEEHDVVVIGG
                     GHAGCEAATAAARSGARTVLVTPFLDKIGTCSCNPSIGGVGKGTLIKEVDALDGVAGR
                     VTDKAGIHFKMLNQSKGAAVWGPRAQIDRNLYLKEMQSILSNYPNLQLQEAKVKDLLL
                     DKEHGDKTVVHGVVLEDSTIMRTRKVVITTGTFLSAEIHIGMKCIPAGRIGEEPTYGL
                     SKTLKEIGFKLGRLKTGTPARLDGKTIDFSNLEKQYPDEVPHPMSFLNNNVAVETQLL
                     CYGTTTTPELHEYLRQNLDKSLHIRETIKGPRYCPSIEAKILRFADKQSHKIWLESEG
                     LDTDVIYPNGISNSMPEDVQLKMMRMVPGLENVRIIHPAYGVEYDYIEPTQLNHNLET
                     KLVNGLYLAGQINGTTGYEEACAQGVIAGANAGLSSKNRDQIILSRSDAYIGVLIDDL
                     VTNGVVEPYRMFTSRSEFRITTRAENADFRLTPIGRKYGIVDDTRWSRFNNDKHIFEK
                     FKTKLKNFDLSASKWNQKLGIRIADSAKNRTAWEVFRYNDITLRYLAVKIPELDIDIN
                     AIPNHVSLKLDVEGKYEPYIVKQNQFVRAFQADEQMLLPKKFDYSNIPTLSSECKMLL
                     NSIQPNTIGQARRIQGVTAAALFELYKLVRPRQAELKNQ"
     gene            <769859..>772234
                     /locus_tag="CAGL0H07887g"
                     /db_xref="GeneID:2888543"
     mRNA            <769859..>772234
                     /locus_tag="CAGL0H07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447141.1"
                     /db_xref="GeneID:2888543"
     CDS             769859..772234
                     /locus_tag="CAGL0H07887g"
                     /note="highly similar to uniprot|P07244 Saccharomyces
                     cerevisiae YGL234w ADE5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447141.1"
                     /db_xref="GeneID:2888543"
                     /db_xref="GOA:Q6FRK3"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR004733"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR020559"
                     /db_xref="InterPro:IPR020560"
                     /db_xref="InterPro:IPR020561"
                     /db_xref="InterPro:IPR020562"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK3"
                     /translation="MLNILVLGAGGREHALVWKLVQSPSVEHIYVAPGNGGIAKIGPK
                     VVCVDIDCDAKNFEKLREFAVSKDINLVVPGPEVPLIDGVTDLFAKVGIPVFGPSAKA
                     AQLEGSKGFSKDFMQRHNIPTARHKTFESYEEAKRHLEEVNYRVVLKADGVAAGKGVL
                     IPENKEEALKALDVIMVEKQFGDAGNTVVIEEFLEGDEISILTISDGYSYFNLPPAQD
                     HKRIGENDTGLNTGGMGTYAPAPVATPKILQEVDSTIIKPSIDGFRKERIPLVGCLFT
                     GIILTKEGPRVLEYNVRFGDPETQSVLPLLTEDTDLAEVFLAAAEHRLDSVEIKTKSD
                     CFATTVVLSAGGYPESYKKGDIITIDEKKLPFDSYVFHAGTALDAQGNLITNGGRVIA
                     ASAVSDTLKGAVDKAYEAVEGIQFEGRYFRKDIAHRAFRDTENKSQGITYADAGVSVD
                     NGNLFVEKIKNMVKSTRRPGADSDIGGFGGIFDLKQAGYNTDDTLLIGATDGVGTKLI
                     IAQETNIHDTVGIDLVAMNVNDLVVQGAEPLFFLDYFATGALDIKIAADFVSGVAEGC
                     IQSGCALVGGETSEMPGMYPPGHYDTNGTAVGAVQKDSVLPMTNLMKEGDVLLGLASD
                     GVHSNGFSLVRKVISHVGISWSEQCPWEPSKTLGEAILTPTRIYVKQLLPSIREKLIL
                     GLAHITGGGLVENIPRALPKHLQAQVDMSNWSVPEVFKWFGKAGNIPVDDILKTFNMG
                     IGMVIIVDKANVARVKELLEQANETVYEIGSLVNRLEGQPGCVVNNASNLY"
     gene            <772741..>775389
                     /locus_tag="CAGL0H07909g"
                     /db_xref="GeneID:2888623"
     mRNA            <772741..>775389
                     /locus_tag="CAGL0H07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447142.1"
                     /db_xref="GeneID:2888623"
     CDS             772741..775389
                     /locus_tag="CAGL0H07909g"
                     /inference="similar to AA sequence:UniProtKB:P22224"
                     /note="similar to uniprot|P22224 Saccharomyces cerevisiae
                     YGL233w SEC15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447142.1"
                     /db_xref="GeneID:2888623"
                     /db_xref="GOA:Q6FRK2"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK2"
                     /translation="MDQETKKVISKDFQDVLLDTSTVVVSSVFDQENKIVGGENAKGV
                     DIIDSTLDIDQRAIDKWIPYLREYTENDQLNTVITELENSIDDNFQGLELQLLQDSQL
                     NDKLETSMDEIAEIQSMVELSLSRDIDEFQKNLTSSTNELIRQKQTYLNSKKTSLKIS
                     EAIILINKVLRLLELSNKCQELITEGNFFKALQNLDSLEKLYLQEFRDYNFKLLKEIY
                     VSIPYLKSVTKDECINLIKNSLNSNLGKNLNVVGQTFYLIYKDELLSKWLNTREIMKL
                     KRVKFNSPIEISMRDEENLRKLELEQFFNLDAFHDSLMIFETLNETDYLVEEFNKEYE
                     FKKSKTIQPLPWKTSGNTVSVNSTAHDEFKESLSVPFLKEYLLNILGFLLYDINLNRL
                     TDYIFVNNNYNATNEFWEMLMMRLKPYFKYFMDTVLKTEKDIIEFKDFLGIYVCIMEN
                     YKLNIDPLYSVMLALFEKYCKTTLELFDKDFQVMLSDDDFMPLTIDNKGFYEKVIKIC
                     WMKENHQIIDDMDDENFSVTLPFSPLYPMTCTMTQKVYAKLTSFISSFYRHSLHSLNN
                     ILVNTIDGILDGVVNKQIRAKLETTSREEIAQLLINLDYFVIASKEFSNLMTKDNILE
                     NPDVEIRLASTKNFAESRKYAESKLIDLIDTKIKDILETVSFDWLDTDRRIDPDISIV
                     DLAQFLEMMFATTLVNLPYSVQILLIFREFDSLTRHFLDVLLHDTPQYISKESVGNFE
                     VDMMYLEGIIPKIFPRTDENENGRLGSQTPKTPTIDDESRSQSNSQIDNNIKSLESTF
                     MELKQCIQLLQSEDPNEYLDPQMRSRKYSRIKPDDANILIGKIRPITAPAPTNEAENS
                     SVFNLDWNGSDSNNGNNRLAKFFNRR"
     gene            <775729..>776526
                     /locus_tag="CAGL0H07931g"
                     /db_xref="GeneID:2888508"
     mRNA            <775729..>776526
                     /locus_tag="CAGL0H07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447143.1"
                     /db_xref="GeneID:2888508"
     CDS             775729..776526
                     /locus_tag="CAGL0H07931g"
                     /inference="similar to AA sequence:UniProtKB:P53072"
                     /note="similar to uniprot|P53072 Saccharomyces cerevisiae
                     YGL232w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447143.1"
                     /db_xref="GeneID:2888508"
                     /db_xref="GOA:Q6FRK1"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK1"
                     /translation="MGTKRGNDGSSQNRKIKKFKIATGFLDPGTSGIYATCTRRKEKA
                     AISEMGILLEEKIEELYGESEVADSDVDEAGSIEDEVAKELAQLKKNKDDQDKKQLLK
                     AIDLQCECVVFFKTRKPVNPTTLVKAIIDDFSNPESKVKRTRYIQKLTPITYSCNATK
                     EQFQKLIDQVVEPAFKSDQSYKFAVEVTRRNFNTMERMDIINTVVSTVMKHGHHKVDL
                     KNYDKVIMVECFKNNIGMSVLDNDYSKKHKKYNLQQIYEAKFKDEEK"
     gene            complement(<776742..>777293)
                     /locus_tag="CAGL0H07953g"
                     /db_xref="GeneID:2888517"
     mRNA            complement(<776742..>777293)
                     /locus_tag="CAGL0H07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447144.1"
                     /db_xref="GeneID:2888517"
     CDS             complement(776742..777293)
                     /locus_tag="CAGL0H07953g"
                     /inference="similar to AA sequence:UniProtKB:P53073"
                     /note="similar to uniprot|P53073 Saccharomyces cerevisiae
                     YGL231c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447144.1"
                     /db_xref="GeneID:2888517"
                     /db_xref="GOA:Q6FRK0"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q6FRK0"
                     /translation="MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRD
                     KKNTSNKQVNKPDIANLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALML
                     LSGPVKSIFTIRETFKPVLGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPN
                     KTSDWMAWEKITDYNKGIRVFSF"
     gene            <778377..>779204
                     /locus_tag="CAGL0H07975g"
                     /db_xref="GeneID:2888439"
     mRNA            <778377..>779204
                     /locus_tag="CAGL0H07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447145.1"
                     /db_xref="GeneID:2888439"
     CDS             778377..779204
                     /locus_tag="CAGL0H07975g"
                     /inference="similar to AA sequence:UniProtKB:P33399"
                     /note="similar to uniprot|P33399 Saccharomyces cerevisiae
                     YDL051w YLA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447145.1"
                     /db_xref="GeneID:2888439"
                     /db_xref="GOA:Q6FRJ9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ9"
                     /translation="MAENQARRNSYGNIDFTEEVSKQCLKQVEFYFSESNFPYDKFLR
                     TTAEKNDGWVPITTIATFNRMKKFRPVDKVVEVLRTSEILEVSENGENVKRRVPLVWN
                     RNDEKFKEAKLEQNKRTLVVMNFPHDEEAGQAQEKKEGEEEKEDKDLQVEIEEFFRKL
                     AQVNQVRLRRDHKKNFRGTVFVEFKNYDECKKFEDEYSAGSKDDKEGGEILSFKGKRL
                     NILTKKQYDMQREATRSKNFSGSGQRSRSFTGHRKNMPKPSKKKDQDSENSSAIAEE"
     gene            complement(<779848..>780645)
                     /locus_tag="CAGL0H07997g"
                     /db_xref="GeneID:2888825"
     mRNA            complement(<779848..>780645)
                     /locus_tag="CAGL0H07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447146.1"
                     /db_xref="GeneID:2888825"
     CDS             complement(779848..780645)
                     /locus_tag="CAGL0H07997g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447146.1"
                     /db_xref="GeneID:2888825"
                     /db_xref="GOA:O74684"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /translation="MLSIILLLMQLVAADIAVVGPSLDQSFDASGGTAKIPIQWLFTP
                     NTPSQDDFTSLTFSLCSGPNYKIEAFKVIGKLSDIGTTDFEAEVSQSVGANGYYYVQI
                     YAATTDGYTIHYSPRFKLTGMTGSKLPDTLLITAPPTPETRVTTGDLGATIDSKSFDI
                     PYGEQNGKAKFAPMQTQPGTKITATTWSRRYATSAVSFFTSLTATPVQHTTLTPGWSY
                     YISSDYNYAPPAPFPSDNGGWYDPKKRQSFTTRKLNMDKLRKRRQTS"
     gene            <781773..>783050
                     /locus_tag="CAGL0H08019g"
                     /db_xref="GeneID:2888464"
     mRNA            <781773..>783050
                     /locus_tag="CAGL0H08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447147.1"
                     /db_xref="GeneID:2888464"
     CDS             781773..783050
                     /locus_tag="CAGL0H08019g"
                     /note="highly similar to uniprot|P40160 Saccharomyces
                     cerevisiae YNL207w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447147.1"
                     /db_xref="GeneID:2888464"
                     /db_xref="GOA:Q6FRJ7"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ7"
                     /translation="MKLDTSHMRYLTADDFKVLQAVEQGSRNHEIVPTQLIHQISKMR
                     SISGTNRSISDLAKLKLISKVRNAKYDGYRLTYNGIDYLALRTLLNQEVVYSVGNTIG
                     VGKESDIYQVSDRNGTAKVMKIHRLGRTSFHTVKNNRDYLRNSRQGTNWMHLSKLAAS
                     KEFEFMSMLYAKGFIVPQAYGCSRHVVVMDLIDGYPMRRLREHKNIPKLYSDLMTFIV
                     KLANSGLIHCDFNEFNIMIKNDEAVTDEKDCGFVVIDFPQCISIQHKDAEFYFKRDVD
                     CIRRFFKKKLKYDPQPEAGMLDTDGFGEGYKYAYPDFNRDVKRTDNLDELMQASGYSK
                     KHPGDRYLEEAVESMRNAEYNSDDDIDVAEDRSEEESDSDYDYYYTEEDEESGEDSDG
                     DSEEEENERIIEALSSGVGNLKMDKLGNYILED"
     gene            complement(<783229..>784590)
                     /locus_tag="CAGL0H08041g"
                     /db_xref="GeneID:2888512"
     mRNA            complement(<783229..>784590)
                     /locus_tag="CAGL0H08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447148.1"
                     /db_xref="GeneID:2888512"
     CDS             complement(783229..784590)
                     /locus_tag="CAGL0H08041g"
                     /inference="similar to AA sequence:UniProtKB:P40161"
                     /note="similar to uniprot|P40161 Saccharomyces cerevisiae
                     YNL206c RTT106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447148.1"
                     /db_xref="GeneID:2888512"
                     /db_xref="GOA:Q6FRJ6"
                     /db_xref="InterPro:IPR013719"
                     /translation="MSSFDFLNELPKELQNKIRNITRALPSSLEVFQELYNYGLSHSD
                     NIEKKRKVTSNGVIDEQNIIFSLKNVSVLSPIRKKLDLVLHLSSIDHKPQLSLVKNGV
                     SEFSISNLKDNVKMGTFLPVPEKPNLLYLFVQLKKVNDKDQDPILLTMNKENVLTEFK
                     SMGLIGQEVDDFNKCTEYIRKQAILTGFKIANPFNPSVEQPVPSFHVECHRGTKEGTL
                     YFLPEIIIFGFKKPILVFESSNIESISYSSITRLTFNVTLIKKVDDGYGTKFEFSMID
                     QTEYSKIDDYVKLKQVKDESMSEELKAKTANKNKQQNNTSDQPSALQEATKQMETEGN
                     INEIPFDSEDDEEADGNFEDNSDLSDGSEVEEEDNEEENEEDEEADGGDYAEEDFEED
                     EIIQEQANPAVNQLISKTTPINKNSSNAGLFDFPIETPSFDIPIELEDNEDDEEGSGV
                     EYD"
     gene            <785331..>786203
                     /locus_tag="CAGL0H08063g"
                     /db_xref="GeneID:2888438"
     mRNA            <785331..>786203
                     /locus_tag="CAGL0H08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447149.1"
                     /db_xref="GeneID:2888438"
     CDS             785331..786203
                     /locus_tag="CAGL0H08063g"
                     /note="highly similar to uniprot|P32573 Saccharomyces
                     cerevisiae YNL202w SPS19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447149.1"
                     /db_xref="GeneID:2888438"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ5"
                     /translation="MVNTLDKTFLEKSSWKPDLFKGKVGFVTGGAGTICRVQVEALVL
                     LGCKVAIIGRDHEKTERVAKEISSLVDNPDAVLPISKVDVREVKQLESAVKRTVDRYG
                     RIDYVIAGAAGNFICDFNHLSANAFKSVVSIDLLGSFNTAKATMPELIKSRGSILFVS
                     ATFHYYGVPFQSHVGAAKAGIDALSNALAVEMGPFGVRSNCIAPGAIQGTEGFDRLIG
                     DASKKKTTSKIPLQRLGTTEDIAQATVYLFSPAASYVSGTIQIVDGAMWHIGTHFAHE
                     LYPDLLFKDPKAKL"
     gene            <786770..>788794
                     /locus_tag="CAGL0H08085g"
                     /db_xref="GeneID:2888606"
     mRNA            <786770..>788794
                     /locus_tag="CAGL0H08085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447150.1"
                     /db_xref="GeneID:2888606"
     CDS             786770..788794
                     /locus_tag="CAGL0H08085g"
                     /inference="similar to AA sequence:UniProtKB:P39875"
                     /note="similar to uniprot|P39875 Saccharomyces cerevisiae
                     YOR033c DHS1 or uniprot|Q12086 Saccharomyces cerevisiae
                     YDR263c DIN7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447150.1"
                     /db_xref="GeneID:2888606"
                     /db_xref="GOA:Q6FRJ4"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ4"
                     /translation="MGIQGLLPQLKPIQNPVSLRRYEGQTLGIDGYAWLHRASCSCAY
                     ELAMGLPTEKYLKFFIKRFNMLKSFGVTPYLVFDGDSINVKQETNKKRREKRQENREI
                     AMRLWQSGNKRNAMDYFQKCVDVTPEMVKCVIDYCKNNGIKYIVAPFEADPQMVYLEK
                     KGLIQGIIAEDSDLLVFGCRRLVTKLNDFGECIEICRDSFGQLTSKFPIGQLSNEEIR
                     MMVCLSGCDYTNGIPRIGLIKAIKLVMTHRNMDRILMSLQTEGKFSVPENFYDEYRYA
                     DYSFQFQRVFCPLSKQIVSLTEIPMGLQSDKILHSCIGKAICRLDGTKRYCLNDEIDH
                     EIHGYLARGDLNPYDFTKRLVNREHKLQLQSKSDMSITYDPSNEQKSRKVLSIDTFFS
                     SVPEIKGQGTSSNKQPVYEDFVEKKYTQLISNRKLGRKSDCNNKVTSKFFTSNQESNS
                     RTAGLNGCNLNSIEQATEKIIISDNESETDLPESELPTQVEAQNTPTEFSLSIASSQS
                     KSTSDGFNSFEVTSQRDEIGNTSEEHEDISELIDLSDNNDVDNSTNLVSGLRNIKTEN
                     SIPSLKLENVRRANPHKFDLSISSYEIKKPKTEILKPSRVLKPRNVNQKPSSGIIPNI
                     IGDKHSRDRLKRDVGKQRVLASKAKALQTETSTRKTGNKLLQQYVYNPSK"
     gene            <792971..>793987
                     /locus_tag="CAGL0H08107g"
                     /db_xref="GeneID:2888788"
     mRNA            <792971..>793987
                     /locus_tag="CAGL0H08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447151.1"
                     /db_xref="GeneID:2888788"
     CDS             792971..793987
                     /locus_tag="CAGL0H08107g"
                     /note="weakly similar to uniprot|Q12398 Saccharomyces
                     cerevisiae YOR032c HMS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447151.1"
                     /db_xref="GeneID:2888788"
                     /db_xref="GOA:Q6FRJ3"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ3"
                     /translation="MKFHKQIKSILSTQENFDNIQLFSSQEAVNQMNMVIPLFPDQSD
                     ELRSGNGDSEQNWRNQGDVHIDHSVPCSLNEDWIDCKSDGESQQSVSSFGNTCTTGSE
                     PKHFESATSSMQTSSQFMNEKHSFIDEQPFPSFTEPADIESRMEKAFDSLISENVLTI
                     TDEKRGKNTSTQCVSTKESVIDKNQHIPFCVSRTMGKNKNGLMGANMHVLDVRNDKYC
                     KKNTKTQTPKGSKRALHSIVEKKYRTNINERLAELKNTVPTIRYTYKKLCNIPLTEAD
                     HRQLNGMEPARKLNKASILHKATEYIKFLENENSDLKAENARLQNIINLSFNLQQRIT
                     PLNM"
     gene            complement(<794516..>796216)
                     /locus_tag="CAGL0H08129g"
                     /db_xref="GeneID:2888627"
     mRNA            complement(<794516..>796216)
                     /locus_tag="CAGL0H08129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447152.1"
                     /db_xref="GeneID:2888627"
     CDS             complement(794516..796216)
                     /locus_tag="CAGL0H08129g"
                     /note="weakly similar to uniprot|Q99234 Saccharomyces
                     cerevisiae YOR030w DFG16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447152.1"
                     /db_xref="GeneID:2888627"
                     /db_xref="GOA:Q6FRJ2"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:Q6FRJ2"
                     /translation="MPNFNDSSYGYLKSNNYGKDLNNNLWKLSGILNSTIFETINSTN
                     QLLHDKAYSCVANLFSGGIVSSADNDLNSGALNYTAKSPLVFIHCSNNTNDKNSVILE
                     NIMQNAVRNISDLMTYEGLGSGTVLAKTDKFYLGMLLICFGQISICIAYWMLFTVVVL
                     LPADDHNRQNKLVLIFVLFSAITEAIILNRTVINVIQPQYYNNYQRSEEYESIIINSN
                     LVKSCDLIYSVFTHFNWLLIIIYMYPTVSLKWVEHVKKLPNGVRHFKHYHICLAIILM
                     LIDDILFCLLLWTNTKPSIHVAFKSFEIIIYTIFCLLLVYFVWSNFAFVLRPKVQKGG
                     CDIDTSETSSKFTTTNETCDNCEKASYSFANKSQNIFVVVMKKGLRLVFYLFNGFFNY
                     FKWSYYHLKVLWKDYQDILPLLAYNIVLFGLSYWATIFFTMGEYYHRRWAYNIVYFLR
                     ALITVNVWALIGVLEKKKIIASRKTVLGRQIRTNSFNENRDITTLGDHFISREDNNIN
                     SGGLISDFYIDKASPRVSPQRNSGEIYESSSANKITPHLNTAKYLLRAYPGARRKKKL
                     "
     gene            complement(<804418..>806169)
                     /locus_tag="CAGL0H08195g"
                     /db_xref="GeneID:2888514"
     mRNA            complement(<804418..>806169)
                     /locus_tag="CAGL0H08195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447155.1"
                     /db_xref="GeneID:2888514"
     CDS             complement(804418..806169)
                     /locus_tag="CAGL0H08195g"
                     /note="highly similar to uniprot|P15705 Saccharomyces
                     cerevisiae YOR027w STI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447155.1"
                     /db_xref="GeneID:2888514"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI9"
                     /translation="MTTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSN
                     RSACYASLKKFPEALNDAEECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALEL
                     DGSNQAAKDGLDQVKRTQESRQGMPDLGLSKIFADPNLIENLKKNPKTSEMMKDPELV
                     AKLIKYKTNPQAMSQDLFTEPRLMTIMATLMGVDLNMPDLSSSNSMPKEPTETPEQSK
                     ETPAEQKSEPQAEATKAEPEPMEVDSAGNEETSKKEEAEKEKALGNKAYKARQFDEAI
                     AHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREMRTDYKLIAKSFA
                     RMGNVHHKTNNLKKAIEFYQKSLTEHRTPEILTKLRNTEKELKKQEAEEYINPEKAEE
                     ARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKA
                     IEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAARTKDAEVNNSANVREIDQLYVKAS
                     QQRFQPASSNETPEQVYERAMKDPEVIAIMQDPVMQSILQQAQQNPAALQEHMKNPDV
                     FKKIQTLIAAGIIRTGP"
     gene            complement(<806660..>807637)
                     /locus_tag="CAGL0H08217g"
                     /db_xref="GeneID:2888860"
     mRNA            complement(<806660..>807637)
                     /locus_tag="CAGL0H08217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447156.1"
                     /db_xref="GeneID:2888860"
     CDS             complement(806660..807637)
                     /locus_tag="CAGL0H08217g"
                     /inference="similar to AA sequence:UniProtKB:P26449"
                     /note="similar to uniprot|P26449 Saccharomyces cerevisiae
                     YOR026w BUB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447156.1"
                     /db_xref="GeneID:2888860"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI8"
                     /translation="MRVEIKDVPREYISGIEIISEQNQIIIVSYDGTLSVYTVDRELK
                     QVNLTVRLQYESSLTSVAQLNIQGRQFIYAGSVDGQLLSVDLENSLFVKVDQIESSAG
                     ISCIAMHGDRVIAGSWDGSIYVVNPKSNSLEFTLELPSEYKKCFKLSVQAHKLLISTI
                     KCKIAIFKLPLTPTTKPHILDSGQIFQIRDSQLTPEGDGFVCTGIDGRVSVEYFDDTS
                     KRFAFRCHKYDLDDTVMTYPINAIRFIPNTSEFYTGGSDGCVSAWHLHKKTKIKQLPK
                     YNENSVVQLACNENILCVATSDDSFKTNAVIDSNLELEPSRIYVEILTN"
     gene            complement(<808082..>809386)
                     /locus_tag="CAGL0H08239g"
                     /db_xref="GeneID:2888908"
     mRNA            complement(<808082..>809386)
                     /locus_tag="CAGL0H08239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447157.1"
                     /db_xref="GeneID:2888908"
     CDS             complement(808082..809386)
                     /locus_tag="CAGL0H08239g"
                     /inference="similar to AA sequence:UniProtKB:P53687"
                     /note="similar to uniprot|P53687 Saccharomyces cerevisiae
                     YOR025w HST3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447157.1"
                     /db_xref="GeneID:2888908"
                     /db_xref="GOA:Q6FRI7"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI7"
                     /translation="MDEKLQTDKIVVFDDTHLLAEEQDDVLLSINRQLNKSRKIILLT
                     GAGISCNAGIPDFRSATGLYNLIKRQYPDISIGSGKEMFDISLFRDEMKISVFATFME
                     KLYASVKLAQPTTTHKFIAHLKNRNKLLRCYTQNIDGLEENLGLAISNSSFQPSTGKT
                     TETDNSPNKNNIDVIQLHGDLNTLACTRCYHEFQWSRYLARYFRRGELPTCPECERIN
                     NERVQMGKRLINNIGYLRPNIVLYGENHPSGEIITQGLNTDINRGKPDLFIIMGTSLK
                     VDGVQRVVKQISKQVHERKGLVILVNKTKLSESRWNGIIDYQICCDCDTWVKYLQGQI
                     PDFFKSQEEVLALRQLRREASELRKLKKSEKSSIKTPPTTPTGKRNTVPTREPILNGV
                     KRKLLTPENSFDERSPKKFSKTTSSNKKNDTLKKKPLGIVNL"
     gene            <810168..>812372
                     /locus_tag="CAGL0H08261g"
                     /db_xref="GeneID:2888445"
     mRNA            <810168..>812372
                     /locus_tag="CAGL0H08261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447158.1"
                     /db_xref="GeneID:2888445"
     CDS             810168..812372
                     /locus_tag="CAGL0H08261g"
                     /note="weakly similar to uniprot|Q99248 Saccharomyces
                     cerevisiae YOR019w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447158.1"
                     /db_xref="GeneID:2888445"
                     /db_xref="GOA:Q6FRI6"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI6"
                     /translation="MEMAEDADRALRDTYKRIKVYYDPAELPYLVRDIRPSVSYDTVP
                     KYIGYSAIEDMDGGFPGVEVTKHTVPVKTDLSRKGATLGSQVFLNPRFLLHNHVSGDD
                     DYEIERMKKRIFDASPLANNPLSLTRSKKSVFNYTADGKIIRSDYPTKPVFVNKIIIR
                     SRTNVHWDERWAQRKSKIEYNMEHKDEKFMYPDILFPEVKEKPLIMGDDFVPITKEQR
                     RRNKILTIKQAHPTLPRTVVCYISGRRHTWAGLDWAVRSLAENDHLVIVATIPKMTSH
                     RDQEPEVDGTWVSGYTFDEIDTIISDLFEYIKVIKPVHKALKVTIEISIERTKGALID
                     AINVYSPDFLILGTLKWQRYENLVSYRGNNMVDKLCTTFPIPTFIVPARRLFMLEKEI
                     EEETLTKLISDNTKKAVTPENEEIEYPRSPKLVSTDSFGFWSKNEQKLLDESYSISTK
                     DKLEKRQESFTSLTTHESEDSLAIEDDDDRDSNLLESTESIVSKLKSIAITNRKNMMA
                     DLEEFDNEHSNINTKENQLAKVSLIIKHSLNSSNTIKNLTQNLDEENRGFAVLQKVIT
                     GTGTVESRPKFSMVDAVRVNGKIPGESSAKKRRSQIKFASNVKPTDGTAGLGTPRIVG
                     PTGESQYSGGTSPLRTVDSNESALTFASNGSKISKHGRSSSFGTHSVNNGFLSVKRNS
                     MSDQVSFRSADHAPKLLTKKTSKSNDKSKDKKDSKKSSTKKKLGKLFSFGNL"
     gene            complement(<812738..>813058)
                     /locus_tag="CAGL0H08283g"
                     /db_xref="GeneID:2888573"
     mRNA            complement(<812738..>813058)
                     /locus_tag="CAGL0H08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447159.1"
                     /db_xref="GeneID:2888573"
     CDS             complement(812738..813058)
                     /locus_tag="CAGL0H08283g"
                     /note="highly similar to uniprot|P38910 Saccharomyces
                     cerevisiae YOR020c HSP10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447159.1"
                     /db_xref="GeneID:2888573"
                     /db_xref="GOA:Q6FRI5"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI5"
                     /translation="MSTLLKSAKSIVPLMDRVLVQRIKAEAKTASGLFLPEKNVEKLN
                     QAKVVAVGPGFTDANGNKVTPQVSVGDQVLIPQFGGSTLKLANDEEVILFRDSEILAK
                     IKDN"
     gene            <814034..>814993
                     /locus_tag="CAGL0H08305g"
                     /db_xref="GeneID:2888856"
     mRNA            <814034..>814993
                     /locus_tag="CAGL0H08305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447160.1"
                     /db_xref="GeneID:2888856"
     CDS             814034..814993
                     /locus_tag="CAGL0H08305g"
                     /inference="similar to AA sequence:UniProtKB:Q99288"
                     /note="similar to uniprot|Q99288 Saccharomyces cerevisiae
                     YDR051c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447160.1"
                     /db_xref="GeneID:2888856"
                     /db_xref="GOA:Q6FRI4"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI4"
                     /translation="MVDSYNRPRLIVLIRHGESESNKDKKINEVTPNHLIPLTPYGKK
                     QAHNAGLKLLRLLNMADASVIEKLGEEYALPATSTNTLELRGYKPNGKHMDDNIIFYT
                     SPYKRTRETLKGVLEVIDRYNELKSGINMCAEQTYNPYGKQKHAIWPHDLENSGIYEN
                     DESTHCGPEREGTYIRYRIIDEPRLREQDFGNYQEVSSMQDVMEKRKTYGHFFFRFPE
                     GESAADVYDRVASFQDTLYRHFQFRQHTKGRDVVVLVTHGIYSRVFLMKWFRWTFEEF
                     ESFTNVPNGSLMVMELDEKLNKYVLRTVLPKWSDLEAEKDLIT"
     gene            <815939..>816685
                     /locus_tag="CAGL0H08327g"
                     /db_xref="GeneID:2888881"
     mRNA            <815939..>816685
                     /locus_tag="CAGL0H08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447161.1"
                     /db_xref="GeneID:2888881"
     CDS             815939..816685
                     /locus_tag="CAGL0H08327g"
                     /note="highly similar to uniprot|P00942 Saccharomyces
                     cerevisiae YDR050c TPI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447161.1"
                     /db_xref="GeneID:2888881"
                     /db_xref="GOA:Q6FRI3"
                     /db_xref="InterPro:IPR000652"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020861"
                     /db_xref="InterPro:IPR022896"
                     /translation="MARTFFVGGNFKLNGTKKSIKEIVDRLNTASLPENVEVVICPPA
                     TYLDYTVSLVSKKQVTVGGQNTYTKASGAYTGENSVDQLKDVGAKWVILGHSERRTYF
                     HEDDKIVAEKTKFALDQGLGVILCIGETLEEKKAGVTLKVVERQLDAVIAEVKDWTNV
                     VIAYEPVWAIGTGLAATAEDAQDIHHSIRSYLAEKLGKDTAEKTRILYGGSANGANAG
                     TFKDKADVDGFLVGGASLKPEFVDIINSRN"
     gene            complement(<816990..>818942)
                     /locus_tag="CAGL0H08349g"
                     /db_xref="GeneID:2888893"
     mRNA            complement(<816990..>818942)
                     /locus_tag="CAGL0H08349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447162.1"
                     /db_xref="GeneID:2888893"
     CDS             complement(816990..818942)
                     /locus_tag="CAGL0H08349g"
                     /inference="similar to AA sequence:UniProtKB:Q04311"
                     /note="similar to uniprot|Q04311 Saccharomyces cerevisiae
                     YDR049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447162.1"
                     /db_xref="GeneID:2888893"
                     /db_xref="GOA:Q6FRI2"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI2"
                     /translation="MSDTSIKKHDLYIYDLPEALLNSLDLLQFDSYRNEVKPKPVERA
                     PVSIEEVKNKQVPTVLKCKVCADSTEAIGREHYQTDLHVANIRRNLNGLPPLNQAQFE
                     ELISKNTAKKDQKIVEGDSDGDISNDSGNDSDSNYSSEDELEKIDEIGGELSRKVNEI
                     NIIDKPITPLLTDTEDSQANLFHLNTGLPQILVRSPLLSNGQTYGIYKALFDKDNIQE
                     PLDTILKWNMDDTRMTSISALFLVGGGHFAGAIVCHQRGNIKSVVRSKRVDETPQEQC
                     VQFLEHKTFHRYTTRRKQGGSQSAMDNAKGKANSAGSTLRRYNEAALKTDIQNLMEKW
                     RPYLNKCESIYIRARNVQDKKIFLDGGILNKDDKRIKSFPFTTNRPTVTELKRIWCEL
                     TYMKPVEKPQPIPNEEASRKAISKPDAESKKKDVPKLELSEAEVHTEQIVTLLKKSRV
                     PLLLSYLKKNKLDGNFILLPRNKYVHTPTMLHYASQQGLRQMVSILLTTVKCDPTIPN
                     DVGKTAWDISKNDTVRYCFQKARHALGEEYTNWEEAHVGVPLSKEEVERLESEKEKQD
                     EAETKKLIQKELELTKERQKQERSARADEIELKHGQGRRLDSGSPGLMNLSSHKIDSL
                     NEDQRRRLMREQRARAAEARMQKLNK"
     gene            complement(<819301..>820383)
                     /locus_tag="CAGL0H08371g"
                     /db_xref="GeneID:2888787"
     mRNA            complement(<819301..>820383)
                     /locus_tag="CAGL0H08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447163.1"
                     /db_xref="GeneID:2888787"
     CDS             complement(819301..820383)
                     /locus_tag="CAGL0H08371g"
                     /note="highly similar to uniprot|P32347 Saccharomyces
                     cerevisiae YDR047w HEM12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447163.1"
                     /db_xref="GeneID:2888787"
                     /db_xref="GOA:Q6FRI1"
                     /db_xref="InterPro:IPR000257"
                     /db_xref="InterPro:IPR006361"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI1"
                     /translation="MFPELKNDLILRAARGEAVERPPCWLMRQAGRYLPEYHEVKGNR
                     DFFEVCRDAEVASEITIQPVRRYAGLLDAAIIFSDILVIPQAMGMKVEMVEGKGPHFP
                     EPLRTSEDLQKVLDYKVDIKKELNWAFEAITLTRKKLDGQVPLFGFCGAPWTLLVYMT
                     EGGGSRLFRFAKQWINEKPEESHKLLQAITDVAVEFLAQQVVAGAQILQVFESWGGEL
                     SAGDFDEFSLPYLRQIATKVPKRLKELGVEEHIPMIVFAKGSWYALDKLCDSGYNVVS
                     LDWCWDPKEAVKINNNRVVLQGNLDPGVMYGSDEIISKKTKTMIEGFGGGKKNYIVNF
                     GHGTHPFMDTEKIRHFLEECHRIGSA"
     gene            <821998..>823836
                     /locus_tag="CAGL0H08393g"
                     /db_xref="GeneID:2888665"
     mRNA            <821998..>823836
                     /locus_tag="CAGL0H08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447164.1"
                     /db_xref="GeneID:2888665"
     CDS             821998..823836
                     /locus_tag="CAGL0H08393g"
                     /note="highly similar to uniprot|P41815 Saccharomyces
                     cerevisiae YDR046c PAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447164.1"
                     /db_xref="GeneID:2888665"
                     /db_xref="GOA:Q6FRI0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FRI0"
                     /translation="MNSNDLLSEVKVSSSEDSQILSKSNDYVHEQNHIIEGDYDDDDK
                     SSSSHNLRSRFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHV
                     IMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLP
                     GSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSIDPDVFVIIF
                     YVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHD
                     PGAFASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRI
                     VVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPHIINAVILI
                     ALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATS
                     PREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSY
                     FGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTV
                     LTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSSFLVKIYEFWC"
     gene            <824631..>824933
                     /locus_tag="CAGL0H08415g"
                     /db_xref="GeneID:2888886"
     mRNA            <824631..>824933
                     /locus_tag="CAGL0H08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447165.1"
                     /db_xref="GeneID:2888886"
     CDS             824631..824933
                     /locus_tag="CAGL0H08415g"
                     /note="highly similar to uniprot|Q04307 Saccharomyces
                     cerevisiae YDR045c RPC11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447165.1"
                     /db_xref="GeneID:2888886"
                     /db_xref="GOA:Q6FRH9"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH9"
                     /translation="MLLVATSDNGVYNLSCRSCPYEFPIESIEIYDRKKLPRKEVDDV
                     LGGGWDNVDQTKVQCPNYDTCGGESAYFFQLQIRSADEPMTTFYKCVNCAHRWKEN"
     gene            complement(<825191..>829423)
                     /locus_tag="CAGL0H08437g"
                     /db_xref="GeneID:2888624"
     mRNA            complement(<825191..>829423)
                     /locus_tag="CAGL0H08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447166.1"
                     /db_xref="GeneID:2888624"
     CDS             complement(825191..829423)
                     /locus_tag="CAGL0H08437g"
                     /inference="similar to AA sequence:UniProtKB:P22219"
                     /note="similar to uniprot|P22219 Saccharomyces cerevisiae
                     YBR097w VPS15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447166.1"
                     /db_xref="GeneID:2888624"
                     /db_xref="GOA:Q6FRH8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH8"
                     /translation="MGGQLSLLAQTAPSIGIFSYIDILDETHYVSQLNNSRFLKTCKA
                     LDPNGEIVVKVFIKPKEDSSLEKIIQRLKREAVLLSALPNVLNYSKIFESTRCGYLVR
                     QHLKTNLYDRLSTRPYFTEIETKFVVFQLLQALKDIHDLDVIHGDIKTENLLLTSWDW
                     VVLSDFCSNIKPAYIPDDNPGEFSFYFDTSKRRACYLAPEKFDSAKASGDGVHQATKE
                     MDIFSLGCCIAELYLDGAALFNLSQLFKYKSGDYTLNDILPQTISKSSPVLKDILQDM
                     LQVDPKKRLSAHELLEKYRTIYFPDTFYDFLYDYCKTLVTLGTSVPCADQIEVNTTLQ
                     DHLGSIDEILIKIYCDFGRICKSLKLPVLDQEDMNYNTKDSFLRVSDKLLRLENYETD
                     KITASIQNEVSLIILVFLCKEFRNLQFPENKVKALQLILAFSLFVLDDTKLDRTLPYL
                     VAALEDDSTRVKVMAMNCVTTLIKEVKHPNQLNENIFVDYLLPRVQALLQNGQEESLV
                     RVAIASNLSDLALKANLFQEYCHTMQSSTIPNIVHDFESIEVIRKYSRKLQQLFEDLT
                     VSILTDPEISVKVALLKNILPLCKYFGREKTNDVILSHLITYLNDRDPALRMYLVECI
                     SGIAILLGPITMEQYILPLIIQTITDEEELVVVSVLKNLKDLLKTRFVNKKYFYDITK
                     FLSPLILHPNSWIRNFVLTTLVECINQMSKAEVYCVLYPVLRPFFDFDVDFTGDMLIS
                     CAKLPVSRNTYNLLRSWNNRSKKTFFWQRVTTNYVDAFGNSTINFVDKRYVKENYGLK
                     TMKVESNIHLHTNENENIPLTLEDKFWIDKFKNSGLTDNELWKIVALREYVVRSSRSS
                     SKKPETVTSIVSKLSLTPSNFSIENVMPNTVFFDIEFLHPETLTFNDLDVTNTNSIKE
                     SESNTFTDNHSKVIEMKGSLIFKTPRIPTTLSNLKNIYVQLEPTNNHSEGHAHLSARN
                     QPANFIVKSSYEGQDKIIEKYLKQLNILPSLKEYKEFGFVSENTTAEADVINLHGKFV
                     RSYPQIFDGTLLQSEVLLGTKSFMIYGSDQGALTVWDIDRLANEKSITRPLYYECSAE
                     ITCIKGLSGYDSFCVGLKSSEILIFRISLSKNGKAKNLQELICIRSLNLIGENSSEYP
                     IQIECCPNNDQFQLVVLSNYSNVYLFDIRTMKVIEKLELNADYGCTISMVLDDKNNLL
                     FFGTVSGIIEMWDARYFVQIRAWTFGESLPINKLAIMEQENKSLLVVCGGVDSAFFTL
                     WNIEKLSCKHVFVRSNEQPSLDSFNVIDADKLDKLAFEKNNSNIKPIVQIFNNKVLYM
                     DDIGRLLHILDTRNPEKSSTFAGSKVELHSFSVLQVTASLTMSLQKHNYQKEVNNSNY
                     TSSRVMTVNVFQLKNKPYMLLTDEEGYINIYT"
     gene            complement(<829775..>830455)
                     /locus_tag="CAGL0H08459g"
                     /db_xref="GeneID:2888904"
     mRNA            complement(<829775..>830455)
                     /locus_tag="CAGL0H08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447167.1"
                     /db_xref="GeneID:2888904"
     CDS             complement(829775..830455)
                     /locus_tag="CAGL0H08459g"
                     /note="highly similar to uniprot|P38256 Saccharomyces
                     cerevisiae YBR096w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447167.1"
                     /db_xref="GeneID:2888904"
                     /db_xref="GOA:Q6FRH7"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH7"
                     /translation="MGILAILFIIYLVSSFKSLPGAYFFRFYYYTFGNIISPYFFGKD
                     TAIIKKLQSNKYGCFAYAELDTYASPFECDFYFHKSNSTYFEELDISRGDLMTKIFQK
                     LFINAKKWPYVPVANVFTNFLKEIKPFQKYAVKSSILCWDNKWIYVMSKFTTNNGKNL
                     CSLSLTKYVLKDGRKTIPPSEALEFCGLYNEEVEKISARNLEILTKQSGFHETSPIEQ
                     LDHEYFRI"
     gene            <831136..>832401
                     /locus_tag="CAGL0H08481g"
                     /db_xref="GeneID:2888448"
     mRNA            <831136..>832401
                     /locus_tag="CAGL0H08481g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447168.1"
                     /db_xref="GeneID:2888448"
     CDS             831136..832401
                     /locus_tag="CAGL0H08481g"
                     /inference="similar to AA sequence:UniProtKB:P38255"
                     /note="similar to uniprot|P38255 Saccharomyces cerevisiae
                     YBR095c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447168.1"
                     /db_xref="GeneID:2888448"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH6"
                     /translation="MPPKEVKDTVKKSGRGRKSKEDAASLQFEQDCINAFTRRVLKEK
                     AGNYRPLKRGIDGKFIYPHASGVTTNRGNKLLQGSELISRNRLDTSRPLEEEKVFYNG
                     SEHRLLQSTRKRMKFPTIPQSESVLQTLPTDDPLEEDFDEINNLSKLVNVRELLTPIS
                     SLADICKRDSIKRTFNRTILKDLALNCILMIEKEQNSVTTYSQLLDVFLGDYPTPIYE
                     KTLRLPKYDHSLTLKEEDLEDGSQLELINSDTRNANDKDKQARVTMFTRKIPTHTYYD
                     LLEESKTQQDDKTDDEIAEEDSDPFFAVPNLALPESYQKLLPETASPRVLEEVENARQ
                     LVQIALQRNQEFIRNLQKIRGCIVKCNRIRERITSWSREYASIPEEGVTVPNALRAAK
                     RGIISATTNRSMSVDEGVRDGQGDKEDEE"
     gene            complement(<832642..>834819)
                     /locus_tag="CAGL0H08503g"
                     /db_xref="GeneID:2888797"
     mRNA            complement(<832642..>834819)
                     /locus_tag="CAGL0H08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447169.1"
                     /db_xref="GeneID:2888797"
     CDS             complement(832642..834819)
                     /locus_tag="CAGL0H08503g"
                     /inference="similar to AA sequence:UniProtKB:P38254"
                     /note="similar to uniprot|P38254 Saccharomyces cerevisiae
                     YBR094w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447169.1"
                     /db_xref="GeneID:2888797"
                     /db_xref="GOA:Q6FRH5"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR027746"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH5"
                     /translation="MKVLITNDDGPLNTQYSPYIRPFVQYILQNRPDWQITVCVPHVQ
                     KSWIGKAHIAGKHLSLQFLYSKRDSTDDSYWGPYIEPQLRDSIELFPEQKVNEDIPAD
                     AIEWILLDGTPASCVNIGLHHFEDKYDLVISGPNVGRNTSAAYITSSGTVGAAMEAVI
                     CDDTRAIALSWAFFDGRKDVPNELMERASARSVDVIEHLVGNWSTQADLYSVNVPLID
                     SIGPETEAYYAPIWENRWTTIYNGPKINRPVNNDIEDGNESKMISFEWMPDFKGHRPS
                     KHCDPDVKYDMDIIEERRICVTPLRAAFHTVPDLVGKLDLGSSTTRSNDESVAVLTIP
                     RNSYIYEPLQQSIARHLHIPILDTLDAAPSGKGKVFQYGDYEDFDLDRVMDSQNYLVN
                     SYIYRKAIIRKHYLSHTIQRYVSKHPGSILKKAYMESYTIDLDYAEFLDDALDENWEL
                     RQELEKNDRWWIVKPSMSDKAQGIRVFKTIEDLQNVFDSFDEEDTDEEIDEETVDDNK
                     IIISQLRHFIIQEYMADPLLLPSMGNRKFHIRCYITCKGDLEVYVYDRMLALFAPKPF
                     SALDSEEYSPTDLDKLGCHLTNTCLQSDADKDLAVMEFGNLTDISREDKSKIIEQIHM
                     IAKDIFLAALNVDRMNFQPLRNAFETFGFDFLVDSSFNVKILEINAYPDFKQTGNDLK
                     GLIYELFDDVVKTCVAPFFQEAEEPQNISNFTKVLDTTSNVWE"
     gene            <835080..>835385
                     /locus_tag="CAGL0H08525g"
                     /db_xref="GeneID:2888812"
     mRNA            <835080..>835385
                     /locus_tag="CAGL0H08525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447170.1"
                     /db_xref="GeneID:2888812"
     CDS             835080..835385
                     /locus_tag="CAGL0H08525g"
                     /inference="similar to AA sequence:UniProtKB:P32830"
                     /note="similar to uniprot|P32830 Saccharomyces cerevisiae
                     YBR091c MRS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447170.1"
                     /db_xref="GeneID:2888812"
                     /db_xref="GOA:Q6FRH4"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027102"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH4"
                     /translation="MSMWLDPLAGQEVSAERMKLAEVQFEAMQTTFNNIMETCRKKCI
                     PRDEGFSESDLTKGEMTCVDRCVAKMHYSNRVIGAYVQTQRFSPERQLPHYEKFYPK"
     gene            <836421..>836702
                     /locus_tag="CAGL0H08541g"
                     /db_xref="GeneID:9488005"
     mRNA            <836421..>836702
                     /locus_tag="CAGL0H08541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999508.1"
                     /db_xref="GeneID:9488005"
     CDS             836421..836702
                     /locus_tag="CAGL0H08541g"
                     /note="highly similar to uniprot|P11632 Saccharomyces
                     cerevisiae YPR052c NHPA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999554.1"
                     /db_xref="GeneID:9488005"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:B4UN11"
                     /translation="MSETRAPRRKTTRRKKDPNAPKRALSAYMFFANENRDIVRSENP
                     DVTFGQIGRLLGERWKALTAEDKQPYEAKAEADKKRYESEKELYNATRA"
     gene            complement(<836841..>837386)
                     /locus_tag="CAGL0H08547g"
                     /db_xref="GeneID:2888461"
     mRNA            complement(<836841..>837386)
                     /locus_tag="CAGL0H08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447171.1"
                     /db_xref="GeneID:2888461"
     CDS             complement(836841..837386)
                     /locus_tag="CAGL0H08547g"
                     /inference="similar to AA sequence:UniProtKB:Q03503"
                     /note="similar to uniprot|Q03503 Saccharomyces cerevisiae
                     YPR051w MAK3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447171.1"
                     /db_xref="GeneID:2888461"
                     /db_xref="GOA:Q6FRH3"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH3"
                     /translation="MKIVYRPLDIGNLAHFEQLKRLIDADLSEPYSIYVYRYFLNQWP
                     DLTFLAFDADAVGQDGNGEDGIAGAVPIGCIVCKSEMHRSSRLRGYIGMLAVASAYRG
                     HGIAKRLVQITLEKMAEMQCDEVMLETEVSNVAALNLYEGMGFIRMKRMFRYYLNEGD
                     AYKLILPLTERSCIRTTFLNQ"
     gene            <837576..>840908
                     /locus_tag="CAGL0H08558g"
                     /db_xref="GeneID:2888485"
     mRNA            <837576..>840908
                     /locus_tag="CAGL0H08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447172.1"
                     /db_xref="GeneID:2888485"
     CDS             837576..840908
                     /locus_tag="CAGL0H08558g"
                     /inference="similar to AA sequence:UniProtKB:Q12527"
                     /note="similar to uniprot|Q12527 Saccharomyces cerevisiae
                     YPR049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447172.1"
                     /db_xref="GeneID:2888485"
                     /db_xref="GOA:Q6FRH2"
                     /db_xref="InterPro:IPR019460"
                     /translation="MEYRCLDCTTGDTIAVDLKVFLDLKEFKSYLSNKWGVPRAQILL
                     LYPFGIKLKDSNFRHASDLESPEIYVYDRRLFSLTNEPHTGADAHADSDADADADTAD
                     VEQQAAQLLDSLLEQRRHPQLQDDLIRPIPSPLEDLKIADGISHRTAVSMLTTNLGWL
                     SALEIDVNYYSSISDKCKEDTQSLARCLGTCEQYLGLYCYDVERLYNSNVVFLDQLHE
                     NSLQSRWKECYKNTLTKLAGLNGYLSQYVDEAKQIEKEVTLKSLDGKVNSKLKQIKKE
                     LDSYADQRKSIQNEIENLKNIKDMKNDDNELHEMQKSFDSIADTVRKASRDILDKDDA
                     LFTDEYITQEVVPVMIDIQKKVKTLLTVSQALYENMHELLTHKRNFQIQIIVKLGQIA
                     WIQLQISELKQYLLNDCNADLTLYKDLEVEFAQIEDYPLIYGLYLVEKYRRQVWKCGM
                     AKNMISISNDIKERSAAELTTRKNWYKNFGELSKPFNEDLTKYNDLDEISKLMNSDSQ
                     FLKEKFIQDLRNEQRKLEDVIKSFIKNMHDLGLSKETTQVLEQSFKEASNSNICSQID
                     VTYDHRRINNENDLIKRYKIRIRKLESLLHEQGYSSISKWPSGVLNHTDRPNYFADNV
                     SPAGRSLLVSSSALLGLEPSASLKTDAEMFDLKKEIGDLSEKVTALEKDNKLKTDQLK
                     ITHSKLIDIEVEKAAFRETLNHLNKELARLTVNEEDQTNLLKEERLRFKKEMTSVTVV
                     NQNLMNNLDALQKTFEDVELENAHLKSKLKELQQRQDQLIEDSANEKLEIKSKYEKLI
                     KEKDENMGQAFAVTNKAISGEQNKTESDIIHSSPYPEAILHLRTELFDIFSTNIYILE
                     NIGLLLTETSAGKFEIKRVKGLKKGLSQSLLDESAQISPIDGVINSVVYKNIRAQYEQ
                     LPNDNNISNCELFISSVKKIYENKLFESAVINRFKDIETLAKRLTKENKSKRILIDLY
                     QNERLAVKDFRVNDLALFLPTKEALSETKSLSSSMASSFSSVDLSTPISGANNNITAS
                     RKSLHKPNVKHPWAAFTAFNESSRYFLKDENMVTDNKEWFIGKITDIQRQVVENISTN
                     NPFKLPKDTVWYLISAEMISID"
     gene            complement(<841038..>842903)
                     /locus_tag="CAGL0H08580g"
                     /db_xref="GeneID:2888507"
     mRNA            complement(<841038..>842903)
                     /locus_tag="CAGL0H08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447173.1"
                     /db_xref="GeneID:2888507"
     CDS             complement(841038..842903)
                     /locus_tag="CAGL0H08580g"
                     /note="highly similar to uniprot|Q12181 Saccharomyces
                     cerevisiae YPR048w TAH18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447173.1"
                     /db_xref="GeneID:2888507"
                     /db_xref="GOA:Q6FRH1"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR028879"
                     /db_xref="InterPro:IPR029039"
                     /translation="MSSSKIAVLYGSETGNAQDFAAILSHKLNRLHFKHTFSSLADYK
                     REDILRCRYLFIVCSTTGQGELPRNVYETVTGDQKNTLWTFLKKKKLPADFLNHIKTA
                     FLGLGDSSYPKFNYALRIIHNRMVNQLGAKEIFDRMEADEQSMAGSNKGTGLGIESVY
                     FEFEKRIITYLMDRFPTRKVGNEIIQREEIDKELYLEPITYLRIDDPHDQQSFSGGPT
                     TFVGDKLIKTGTITLNKRITAKDHFQDVRQFTFESCDDIKYKPGDTVALYSYNTDQSV
                     ERMLECQPQWIPLADKPLSFTNGIPTHLLDGGVVQPLTLRNLLKYHCDFMSIPRSSFF
                     LKIWTFATDVTRMERGEEQMKDQRQKLYEFATDEDMQELYDYCNRPRRSILEVMEDFL
                     SIRLPLEYLLDFFPPIKPRLYSISSTANCNNIELTVAIVKYKTILRKIRTGVCTDFIS
                     KLKVGDKIRYKIQQNDLIKEEYRSNPFVMVGPGVGLAPLLSAVRSKVSPEMSLYFGCR
                     FKDKDYLHGKELEDMANQGLIKFYPVFSRDRENSPDTKYVQDVLWKFGEEVTNLLVER
                     KGIFFLCGASGKMPIQIRLTLLEMLKKWGGFKDDASAKEYLRSMEKEYRYIQETW"
     gene            complement(<843298..>844737)
                     /locus_tag="CAGL0H08602g"
                     /db_xref="GeneID:2888734"
     mRNA            complement(<843298..>844737)
                     /locus_tag="CAGL0H08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447174.1"
                     /db_xref="GeneID:2888734"
     CDS             complement(843298..844737)
                     /locus_tag="CAGL0H08602g"
                     /inference="similar to AA sequence:UniProtKB:P08425"
                     /note="similar to uniprot|P08425 Saccharomyces cerevisiae
                     YPR047w MSF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447174.1"
                     /db_xref="GeneID:2888734"
                     /db_xref="GOA:Q6FRH0"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004530"
                     /db_xref="InterPro:IPR005121"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6FRH0"
                     /translation="MGSNIVVRLTPLRVVRNAIHKHIRLYSSIRQTVEINGKTYDTDE
                     EMTNITPSIIDLTDRSLHLKPNHPIGILRKLIEGKLNDGKKAYTAYDEFKPVVSVFEN
                     FDSLGFPKDHPGRSKSDTYYINKDTLLRTHTSAHELECFKNIPKYNNDGFLITADVYR
                     RDEIDKTHYPAFHQMEGARVWNRSIKSDGTYDISESAPHIKKLKTDIRELEDILRNEK
                     TNMIVEDNTAREVNPKQEYMTDLEVDLVSQHLKRSIEIVVSEVFHKKIESMKALKGAN
                     DPSIPKELKVRWITAYFPWTAPSWEIEVWWEGDWLELCGCGLVQQQVLINSGNKPDST
                     IAWAFGLGLDRIAMLLFEIPDIRLLWTKDERFHNQFKEGKITTFTSYSKYPGSYRDIA
                     FWLPEKLKNEVQLQENDLMEIVRNIAGDLVESVKLIDDFTHPKSKKRSLCYRINYQSM
                     DRNLTNAEVNKLQSKVEEELIRLFQVELR"
     gene            complement(<845036..>845593)
                     /locus_tag="CAGL0H08624g"
                     /db_xref="GeneID:2888717"
     mRNA            complement(<845036..>845593)
                     /locus_tag="CAGL0H08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447175.1"
                     /db_xref="GeneID:2888717"
     CDS             complement(845036..845593)
                     /locus_tag="CAGL0H08624g"
                     /inference="similar to AA sequence:UniProtKB:Q12262"
                     /note="similar to uniprot|Q12262 Saccharomyces cerevisiae
                     YPR046w MCM16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447175.1"
                     /db_xref="GeneID:2888717"
                     /db_xref="GOA:Q6FRG9"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG9"
                     /translation="MEDKWERVCALEREHVDLYTQLLRVLDELHLERSNSNHKVIIKD
                     EQENLMKVRRQMQCGLEESAAILRTLQRVNQLDKDGERSLEDLVAERLNSLMERHYST
                     ETECMQIINARLDVSTKIFDEQKKFMKLREELQELDKLYGDQGLDAPAKPAKTAEQEQ
                     LERENETLRELLVALQVYSGSGVVL"
     gene            complement(845795..845903)
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0H08646r"
                     /db_xref="GeneID:2888752"
     tRNA            complement(join(845795..845839,845865..845903))
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0H08646r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2888752"
     gene            <846457..>847779
                     /locus_tag="CAGL0H08690g"
                     /db_xref="GeneID:2888720"
     mRNA            <846457..>847779
                     /locus_tag="CAGL0H08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447176.1"
                     /db_xref="GeneID:2888720"
     CDS             846457..847779
                     /locus_tag="CAGL0H08690g"
                     /inference="similar to AA sequence:UniProtKB:Q12049"
                     /note="similar to uniprot|Q12049 Saccharomyces cerevisiae
                     YPR045c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447176.1"
                     /db_xref="GeneID:2888720"
                     /db_xref="GOA:Q6FRG8"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG8"
                     /translation="MSYNQVTPIALGQRSKRKIVPKAEPKDDKKIEVQANKGKNVLKK
                     PPVANTNSVVNPAVSVFPQPNKVRPSRIAQKGPTKQNNTNGSNRTNKKLKSNEGKVRH
                     PNNNRTNSSGGLSETERRRKRAERFSKANNTISKNELEHEDNFSDLNSIGTKSHIFNK
                     DQRIVGRCQKLEKSYLRLTSEPNPEMIRPPEVLEKALEMLMEKYKNKEVNYTYLCDQF
                     KSIRQDLRVQMIEDSFTMTVYQEHARIALENDDLGEFNQCQSRLMVLYDNTTIKRTHR
                     EEFTVYLILYYVLMQDYSAIDALKLELIRERGRSIKNAGIALAFEIAETRLVGNYHKF
                     MKLCASLKGLGQKLIKAFMDQEILKTLVTICRSYNQVNLVFLTKELEFETADETIQYL
                     KRKNLGNYIVTKNLNMPNEFKYLDTKACRIEVIQAYAKLKKVDIKGQK"
     gene            complement(<848229..>849446)
                     /locus_tag="CAGL0H08712g"
                     /db_xref="GeneID:2888750"
     mRNA            complement(<848229..>849446)
                     /locus_tag="CAGL0H08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447177.1"
                     /db_xref="GeneID:2888750"
     CDS             complement(848229..849446)
                     /locus_tag="CAGL0H08712g"
                     /note="weakly similar to uniprot|P29366 Saccharomyces
                     cerevisiae YBR200w BEM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447177.1"
                     /db_xref="GeneID:2888750"
                     /db_xref="GOA:Q6FRG7"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG7"
                     /translation="MAIFVLQKEDTSPTLTKKRSIRDRQRQLNISPPMKHDNSVASWN
                     TLHRSASLNYKFYNVKQTYNPTETSSDITHLDPNELRDSNGTPLIDHYLHVTKGSLVQ
                     KISDMGDGMWYVKPINELVCGLVPASYLEEEKQLNCTLSAKPHAAKWNTSLIDLTPPT
                     SPSTIVSKTFSKASYSRKTSLSIESPRSKQDSFLAVKLITKCEVESIELKDNRLEYTV
                     RIQDSEGNTKVKHIYYSAFYKLHTKLMAGLKENMSLPNIPAPSSNYAQEKVDESTKLD
                     RLQMFNTYLTYLIDVIYDIKSPLHLQDTFTNWVNDIEPSSANQQIKIKILFQGDYYAL
                     KCTKSEIDNLDKLHALLRSKIRALKDRTSLKMTAKLEGWYIVELTDEIMYRMILAKLN
                     DIRRLAIDVSLVD"
     gene            complement(<851585..>852252)
                     /locus_tag="CAGL0H08734g"
                     /db_xref="GeneID:2888745"
     mRNA            complement(join(<851585..851861,852251..>852252))
                     /locus_tag="CAGL0H08734g"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_447178.1"
                     /db_xref="GeneID:2888745"
     CDS             complement(join(851585..851861,852251..852252))
                     /locus_tag="CAGL0H08734g"
                     /note="highly similar to uniprot|P49631 Saccharomyces
                     cerevisiae YPR043w RPL43A or uniprot|P49631 Saccharomyces
                     cerevisiae YJR094wa RPL43B"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_447178.1"
                     /db_xref="GeneID:2888745"
                     /db_xref="GOA:Q6FRG6"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHARYDCSFCGK
                     KTVRRGAAGIWSCHSCKKTVAGGAYTVSTAAAATVRSTIRRLRDMVEA"
     gene            complement(<853720..>853968)
                     /locus_tag="CAGL0H08756g"
                     /db_xref="GeneID:2888760"
     mRNA            complement(<853720..>853968)
                     /locus_tag="CAGL0H08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447179.1"
                     /db_xref="GeneID:2888760"
     CDS             complement(853720..853968)
                     /locus_tag="CAGL0H08756g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447179.1"
                     /db_xref="GeneID:2888760"
                     /db_xref="GOA:Q6FRG5"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG5"
                     /translation="MRGKAISEDQRVCTGVSERMYALNKSRGPLLPTSHKHKHKHKYK
                     YKHNSCENLRRGTDFGSTLRAAFRLWGLRRAISAESSD"
     gene            <854147..>857344
                     /locus_tag="CAGL0H08778g"
                     /db_xref="GeneID:2888724"
     mRNA            <854147..>857344
                     /locus_tag="CAGL0H08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447180.1"
                     /db_xref="GeneID:2888724"
     CDS             854147..857344
                     /locus_tag="CAGL0H08778g"
                     /note="some similarities with uniprot|Q12221 Saccharomyces
                     cerevisiae YPR042c PUF2 or uniprot|P47135 Saccharomyces
                     cerevisiae YJR091c JSN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447180.1"
                     /db_xref="GeneID:2888724"
                     /db_xref="GOA:Q6FRG4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG4"
                     /translation="MDGNDIHNPRNDSRNDRIDRNERNERSESGDDLDESKRISYRSK
                     KERFASTLNSILPSISAKFHSRKNVNTSSDAPTDVTESTGVDYDKSKDRYFMSDGTSV
                     SDYRTAFSSGYQQGSLYQGNNYDTMSNSSKDLNYTPITYASMETSPNYLNSQQIQHPG
                     SSGMPLISPQLQGHVNSMSLPQNSNSLNLKIGNMSAMTNNNLPIPAQPNNVWQSMNSN
                     STPISLPQSVPDPFEHSNPPVSGLNNTASLVNSGFDRERAHSFGSFQNGSSHYGSDMS
                     LHYSLNNNTASGYPALNAATQNIPAVTTSTNVTTSVPQMQQQEQLTPVVADDVDPALI
                     SWVSTNINIPASNQTGFLLPTNTLCISNVFPLQTPGEYGNNNLSHPINLTSTLLASLC
                     SQYGKVLSSRTLRHLNIALVEFETVDSAITALESLQGKELSLLGFPCSAAFAKILSVS
                     DGVGLGEHTLSVKENSTRKPLLHEVFLNTALYQGSNSTFTLQSNLQPPVVISQPSKEN
                     ISTKNASNVHLSSADNDPCPFKLPPAILADKLDDFQDIIKKFNIKYDVDIVNHMLNNS
                     LQKGPNACDVNNFGPIPQQSVHRQFDAPKLRELRKAFDSNSLSQVEMEQLAIAMLDEL
                     PELCLDYSGNTIIQKLYDNCSPIIVDLMLRESHKYLTSMGIHKNGTWVSQKIIKVVKT
                     PRQMDFITKGIQDYCTALFNDQYGNYVIQGVLTFGFPWNSFIFENIMSNFWVIVDNKF
                     GVRAVRACLEANGHMSKEQELLLCSMIILYSEYLSTSNTGTLLVTWYLDSCTFEEKYA
                     MIISSLIPHIVELCSHRLGSLTVLKLLNLRIDQCVKDSILTAIFGDLNDNKPSENLIE
                     ILKDNHNGGSFLYKIISSRFLESERKSHLVEKIKIVLLNSNLAHQNKRLIEEVGLTST
                     GNGNGMSQPIRHRKTISYSHSHESARQSRDHTMPNRVSYPKSIVSAGSYLSPNGITGI
                     GHNENISPDMALYLANSSPNLLYGSRNSQTYQQVPELQDLSLQLEGMKIHNDQNYFGQ
                     IQSHTYDTTGMPGHDLLANRLDHDESGYNMSYNYR"
     gene            <857901..>858347
                     /locus_tag="CAGL0H08800g"
                     /db_xref="GeneID:2888741"
     mRNA            <857901..>858347
                     /locus_tag="CAGL0H08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447181.1"
                     /db_xref="GeneID:2888741"
     CDS             857901..858347
                     /locus_tag="CAGL0H08800g"
                     /note="highly similar to uniprot|Q08971 Saccharomyces
                     cerevisiae YPL225w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447181.1"
                     /db_xref="GeneID:2888741"
                     /db_xref="GOA:Q6FRG3"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG3"
                     /translation="MSLNTFDPNTAENSEDIEKQFAVVAVEQAETYWKLITSIPGSKL
                     RLTKLDDEIYELFMERFPEYKDIERLRKFDEEELKNKVAKERWRQFANYFEKKVEDFN
                     FGTLLRTDANAEYGQFTTCFVVRIQFYAFEIARNRHGLNDWAVGHQ"
     gene            complement(<858891..>860435)
                     /locus_tag="CAGL0H08822g"
                     /db_xref="GeneID:2888719"
     mRNA            complement(<858891..>860435)
                     /locus_tag="CAGL0H08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447182.1"
                     /db_xref="GeneID:2888719"
     CDS             complement(858891..860435)
                     /locus_tag="CAGL0H08822g"
                     /inference="similar to AA sequence:UniProtKB:Q03218"
                     /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
                     YMR177w MMT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447182.1"
                     /db_xref="GeneID:2888719"
                     /db_xref="GOA:Q6FRG2"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG2"
                     /translation="MLRLSIPTLSNRALQSSHIIISNKRVVFSRIKLGYALQRYNFTT
                     SSIRNASNKADEDKIEEHGHGHHHNHDHGHIHTHNSVHDSEDSDHRHVHMKQSETEQN
                     DTYSIRSILKHSHTHSPKATYLGTPKAAKAPATHIHSHMHHHGHGHTHSHSGGNPLLV
                     LSAEEIRKNAGVRITWIGLGLNVAIAIGKFIGGIVFHSQALFADAIHALSDMVADFLT
                     LFSVDLASNKPSQKYPYGYGKVETVGSLAVSTILAMAGLSIGWTSICALVGPYVPHAI
                     IESLHQIGLANASHHHHHTVEEITKEVTDINAAWIAAASIAAKEWVFRATRKVAIETN
                     SNVLMANAWHHRVDSLTSFVALITITAGHLFSIQSLDTIGGLIVSILILKAGVHGMTM
                     SLRELVDEAVPSSDPRYIEVETIIDETLAKLVTNNNSKIPYKIKELTVLPSGPNLRAH
                     LTLTVPLQRWNNVLDLGEFELISAHLRKILSEELPSLIKIDIEYVEEVDEKDLIDEKN
                     ELEQKN"
     gene            complement(<860942..>862918)
                     /locus_tag="CAGL0H08844g"
                     /db_xref="GeneID:2888677"
     mRNA            complement(<860942..>862918)
                     /locus_tag="CAGL0H08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447183.1"
                     /db_xref="GeneID:2888677"
     CDS             complement(860942..862918)
                     /locus_tag="CAGL0H08844g"
                     /inference="similar to AA sequence:UniProtKB:P18899"
                     /note="similar to uniprot|P18899 Saccharomyces cerevisiae
                     YMR173w DDR48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447183.1"
                     /db_xref="GeneID:2888677"
                     /db_xref="UniProtKB/TrEMBL:Q6FRG1"
                     /translation="MGLFDKVKKAFDDNKGGDDANNNDNDYIKKAEGYLGEERVNQFK
                     SKIGEDNFDKLENTVRNQFSKTSIDDSDKKNNTSYSNDNYGDDSYGSSNKNQSSYGDD
                     SYGSSNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSY
                     GSSNKNKSSYGDDSYGSSNKNSYGDDSYGSSNKNKNSYGDDSYGSSNKNKSSYGDDSY
                     GSSNKNKSSYGDDSYGSSNKNSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSYGS
                     SNKNSYGDDSYGSSNKNSYGDDSYGSSNKNRSSYGDDSYGSSNKNKSSYGDDSYESSN
                     KNKSSYGDDSYGSSNKNKSSYGDDSYGSSNKNSYGDDTYGSSNKNSYGDDSYGSSNKN
                     KSSYGDDSYGSSNKNSYGDDSYGSSNKNKSSYGDDSYESSNKNKSSYGDDSYGSSNKN
                     RSSYGDDSYGSSNKNNSSYGDDSYGSSNKNSYGDDSYGSSNKNSYGDDSYGSSNKNKS
                     SYGDDSYGSSNKNSYGDDSYGSSNKNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNSY
                     GDDSYGSSNKNKNSYGDDSYGSSNKNKSSYGDDSYGSSNKNKSSYGDDSYGSSNKNKS
                     SYGDNSYGDNSYGSNRNSYGNDNYGSNQDSNNRY"
     gene            complement(<864317..>866293)
                     /locus_tag="CAGL0H08866g"
                     /db_xref="GeneID:2888634"
     mRNA            complement(<864317..>866293)
                     /locus_tag="CAGL0H08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447184.1"
                     /db_xref="GeneID:2888634"
     CDS             complement(864317..866293)
                     /locus_tag="CAGL0H08866g"
                     /note="some similarities with uniprot|Q03213 Saccharomyces
                     cerevisiae YMR172w HOT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447184.1"
                     /db_xref="GeneID:2888634"
                     /db_xref="GOA:Q6FRG0"
                     /db_xref="InterPro:IPR022210"
                     /translation="MSDAGDSKLAKEQSDASTGTCNGNGTGNGTGSGTATANATTTPT
                     PTPTSIPTAAGSVTDVTATSSMVLAKLDDISSRLTMLESNFNNVFSKINDQNSMILDL
                     KQNNSHAFLRLSSKVNKLETHVAALASNNPQSAFVTDLLNSITNVSSSYLRKMKHNGA
                     ENLNVQLSTHENGFVHPTPNDSPNMMGPIYYNQIETSKARGQLKSLNRKKTFTLNPNG
                     IKKRRLGHHHGNSGSRSNNLNVTFDITGQVGQPGYDTSLNSATPNNHAMTPSNVISSS
                     NSYSELQSLNGLQSNTTASDGRTLSPVNTVQALKTPYLTATNQHSLNHGSLNNYNLNF
                     PQFLDNTNSVTLSRLGSSSPVEKRDGIVMSHSAPQLDNGSITYPDNRLHIRNQASQDI
                     LGGASQGQPQKINNIDEDGYQEDDEEEESELNKHKNKVGNLKYNTTLTDSHSINDDRK
                     PTVNVYASTGHPVNNTKSEYLEDDESNDSDNSHETDEESEDEVEEYDEEDDMVNEEDR
                     QPYSRKPKEPASERKRKKLRKINKYRNNVIEPRKKDDKEKDAQNSDLNYMLLKAPSSV
                     KTIWEEYVNGIDGNPSIRGLEEKYGNKWRIKRNKKTFSRRKRLYKFILNGIDKGKTAD
                     EMIDMLEKQRLYRDENGEIKRRTIGWLQQSLIGI"
     gene            <867213..>869633
                     /locus_tag="CAGL0H08888g"
                     /db_xref="GeneID:2888799"
     mRNA            <867213..>869633
                     /locus_tag="CAGL0H08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447185.1"
                     /db_xref="GeneID:2888799"
     CDS             867213..869633
                     /locus_tag="CAGL0H08888g"
                     /inference="similar to AA sequence:UniProtKB:Q08967"
                     /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
                     YPL221w BOP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447185.1"
                     /db_xref="GeneID:2888799"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF9"
                     /translation="MLWCWLFMLLFGEALAKRSLYATSLVTCMENSQLQANSFDVKFN
                     PDDRSLFYNLDMTTSINSYVYALIDVYAYGFKIITKEVDLCNINWKQFCPVHPGNIQI
                     ESIQYISEEYVNEIPGIAYHVPDIDAFAKVRIYSPENQYLACVQVFFSNGKTVSQTAI
                     KWVSAVIAGIGLLLSATLSTFGNSRAASHISANTMLLFLYFQSVVVVCMQHVHRVPPI
                     AAAWTENLVWSMGLIRVTFMQKIFRWYVQSTGGTPDLYLTSKTQSVLTQRAIDYIRSS
                     TVYKRAEEVLYGNQNTMIFRGIKRLGYQMKIEPTSIVPTGFTFFVLCGYLLAGVIIAA
                     KYAIELCIRAGWMDKRRFFEFRQNWRLILKGAILRYIYIGFVQLTILSFWEFTQRDSA
                     AVIVIACLFVVLSCGLMLWSIFRTYHYGQKSIRLYNNPAALLYGDEYVLHKYGFFYTM
                     FSAKFYWWNGVLLSYLFLKSLFVGFAQASGKTQALAIFIFDFFYTIAIIRYKPYLDKP
                     TNVMNILICVVTSINSFLFMFFSDLFKQGYQVSAVMGWVFFILNAAFSLILLLMILTF
                     TLLMVFSKNPDLRFKPAKDDRASFQKTGLSNPFEDSPYSGDNMGSPSTFSSESPYNEK
                     KKNRKYTAADELLALGNVAEDHDNWEDQIHNEKPEAQNGLMSPFMDVSEAGFMDNSSN
                     SNTSASENEKKDMPQRKVSFPGKIMRALSLRGYKDNYNEPKSSINKKAVLPDRNVEGT
                     LDPSSNHDGFYDGDNDFEREHTNPFDSDPENAFSTPDANLGRFDTDVETESFTFSLNR
                     NSNNNNMQ"
     gene            complement(<870096..>871136)
                     /locus_tag="CAGL0H08910g"
                     /db_xref="GeneID:2888726"
     mRNA            complement(<870096..>871136)
                     /locus_tag="CAGL0H08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447186.1"
                     /db_xref="GeneID:2888726"
     CDS             complement(870096..871136)
                     /locus_tag="CAGL0H08910g"
                     /note="weakly similar to uniprot|P53122 Saccharomyces
                     cerevisiae YGL138c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447186.1"
                     /db_xref="GeneID:2888726"
                     /db_xref="GOA:Q6FRF8"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF8"
                     /translation="MMLHLVTLFILVVNKFSCGFIVPQMNHEQPSDIASLVCATRIED
                     ERFPNIKKFLSQYFQAWQPGSNSGGYTGFKIYKHFLFQFLPPLVDNSIKVTFCRDGVS
                     QWTVTQNMQEDIDWNEFICIYDGKSNITSSLRTAAINDINNYHCFKLARRKKYVKRNY
                     SFFLPGSFIGGLYYCNLSKNQKIQILDSSTSNLVVLHSNPVPLCNENNTIPLLPLVSD
                     DLRGYWSYWYSKKSHNKVKEILNANVHKVVPYIHTYNFPSFEYNKTGSIPMFSVRELL
                     FNLITANELGLNGLKNGIRSWFYEVSVTEDYSNFDTKPIIVDVIINTVINVLGQAAST
                     PHRALYKIFKEK"
     gene            <871668..>874779
                     /locus_tag="CAGL0H08932g"
                     /db_xref="GeneID:2888846"
     mRNA            join(<871668..871685,872089..>874779)
                     /locus_tag="CAGL0H08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447187.1"
                     /db_xref="GeneID:2888846"
     CDS             join(871668..871685,872089..874779)
                     /locus_tag="CAGL0H08932g"
                     /note="highly similar to uniprot|P41811 Saccharomyces
                     cerevisiae YGL137w SEC27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447187.1"
                     /db_xref="GeneID:2888846"
                     /db_xref="GOA:Q6FRF7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR011048"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016453"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF7"
                     /translation="MKLDVKKTFSKRSNRVKGIDLHPSEPWVLTTLYSGRVEIWNYET
                     QQEVRSIQVTDTPVRAGKFITRKNWIVVGSDDNKVRVFNYNTGEKVADFVAHPDYIRS
                     IAVHPSKPYILTGSDDLTVKLWNWENDWSLEQTFKGHEHFVMCVAFNPKDPNVFASGC
                     LDHKVKVWSLGQSTPNFTLHTGQEKGVNYVDYYPLPDKPYMITSSDDTTVKIFDYQTK
                     SCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTVKLWNSSTYKLEKTLNLGLERSWCI
                     ATHPVGRKNCIASGFDNGFTVLSLGNDMPTLSLDPVGKIVWAGGKNASVSDIFTAVIR
                     GNEDVEQDEPLPLQTKELGSVDVFPQILKHSPNGRFVTVVGDGEFIIYTALAWRNKAF
                     GKCQDFVWGPDSNSYALIDETGQVKYFKNFKEVTSWSIPVSYGVDKLFSGALLGAKYD
                     GFTYFFDWETGSLVRRIDVDSKDVIWSDNGELLMILNKDSEQNEGSSGYSLIFNKDIY
                     YEVSQQGEVDETEGVDEAFDVLHELNETVTSGKWVGDVFIYTTSSNRLNYFVGGKVHN
                     LAHYTKEMYILGYLPRDNKIYLVDKEIHVYGHQLSIEVLEFQTLTLRGELQEAMESIL
                     PNITEKDALNKIARFLEGQEYYDEALQIATDKDQKFDLALKVGQLDYAHSVLTEDASE
                     LKWRSLGDAALQKFHFKYAIEAYEKSHDLDSLFLLYSSFNLKDKLSELAVQAEEQQKY
                     NLAFDAYWTLGDIKSIKNLLIKSDRLSEAAIVSYTYGLNDDEVLDVIKQWREKLVLDK
                     GNDKLAARIGDLDNNLPPRNINSAPLLDLDEKENTEKPQEPKKTKKNKNKKANKAENT
                     KETPFDDKLETKPSEAATKVEMKEEKPIDTVTAEVVEEETDEKEDA"
     gene            complement(<875104..>875949)
                     /locus_tag="CAGL0H08954g"
                     /db_xref="GeneID:2888754"
     mRNA            complement(<875104..>875949)
                     /locus_tag="CAGL0H08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447188.1"
                     /db_xref="GeneID:2888754"
     CDS             complement(875104..875949)
                     /locus_tag="CAGL0H08954g"
                     /inference="similar to AA sequence:UniProtKB:P53123"
                     /note="similar to uniprot|P53123 Saccharomyces cerevisiae
                     YGL136c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447188.1"
                     /db_xref="GeneID:2888754"
                     /db_xref="GOA:Q6FRF6"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF6"
                     /translation="MIRMNLTLAIRAAHRTQNRCYSRASSKRWLDRQKQDFYTRESKL
                     DNLRSRAGFKLAQLDDVYHVFHKSVPQRILDLGYAPGAWSQVARKRTHPDSIVLGVDI
                     LPCDPPFGVSSMQANILSKRTHQLIRQFFMEQIFMNDSQVESMARNDSDTEQQPQFPV
                     NIILSDMYEPFPQLSPSLNNLTNMPYYRMSNTSGLNFKDHLNSIDLCDAALITAVDLL
                     EPAGSFICKQFSGAETSLFEKRMKKVFDRVEITKPSASRDESKEIYFIGKKKKKNVDK
                     LNVFC"
     gene            <876668..>877321
                     /locus_tag="CAGL0H08976g"
                     /db_xref="GeneID:2888728"
     mRNA            <876668..>877321
                     /locus_tag="CAGL0H08976g"
                     /product="60S ribosomal protein L1"
                     /transcript_id="XM_447189.1"
                     /db_xref="GeneID:2888728"
     CDS             876668..877321
                     /locus_tag="CAGL0H08976g"
                     /note="highly similar to uniprot|P53030 Saccharomyces
                     cerevisiae YPL220w SSM1A or uniprot|P53030 Saccharomyces
                     cerevisiae YGL135w SSM1B"
                     /codon_start=1
                     /product="60S ribosomal protein L1"
                     /protein_id="XP_447189.1"
                     /db_xref="GeneID:2888728"
                     /db_xref="GOA:Q6FRF5"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /translation="MSKITTSHVRENVKELLKYSAETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGTLKLPVCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKK
                     LSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLK
                     KVLCLAVAVGNVEMDEDTLVNQILMSVNFLVSLLKKNWQNVGSLVIKSTMGPAFRLY"
     gene            <877952..>879595
                     /locus_tag="CAGL0H08998g"
                     /db_xref="GeneID:2888737"
     mRNA            <877952..>879595
                     /locus_tag="CAGL0H08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447190.1"
                     /db_xref="GeneID:2888737"
     CDS             877952..879595
                     /locus_tag="CAGL0H08998g"
                     /note="weakly similar to uniprot|Q08966 Saccharomyces
                     cerevisiae YPL219w PCL8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447190.1"
                     /db_xref="GeneID:2888737"
                     /db_xref="GOA:Q6FRF4"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF4"
                     /translation="MMNDTDDESDFMELPLRHNGSRLLDSANDNFSELNEDLDGNLLH
                     SGEKDQSSSSLTKKVRFESNEGNDFNEQATITEHQGLAAMDGGPHQEEESNEFILHAP
                     GHIRLSDRNGIDSDLMLADRSQTSSTVSNKMDVEDLIRAASEVNEYMSQNLDKINSFR
                     SELLSSTDFTRDNKLKDPSNHLNVENTSILANPAHNISGSLSNFELSDNEDSERDSDE
                     LRNYVMNREILLSSSTSLGSTSDFGRKSYNSSTSLSKLLNNNNFEGSQLNLNSVQQEL
                     LKTQQFNDSIDIDVDQAITEIKQRKHSDHSARHEHEEVMDSSTVLLLKYIDDDINFED
                     VTIEKALEIYQQNLSQIMELSKSAVSKSDLTANEQNPEDHNDNEAEKRDEADNDESST
                     KKGDDIRVEGPYEIESPAALNFTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQ
                     ILFLTRDNPDSNIRVRLKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKK
                     LLSKLEVSLIMCIKNERLMITKQKLTASQKILDELQSAL"
     gene            <880434..>884210
                     /locus_tag="CAGL0H09020g"
                     /db_xref="GeneID:2888729"
     mRNA            <880434..>884210
                     /locus_tag="CAGL0H09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447191.1"
                     /db_xref="GeneID:2888729"
     CDS             880434..884210
                     /locus_tag="CAGL0H09020g"
                     /inference="similar to AA sequence:UniProtKB:P53125"
                     /note="similar to uniprot|P53125 Saccharomyces cerevisiae
                     YGL133w ITC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447191.1"
                     /db_xref="GeneID:2888729"
                     /db_xref="GOA:Q6FRF3"
                     /db_xref="InterPro:IPR004022"
                     /db_xref="InterPro:IPR013136"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="InterPro:IPR028941"
                     /db_xref="InterPro:IPR028942"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF3"
                     /translation="MVLYKRKPIELPRPKPLPSDLNVQIWHIDETGEWFPTYEEYLER
                     LDFYTRHQFTCEITGASCLTFFEALDSEESRFKYVEEKFPLKLREPVARFLHFHEIRR
                     LDVLVEKVYARFKNDYFPGELVYLRKPNSTASNANSTVPSETSTPAPPPPEDPKKSGE
                     SSATYFYPIRKYDQLTPPAHPYIIKEKVQFNANSDTNPDGKTGPQTKYMLIDEKDPHD
                     SVIADETQIYRDRSTFTKHLIKCFFKITFQKASYKMGAPWCVKPEYLAMYGLTMDWPP
                     EMLKYKAEPGHVQTDDDGEESDRDRKRSHSGRHDSSDEGEGRKESKKKKKNTLKKEEP
                     TEQKETTENISTASDIEQSAQVQETPLLASAATTITSIVDDMVLPFQPLAQQVFDKLH
                     QYNINLESLDVKETENDTAFPAFDKILQINQFLNTFGNKLYISNFTLEQFITSLKCSD
                     PYELKGEVVYVNLKKDQSEIDDDDLSDWKRNSKMRKMINSKNDEYVEYRIIKDDPADD
                     EMIDNINSNGSSLFVECFVALLRLIINENGDWTCLVVEEWVEDKDIMELPIKNEENSN
                     NVEEIKEEDAKSEDVDMIKQENSNEGATVKSEVSDVPNGTSNDNEKNYAVENGNSEIS
                     TNDQESLQEAEEEKDQEREEEDDSESIEDILYKCLNYRNVNWAERLSKRQFNNNNWLL
                     ILLGVFEDCKHIPMYTDIIQNMFQKILPKGVAQTQIPKQLWRNFCRNLTLKEKVDALW
                     ILVDLVSNYCSEVRSFVDDAMELCGIIRSERFRVSKEIKNVSNSLYQSTIQLRELETI
                     AQMGGQATTFTNIENLQIQPANGDTNEIKPAENGEENSSSQLPVTERIEKLKQELEEL
                     EQKLATLQNDKTILDKQLMLNDGQRLRSLGMDRYGNKYFWFELFGQVLDTVPKSDDHN
                     DWEGLSYQNGRVWLQGPHKDAAKFFLDLSEEQITNWRRIAKQDGRVAATKEVFGVYTE
                     GNKTLYNQPDGTLIVLVDEEGNVNQDITLTPILRKIIDETPAALLLSEEQWYAVETYE
                     DFDFMLNSFNQWGRKEHDLIKQVRPVQEYIQDVYMIRNHNLKLSDLNETEQSLINELK
                     EYEFNDTEHELMKGSDNPNNTEGQLEKIEKSLDTIVQRVMELDDQGETDENKAELKTL
                     EEERDRLLAEQDKLASNGDNGGRLMARSEKKKMLVRIQTKVEKQMEILTDLINNRHFK
                     AMEDVIAWKNDISLKVWGSELRRNASGAKKNTITETVAERFDEIVDLTSRIASQ"
     gene            <884592..>885755
                     /locus_tag="CAGL0H09042g"
                     /db_xref="GeneID:2888470"
     mRNA            <884592..>885755
                     /locus_tag="CAGL0H09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447192.1"
                     /db_xref="GeneID:2888470"
     CDS             884592..885755
                     /locus_tag="CAGL0H09042g"
                     /inference="similar to AA sequence:UniProtKB:P38696"
                     /note="similar to uniprot|P38696 Saccharomyces cerevisiae
                     YHR129c ACT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447192.1"
                     /db_xref="GeneID:2888470"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF2"
                     /translation="MTDFSPDLLNQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL
                     AERSMVTVSNKETYIGNSAYERRATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIE
                     QLQEHPVVLTNSMSTSKKEEEKMCEVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVS
                     CGHRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRS
                     IKERCCVLSKDFYNEIRAYELITSKTSNNKYRLPDGNIIEIGSERFEAPEIIFNPQAY
                     GYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGERLTKEIRKEIDGNQ
                     KIMLNAPHERRFLPWIGGSVLSGLSTMKLLWKSKSAYREDKHFDFNTLYNNRM"
     gene            complement(<886051..>886701)
                     /locus_tag="CAGL0H09064g"
                     /db_xref="GeneID:2888801"
     mRNA            complement(<886051..>886701)
                     /locus_tag="CAGL0H09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447193.1"
                     /db_xref="GeneID:2888801"
     CDS             complement(886051..886701)
                     /locus_tag="CAGL0H09064g"
                     /note="highly similar to uniprot|P18562 Saccharomyces
                     cerevisiae YHR128w FUR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447193.1"
                     /db_xref="GeneID:2888801"
                     /db_xref="GOA:Q6FRF1"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF1"
                     /translation="MSSEPFKNVYLLPQTNQLLGLYTIIRDKNTTRPDFIFYSDRIIR
                     LLVEEGLNHLPVENKDVDTHTSEVFNGVGFMGKICGVSIVRAGESMEQGLRDCCRSVR
                     IGKILIQRDEETALPKLFYEKLPEDIADRYVFLLDPMLATGGSAMMATDVLIKRGVKP
                     ERIYFLNLICSKDGIDRYHAQFPDVKIVTGAIDKGLNEQKYLVPGLGDFGDRYYCI"
     gene            complement(<887366..>888061)
                     /locus_tag="CAGL0H09086g"
                     /db_xref="GeneID:2888832"
     mRNA            complement(<887366..>888061)
                     /locus_tag="CAGL0H09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447194.1"
                     /db_xref="GeneID:2888832"
     CDS             complement(887366..888061)
                     /locus_tag="CAGL0H09086g"
                     /note="some similarities with uniprot|P38833 Saccharomyces
                     cerevisiae YHR127w HSN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447194.1"
                     /db_xref="GeneID:2888832"
                     /db_xref="GOA:Q6FRF0"
                     /db_xref="UniProtKB/TrEMBL:Q6FRF0"
                     /translation="MARKDSGKYAGKSLIDRIGKVNGAGVNRKRAIPGPTPTGPKKAG
                     SAGFTVVNGKLVKADDIGVLLRAAGNSPRDVVKGKREVKKSIRSAKANSVKVPTKPKQ
                     STSKAQKKMKSKPNVITPTNIPTFPVGTGNTLVISTNTDASDKSLVLYNLTLGVNQRN
                     LQKILENLANVSIKRVKVRDLPSGSATAHVWLKKATIEELERVRKLFHGALVDGRTIQ
                     VMISSETSNNLTY"
     gene            <889038..>890636
                     /locus_tag="CAGL0H09108g"
                     /db_xref="GeneID:2888746"
     mRNA            <889038..>890636
                     /locus_tag="CAGL0H09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447195.1"
                     /db_xref="GeneID:2888746"
     CDS             889038..890636
                     /locus_tag="CAGL0H09108g"
                     /note="highly similar to uniprot|Q08977 Saccharomyces
                     cerevisiae YPL260w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447195.1"
                     /db_xref="GeneID:2888746"
                     /db_xref="GOA:Q6FRE9"
                     /db_xref="InterPro:IPR018810"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE9"
                     /translation="MSGVPMSVSGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQ
                     YLNSKDVLNTYQEVLTRVRELDGIRKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDV
                     FQLLSLCFLTVGLKNSAPATYASLSTVQCLLEHLCESNVFTHHDLRPIKERLDEISKI
                     VEKSVESRPEDEVAEFKEIDTERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPD
                     LSDIMERLFKVRRGLLSLAASSKKNIPDENYKEPAKLDDSKHVLSQEYLSNSLEKYKK
                     EVAKMEAMRDENGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGGLTLDPY
                     LQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSK
                     GQSIILYLLRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERE
                     LYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELKVEAEEREDE
                     EDEDEEEDEDDNVSHDRNHDEEYL"
     gene            complement(<891140..>894187)
                     /locus_tag="CAGL0H09130g"
                     /db_xref="GeneID:2888794"
     mRNA            complement(<891140..>894187)
                     /locus_tag="CAGL0H09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447196.1"
                     /db_xref="GeneID:2888794"
     CDS             complement(891140..894187)
                     /locus_tag="CAGL0H09130g"
                     /note="some similarities with uniprot|P36044 Saccharomyces
                     cerevisiae YKL201c MNN4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447196.1"
                     /db_xref="GeneID:2888794"
                     /db_xref="GOA:Q6FRE8"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE8"
                     /translation="MLTNTVAAKVVVGLMVIVCLGYYNYHHAYSNLYNYRSDTSTALP
                     ADSVLSKADVSHDTTAYTKFPNNVVEDFHSTKADTVRSNSGKLLDLARRIYYKYKFDT
                     SPKWMDKYTLKKNLLRYSAGPKKGEPIPAISNLGFYDFDPRMTWSVYLHHFLSTATDD
                     YEDDGEQVQFSWYDWTDFHEVNNMLAASVSSLPCNFVLESAFDREYIEMIEEENGEPL
                     FSYDRKKYSQASWYKMERKKADFHRRNKISDYCEPFNIGKHFGVNSSTLAGVDLTQDV
                     FSRMQPPFYIKKPWDNLRPEVFQLQARIYMWSTLQPPLSITILDGMNNSFQIPINQTS
                     RLNLAQNGMLQNFVNNRTEEKIEQMKKAKWQQDPNDIDVEFDHIELFEKFVNDDRIQK
                     YKVKIPGTNKHALQHDEFIELKEEDFDFDVKSKISELEELEREGMATKQDSMYLDSLK
                     FSLNTPAVLQPKYFAEARGVLQYNGLGHHRDRRFFYGDNLIHDTHEYALRLNSMIRTF
                     QKFAIANGLVSWLSHGTLYGYMYNGMTFPWDNDFDLQMPIRHLHLLAQYFNQSLVLED
                     PREGNGRYMIDVGSSLVTRSHGNGHGNIDARVIDIDTGMYIDLTGLSVSYSRISDKLK
                     LQIGHMISDQNIIVEPKEEPVTDLESLKQIPLGLMTPLQLYNYSTAFKEQFSKAELRT
                     LKENAEREIKDSKGNGWAPRKLNPAQRLEFNKLMKAYNCKNEHFSLLSELSPLRNTLF
                     HSVPALIPNRYVDLLRHEYRVPAQYEFTVFQQNAFIPEFRSWLTYNAIRKYANIHHWY
                     ANLKSIIKSLPPNIVKQFLGLSLSDVKTMYANMVKSHDDDLLALQFASFDLTSYRVKE
                     LGILYSKLTPILKTKLLRELRRNVAPHISSPGKDAFMFNYERKLWKNVTESMDPTEVR
                     IIEEWVMLDIYDNIVTRTDDLMNEKYYLFNISEPVKNIDRSIFAAINPQNTTSTVLDF
                     NKIGTNFFTSKDKSWSLRSDNMLFRTDVNLVPGLFLVGATSQS"
     gene            complement(<895722..>898055)
                     /locus_tag="CAGL0H09152g"
                     /db_xref="GeneID:2888743"
     mRNA            complement(<895722..>898055)
                     /locus_tag="CAGL0H09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447197.1"
                     /db_xref="GeneID:2888743"
     CDS             complement(895722..898055)
                     /locus_tag="CAGL0H09152g"
                     /inference="similar to AA sequence:UniProtKB:P47116"
                     /note="similar to uniprot|P47116 Saccharomyces cerevisiae
                     YJR059w PTK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447197.1"
                     /db_xref="GeneID:2888743"
                     /db_xref="GOA:Q6FRE7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MTVATEKTPHKSSSMFKLFSNKLRGNNDSTPAAAPAPVPTKKLT
                     KAHTSAHISRSASTNTPHPLRNGVTGIPSASPAPRQMTRRSTGVTPTMVKSSKQLSTL
                     TAHNSNPFRNKNGTISSASHTHNGPTNSQHMVYNPYGINNRPTETQSSVRGSSYSRHG
                     SGSHISSGSASSTNNNTDLSFYMHDGDNKIRMLPLPIADPNEFLPDDIKQVSIHLSDN
                     FSFDKDNKTIGSGGSSEVRIVRSNYRSKDVYALKKLNMIYDETPEKFYKRCSKEFIIA
                     KQLSNNIHITSTFYLVKVPTTIYTTRGWGFIMELGSKDLFQLMEKSGWKNVPLHEKFC
                     LFKQVAQGVKFCHDNGIAHRDLKPENVLLSKDGVCKLTDFGISDWYHKENEDGTIEVK
                     QNAGMIGSPPYAPPEVMYWDAKKKYPTSMQKPYDPLKLDCYSLGIIFITLINNIIPFF
                     ESCNMDPKFREYENSYNNFIRYQNKNFRQKGTYKPGPGSEYMLARRFKNADASRVAWR
                     LADPDPETRYTMEDLFNDPWFQSVETCVDVNDVNLVRHPQIKKTSSEGINLVNAADAH
                     PIPSPMVGTDTNGGLHSDSENPAGTHTTEESVETPKPASIRELHKPRSMVDIAESPMK
                     KAATTPLFTLDEEAKEERDHEQETNTTAEADNEKAQTVPTSAVDTNEFASKENATTTD
                     NDNVNTKATTADPTTQQGAEITETGSIAGSISASISASITASMSGSVSGAATAPIPRR
                     DPSNRSIHSNATSTGTAGRKKKVVHHHMEVPGSAFQI"
     gene            complement(<898883..>901978)
                     /locus_tag="CAGL0H09174g"
                     /db_xref="GeneID:2888733"
     mRNA            complement(<898883..>901978)
                     /locus_tag="CAGL0H09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447198.1"
                     /db_xref="GeneID:2888733"
     CDS             complement(898883..901978)
                     /locus_tag="CAGL0H09174g"
                     /note="some similarities with uniprot|P24004 Saccharomyces
                     cerevisiae YKL197c PAS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447198.1"
                     /db_xref="GeneID:2888733"
                     /db_xref="GOA:Q6FRE6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE6"
                     /translation="MEAETKVVYSHDVKGNFVRLPIELVDAVEAANIQVQDVKVKLHG
                     SELLTLGWDGFETTTNGTVEINASLAKLYSLKPGQIITTSIAKFTDEDVAIEVHLEPN
                     SSYDWDIIEGNSRLIQDSILFQTRAVTLQKPFICYLDSMIATFKVTRIVPENVKTVKL
                     TDGTLVVVAPKLNTKSKQKLKNSVPEKCKRLVKSRLCEQQENLEGLTVIIRGEPEKES
                     EYGCISVKRKLHVKNKDPYLRQIPVRVCYSDLVAQEHVLIAPLVWQCLALTAANNELF
                     ELWINTINVQVASSPEDITLIFRPFGSNQHHHTSESKKKSEISQLLDQLKGSLIATDL
                     VLTKQQCVLEIKSNNGEKVPVVDLKDLSHPLEKFLYLNSEPKDISLPPDVLHFSQLHD
                     FGDINVEPIQSVLEVLEEQLLAPLNPAPAFLVEGESGMGKTMLFKYLQRRLATQNQLN
                     VMYIDCNDLLKYSSFEKLRRFWGGIISSCYWTQPAVILMDNADSVFPTTKSDDAQQQA
                     QMQSPHSLGNVARQTLVYLVETLTHMNTKSRGCVRVVLGAAKKYSLDAMFFDTHFVCE
                     TYSLKAPNRDQRAMYLQGFCGTHGEGNTSAYGLCLDSRLDWADIAAETEGFSVRDLKM
                     FSEMLYYRTVMAQRLSQDGSGLVDQVVLDSCVKDFTPSSLRGVQLTKGTGVRWDSIGA
                     LQEAKQILLETLEWPTRYAPVFAKCPLRLRSGLLLYGYPGCGKTLLAGAVAHQCGLNF
                     ISVKGPEILDKYIGASEQNVRELFERAQSVRPCVLFFDEFDAIAPKRGHDSTGVTDRV
                     VNQLLTQMDGAEGLEGVYVLAATSRPDLIDAALLRPGRLDRSVLCDMPDESARLDILR
                     AITREQPGGATQLRVAADVDLAEIARGTRGFSGADLQSLCYNAYLKAVQRQLAHVSTT
                     PTAEQKATDHMEYVVLPGNDTTITADQIRKIVAGRKGYEAVSDYPNGTSGSSENSAQN
                     PDIQAADLQEALQETKPSVSATELARLRTVYANFASDRTGEMPAPHTDPADIGTKLSL
                     M"
     gene            <902895..>903869
                     /locus_tag="CAGL0H09196g"
                     /db_xref="GeneID:2888653"
     mRNA            <902895..>903869
                     /locus_tag="CAGL0H09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447199.1"
                     /db_xref="GeneID:2888653"
     CDS             902895..903869
                     /locus_tag="CAGL0H09196g"
                     /note="highly similar to uniprot|P40107 Saccharomyces
                     cerevisiae YGL225w GOG5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447199.1"
                     /db_xref="GeneID:2888653"
                     /db_xref="GOA:Q6FRE5"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /translation="MSELKSRIGNSGSIANSGPVSILCYCASSILMTVTNKFVVNTDG
                     FNMFFVMLFAQSLVCTMCLMVLKMFGYAKYRPLNLIDVKNWLPISFLLVFMIFTSAKA
                     LKYMPVPIYTIFKNLTIILIAYGEVLFFGGSVTPMELSSFILMVLSSVVASLGDQQAA
                     KIAQPLANNSILSPEYYWMFLNCICSASFVLIMRKRIKLTNFKDYDTMFYNNALALPI
                     LLGFSFLSEDWSSENLAQNFSGESLSAMIISGMTSVGISYCSGWCVRATSSTTYSMVG
                     ALNKLPIALAGLIFFDAPRNFLSIMSIFIGFASGLSYAVAKQKKVQKN"
     gene            complement(<904209..>905048)
                     /locus_tag="CAGL0H09218g"
                     /db_xref="GeneID:2888742"
     mRNA            complement(<904209..>905048)
                     /locus_tag="CAGL0H09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447200.1"
                     /db_xref="GeneID:2888742"
     CDS             complement(904209..905048)
                     /locus_tag="CAGL0H09218g"
                     /inference="similar to AA sequence:UniProtKB:P53078"
                     /note="similar to uniprot|P53078 Saccharomyces cerevisiae
                     YGL224c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447200.1"
                     /db_xref="GeneID:2888742"
                     /db_xref="GOA:Q6FRE4"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE4"
                     /translation="MTIATDACNEHRLKVYREIKANEEHLNSLDHDGSKVTFVVDQEI
                     PEPDENLRVFYFDIDNCLYPSSTRIHDLMQIAIVNYFEKQLGLDKVHAEELNRTYYKQ
                     YGLAIRGLTLHNGIDPMDYNTLVDDALPLQHILKPNLKLRETLIRLRECGKIDKLWLF
                     TNAYKNHALRCVRLLGIADLFDGITYCDYNHAESLICKPDPAAFEKAKRESGLGDFKN
                     AYYVDDSGSNIKTGLSLGIPKCAHLVEDKVLDVLGKTPEGSIVIKDITDLDKAFPELF
                     QIN"
     gene            complement(<905670..>907598)
                     /locus_tag="CAGL0H09240g"
                     /db_xref="GeneID:2888721"
     mRNA            complement(<905670..>907598)
                     /locus_tag="CAGL0H09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447201.1"
                     /db_xref="GeneID:2888721"
     CDS             complement(905670..907598)
                     /locus_tag="CAGL0H09240g"
                     /note="some similarities with uniprot|P40549 Saccharomyces
                     cerevisiae YIL014w MNT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447201.1"
                     /db_xref="GeneID:2888721"
                     /db_xref="GOA:Q6FRE3"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE3"
                     /translation="MKPMNYRARKQFGRRAVLTVVVIFVLLYLSSSSSSPKAGNHVSD
                     KDAVDDPFRMHYEFGLYPASTFSPFSYINTRIMKLKEEKDDPKKAGKKTRTESEEDKI
                     LLNWNKGSRFDQCRLLVKGFYTDEKWNNMNLVYAWSSKDYMEKTAQFAGECMRIYNYC
                     FFEGDVNPRELFKKLDLQATDAYDFQKRMFFFLKNVTQEDSDYLYPTIKNVRTGEVVS
                     KPKTKQSPQEFNSNFFANWRKIASGRGIVLSAKPDDIDMLRQQLSVWKELGNKYPIQV
                     VHKGGELTRDNEISLKQFAEETDQNIYIVDAGPVLDKNFADEHITKFHNKWVGVLFNT
                     FEEYIMVDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNRHIREHCPDLALKLEPS
                     LEEHRILGTTLRFKLLDPDLKQEKTSEERAFNQMRTNLALHHVDSGLVVINKKEKLHS
                     LLLSEFFQNHALFRRCSYGDKELFWYAAFSANTDYVIEPEDAATIGKLEYSEKDRRYS
                     ICAIQMAHTDSNDQLLWTNTGLRNCKIPEVAKKDFDENPKMMTEKYGSLEVMKISYHA
                     PLQIDGYLIPDPEEHEWQQTHVCADYTYCGFVDELNIGYSKAKVHEFSDEEKKRLNKI
                     SKIWNNADVNKERNRIGV"
     gene            complement(<908258..>910135)
                     /locus_tag="CAGL0H09262g"
                     /db_xref="GeneID:2888837"
     mRNA            complement(<908258..>910135)
                     /locus_tag="CAGL0H09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447202.1"
                     /db_xref="GeneID:2888837"
     CDS             complement(908258..910135)
                     /locus_tag="CAGL0H09262g"
                     /inference="similar to AA sequence:UniProtKB:P40549"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014w MNT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447202.1"
                     /db_xref="GeneID:2888837"
                     /db_xref="GOA:Q6FRE2"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE2"
                     /translation="MKTLLRARNPGFKRCSLLAVIAICFLFIFMRADSASQRRSTRYE
                     EDLLFSSGNSTYAYFQRKVKELHDNKPFFSLENMLPSWMLSTHTAREKRVLLNWDKSS
                     GFDQCAMLIKGLYNDPNWDNMAITIDHDNATINDEVFQMSAERVRLYNHCFLQNSYDI
                     NEMFEKYRMYYTSPHDYQRRMFPFLRKVTAMDGYYIYPTITNLRTGEVQTGPIADMSY
                     QEFNSNFIAHWKNEAKGRGIVVTASVNDCRFLRSQFFVWKELGNTYPIQVVTKGKEMP
                     PELIAKIKEYATEADQEVYIVDLQNVLDPNYAEKYIENFHNKWYAAMFNTFEEAILVD
                     ADVVSYVHPDEYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLG
                     TTLKYRLEEESLKDAGTSEADGLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFFH
                     TDAKFKPCTYGDKEIFMLGAYSAGVDYSLDPEAAVIIGPIRESTNKKFNSICSAQMGH
                     TNGRGKLLWSNGGLQVCKNPNFAKDDFEKDVKFMSNNYGTLEDTEKYYKSNLSIDGFI
                     SPNVPNLKFQQQPACHHYMYCVHMPVDGEDMGELVRFDQEQRERVNKISNVWNSVKIN
                     L"
     gene            complement(910652..910724)
                     /locus_tag="CAGL0H09284r"
                     /db_xref="GeneID:2888757"
     tRNA            complement(910652..910724)
                     /locus_tag="CAGL0H09284r"
                     /product="tRNA-Thr"
                     /note="tRNA Thr (AGT) cove score=72.75"
                     /db_xref="GeneID:2888757"
     gene            <911146..>911433
                     /locus_tag="CAGL0H09306g"
                     /db_xref="GeneID:2888718"
     mRNA            <911146..>911433
                     /locus_tag="CAGL0H09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447203.1"
                     /db_xref="GeneID:2888718"
     CDS             911146..911433
                     /locus_tag="CAGL0H09306g"
                     /inference="similar to AA sequence:UniProtKB:P53299"
                     /note="similar to uniprot|P53299 Saccharomyces cerevisiae
                     YGR181w TIM13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447203.1"
                     /db_xref="GeneID:2888718"
                     /db_xref="GOA:Q6FRE1"
                     /db_xref="InterPro:IPR004217"
                     /translation="MALFGGSSSQAPASATDNKVQAFKQQIAQEIAVANATDLVNKVS
                     ENCFEKCLQSPYKDGNEGCVDQCLAKYMRSWNVISKTYINRIQDASTTGEI"
     gene            complement(<911758..>911967)
                     /locus_tag="CAGL0H09328g"
                     /db_xref="GeneID:2888725"
     mRNA            complement(<911758..>911967)
                     /locus_tag="CAGL0H09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447204.1"
                     /db_xref="GeneID:2888725"
     CDS             complement(911758..911967)
                     /locus_tag="CAGL0H09328g"
                     /note="highly similar to uniprot|P22289 Saccharomyces
                     cerevisiae YGR183c QCR9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447204.1"
                     /db_xref="GeneID:2888725"
                     /db_xref="GOA:Q6FRE0"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="UniProtKB/TrEMBL:Q6FRE0"
                     /translation="MSFSSLYKVLFKRNSIFVGTILASAFVFQGAFDTAVTSWYENHN
                     KGKLWKDVKAQIGAAGGDEEDDDDE"
     gene            complement(<912452..>918349)
                     /locus_tag="CAGL0H09350g"
                     /db_xref="GeneID:2888633"
     mRNA            complement(<912452..>918349)
                     /locus_tag="CAGL0H09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447205.1"
                     /db_xref="GeneID:2888633"
     CDS             complement(912452..918349)
                     /locus_tag="CAGL0H09350g"
                     /inference="similar to AA sequence:UniProtKB:P19812"
                     /note="similar to uniprot|P19812 Saccharomyces cerevisiae
                     YGR184c UBR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447205.1"
                     /db_xref="GeneID:2888633"
                     /db_xref="GOA:Q6FRD9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD9"
                     /translation="MDLQAVRMEVRETLNSIHEMNYFKGTRGPTERVKMSFTLKEFLY
                     RYLYYLICDEGKNLPQLFDTAPVGLFPKDLKEIKDIDLVWATKSNSFFTIDKEKVTKV
                     HRHSGRNCGRKFKIGEPLYRCHECGCDETCVLCIFCFNPEDHVGHHVYTDICSDVTSG
                     ICDCGDEEAWNVPLNCKAELEEKNQESTGESNASNENTFMKPETTQLIEVILEEVIDH
                     FIDVFNQNLEPLPTFQHAISLKLKSHTQFGKIKERSEFLNDFKYKNFYNSAANYGETN
                     ENSSSNENIPEENMDKDSDEVADDVASTGGVLQADKTSEDCPTEPKHYTVMIYNDEFH
                     NYSQATTALRQGVPDNVHTDLLTSRIDSEGRAMLKCSMDLSSVMGGFFAVQTNGLTAT
                     LTSWDEYIHQEACKHLIFWITHCLAIPDPDFQNTFRDALGKVLCSQYDSTKTVDMNPF
                     INKHFEHLFEEEGNHDCLNMSVLAPGNKIPLGKHKALSNDSIDKISTGINELIEIKDK
                     NYTNSRVQYLLYFDNRYWKRLRKEVQNMIIPTLSSSFTYKPYFCRQVVEIFNHMTRSV
                     AYMDREPQLTALRECIVQLFTCPTNAAMIFNDGSFIDIVWSVFDIFAEFCKYDGPLLL
                     WQRVQKSNPTKSYSISFKQGLYTVETLLSKVADPNIPLRAPEFVSIVTLCKIFNGAWK
                     LKRKEGEHILHEDQYFIPYLEYTTSIYSIIQTIEKIMEQFKEQIDTNLLRNAIKLVNT
                     FLAHRSLTYREVAGTHEIIKFEVSREPVAYMNPVQTLFSFLIEKTSLTEAKEIVLRDC
                     NDFLKISDFSLRAVVLCAQIDVGFWVRNGVSVLHQASYYRNNPELNSYSRDIHLNQLA
                     LLWEVDDIPRILYNILDRWELLSWFTGETEYNNTVYEDKIGLVIQQFITFLYHLLTER
                     RFFKNYASAKEKRFSQIKTSIMYSLYTKPLSYSKLLKNVPDYLSEDGTEFDKALSEVS
                     TFMEPKGLADNGVFVLKDNLYSKIDPLRLDNLENEFESSASIIKSHLATSKEDVNKTI
                     LVPQLIHPKHLDPLTMRLGAFTRTGVFAKLMYKLLQVCLDTENGLFLNELLHLIHCVF
                     KDDEQVNGKSSIPQNFISKSICNLFLSIANAKSDIFSESITSKADYLLEVMIRKNPED
                     VFDSLITGFGLEYVDEYKTKKLNQGVILEETEKEKKKRLAKKHQAKLMAKFNSQQSKF
                     MKENSAVFDDKENELDMLGNKITASEDFTCSLCQDDTSDDFFVVPVYHDFSPAFREAD
                     VYSAEDYSGKVHGFFNDEEKASATDATVLEDLRLNSEMGSRKVFVSCNHHIHHNCFRR
                     YIQKKRFSSNAFICPLCQTFSNAVIPICQTDKSEEALNLNSFGMPMPILDIVSRLFKN
                     FTVSRYKSIHSIFNLILPQINSFDKIIRKSSEFNDTDTSLIMAAHWANTISMLEISSR
                     LDPPDTNSYIKGREQKFKTLGNILISMSLFYYIMGKPTNKLEIYDSSSESGNCYNQVL
                     QYIVKSTLFENTPVKEAVSRVMFVLIKQTVQSYFKCMWMNDSREDYQFSDMFKDGYEA
                     PELVVSAIRQFENEYFKTNISKTREVHEKDQAYYNIIYSFLLNQIVPSYKRVFIMLKV
                     FHNLVKESEDQPLIIDDVNIESDISIEDYVSFANSATPLLTEFTDFDDMFVQALLDSK
                     FTEGNDTYLKDIPHEYPGVVKLINLKKYLNTYVTDSKQFKLLEEALTNVINPKNRLDF
                     RICLTCGMKVHLRTDRREMSRHLTNCFSSFGLFLMPNTSEVCLFLSQPPSNIFISAPY
                     LNSHGEVGRNAMRRGDLTTLNLKRYEHLNKLWINNEVTGYISRVMGDEFRVNILSNGF
                     LFEITRGQRFPTRPTEIDEDNDFYDDEEIRDVDMDDEDLARGANGIVGGPAAAAAAAT
                     TLFGFPNAAGAQGDVRDFFQIFEDFRDAVQNGDNDEQDFRMDLEDTDGNTWQNQDQED
                     TDDEPEW"
     gene            complement(<918777..>919955)
                     /locus_tag="CAGL0H09372g"
                     /db_xref="GeneID:2888727"
     mRNA            complement(<918777..>919955)
                     /locus_tag="CAGL0H09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447206.1"
                     /db_xref="GeneID:2888727"
     CDS             complement(918777..919955)
                     /locus_tag="CAGL0H09372g"
                     /note="highly similar to uniprot|P36421 Saccharomyces
                     cerevisiae YGR185c TYS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447206.1"
                     /db_xref="GeneID:2888727"
                     /db_xref="GOA:Q6FRD8"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023617"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD8"
                     /translation="MDAEEQYEWITKNLQEVLNPQIIKDVLKEGRPLKLYWGTAPTGR
                     PHCGYFVAMTKLAHFLKAGVEVTVLLADLHAFLDNMKAPLEVVNYRTKYYEYTVKAIL
                     KSINVPIEKLKFVVGSSYQLGGDYTLDLFKLSNMVSQNDAKRAGADVVKQVANPLLSG
                     LIYPLMQALDEQFLDVDVQFGGVDQRKIFVLAEENLPRIGYKKRAHLMNPMVPGLTQG
                     GKMSASDPNSKIDLLEEPKKVGKKINSAYCSPGDIENNGLLSFVEYVIEPIQELKKGT
                     GKFEFFINRPEKFGGPVTYTSFKDLQTAFKEQQLMPVDLKIGVTDAINELLAPIREEF
                     ANSKEYQEAEAKGYPQVVPEKTKKVKKPKNKGTRYPGATKTEEPKVEAVTEELKEASI
                     "
     gene            complement(<920468..>921373)
                     /locus_tag="CAGL0H09394g"
                     /db_xref="GeneID:2888537"
     mRNA            complement(<920468..>921373)
                     /locus_tag="CAGL0H09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447207.1"
                     /db_xref="GeneID:2888537"
     CDS             complement(920468..921373)
                     /locus_tag="CAGL0H09394g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447207.1"
                     /db_xref="GeneID:2888537"
                     /db_xref="GOA:Q6FRD7"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD7"
                     /translation="MSSESRIVGEFSEYLKEVEQRVRREIEAELAEKYERRLKELEAA
                     AEGHTRADSHVRADGNGVEVTEVQERGIEGGFSDKRRPSDEKDRHLKRIRGIKEWPEV
                     VMRLHKRPPSNATMLMWEELECLLIYLHTGVNITEQIKDNVCRVEAVRMAQLVCFTEI
                     TSLEAKIQLVQEGYGKIRSKHVDSMLFSLVARFCPHIVLDANEELVGTYTKAITETDL
                     LTQDRDLFKDDYLANYTADLLSVQELLKQEQVQYNDWTVFLDACIPEKISDGVLRNSN
                     NNLLPWDCAVLEIFKRWGSSRMEAE"
     gene            <921571..>923823
                     /locus_tag="CAGL0H09416g"
                     /db_xref="GeneID:2888723"
     mRNA            <921571..>923823
                     /locus_tag="CAGL0H09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447208.1"
                     /db_xref="GeneID:2888723"
     CDS             921571..923823
                     /locus_tag="CAGL0H09416g"
                     /note="highly similar to uniprot|P39925 Saccharomyces
                     cerevisiae YER017c AFG3 or uniprot|P40341 Saccharomyces
                     cerevisiae YMR089c YTA12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447208.1"
                     /db_xref="GeneID:2888723"
                     /db_xref="GOA:Q6FRD6"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD6"
                     /translation="MLRLLTRLNVPVRAMRPMPLAPLARALPVTRPLALPLRFYSDMN
                     SRKQETGSGGSSDGGPAGDEGSGGKGQGQGKGPGKDPREEMMKAFWQYVKSKEFQNTM
                     YLTIGLSFIYTLMSANEDTSGRDPLTFQDFKAKYLEKGLVKKIYVINKYLVEAELVPL
                     ANDSNGQYGANGMVPRVISFTIGSADVFEEQLDELQDRLQIPPSERIPVQYVERASAF
                     QYLYPFIPTVLLIGGLYFIAKKLNPNANMNGGGGSSGMFGVGKSKAKLFNKETDIKIS
                     FKDVAGCDEAKQEIMEFVHFLKNPAKYTQLGAKIPRGAILSGPPGTGKTLLAKATAGE
                     AGVPFLSVSGSEFVEMFVGVGASRVRDLFEQARQMAPSIIFVDEIDAIGKERGKGGAL
                     GGANDEREATLNQLLVEMDGFSTSDQVVVIAGTNRMDVLDPALMRPGRFDRHIEIDAP
                     DMSGRKAIYNVHLQRLNLDPKLTETAEKRDNLSGKLATLTPGFTGADIANACNEAALI
                     AARHQDKYVELLHFEQAIERVIAGLEKKSKVLSPEEKKTVAYHEAGHAICGWFLQYAD
                     PLLKVSIIPRGHGALGYAQYLPSDQYLITEEQFRHRMIMALGGRVSEELHFPSVTSGA
                     HDDFKKVTNMAHAMVTSLGMSKEIGYLSYDQKGSGFQINKPFSEKTGRKIDLEVKRIV
                     DEAHEACRKLLTENLEDVDKVAKLLLQKEAISREDMIKLVGPRPFPEKNEAFEKYLDN
                     GLNGPAPATD"
     gene            complement(<924130..>925104)
                     /locus_tag="CAGL0H09438g"
                     /db_xref="GeneID:2888715"
     mRNA            complement(<924130..>925104)
                     /locus_tag="CAGL0H09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447209.1"
                     /db_xref="GeneID:2888715"
     CDS             complement(924130..925104)
                     /locus_tag="CAGL0H09438g"
                     /inference="similar to AA sequence:UniProtKB:P40013"
                     /note="similar to uniprot|P40013 Saccharomyces cerevisiae
                     YER016w BIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447209.1"
                     /db_xref="GeneID:2888715"
                     /db_xref="GOA:Q6FRD5"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR004953"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD5"
                     /translation="MSGIGESRTELLNWLNDLLKLNYKKIEECGTGAAYCQIMDSIYG
                     DVPMHRVRFNSTADYENQINYKVLQSNFTKHNIEKTVYVDKLIRCRFQDNLEFLQWLK
                     KYWVNNKDGTPYDAEARRNYRPISSTNSGTPGTPSGLSSASNSSSTLNISKRRNMSDS
                     TSLSRTQSLSTRYASGTSGNNINRRVTSEQIIALQTELSQSHNKIQEMEQEMGTFKEA
                     LTAMEAENNFYFSKLRDIEILVQTTQDFIKEGLYKGDVEELDKFTNKVQHILYATIES
                     ASNEETKDTNESNRITTNNTSSGNIASQTLEGESLRSSNNLIIDEETF"
     gene            complement(<925461..>927686)
                     /locus_tag="CAGL0H09460g"
                     /db_xref="GeneID:2888759"
     mRNA            complement(<925461..>927686)
                     /locus_tag="CAGL0H09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447210.1"
                     /db_xref="GeneID:2888759"
     CDS             complement(925461..927686)
                     /locus_tag="CAGL0H09460g"
                     /note="highly similar to uniprot|P39518 Saccharomyces
                     cerevisiae YER015w FAA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447210.1"
                     /db_xref="GeneID:2888759"
                     /db_xref="GOA:Q6FRD4"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD4"
                     /translation="MSFSVTELVETSPRYAELKKRLSGYKPGSDEYLRALMDTFPLSN
                     HPDYRKFLQAQAVPVPGSQAKGFSPVYRSILSTERLVTCMDKNLATYYDYFLFSARNW
                     PDNDCLGRRPYNDEKQDWEQYYEFDSYQRTLERSQALGSGIMTLVNTKRRRKLTDNKD
                     LIVAILSHNRPEWILTDLACQAYSLPNTALYETLGPETSEYIMNLTESPILIFAKSNM
                     YNVLKILPQLKHLNTLVCIEDLSDEELHMLNTSSLPNATNANGEKISVHTLSQVEKLG
                     ALNKIPIIKPKPDDLYTISFTSGTTGLPKGVEMSHTNIASGLAFAFSTFRKNPDKAHR
                     QLYDLCFLPLAHIFERMICAYDLAIGAGLGFLHIPDPSALVEDLKILKPDNLALVPRI
                     LTRFEAGIKNSFDKSAVSRAISGTIVNAKINRYSTKAGPDDSLVNSLIYKKVLINKVR
                     EQLGLSRTDFMVTGSAPIAKETLLFLKSCLDVGVRQGYGLTESFAGICISEQDEKDVG
                     SCGPIGISAECRLKSVPDMGYDAERDLKGELQLRGPQIFDRYFKNPDETNKAIDKDGW
                     FSTGDVSYIDKKGRLHIIDRVKNFFKLAHGEYIGPEKIENTYLSSSPYITQAFVYGNS
                     LQNFLVGILGLDLESLRPQLMHSHPEIKSWTDEKLLDQINSDKKLRLVLLQLINRSCV
                     GLQGFEKLHNIYVGLEPLKVEDDVVTPTLKIKRQKASKFFKDILDDLYKEGSVIKAQK
                     L"
     gene            complement(<928384..>928788)
                     /locus_tag="CAGL0H09482g"
                     /db_xref="GeneID:2888614"
     mRNA            complement(<928384..>928788)
                     /locus_tag="CAGL0H09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447211.1"
                     /db_xref="GeneID:2888614"
     CDS             complement(928384..928788)
                     /locus_tag="CAGL0H09482g"
                     /note="weakly similar to uniprot|P85052 Saccharomyces
                     cerevisiae YER014C-A BUD25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447211.1"
                     /db_xref="GeneID:2888614"
                     /db_xref="GOA:Q6FRD3"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD3"
                     /translation="MKLTNLLSLVVPISVAMCIDSNNKEELHGYVQGYINELVEKHQG
                     AVLASIQAATDPENEQTIEFHNLQQGIDLDKNKEWTIGESHLKQVDDNILGVMIQKLY
                     SMAKTNLWKRFNLKETGLYYYSFTSTNIFEDL"
     gene            complement(<929241..>930857)
                     /locus_tag="CAGL0H09504g"
                     /db_xref="GeneID:2888612"
     mRNA            complement(<929241..>930857)
                     /locus_tag="CAGL0H09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447212.1"
                     /db_xref="GeneID:2888612"
     CDS             complement(929241..930857)
                     /locus_tag="CAGL0H09504g"
                     /inference="similar to AA sequence:UniProtKB:P40012"
                     /note="similar to uniprot|P40012 Saccharomyces cerevisiae
                     YER014w HEM14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447212.1"
                     /db_xref="GeneID:2888612"
                     /db_xref="GOA:Q6FRD2"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD2"
                     /translation="MLSPLTALPKNAKVAVGGSGIAGLSFAYFLAKMRPDVSVTLYEK
                     AARNSGWINSWQTKDKNGQPVMIERGPRTLRGVSDGTVMMIDAMKDLKSLDIVHFIEH
                     NSDADKKFLLDPNDKLVKVPDSFLSGIKFIMSDLGKGIIPAMLGEFWRKASANPGKDE
                     TVASMLDKRMGNEHLGKNVFSAIYRGIYADDINTLSAKKVMHKMVANELKFGSNTKAL
                     IHSMKTKKDRKKNADSLTLILDKYTKVMGKEESKILELSKKLKHYPMLGFKGGLESFC
                     QTLLKGLESMPNVSVLNNSAITKLISDAKSDNNNITVEINHGKSTEKFDHVRLTGIPH
                     RLGPLLREIDGHIADSLETIKANTVVLVNFYLPDKDVIPKKNRGFGYLVPESNPNKEK
                     LLGVIFDSVIEQNLKNIENAQEMVSSDKKSYTKLTAMVGGYMYNDPATGEPVVPKDEQ
                     IIDAVRNTLERHLGVSPNDLDRGLWQVTPANKCLPKYNVGYMDWQTDMEKKILKLFNN
                     KVSIGGMGFAIGPGIPDVFADGFQDALKLR"
     gene            complement(<931276..>934683)
                     /locus_tag="CAGL0H09526g"
                     /db_xref="GeneID:2888753"
     mRNA            complement(<931276..>934683)
                     /locus_tag="CAGL0H09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447213.1"
                     /db_xref="GeneID:2888753"
     CDS             complement(931276..934683)
                     /locus_tag="CAGL0H09526g"
                     /note="some similarities with uniprot|P24384 Saccharomyces
                     cerevisiae YER013w PRP22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447213.1"
                     /db_xref="GeneID:2888753"
                     /db_xref="GOA:Q6FRD1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD1"
                     /translation="MNKNDDDIESILGTKDPVVVEFVLRIAQESQDLNEFEKKFEALG
                     VVLETDKIQRLYATLTSTVKDDPISSISKVLDSELGISDNVVAEFILQIVKDSPNIST
                     LLKKLTEMNTGVPPIVAKKLFDSYNASQGQLTVKTKVRIKNEVDGLELPNETIKWEDI
                     YDSKDLLSMNFITEDEQPVLGKIYKGIIKKIMPFGCFVQILHLKKECGEGLVHISELC
                     KNKVRHPSDVVKQGQTVYVKISKIMTNGKISLSMINIDQVSGKEKESTDVDVESLKVR
                     GRPGEKQSNPIRKRKLTSPERWELRQLIASGMASIKDYPELLKYDQKEVVDHEGNNDK
                     TEDQSDNINEIEEIDIERNPNDRPKFLRKEGKKVSKKYELPKLSNNPMGSLNRAGSQG
                     SKLMLQHREEKLQKKKDIEEQIKQKRKIEDPTKDPLQIKKEIDDLRQQLTVTSWEKKK
                     SREKVSYGKKSAKPISAQRKSLPVYSMREKLMSEIKNNQFLVIVGETGSGKTTQITQY
                     LDDEGFSKNGIIGCTQPRRVAAESVARRVAEEVGCKIGREVGYTIRFENVTSDVTRIK
                     YMTDGMLQQEALLDPILSKYSVIMLDEAHERTIATDVLFALLKKAAMKRDDLKVIVTS
                     ATLDSNKFAEYFNNCPIINIPGKTFPVEVLYSKTPTMDYIASSLDCVMDIHTSEGPGD
                     ILVFLTGQEEIDTCCEVLFERAKEMGDKIDPLIILPVYSALPSEIQSKIFEPTPRGSR
                     KVIFATNIAETSITIDGIFYVVDPGFSKVNTYSPRAGMEQLVVAPISQAQANQRKGRA
                     GRTGPGKCYRLYTESSYQNEMLPNAIPEIQRQNLLHTILMLKAMGINDLLHFDFMDPP
                     PKSLMVHALEELYHLQALDADGHLTKLGQRMSLFPMEPTLARALLSSVSNNCSDEMIT
                     IIAMLSVQNVFYRPKNKQQEADGKKARFHHPYGDHLTLLNVYNRWERSNCSEDFCNTN
                     FLHFRHLRRAKDVKRQISMIFERLNLPITSCNENPEIIRKTLVSGFFLNAAKRETKSG
                     YKTINGGTEVGIHPSSALYGREYEYVIYHSLILTTREFMSQISGIEPQWLLEVAPHFY
                     KVADENSQSRKKTKIEPLFNRHSKDQNSWRLSSKKQNREKALGMKKK"
     gene            complement(<935231..>935815)
                     /locus_tag="CAGL0H09548g"
                     /db_xref="GeneID:2888716"
     mRNA            complement(<935231..>935815)
                     /locus_tag="CAGL0H09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447214.1"
                     /db_xref="GeneID:2888716"
     CDS             complement(935231..935815)
                     /locus_tag="CAGL0H09548g"
                     /note="highly similar to uniprot|P22141 Saccharomyces
                     cerevisiae YER012w PRE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447214.1"
                     /db_xref="GeneID:2888716"
                     /db_xref="GOA:Q6FRD0"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FRD0"
                     /translation="MDIILGIRVQDSVILATSKAVTRGISVLKDSDDKSRLLSPHTLM
                     TFTGEAGDTVQFAEYIQANMQLYSIRENYELSPSAVSSYVRQELAKSIRSRKPYQVNV
                     LIGGYDTKKEKPELYQIDYLGTKVDLPYAAHGYSGFYTFSLLDHHYRPDMTTTEGLEL
                     LKLCIAELQKRMPIDFKGVIVKIVDKDGVREVEQ"
     gene            complement(936248..936319)
                     /locus_tag="CAGL0H09570r"
                     /db_xref="GeneID:2888739"
     tRNA            complement(936248..936319)
                     /locus_tag="CAGL0H09570r"
                     /product="tRNA-Glu"
                     /note="tRNA Glu (TTC) cove score=62.99"
                     /db_xref="GeneID:2888739"
     gene            <937859..>938569
                     /locus_tag="CAGL0H09592g"
                     /db_xref="GeneID:2888530"
     mRNA            <937859..>938569
                     /locus_tag="CAGL0H09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447215.1"
                     /db_xref="GeneID:2888530"
     CDS             937859..938569
                     /locus_tag="CAGL0H09592g"
                     /note="highly similar to uniprot|P10863 Saccharomyces
                     cerevisiae YER011w TIR1 or uniprot|P33890 Saccharomyces
                     cerevisiae YOR010c TIR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447215.1"
                     /db_xref="GeneID:2888530"
                     /db_xref="GOA:Q6FRC9"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC9"
                     /translation="MAYSKTAILIAAAAALVSAQTPQQLDELNVILDDVKSNLSSYMS
                     LVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDFDGIVPFLSKLPWYSER
                     LAGKLAKDLGEASSSAAPSSSAAPSSSAAPTTSSSAAPTTSSSAAPSSSKASSSAAPS
                     SSKASSSAAPSSSKAASSSAKASSSAKASTTVVTSATKAAISQIGDGQIQAQTANGAG
                     KVAAGMGAGVIAAAALLL"
     gene            complement(<939286..>939996)
                     /locus_tag="CAGL0H09614g"
                     /db_xref="GeneID:2888738"
     mRNA            complement(<939286..>939996)
                     /locus_tag="CAGL0H09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447216.1"
                     /db_xref="GeneID:2888738"
     CDS             complement(939286..939996)
                     /locus_tag="CAGL0H09614g"
                     /note="highly similar to uniprot|P10863 Saccharomyces
                     cerevisiae YER011w TIR1 or uniprot|P33890 Saccharomyces
                     cerevisiae YOR010c TIR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447216.1"
                     /db_xref="GeneID:2888738"
                     /db_xref="GOA:Q6FRC8"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC8"
                     /translation="MAYSKTAILIAAAAALVSAQTPQQLDELNVILDDVKSNLSSYMS
                     LVQDPSSGITLANLPAGVLNLGMALASATDDSYTTLYKDIDFDGIVPFLSKLPWYSER
                     LAGKLAKDLGEASSSAAPSSSAAPSSSAAPTTSSSAAPTTSSSAAPSSSKASSSAAPS
                     SSKASSSAAPSSSKAASSSAKASSSAKASTTVVTSATKAAISQIGDGQIQAQTANGAG
                     KVAAGMGAGVFAAAALLL"
     gene            <942183..>942890
                     /locus_tag="CAGL0H09636g"
                     /db_xref="GeneID:2888740"
     mRNA            <942183..>942890
                     /locus_tag="CAGL0H09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447217.1"
                     /db_xref="GeneID:2888740"
     CDS             942183..942890
                     /locus_tag="CAGL0H09636g"
                     /inference="similar to AA sequence:UniProtKB:P40011"
                     /note="similar to uniprot|P40011 Saccharomyces cerevisiae
                     YER010c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447217.1"
                     /db_xref="GeneID:2888740"
                     /db_xref="GOA:Q6FRC7"
                     /db_xref="InterPro:IPR005493"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC7"
                     /translation="MTLEGYVVKLKDYGACDVSDGLLHYCKIDDGGFFPDLIQRSGPH
                     KTIVGPAYTVLFASVDDPRPEVNYIDNIPAGAFMIIALEKSLQEKPEQITQALYGGLM
                     ANRAQYQNSAGTIVFGRVRDLGEHKECGQPLFSLGVGTCAPKKAVKPVATNVSLPILL
                     PNGCTSAISPGDVLVADENGVVRIPKDTLLESGDKLINYIEQQIAADTLVMEDIRNGI
                     PAKQSQKDRRAALKQLL"
     gene            complement(<943088..>943465)
                     /locus_tag="CAGL0H09658g"
                     /db_xref="GeneID:2888732"
     mRNA            complement(<943088..>943465)
                     /locus_tag="CAGL0H09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447218.1"
                     /db_xref="GeneID:2888732"
     CDS             complement(943088..943465)
                     /locus_tag="CAGL0H09658g"
                     /note="highly similar to uniprot|P33331 Saccharomyces
                     cerevisiae YER009w NTF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447218.1"
                     /db_xref="GeneID:2888732"
                     /db_xref="GOA:Q6FRC6"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /translation="MSMDFNALAQQFTEFYYNQFDSDRSQLGNLYRDESMLTFETSQL
                     QGAKSIVEKLVSLPFQKVAHRITTLDAQPASPNGDVLVMITGDLLIDDEQNPQRFSQV
                     FHLIPDGNSYYVFNDIFRLNYSA"
     gene            <943940..>947986
                     /locus_tag="CAGL0H09680g"
                     /db_xref="GeneID:2888456"
     mRNA            <943940..>947986
                     /locus_tag="CAGL0H09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447219.1"
                     /db_xref="GeneID:2888456"
     CDS             943940..947986
                     /locus_tag="CAGL0H09680g"
                     /inference="similar to AA sequence:UniProtKB:P33332"
                     /note="similar to uniprot|P33332 Saccharomyces cerevisiae
                     YER008c SEC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447219.1"
                     /db_xref="GeneID:2888456"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="InterPro:IPR028258"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC5"
                     /translation="MKSARSPFKKFGHSRENSTDETKNGGHKRTASGHSGHKSHSRQP
                     SGSNIPPVAGNNNTNGHKHNSSRASNSSQNSNFLADQYERDRKAIIKYCFSKPDPKTG
                     VPPNNYITHVRIIEDSKSPNMRPPPDSKLENKKKRVLIVSSKANNTKEVQLHKARENS
                     DKSFQIGRTWTLKELVKIEADSVVPEGFTFTMGKVYYWETNTAKERTVFLKSVVSLYI
                     QTFEGKVPELINLDLSLFYLDEKSYSRAVITRSPSSSLPSSPLRATPNLGASHGNSGI
                     QQLQQAAVTAPAAIPPMNKDRVLKGSNVTPINTSISNVMTMDPPMRSPNRQTSRLSND
                     TGGLSKSPYANNTTINDVHRNYGAPAHSIKSDRQDSLVDNSSGKFSNSELGSDKVIAN
                     SLSKNSTNDKEGNEMVSQHSRESKGFKLPSEKRWSSNLPDDDSRPDFDDSEYNKPPQN
                     RPPDLTNPGMPEYLDKQNNSLRDRPKDNLLEDLNAVLASDDFKAPKTAMYANEDLNSS
                     VISEDGVAPLNLAEVIPLQTKSVEALAEPIDLNESPRMTDDYPIREDVTEDMTESYLD
                     DTKEDTTEMSFEKNDEVRYSHGYEPQIEHVYHEVSTIQEEPDLAKVPARNTDRLKKVD
                     EVPPINVNINDEALMEILTDIHWDVENDDADTLLEKVNTNLSKTEYMFNTSLLTLSKL
                     SNNLQPYETNVNKACDNINPTFSLFLMEMSNCSEDIDYVESQNNGLQIESANKKQLWS
                     TLDNLLKIVSLDEETLNKLLNCPIREKNLPWIEEQLDAMCKAYNAIEGAKNNDESNLR
                     DLEALRQRREFYERVTKLLIDRMVDELGRRFSNLHNSSTSSEQVMNILNNLLVFSPLI
                     LFCKIMSPESYEKLLELWNANSQAIHKTIWDKEFAKLDKNEIMELKANHAILMEKGTE
                     QLLKQWKHFKTTRKTTTDEPIYGDILVSVLEMLESLQKQCIYYQNFIDLYFHISSTQN
                     FTEAIKAKYSPEYNHSLLASIHCIESDREAAVKKMDIVSKAFQSVVTSISVKISDILK
                     EENSVAPALMLYLEQKIKELESTNQDYLSSAYNRLLAQINQSWSEFLEESLVQMERSF
                     HGASLSDALTVINNTAVYMKNIQDLFEYIQSQMKIENTNTFDTVSIVETGCTTLTLRV
                     SKILDRKNDGGSIISGIQGNNSQEDIENTIALIINSNSMVEFLMVLNNYMGGILESSL
                     QESKNIFDCEKEIYAAYILRETMPKLTSFVNGATNMLNTQSAMNNARFAAYSKHNLQN
                     ILAGYSSKDIGVIIEKFHQRIIEQFNPNGELNPMEIVLCDKLWSCLQGNTVSLYLKLQ
                     TLIEKVYPGVSAKFTKNDIISAFEKYRK"
     gene            complement(<948066..>949553)
                     /locus_tag="CAGL0H09702g"
                     /db_xref="GeneID:2888751"
     mRNA            complement(<948066..>949553)
                     /locus_tag="CAGL0H09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447220.1"
                     /db_xref="GeneID:2888751"
     CDS             complement(948066..949553)
                     /locus_tag="CAGL0H09702g"
                     /note="weakly similar to uniprot|P39937 Saccharomyces
                     cerevisiae YER007w PAC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447220.1"
                     /db_xref="GeneID:2888751"
                     /db_xref="GOA:Q6FRC4"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC4"
                     /translation="MVMCAKFKVGDRISYSDYNCTILYVGEISVWPGEIAYGVEWDDD
                     TRGKHNGKLGGIQYFNTIRPKSGSFLKVSKVDVSADPRRSFYDGICEKYGNTASDQFN
                     VNIGTKMVEQLGFDKLNLINKRWNSLGIIDLSSAKIFCAGDNPSTEPITTKDLDLSRN
                     LITDFKEIAKILNNFKSVACLDLSENRFLRFLFDKTIKFCTVKTLKIRSCYLSMNNLQ
                     DILAVFPNVQNLDISGNRLYGNDLANIHLILPNLKSLTVSNNCITNIDLSKLIYLTEL
                     DISSTDIKIQLSDIKSNSITFLNMTHIRLDSWTLVDKINIMFPSLCEIRCSLNWLPPI
                     DAQFPDSKLFILIAILRHINIINGTIIDRRMRKDADYYLECKLKEGALKLEGFTLRMK
                     ELVKKFYNTIETVENHSWLNTNIITISLIIYFDELMHSKMKIYDKYSIRYLKGLISDE
                     FNMKYYQIDIKYESTPGVLIPMSREFSPLSDYGVANGGKIHVNLM"
     gene            complement(<949913..>951472)
                     /locus_tag="CAGL0H09724g"
                     /db_xref="GeneID:2888761"
     mRNA            complement(<949913..>951472)
                     /locus_tag="CAGL0H09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447221.1"
                     /db_xref="GeneID:2888761"
     CDS             complement(949913..951472)
                     /locus_tag="CAGL0H09724g"
                     /note="highly similar to uniprot|P40010 Saccharomyces
                     cerevisiae YER006w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447221.1"
                     /db_xref="GeneID:2888761"
                     /db_xref="GOA:Q6FRC3"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC3"
                     /translation="MRVRKKTSKRTSTRMREGIKKKATAQRRKEKKMAKKDITWKSRS
                     KKDPGIPASFPYKAQILEEIEAKKMREMEERELAKQQRLEAKRAAMEAGVTEEMMDDD
                     EDDSNGLSALVESAQAAAEEYDGHPYSEELQSQPVDVIDYDIDFYTDADNDNDSELEK
                     SRKAYDKIFKTVVDASDVILYVLDARDPEGSRSRRVEQAVLQSQGKRLLLILNKIDLV
                     PPHVLEQWMNVLKSSFPTIPLRAAPGATNKSTFNKKLTQSATANALMDALKTYANNSK
                     LKRSIVVGVIGYPNVGKSSVINSLLSHRGGTSKACPVGNQAGVTTSLREVKVDNKLKI
                     LDSPGICFPGENRSMSKVEQEAELALLNALPPKYEIDPYPAILKLVKRIAGSDEMTEN
                     FKKFYELPPIPSGDPETFTKHFLIHVARKRGRLGKGGVPNLSSAGISVLNDWRDGKIL
                     GWVLPKASKNNTIEPSVQESTISSGAQPAPAKSEQTTIVSDWSKEFDLDGLFSTLDNA
                     IQDSKDQAMQD"
     gene            complement(<951805..>953709)
                     /locus_tag="CAGL0H09746g"
                     /db_xref="GeneID:2888747"
     mRNA            complement(<951805..>953709)
                     /locus_tag="CAGL0H09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447222.1"
                     /db_xref="GeneID:2888747"
     CDS             complement(951805..953709)
                     /locus_tag="CAGL0H09746g"
                     /inference="similar to AA sequence:UniProtKB:P40009"
                     /note="similar to uniprot|P40009 Saccharomyces cerevisiae
                     YER005w YND1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447222.1"
                     /db_xref="GeneID:2888747"
                     /db_xref="GOA:Q6FRC2"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC2"
                     /translation="MASKQYGIVIDAGSSGSRVHVYEWDDPNVLRESENSTPALLRSV
                     PEIRQDPSWTKKISPGLSSFEHKPGKAFKKHIKSLLEFAEDIIPENKRKETPVFIQGT
                     AGLRLIPEDKRTKILHEICNGITKHTDFLLEDCDYQVQVIDGETEGLYGWLSLNYLLG
                     KFNEYEVNANSHFTFGFMDMGGASTQIAFVPSSADDIAKHKEDIATVYLKNVNGDVQE
                     WNVFVSTWLGFGANQARNRYFAQLVNALPENTNKYDDDDFTTRKLTDPCTPKGAKIKF
                     EFKDKEFQILGSGNYEQCSKSIYPLLLKNIPCSDEPCLFNGIHAPHIDFKKDRFIGTS
                     EYWYTANDVFKLGGEYNFQEFNEQVIKFCNSDWQTLKNKSDNGAFNGMPQNLLKDACF
                     KANWVLNILHEGFELPRLGFEKELSQEIEEETPIFQSLERINERELSWTLGRILLYAT
                     STITAGSKSITAGVLPSSLEMEKLGKTFSPGGLIGNSSFYHSKSSHFLRSIFLFLMVI
                     VLLYAFVFKNKLRRLINSSKILEYNSEFISSVKSLFRGAPAFEDKLSQLEEGLPNGRA
                     FREQFEMNPSPSYSRTGSSSRRLEREIYKTGKSPSSSHLSSPSVPGTATRTAFSISDF
                     GKFKDERFTE"
     gene            complement(<954112..>954813)
                     /locus_tag="CAGL0H09768g"
                     /db_xref="GeneID:2888564"
     mRNA            complement(<954112..>954813)
                     /locus_tag="CAGL0H09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447223.1"
                     /db_xref="GeneID:2888564"
     CDS             complement(954112..954813)
                     /locus_tag="CAGL0H09768g"
                     /inference="similar to AA sequence:UniProtKB:P40008"
                     /note="similar to uniprot|P40008 Saccharomyces cerevisiae
                     YER004w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447223.1"
                     /db_xref="GeneID:2888564"
                     /db_xref="GOA:Q6FRC1"
                     /db_xref="InterPro:IPR016040"
                     /translation="MSKQTAVVLGATGLCGEHLLKSAVASQAFEKVYSISRRSLPYVA
                     DCEQIVDKDSSSWASLLPKENFKFLFTSLATTRAAAGGFDKQYQIDHDLNLELAKASK
                     ANGCETIVLVSSTGANKNSWMPYLRMKGEIEEDIIALNFKHTIILRPSALLGDRRDHH
                     KGFGNDLFVKIGNCFYRSRLQSIMGYPVQGEEVGIAGVQAALQEAEKNTESPTVRYVG
                     SSEILELVDNFKNNS"
     misc_feature    955007..955118
                     /note="Centromere Cen0H"
     gene            complement(<955495..>958446)
                     /locus_tag="CAGL0H09812g"
                     /db_xref="GeneID:2888852"
     mRNA            complement(<955495..>958446)
                     /locus_tag="CAGL0H09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447224.1"
                     /db_xref="GeneID:2888852"
     CDS             complement(955495..958446)
                     /locus_tag="CAGL0H09812g"
                     /note="some similarities with uniprot|P40317 Saccharomyces
                     cerevisiae YDR006c SOK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447224.1"
                     /db_xref="GeneID:2888852"
                     /db_xref="GOA:Q6FRC0"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:Q6FRC0"
                     /translation="MDNPRTHTRTRHSSSTATPKSTVPPPVSLTSTSSSLLNTSSNSA
                     GSVTSGDSDKGVDAGIELKEEPSSIITAGTRDSDIDRQQFEMAMRTHEDMYGSEDIGN
                     HDHSNSSTDLPDTEMSCGDEDINMLDKPQQRQGITKKFKSNQDNETENTDGLGFPNSV
                     SNQDRNNLNEDVDMKDYMSTAVPSQQLNSVTPLSKLVDQEVQQSQEQHNNKNIFKPFD
                     MKTGQFLRVDSNSNEQESTTSANNRSNESHQGSITKENNISPDDLSHTERTDTTDKHN
                     KNSALQLNEDNVNSKPTNDTPVVLTDFMNHHNSHKVRSHSVPTILHSSLRRMTTTNIP
                     VVNKDIYPFKTNAAYHQPSTKATNFSKGGIIISKDSAGEGVYQKNMDERGLKADNMTS
                     SSMVALRKAMILSQQFHNETSKRNITENEMLLPTTSLDERIEYLKRTRDVIPLPPINL
                     QGLKEIDLHEIMKNPQLRHDIIFDPLLQFRPNLDGERGVKKRQLAAKYWSDVENEIIV
                     YKERPELFEYGKTRLVPLFDTLKEVLLTIVPQKEATTINNVLDTELNMQELLKGSLVM
                     TNLSEWLAELFKRHCAPMRDAWVDKMSATFKEAETENSLSKLIDGLRIVFQILETMKL
                     DIANHQIRILRPALLSNAVEFEKQYFNTLMNSKRIDLVGSLKWFSQKFDSYVKNNEFN
                     ENNIQIPDVYRICIKSIISLLSCRKMVREYPTSLSFDHARLILLRADIRQIVCLQVCR
                     LLFQQLVANDNSIDKMAKSYIINKYSNKLLVNDIVSIITDDHGNCRWTKNTLSIAVHL
                     CKVISDLKLEYTNNAKGQGSIANTRSAASTKLDTNKINFAKSWLGKQTQPLSDVYGVL
                     ENRIFKLLEDGIYRRSSCTLEGRVKQDFVYLYNANPSQNTEGDTSAMENSGQTLNIDS
                     KVKGIKNSSLFAYPLTDEMRRNMATYAVTEMEEFGNVFRHLYTVVNLHWSVFGMHYAD
                     CLGDKIAKKGI"
     gene            complement(<961286..>961597)
                     /locus_tag="CAGL0H09834g"
                     /db_xref="GeneID:2888694"
     mRNA            complement(<961286..>961597)
                     /locus_tag="CAGL0H09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447225.1"
                     /db_xref="GeneID:2888694"
     CDS             complement(961286..961597)
                     /locus_tag="CAGL0H09834g"
                     /note="highly similar to uniprot|P02309 Saccharomyces
                     cerevisiae YNL030w HHF2 and highly similar to
                     uniprot|P02309 Saccharomyces cerevisiae YBR009c HHF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447225.1"
                     /db_xref="GeneID:2888694"
                     /db_xref="GOA:Q8NIG3"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <962788..>963198
                     /locus_tag="CAGL0H09856g"
                     /db_xref="GeneID:2888834"
     mRNA            <962788..>963198
                     /locus_tag="CAGL0H09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447226.1"
                     /db_xref="GeneID:2888834"
     CDS             962788..963198
                     /locus_tag="CAGL0H09856g"
                     /note="highly similar to uniprot|P02303 Saccharomyces
                     cerevisiae YNL031c HHT2 and highly similar to
                     uniprot|P02303 Saccharomyces cerevisiae YBR010w HHT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447226.1"
                     /db_xref="GeneID:2888834"
                     /db_xref="GOA:P61833"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            complement(<963767..>964630)
                     /locus_tag="CAGL0H09878g"
                     /db_xref="GeneID:2888731"
     mRNA            complement(<963767..>964630)
                     /locus_tag="CAGL0H09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447227.1"
                     /db_xref="GeneID:2888731"
     CDS             complement(963767..964630)
                     /locus_tag="CAGL0H09878g"
                     /note="highly similar to uniprot|P00817 Saccharomyces
                     cerevisiae YBR011c IPP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447227.1"
                     /db_xref="GeneID:2888731"
                     /db_xref="GOA:Q6FRB7"
                     /db_xref="InterPro:IPR008162"
                     /translation="MVYTTRQIGAKNTLDYKVFIEEDGKPVSPFHDIPLYADKEENIF
                     NMVVEIPRWTNAKLEITKEETLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWE
                     DPNQTHPETKAVGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVIAID
                     INDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALD
                     IIKETNESWKQLIAGKSTDSKDIALENTKVTDSPYYSASAASAIPAAAPQADAPIDKS
                     VDKWFFISGSA"
     gene            complement(965445..965518)
                     /locus_tag="CAGL0H09900r"
                     /db_xref="GeneID:2888748"
     tRNA            complement(965445..965518)
                     /locus_tag="CAGL0H09900r"
                     /product="tRNA-Val"
                     /note="tRNA Val (TAC) cove score=72.86"
                     /db_xref="GeneID:2888748"
     gene            complement(<967366..>970713)
                     /locus_tag="CAGL0H09922g"
                     /db_xref="GeneID:2888749"
     mRNA            complement(<967366..>970713)
                     /locus_tag="CAGL0H09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447228.1"
                     /db_xref="GeneID:2888749"
     CDS             complement(967366..970713)
                     /locus_tag="CAGL0H09922g"
                     /note="weakly similar to uniprot|P38229 Saccharomyces
                     cerevisiae YBR045c GIP1 GLC7-interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447228.1"
                     /db_xref="GeneID:2888749"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB6"
                     /translation="MFSFSSKSKIDRFTEQPVSFKEKFLSKKARFKEFVKTKVFNRTP
                     SPPLIEFSEEYLFDCYAPFDLEAQIKRDPALTILSRKVKNKCYSIRDYKRKVFNGSAR
                     TFFKDKASLWAGWSTDSEIPVSNKYTAAYPSPVNSSDDTLPVLAPIDAFSILAATKTA
                     ETDYQYLANDCYVHSNRGVENAAAISVNAKCSEVDLRNFTDSQDERFVPMQEAFEKSV
                     SMEEQFFADISTDNIGLKPAETINATDIGSFFKDASNIDTWKSTVLKPITNVVNNNNN
                     NNNNVIKNVTFKDSNHDLTFKSDDHIVVATHEDSLGAISIDVIAATNSIDPGVVVNHT
                     YSDDDSIDYLTSLRRTHEENHDTTDNNSEFVIEGFQESKTKIHEIDETPADATAEEAS
                     YDRRTNNELVGNSGSLRKFGNLHTDADDTTSFLDSTISDIAADEDVFSFEEVEDQEEE
                     STKSDSNGVRTHMLNSLPAISEDDAEGLKASSDTSEVTETCPTTQFNCNILNNKDPQN
                     RSTDLSHSIIIANDSQYLSPCRSQNSLVIDILEEDSCAEETSFKYSDKGQETGDNCSA
                     NSCIRVNDNILNLEESENSILIIQEECQFTHVTKASQSISSHNVENSLKRQGSDIEKS
                     DSTDGETNIKNPLLKRQRVSSEETVLDEGYYSVQAPNSNEIFSKKISEEVTIVDNLEN
                     SKFNLEKKKTGGSSYRKTNENHLNEDVCNYSEDLLGEQVVETSCEEFKNLKSRFSDVD
                     NNESCSGVKDHCSQGSVDVGSKSVLQCGATIEESIISTNALKNESVRDLPSNFEVKNV
                     SDLSNLDSNTNSLENSFKDQCKFGIDIVKSFIKSSKVNESNTEIDESVESLLDIEEQS
                     DYEYFLVPTFRGELKNKISLSSFISSEKENSIRVNSKIFNKTFQCVKRPISFRNKTFY
                     ENELEAGPDYDELPEFSDFGSDIESGSISMPSKGSIRFDNKSYVCVFDKNKAVDSSNS
                     KNEVSTISSSTGTSDCSLSLNNCSGRLFNPEKRSILKKKISDKIFQEANRMVSCDNIG
                     IDSFLKMLDKGEDERASDMDSISTKKHMQLRNYFDNFVNKNEDMNSSIYEQFERCIEA
                     TADNIGRPIYDYDCLNGKERELIDEMI"
     gene            complement(<971519..>972520)
                     /locus_tag="CAGL0H09944g"
                     /db_xref="GeneID:2888730"
     mRNA            complement(<971519..>972520)
                     /locus_tag="CAGL0H09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447229.1"
                     /db_xref="GeneID:2888730"
     CDS             complement(971519..972520)
                     /locus_tag="CAGL0H09944g"
                     /inference="similar to AA sequence:UniProtKB:P38230"
                     /note="similar to uniprot|P38230 Saccharomyces cerevisiae
                     YBR046c ZTA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447229.1"
                     /db_xref="GeneID:2888730"
                     /db_xref="GOA:Q6FRB5"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB5"
                     /translation="MFIPTTQKVVLIDGKSDDYDVIKYQDFAVPSIGSTDVLVKNKYA
                     GVNFIEAYFRKGYYPCELPYVLGREASGEVVQVGSEVKDFKIGDKVAYLGGSTFAQYT
                     KKSTENHIMNLGQSCPDEDLKLYGSSLVQCLTAISFIDEAYKVMEGDYILVYAASGGV
                     GSILCQLISQRKAHVIAVASSAEKLAMAKENGAEFLINYAEDDILEKVMQYTNGKGVH
                     AAFDSIGKDTFETDLAALRRKGTLVSFGNASGMVPPFAINKLSPKNLKLLRPQVYGYL
                     GTRSEWDHYCSIFKHFVQSKSLKVDISGIYPLSEYAEVAKLLERRQTTGKVTLEIPQ"
     gene            <973025..>973576
                     /locus_tag="CAGL0H09966g"
                     /db_xref="GeneID:2888844"
     mRNA            <973025..>973576
                     /locus_tag="CAGL0H09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447230.1"
                     /db_xref="GeneID:2888844"
     CDS             973025..973576
                     /locus_tag="CAGL0H09966g"
                     /note="some similarities with uniprot|P38231 Saccharomyces
                     cerevisiae YBR047w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447230.1"
                     /db_xref="GeneID:2888844"
                     /db_xref="GOA:Q6FRB4"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB4"
                     /translation="MYWPLMRRALAKISYRPLVIARPSCRPYSKEVSSKIIIPPAGHF
                     GEELNYAGAVVTKKSNIPMHEYRQLPDDSNYIEKYYAELDVFLQYLQTQLHKSYVDFE
                     NDPDELVFQLEKYIELQVRSNYDANKAGEKLVIDRFVAFCEGVKLTLWLNGGHCFIFD
                     VLLQTKGEFDKLETTKKKQEIHA"
     gene            complement(<973850..>975811)
                     /locus_tag="CAGL0H09988g"
                     /db_xref="GeneID:2888735"
     mRNA            complement(<973850..>975811)
                     /locus_tag="CAGL0H09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447231.1"
                     /db_xref="GeneID:2888735"
     CDS             complement(973850..975811)
                     /locus_tag="CAGL0H09988g"
                     /note="some similarities with uniprot|Q12457 Saccharomyces
                     cerevisiae YDR026c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447231.1"
                     /db_xref="GeneID:2888735"
                     /db_xref="GOA:Q6FRB3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB3"
                     /translation="MSEHKEDDQSVEEAVMKYVGSLSGGARGDDGDAVPETDGGALLE
                     SHTGNGGKSKKSKKRRGSKVSKRERKRSLEGGHSKKLKLSEDISNNVPDITSADDEGF
                     IVDPDLADLEDPSVMMDQPDPIVQKALLASRDVDKTTDLSQYNSDGQSSSDEAKAMKD
                     LESYVEGQQHDLAVDGGADTEQPQDKLNYEPNDQTLDIGLGDGSRSYDDELSNPLSKP
                     LEGKNYQEVLPKVINTKQRNDTTFGNKITLGGTEYDVDVPESVRVRQLLKEAVINASK
                     LVDKETADSVRAASKKGAGGSVQPDGRIISSKAFSKEEDEALEKFVNEYQIIEGVTRR
                     QVCERIWNSDRPRDNFWHSIYQVLPYRTSASIYKHMRRKYHIFEQRGKWNKEEDEILE
                     KLCKDKEGQWVEIGKVLGRMPEDCRDRWRNYVKCGGNRSANRWTAEEEEMLKRVVNEM
                     MEEANGQYRGMDESGNNIGELGSGDQTDLGIDDSNSMISDKKENNLSFKDVINWTIVS
                     ERMQGKRSRIQCRYKWNKMLKREASDRLDSRDEEDMKWLFKRIIQLEITDEKSLDWQE
                     LAESNPSSEMTPLEAEVCYDKLKRLVKEIKNKNPTEVATKVLAHFEYQASDDIETNKQ
                     LHTHTAKFIRVHPSTTLTSHAVEVLQNRR"
     gene            complement(<976466..>977299)
                     /locus_tag="CAGL0H10010g"
                     /db_xref="GeneID:2888548"
     mRNA            complement(<976466..>977299)
                     /locus_tag="CAGL0H10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447232.1"
                     /db_xref="GeneID:2888548"
     CDS             complement(976466..977299)
                     /locus_tag="CAGL0H10010g"
                     /note="weakly similar to uniprot|P38835 Saccharomyces
                     cerevisiae YHR131c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447232.1"
                     /db_xref="GeneID:2888548"
                     /db_xref="GOA:Q6FRB2"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB2"
                     /translation="MEMLLRDRNGRKRRSSAGAGSGGSGGSGVGGVGGGSGSGAENRV
                     RKVRFSETVQCMAVDGAGVVRALSDVVLSDCVSVEYTLSGRRSGVRRRYEYNRVVTYG
                     DIEDFLPGEAVDQGLLQPPLGAVHVEAIHLGSVPKTAVVVGENEVVDVPRDAMAGIDI
                     LLSADSSAETLSLRRTPRSSSIRLTGAAAGLKRSASLSPRSLYNSTFIFNSDDDIDAD
                     GTDSDTGIDTEAETERNADTDTDIDDPTAKNPYPATQASLQPLAHDRNATAGPPPDVL
                     N"
     gene            complement(<978463..>979059)
                     /locus_tag="CAGL0H10032g"
                     /db_xref="GeneID:2888755"
     mRNA            complement(<978463..>979059)
                     /locus_tag="CAGL0H10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447233.1"
                     /db_xref="GeneID:2888755"
     CDS             complement(978463..979059)
                     /locus_tag="CAGL0H10032g"
                     /note="highly similar to uniprot|Q12335 Saccharomyces
                     cerevisiae YDR032c PST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447233.1"
                     /db_xref="GeneID:2888755"
                     /db_xref="GOA:Q6FRB1"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB1"
                     /translation="MARVAIIIYSMYGHTAALAEAEKRGVESAGGKADIYQVAETLTA
                     EQLEQFGAPAKATYPIATRDTLEEYDAFLFGVPTRFGNFPQQWKAFWDATGGLWAKGA
                     LQGKAAGFFVSTGTGGGNESTVINAISTLAHHGIVYVPLGYKNVFAQITNLQEVHGGS
                     AWGAGTIAGPDGSRQPSELELKTHELQGKYFSETVKKL"
     gene            complement(<979535..>980596)
                     /locus_tag="CAGL0H10054g"
                     /db_xref="GeneID:2888736"
     mRNA            complement(<979535..>980596)
                     /locus_tag="CAGL0H10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447234.1"
                     /db_xref="GeneID:2888736"
     CDS             complement(979535..980596)
                     /locus_tag="CAGL0H10054g"
                     /inference="similar to AA sequence:UniProtKB:P38235"
                     /note="similar to uniprot|P38235 Saccharomyces cerevisiae
                     YBR053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447234.1"
                     /db_xref="GeneID:2888736"
                     /db_xref="GOA:Q6FRB0"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:Q6FRB0"
                     /translation="MGKTKYQELQPFYHVADARLSEGLTYIKETDTLLWVDIYRGEIH
                     RLDSVSASGTANHKVFNVSQSTYSSGAAIKYPKTPTPLRESVGCIFPVITDGQVDTVL
                     FGSKFGVGRCQFSSGEWEYLTLYSHCPELASGDRWLDLRSNDGNVSPDGKSLYVGVMC
                     DFHVPMQDIGAIVRVDLVGSAALPLPVHLVIDRVKIPNAIHWNSAGTKMYWTDSLHFC
                     LWEQDGDDSSTKKKLIDVQRHNPEFESPEPDGSATDLVNNVVYVCVWSTHKVQKYSLE
                     DGTLLHEYVLPQSTPRISSCCFVGRDLCITTANLDIEQGSSASGDSVGGCIYKLTDVL
                     DSSTDVGSAKRQPDISQLP"
     gene            <982652..>983629
                     /locus_tag="CAGL0H10076g"
                     /db_xref="GeneID:2888888"
     mRNA            <982652..>983629
                     /locus_tag="CAGL0H10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447235.1"
                     /db_xref="GeneID:2888888"
     CDS             982652..983629
                     /locus_tag="CAGL0H10076g"
                     /inference="similar to AA sequence:UniProtKB:P38079"
                     /note="similar to uniprot|P38079 Saccharomyces cerevisiae
                     YBR054w YRO2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447235.1"
                     /db_xref="GeneID:2888888"
                     /db_xref="GOA:Q6FRA9"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA9"
                     /translation="MSTFVDLYKRGGNEAVKINPPTGADFHITSRGSDWLWAAFCVFL
                     LLAIVFVLLMFRKPVNNRFVYLTAIAPNVFMAIAYFSIASNLGWIPVRAKYNHVRTST
                     QQQHPGVRQIFYARYVGWFMALPWPLIQASILGKTPVWHVAFNCTMGCVFSVCFLIAA
                     CVHSTYKWGYFTIGCGAGIVSIISLMTTTYTLIKKCGDKEIKRCFLIYVCPIIVLYLV
                     AWPVCFGITDGGNVLQPDSEAIFYGIIDLLLLGIFPALYVPMASHVGYENITYGIFDS
                     AIGGAAPGGMAHSASMDIEKSPMSATSSPTPVSPTPKAGIKKPKLKLKK"
     gene            complement(<984334..>986919)
                     /locus_tag="CAGL0H10098g"
                     /db_xref="GeneID:2888619"
     mRNA            complement(<984334..>986919)
                     /locus_tag="CAGL0H10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447236.1"
                     /db_xref="GeneID:2888619"
     CDS             complement(984334..986919)
                     /locus_tag="CAGL0H10098g"
                     /inference="similar to AA sequence:UniProtKB:P19735"
                     /note="similar to uniprot|P19735 Saccharomyces cerevisiae
                     YBR055c PRP6 snRNP(U4/U6)-associated splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447236.1"
                     /db_xref="GeneID:2888619"
                     /db_xref="GOA:Q6FRA8"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA8"
                     /translation="MSGYRPAFLDQKPPPGYIAGVGRGAFGFATRGQKNETPRVPKRY
                     TKESNDDDDEDVFASIEEKRARKRAPKPEERSKADFIPLKRKLANVTEDQWLNLPEAT
                     DMTRRNRRIRLEEQMNRKTYAAPDSLLDSNSVDLVKLTEEREKLLARQLDTDFFAKNE
                     PNDQEMKTLKYIADIDKDSVNIVRRGDDEEVQKQRLVLKSYRRAEPKDPTSWIASAKL
                     EENCGNYELARELIQQGCLQCPLDEIIWLENLRLNVSNNEKKKIIVANAIRFQPKSVA
                     LWLEGIKYEEQPANKFRVIQKALREIPAEEEIWKLAVKYNPNDYDSLRICKKALEFIP
                     TSFYFWAILMKEPYEDVMNTLEKVITQNPKQIDLKVYKLMNEEIHKKIDSVSQCKSVI
                     IKELGINMKDMDKSVVTKWLDKVEIWNKSIAVDITTASLCEVIFDSIGEKIVKEYGLN
                     YLDNISNVKIQIIFLKSYLKFEPTKISVWQKLKNICVKSYNIDKFFQVFEELLFDRDT
                     QNSYEMVKIHPNLVLLYVKELWKHDGNPDKALEILSKTLNEIPNFIEGWLAKIKILLQ
                     TGRLDCVASIFDKLLNSLETANYDDHNKERLLYRHVSFLRFMDENEKAVSYIENKYLL
                     LFPQSVKLKLQLVQIYEDMGMNSICSRLYDDYTKRLPSHAVFWIEYANFIQRTSGNTS
                     RARSILDKGIVHNPSNVSLIVAKVKLEETVGNFAQEELLISQGLQTFAKDAELWACRM
                     RLSKSKKSSLKKTLFQDALKATNNSYLILFEVGRSFYNDNQYKVAMKWFDRAVTKQPR
                     FGDGWAYIYNCKQKLNDDLDKLLEKVAELDPAYGEEWIKVSKNVKMQYLSSPVILKKV
                     AERCK"
     gene            <987346..>988833
                     /locus_tag="CAGL0H10120g"
                     /db_xref="GeneID:2888595"
     mRNA            <987346..>988833
                     /locus_tag="CAGL0H10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447237.1"
                     /db_xref="GeneID:2888595"
     CDS             987346..988833
                     /locus_tag="CAGL0H10120g"
                     /inference="similar to AA sequence:UniProtKB:P38081"
                     /note="similar to uniprot|P38081 Saccharomyces cerevisiae
                     YBR056w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447237.1"
                     /db_xref="GeneID:2888595"
                     /db_xref="GOA:Q6FRA7"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA7"
                     /translation="MFDKLKQKFEKLSVGGSSGEPIPTEEVVFGEELPEEVVYKYRYN
                     HGVNLGSLFVLEEWIFNSVFEHGGGNEFDAVNNYLKNGKSEDEVAKKLQDHYHDYSCR
                     IDWDWLKNEVGITAVRVPIGYWHVRDGDLLSGLPFEPLKKVYHLAKPTNYLKDIIESA
                     RNRGIGVLIDIHGLPGGANGDGHSGFPNRGADFFRNSGYIDRICNDIIPAIIEDICKP
                     NKNVIGLQVVNESVFDNNAHGQKNYYKRAIQTIASNQPGLPVIISDGWWPQQWSDWLK
                     QEKLDLVTVVDTHVYRCFSDEDKKKSADQIINDLEGSTSFPKNDADFVVGEFSGVLDE
                     ETWKKSPGDRNEYAKQFLNKELEVFSKSSSWGWFFWTLQFKYGDGGEWGLKPMYERGG
                     IKKRSTQNNLNIDDNRVRQIIDEHINYWKDKGGDKFEHWRFEDGINSAISDIKEFARF
                     DNSRLGRWHAWKAQRRNDYMKKKGDSEYMWEWDQGYDRGIAEFNF"
     gene            <989652..>990770
                     /locus_tag="CAGL0H10142g"
                     /db_xref="GeneID:2888486"
     mRNA            <989652..>990770
                     /locus_tag="CAGL0H10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447238.1"
                     /db_xref="GeneID:2888486"
     CDS             989652..990770
                     /locus_tag="CAGL0H10142g"
                     /note="highly similar to uniprot|P14843 Saccharomyces
                     cerevisiae YDR035w ARO3 2-dehydro-3-deoxyphosphoheptonate
                     aldolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447238.1"
                     /db_xref="GeneID:2888486"
                     /db_xref="GOA:Q6FRA6"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA6"
                     /translation="MFIKNDYRGDRTRLEDWRIKGYDPLTPPDLLQHEYPISEKGAAN
                     ILKARDSVCDILNGKDDRMVIVIGPCSIHDPKAAYEYADKLAVIAEKLSDDLLIIMRA
                     YLEKPRTTVGWKGLINDPDIDNSFQINKGLRISREMFTKLIEKLPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAIDAMRAASHEHYFL
                     SVTKPGVTAIVGTEGNSDTFIILRGGKHGTNYDAENVKSTKEQLRKAKLIDEADSTRR
                     IMIDCSHGNSNKDYRNQPKVAQEIYNQLSAGENGLCGVMIESNLVEGRQDVPPEGGRE
                     GLKYGCSITDACIGWDTTESVLELLAEGVRNRRKHLSK"
     gene            complement(<991125..>992579)
                     /locus_tag="CAGL0H10164g"
                     /db_xref="GeneID:2888722"
     mRNA            complement(<991125..>992579)
                     /locus_tag="CAGL0H10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447239.1"
                     /db_xref="GeneID:2888722"
     CDS             complement(991125..992579)
                     /locus_tag="CAGL0H10164g"
                     /note="weakly similar to uniprot|P38236 Saccharomyces
                     cerevisiae YBR057c MUM2 meiotic protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447239.1"
                     /db_xref="GeneID:2888722"
                     /db_xref="GOA:Q6FRA5"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA5"
                     /translation="MSYFYNFNQGDGFANNTSMGTQDQSAFQNQNQNQVQNQSQGKAH
                     TQFGSGQTYIASSMLNGMSGSSYSGNYEKNVNSPQDASAYANYFQPLQNAFNSSPGFQ
                     TVTQNNLATDYSYSHANSNGNNQIASSGSTDTTTTDTTAYNVSTNNDRFPKMTSDLTH
                     MTSQQSRYPNTTSDKGVDDQLFTSRYNSMGTLTSTSTISSIPAKQDNASYLGQVNYNG
                     IPSNRNYTASSTTHSAMLGNSFTSDAVTGYYYPTNRETNKQGLINSTKLPSRYSGSDN
                     GQVYNNATTFDATQSSQPSNCSATVNPKEPKESSGEIDTLKYDIQVKDAQLQSLQREL
                     TRLKSAISVAVDNTKDISSKTADKEEHITTKEIDVPNSLDIIFRKLSSALQKREKELD
                     ETKTNLESVLAAMALNPSNSSTKFGRYDPENLAHKTVVRLETLTKENQEMARMLSFGR
                     AKEKHIALELLKKENKDLKTQIIQLKEKLGKDKV"
     gene            complement(<993354..>995690)
                     /locus_tag="CAGL0H10186g"
                     /db_xref="GeneID:2888897"
     mRNA            complement(<993354..>995690)
                     /locus_tag="CAGL0H10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447240.1"
                     /db_xref="GeneID:2888897"
     CDS             complement(993354..995690)
                     /locus_tag="CAGL0H10186g"
                     /inference="similar to AA sequence:UniProtKB:P38237"
                     /note="similar to uniprot|P38237 Saccharomyces cerevisiae
                     YBR058c UBP14 ubiquitin specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447240.1"
                     /db_xref="GeneID:2888897"
                     /db_xref="GOA:Q6FRA4"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016652"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA4"
                     /translation="MSDQILQGLEVPAIIAKEECIYCFETPYNPEKPGSKEQQLTDST
                     KAAHTLNICLVCFQAVCPRHTPFHIEVGKHNDAQHFDYLNVAKVRKYEDMLDGEEDED
                     TNSSKKIKLQVIEKSRDEDYNDVWSLLHFESSQSSPHIVLKSNEANAAQTEKVDHVLN
                     AKSQDLADQANVWELDIKPCKHVDSFSFANVQEKPLETHCSSCELTQNLWICLYCGNL
                     GCGREQVGIEGHSHALEHFKSKNDHCLAIKLGSLSSSSFDLYCYACDDEVKFNDLQVL
                     KTTLAKYGIDMDKKSADEKTLVELQVEQNMNWDFKMVDEKGQQLKQLNASQELGCGLI
                     NLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPSLNVVYPANNLKSQLTKLRTALKEEP
                     TIYKQGIRPKSFKKCIGGSHEEFSSGRQQDALEFFTYFVDELDKKLFKNSDYNPNDLM
                     KFMMEDRLQCQECHGVKYSTETSNVIQLPLQESNDAQDLEERINAYFSGEVIEFKCPN
                     CKKMVNAVKKPAMRTFPDTLVINPIRIKIENWTPVKTSNLLTIPGLETPTEVLELTQY
                     KGNGLQKDTETQLNDDNDEIQFEVNETFVNQLMEMGFTENACVRALYHTGNKDPELAM
                     NWLFGHIEDADVNAEFIPPKKAKNDVNPEHISMMVGMGLDPKLCRKALILNNHDVTRS
                     VDWVFNNMDDDGEIEELKEQSDTSKTYGHHDAKPYELSAIICHKGNSVHSGHYVAFIR
                     KMVDGKPTWVLYNDEKIVVSNNFEEMMKNSYMLFYSRT"
     gene            complement(<996157..>996411)
                     /locus_tag="CAGL0H10202g"
                     /db_xref="GeneID:9488006"
     mRNA            complement(<996157..>996411)
                     /locus_tag="CAGL0H10202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999509.1"
                     /db_xref="GeneID:9488006"
     CDS             complement(996157..996411)
                     /locus_tag="CAGL0H10202g"
                     /note="highly similar to uniprot|Q3E790 Saccharomyces
                     cerevisiae YBR058C-A TSC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999555.1"
                     /db_xref="GeneID:9488006"
                     /db_xref="UniProtKB/TrEMBL:B4UN12"
                     /translation="MSTGNDKKSTMRYVLTLKERRELEGKGITMMHRVEDFMDRIYWM
                     YYIHMPYYLMTSFDAFCLHTFFLMIFSLSLFGIVKYCFFL"
     gene            complement(<996853..>999936)
                     /locus_tag="CAGL0H10208g"
                     /db_xref="GeneID:2888744"
     mRNA            complement(<996853..>999936)
                     /locus_tag="CAGL0H10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447241.1"
                     /db_xref="GeneID:2888744"
     CDS             complement(996853..999936)
                     /locus_tag="CAGL0H10208g"
                     /inference="similar to AA sequence:UniProtKB:P38080"
                     /note="similar to uniprot|P38080 Saccharomyces cerevisiae
                     YBR059c AKL1 Ark-family Kinase-Like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447241.1"
                     /db_xref="GeneID:2888744"
                     /db_xref="GOA:Q6FRA3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA3"
                     /translation="MERPNSRSMTSLNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGF
                     AQIYVVKFVEYLNEFESLGSKSAITVGDIACLKRVIVNDEMGLNEMRNEVEVMKKLKS
                     SPNIVQYFDSNASRRTDGKPGFEVLLLMELCPNKSLLDYMNQRLKTKLSESEILKIMY
                     DVSIGISNMHYLDQPLIHRDIKIENVLVDANNNFKLCDMGSTSQCSPPMMSNQDIAMM
                     TQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIWALGIFLYKLLFYTTPFEITGQMAIL
                     HSKYDFPPNKYSSKIINLIIIMLAENPNLRPNIFQVVYHICSIMNLPVPIEDRYGLGP
                     YNFDLYTKFQSKVQTIQNQINYLQNKVVSSKSKLSKEDGLVLDELYIKTFEMIPKIPN
                     PRLSEKQPTLEIGLNSPSIQDQHLDVNNKRRSMHESINSRQASDNISQKSVRTSSNTI
                     EKTFSQTSNKEFSKETDPESHDESGEPYFPSVNELNTYLDKEFKQQKAQDNVVKNQII
                     NNSGGNMNSSNPERQKSISSFSSSGKSMKSSSHVPSAGFVGADATEGPKMVGYLKSQN
                     HKSNNPFPFMAGDRQRSTESLNNKHNNYDANNTTAPVKGNYGGIQANNIPSQPKNFEY
                     NNPVNDTNRIQDTGIGQSAGRPQNVSQFSNTKMNFVPGTNMSVNFDVTNPINQHNIPI
                     SQGVVNNSGVPSNQGFHNKVPLPNAGSNYIPFPPRPQMMQQSYEAPQKQMQKYDQVYH
                     EQPSQQNAYINTTPQEVQNEQLLIDISPPRDIKRTSSPQKELSNVKTHAPQVLDLQLN
                     EMDISEASIADSSNGNDVDSSLLSSESVDLDVTNRLKMHYPFGNQRQTKLAQKPIQSK
                     VKDTDKQQKNGRRSLDLSVQEVHFNSEAGKNNLLHNKNTHRPGIKGSMSEESVEDTIK
                     SLPPSNTLPRSQSSKVISQSTNARTSLDRQRQRHIEPRDSKSRSRSHGLEEYTSSNGS
                     NSSINISTSNKFEMKRSFAKARQSLDLERARRDAMSRSNSGHETGKRKSLFSMFK"
     gene            complement(<1000574..>1002118)
                     /locus_tag="CAGL0H10230g"
                     /db_xref="GeneID:2888758"
     mRNA            complement(<1000574..>1002118)
                     /locus_tag="CAGL0H10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447242.1"
                     /db_xref="GeneID:2888758"
     CDS             complement(1000574..1002118)
                     /locus_tag="CAGL0H10230g"
                     /inference="similar to AA sequence:UniProtKB:P32833"
                     /note="similar to uniprot|P32833 Saccharomyces cerevisiae
                     YBR060c RRR1 origin recognition complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447242.1"
                     /db_xref="GeneID:2888758"
                     /db_xref="GOA:Q6FRA2"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA2"
                     /translation="MSPPETPKKESLKENEDLAIKENGTSPREIGDKIKVESAGEYET
                     PELTSDEENLVQLQTPRKRRKVNLSKEHDFTSPLKKVIMNNLNEYKKSDLADKLKLSR
                     DFVNTQVPRPADVEKLKANRAVTSFTDTFEGYFEQKRSVRGVKVSKNSITMAPHVTRE
                     EFGLISNIFHRNLHKNLRDHLYIIQKKLYPQYWFEVIQGFSLLFYGIGSKKVFLEDFV
                     FKYLSPKLALSQAIEVPTYNGKKSKFEGIPVVVVNGYNPTCNYRDVFKDILSLLTPAE
                     LTQSESKFWGNHVIMNIQKLIDYYKDKPLDIKLIVAIHNIDGPNIRRGDSPTILSFLS
                     LIRQVAIVASADHIYAPFLWDNLRAQNYNFVFHDVTNYAPYEAESSFQDVMRLGKSEN
                     STGAEGAKYVLQSLTLNSKKMYKLLIETQLQHMEKVSTTKSTGKVAASKRGTMSMGVE
                     FKQLVHLCAADFIASNEMALRSMLTEFIEHKMASVSKNTVGTEFVWVPYTYAEMKRLQ
                     EILYEE"
     gene            complement(<1002563..>1003492)
                     /locus_tag="CAGL0H10252g"
                     /db_xref="GeneID:2888674"
     mRNA            complement(<1002563..>1003492)
                     /locus_tag="CAGL0H10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447243.1"
                     /db_xref="GeneID:2888674"
     CDS             complement(1002563..1003492)
                     /locus_tag="CAGL0H10252g"
                     /note="highly similar to uniprot|P38238 Saccharomyces
                     cerevisiae YBR061c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447243.1"
                     /db_xref="GeneID:2888674"
                     /db_xref="GOA:Q6FRA1"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA1"
                     /translation="MGKSSKDKRDLYYRKAKEEGYRARSAYKLLQLNEEFHFLDDPEL
                     KRVVDLCAAPGSWSQVLSRKLFAEREPVADGQEDDRKIIAVDLQPMSPIDHVITLQAD
                     ITHPRTLERIYELFGNQKADFVCSDGAPDVTGLHDLDEYIQHQLIMSALQLTTCVLKR
                     GGTFVAKIFRGRDIDMLYSQLGYLFEKIVCAKPRSSRGTSLEAFIVCIGYNPPAGWEP
                     KLDVNSSVTEFFATCDLGKLSIDDTLQPWKDQPRSIADFMACGSLSSYDSDATYHDLP
                     KYGVALDPVQAPTNPPYKRALELKRDGKLTRNI"
     gene            complement(<1003801..>1004483)
                     /locus_tag="CAGL0H10274g"
                     /db_xref="GeneID:2888536"
     mRNA            complement(join(<1003801..1004312,1004468..>1004483))
                     /locus_tag="CAGL0H10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447244.2"
                     /db_xref="GeneID:2888536"
     CDS             complement(join(1003801..1004312,1004468..1004483))
                     /locus_tag="CAGL0H10274g"
                     /inference="similar to AA sequence:UniProtKB:P38239"
                     /note="similar to uniprot|P38239 Saccharomyces cerevisiae
                     YBR062c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447244.2"
                     /db_xref="GeneID:2888536"
                     /db_xref="GOA:Q6FRA0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FRA0"
                     /translation="MSTYEEEHNINNNESSDEGRQEVRDHFRTLFQQFYGPGTHRDGT
                     ERGGEATTTLLQLLSQLMPEDLQEQLMQSMDSASKQGCSDTFIDSLPRIPQKKLKSDD
                     TCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWLTKNTTCPMCRDDVTHKKELPEL
                     DTSKVELEEDWGMYG"
     gene            complement(<1004900..>1006021)
                     /locus_tag="CAGL0H10296g"
                     /db_xref="GeneID:2888847"
     mRNA            complement(<1004900..>1006021)
                     /locus_tag="CAGL0H10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447245.1"
                     /db_xref="GeneID:2888847"
     CDS             complement(1004900..1006021)
                     /locus_tag="CAGL0H10296g"
                     /inference="similar to AA sequence:UniProtKB:P40990"
                     /note="similar to uniprot|P40990 Saccharomyces cerevisiae
                     YDL107w MSS2 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447245.1"
                     /db_xref="GeneID:2888847"
                     /db_xref="GOA:Q6FR99"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6FR99"
                     /translation="MSFVSQFLKKKPDVLGTLEVSKKFMEHFPKKKTINKLLFDLNSR
                     LTYKKLYPIYVGLYHGVPVPQQQKLLDGVKGSDLIVMRNVLEKVRNRTRYARPDMLKL
                     EDKLLELAAELGNNDAIAILSFRSIRENMGTNSAAEANNEEVTIAKKLFKDLYNINHL
                     LAIKLLGDLALEANNWEEALTFYNKYINIAVKDNGHLLTGNDDLTGEVYGKLGEIEFT
                     YLANMTKAEEYWQKCLELTSVEDSVRWYFLAAQIYMSSEPLKSRILLEKAASQGFKES
                     LTSLGFLEMNYFRDYGRAKEWFKLGMEVFELQSYIGFFDCCVKNEDWIAALKCLKSIE
                     KIGTMESFGSDNTNKATVSNFMNSRAEFIDKVRLKSALV"
     gene            complement(<1006299..>1007222)
                     /locus_tag="CAGL0H10318g"
                     /db_xref="GeneID:2888435"
     mRNA            complement(<1006299..>1007222)
                     /locus_tag="CAGL0H10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447246.1"
                     /db_xref="GeneID:2888435"
     CDS             complement(1006299..1007222)
                     /locus_tag="CAGL0H10318g"
                     /note="highly similar to uniprot|P06242 Saccharomyces
                     cerevisiae YDL108w KIN28 cyclin-dependent ser/thr protein
                     kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447246.1"
                     /db_xref="GeneID:2888435"
                     /db_xref="GOA:Q6FR98"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FR98"
                     /translation="MERAEYTKEKKVGEGTYAVVYVGTKQSTGRRIAVKEIKTSEFKD
                     GLDMSAIREVKYLQEMQHVNVIELVDIFMSYGNLNLVLEYLPTDLEVVIKDKSILFTP
                     ADIKSWMLMSVRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARAVPSPHEVL
                     TSNVVTRWYRAPELLFGAKHYTSAIDVWSLGVIFAELMLRIPYLPGQNDLEQMEVTFR
                     ALGTPTDKDWPEVSSFNSYNKLQMYPPPSRDELRKRFIAATENALNFMNGMMCLNPAK
                     RWSTAQCLESEYFKELPRPSDPATIDITRKE"
     gene            <1007564..>1009342
                     /locus_tag="CAGL0H10340g"
                     /db_xref="GeneID:2888783"
     mRNA            <1007564..>1009342
                     /locus_tag="CAGL0H10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447247.1"
                     /db_xref="GeneID:2888783"
     CDS             1007564..1009342
                     /locus_tag="CAGL0H10340g"
                     /inference="similar to AA sequence:UniProtKB:P53118"
                     /note="similar to uniprot|P53118 Saccharomyces cerevisiae
                     YGL144c and similar to uniprot|Q12103 Saccharomyces
                     cerevisiae YDL109c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447247.1"
                     /db_xref="GeneID:2888783"
                     /db_xref="GOA:Q6FR97"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FR97"
                     /translation="MIHVRGALAIGETSRFLIEVNSNIDGPVFVRLRNRTKATRRATY
                     LLGPFVLYCDSRPVIPANQNEYVPQFKANIEPQGKFTFQLKPEDARDVGGKRCWIIDV
                     VSEVLFNQITKVDYELLISLDINNFKKSKYQQDIYESIEGDVVAKQYSNHDIQEFIEV
                     GAKIKKSQTKERNQHLVIVTHGMISNVSNDMMYIMEQLRAIDRDDLDEELILDGYTGN
                     VCRTELGIKNLGIRLANYIVKERYNTNIKKISFIGHSLGGLVQTFAIAYIYILHGWFF
                     DAVKPVNFISLATPFLGLYSHIGNYTKRLLSSGALGQTGEDLRYHSHNKLKNFSILYL
                     LSGDPAHSILQKFERRTLYANAINDGIVPLASSALLYLDYSKILKDSKLLKKETDDIR
                     SIVMTWKEFQDSEDFKVYKKVNPKSKIFRRVSLTNTVGNLVLPEPPKNITSDMKVLIH
                     DQVYQYNDIPDSEYFPPDGIDEIMAMDRHQLQECMARRWHAGKSWRKVIVCLEGDAHN
                     SINVRRRYSNSCGWAVISHMILNHFIKPQKCDVPEADIVSQPASRDEADMEPNKTYAW
                     LLKEDKEKGGLIRRATNALNPIARRL"
     gene            <1009858..>1010307
                     /locus_tag="CAGL0H10362g"
                     /db_xref="GeneID:2888613"
     mRNA            <1009858..>1010307
                     /locus_tag="CAGL0H10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447248.1"
                     /db_xref="GeneID:2888613"
     CDS             1009858..1010307
                     /locus_tag="CAGL0H10362g"
                     /inference="similar to AA sequence:UniProtKB:Q12513"
                     /note="similar to uniprot|Q12513 Saccharomyces cerevisiae
                     YDL110c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447248.1"
                     /db_xref="GeneID:2888613"
                     /db_xref="GOA:Q6FR96"
                     /db_xref="UniProtKB/TrEMBL:Q6FR96"
                     /translation="MTSASGMKRPVDVANFKIAIRDMGDDELGRVKQEVENSIRHLTR
                     SNERLHRYIKKLQGHAVELEDGEEMDENLGSDDIELFQESIRENELVLDNSRERLEAL
                     HDELAYRKAQHPDGKSNPEGSLAERKLSAIDMDNTNVDVAAPNSIYL"
     gene            <1010679..>1011473
                     /locus_tag="CAGL0H10384g"
                     /db_xref="GeneID:2888833"
     mRNA            <1010679..>1011473
                     /locus_tag="CAGL0H10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447249.1"
                     /db_xref="GeneID:2888833"
     CDS             1010679..1011473
                     /locus_tag="CAGL0H10384g"
                     /note="highly similar to uniprot|Q12277 Saccharomyces
                     cerevisiae YDL111c RRP42 rRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447249.1"
                     /db_xref="GeneID:2888833"
                     /db_xref="GOA:Q6FR95"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FR95"
                     /translation="MVLSVTEKAFLADSLKADPVIRPDGREAYQNRPIELFVNFLPSS
                     NGSSRIIASDGSECIVSVKSKVVDHTLEDELIEVDVDIVGYRDDSLLVESTSSFLKKA
                     LRLGETVERKSLQLTTKYSFKLYIDILVISCNSNPTSLISFGMYTALKSTYLPKLISS
                     YDDLQVEELPTFHDYDLVKLEIDPPVVFLLAIVGDNIILDPAANECEVANNGLLLTWS
                     NGKIVSPVRTIALNDTHLEGFDQNIIKLAYEMVTQYAPEIVRALDQ"
     gene            complement(<1011563..>1015825)
                     /locus_tag="CAGL0H10406g"
                     /db_xref="GeneID:2888520"
     mRNA            complement(<1011563..>1015825)
                     /locus_tag="CAGL0H10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447250.1"
                     /db_xref="GeneID:2888520"
     CDS             complement(1011563..1015825)
                     /locus_tag="CAGL0H10406g"
                     /inference="similar to AA sequence:UniProtKB:Q07527"
                     /note="similar to uniprot|Q07527 Saccharomyces cerevisiae
                     YDL112w TRM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447250.1"
                     /db_xref="GeneID:2888520"
                     /db_xref="GOA:Q6FR94"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:Q6FR94"
                     /translation="MSESLVVLRYLNAEQRVSLLDDLIEQDNFSALVGVIDAHEQLSG
                     SHVEALFEKVVSKVDNEVQEIDLQNAHRDVGCEHLSEDMDIFAKIVVSVPDLWVKIER
                     KISVMLDNYIRCNMGRCFSEAMKKVYESECSIAEHDMEQEETSTVITYLAFLELLFLK
                     QESLQTLELVALDKILIVLQACNIENIATSCSRLMRWTHQSVVSQSLKSQSFDLFLWH
                     VITLMNLEKDEIDWKQRVCLSLLLRILSNEGISDQGVQFVKTQEFWTLIHSSLNHTVH
                     EYRKLGLSIVKLAILKIVDKVSEPLEHEMFKWDPQQNVKIIESWKRFTTLYEIVAVDT
                     ALNQIQDARNDIIDIFNDDNLPPTWSLLLFSTGLTASMESVRKYIVNIMLDIKNMSVF
                     SANLNVLRTSFIPALMNAHFFNVIGCECPYGDKLSEFIKSIILASNIKSEIISSILEL
                     LIDQGTSFDPARIYVTYGILNCLNTQVPKSLQSKHFRLIRRLFEFECEEEVFETTLQH
                     ILLRLLLHGNNSISAAELVQSVVAHIKCQRGDFKYVKPLVEDFREHCVINFNPILVDE
                     QLSPSLGVDSVFDAVAVTLFDISGPRTDINVIKQLIKLDNLQPEDNSIISTELVRLLD
                     AKELNEYPKDCDILTRAKTINQGIWSNLNVQSLYVSLRENFEPEKFKFFVALYQNMIN
                     YGTIVVDFAFTDICDIYESIKKFNTAKKTDSDYKMKDSLYDTYFKLLFVYLKTTPLRQ
                     ERNDIINILNILESNVNTDNGYYLGNLGAVSICQTLTSTYLIPIANKLHDEQVVIGKH
                     IITILSTIWDNISGERLILKERDLHLAFIDTLFHPHILLLVTTDSEYETKISKIGLDI
                     ISKAYSRRSLLPHLGKRINEFFMSYNSLLLKCEWMIAIMVNAFKTVQMGENVFKLKPV
                     ISKFYENHVSAFFGLQQSLYYQVYGDDEHSCRVHIISAILFCNNTTKNAIVKYIVTQT
                     KALVPVKRTDGVEGLERLLLWQLILLCVVTSDAKSIEWSIFEQMLSSIEDESSPLVRI
                     CKEWSIAHVLAHQESEKLTKQANYLFSHFDDHSKPILVVTVEKIIYITLKAMVFDIKN
                     EYFSTLQDRFVALLVANCTSNKPLVRHFSNSLILSFWPKFKEVLQDSSLKLILQKLYE
                     NSKEAQIVGQYRTGDANVWDLVDDCTLTGLFGGVLMKCIDHEVPYLSKSDFEKYIPQS
                     TDLPIPIGIDENDKWLSKRESKNVSNPNVTSQNALSDSLQTKSGAWETVLDIDQKRSN
                     SMIKRSELIVVSSLVDKPPNLGGICRLCDVLGVGLLTVQDLRVKNHPQFKNVAVTADK
                     WMPMEEVPIDEISKFMKEKKKEGYTLIGLEQTDKSIKLDNNFKFPSKSLILLGTEAHG
                     IPGHLLNELDLCLEIKQHGVIRSMNIQTATAVIVHSYSAQIL"
     gene            <1016374..>1018635
                     /locus_tag="CAGL0H10428g"
                     /db_xref="GeneID:2888784"
     mRNA            <1016374..>1018635
                     /locus_tag="CAGL0H10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447251.1"
                     /db_xref="GeneID:2888784"
     CDS             1016374..1018635
                     /locus_tag="CAGL0H10428g"
                     /inference="similar to AA sequence:UniProtKB:Q07528"
                     /note="similar to uniprot|Q07528 Saccharomyces cerevisiae
                     YDL113c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447251.1"
                     /db_xref="GeneID:2888784"
                     /db_xref="GOA:Q6FR93"
                     /db_xref="InterPro:IPR001683"
                     /translation="MGRSKRSKKKSLAHLQSDGKDKLSSEENISRGSEVEESPENFEE
                     AQDYGDSLKDTDEQSDSITAIRSVTGGTASTITDLNNKFKSQELVDNEKVEINTKSTE
                     EVGCKPSTDHSTEALDEGHDTGISSTNKDDSDVRIIGDDNEDSEAIESVDIKGKVSSG
                     ISDADVLKPQEELVHTAILENDNPFYDANKEISGSKKLDEKVNSVDSMAETTKVNSGD
                     SKQRMGDLVVRRSENLHNPNLDYEEEDEILVSNTDTNKHSKESSSALNNANMKSFGNA
                     VKSYTKKSGKHVRILEAKKVSEGQSRTFVAYFIKYNGHMVRRRYSDFESLRSILVKLF
                     PLMVIPPIPEKEGLKSYSKAIAGLKHAKYILPSEQTDSVDLSLSIIDQSVSDKEENII
                     RHRVRILTKFLNRLLDNTDISSTSLIEDFLNPNNSNWNDFVTSSATFSMLPRNRLQAN
                     PVDPTNTTRVHACLPIPNTSVALGKRDPELFVSGNENDDTDGYILLEKEHKRYESIVN
                     NTYKYNRRITKNFNEMKHDYDDLAAAFAELSNLDISSNPKHVDFCATFDKSSIAMQAL
                     VSNLYYNIDEPLNEAIYNTNAVTELLMFRKLKAVQLYKVEKSLVGKVHELQKLEKGEN
                     KIESEPNQESLTSARRLSPIPAPQKLGGSFFNKISEIANKVKESVSYQELDVETQISN
                     LRKEIERLKETSAVTTKDMEVINDTICKEEVPKALKCGEKELEDILASYASYMKTYAK
                     QNLEYWKSIQEAR"
     gene            complement(<1018805..>1019740)
                     /locus_tag="CAGL0H10450g"
                     /db_xref="GeneID:2888466"
     mRNA            complement(<1018805..>1019740)
                     /locus_tag="CAGL0H10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447252.1"
                     /db_xref="GeneID:2888466"
     CDS             complement(1018805..1019740)
                     /locus_tag="CAGL0H10450g"
                     /inference="similar to AA sequence:UniProtKB:Q07530"
                     /note="similar to uniprot|Q07530 Saccharomyces cerevisiae
                     YDL114w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447252.1"
                     /db_xref="GeneID:2888466"
                     /db_xref="GOA:Q6FR92"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FR92"
                     /translation="MDITEDIGRLWRANMHRILDIKSRILAKKKPTTNLDYDTYKEKT
                     LVALITGGSGGLGLEIAIALVQRYKSVIVAIVDVVPPKKQLVKQYPNIIHYRCDITDS
                     FQVAHMKKKVLLDFGKVNILVNNAAITIIKQLTDMTEAEIQRVINVNLIASYHLVSMF
                     VPEMLYTKNGCIINIASVLGELTPSRLIVYGATKGGLIELHNYLNQQINAHNSYAYNR
                     RGLKAILVCPGKISTTMFKDVDTPSKFLAPDLPPNELATEIIKTVDSKISSTLRRPYY
                     SGLIPYIKILNQSYLDLLKNLSGMNRVTKLKKKML"
     gene            <1020597..>1021343
                     /locus_tag="CAGL0H10472g"
                     /db_xref="GeneID:2888628"
     mRNA            <1020597..>1021343
                     /locus_tag="CAGL0H10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447253.1"
                     /db_xref="GeneID:2888628"
     CDS             1020597..1021343
                     /locus_tag="CAGL0H10472g"
                     /inference="similar to AA sequence:UniProtKB:Q07532"
                     /note="similar to uniprot|Q07532 Saccharomyces cerevisiae
                     YDL115c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447253.1"
                     /db_xref="GeneID:2888628"
                     /db_xref="GOA:Q6FR91"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:Q6FR91"
                     /translation="MVNKYLTLNKDSENSRKKRKPSRKHFRGAAAEVKSLPSQDYVYD
                     VYHLEQVPEDEYNKYEGSKVGFIKIIDVYGDLLPDELTDSDEQFLSDEEDSNDENYYR
                     NDYPEDEDDDRSILFGSEGEEMAELETEFLANHDVDEFERPEMTDSADVIRPREDYDP
                     KIATYDDVFSKLQGSSNILRSINDANFIDLDRDFEEEEGSDGEFMYNEEQEDKDEFPR
                     NEFFPTDKDDPVAIHRDRIFHRLQKMIEKD"
     gene            complement(<1021457..>1023631)
                     /locus_tag="CAGL0H10494g"
                     /db_xref="GeneID:2888617"
     mRNA            complement(<1021457..>1023631)
                     /locus_tag="CAGL0H10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447254.1"
                     /db_xref="GeneID:2888617"
     CDS             complement(1021457..1023631)
                     /locus_tag="CAGL0H10494g"
                     /inference="similar to AA sequence:UniProtKB:P52891"
                     /note="similar to uniprot|P52891 Saccharomyces cerevisiae
                     YDL116w NUP84 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447254.1"
                     /db_xref="GeneID:2888617"
                     /db_xref="GOA:Q6FR90"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:Q6FR90"
                     /translation="MNSSLGITDMSGKDYYVRFARAVNDYQIDSIDGDQAGDPFEIAQ
                     EFRSIAGECALTELRSGNIKAGKDWELEANYWSLFRQLIKFRYSDKHQQQSQVNCSTR
                     AAYEKELLQNNNDFYELWIIMVWLQDNLQTVERPENLPTKKWNHTLLKQGLQSQDVDY
                     PLRDSSVILDEKDREQDRVIFKYIFQLLLRGKIEEALNECELSGNLTLSMIICGLQEY
                     VNPEIDFHLKNEFDFQQGIKKHSLWRRTVYGISQNSKLDLYERAIYSLLAGVSPSEEV
                     MSICNWEELLIFFINQKLQTDIENEMIRAGFVTDEEIQLYIPSSTESLSSILNDLSNL
                     KPEESSHPLRTLIASIILGTTDSIVHSSVLQLFDAIKNSEQENEIFNEPYLLRVMTHT
                     AIMFKIIDRHALNETDTSKLITSYITILKFYELFDCIPAYMTLLSAEETIEAYSFVLS
                     TIEESSEKRKQIELMSVLHLPCSEIIKKITQRVFDDTEQQYQPTQVMSVCFETTKIDL
                     HLINSVEWLLEGKLYVDAMNSILALARRFLLNGKVKSLELFFERNDLTTVINQIEIAI
                     AVGKQPINSSTRKELSQYENLIQGFVEYENWQKSVNQLNSESNIPSLIEKFQGFSNDI
                     NILIKDFLVELCEDEKSENTAILYEIRALYIPYLIIELHKKLVEASELLKIPKFISRA
                     LELTNFVANESERIYVLFQESGKLKEYLDLVAKTAILAEDIK"
     gene            complement(<1024427..>1027069)
                     /locus_tag="CAGL0H10516g"
                     /db_xref="GeneID:2888478"
     mRNA            complement(<1024427..>1027069)
                     /locus_tag="CAGL0H10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447255.1"
                     /db_xref="GeneID:2888478"
     CDS             complement(1024427..1027069)
                     /locus_tag="CAGL0H10516g"
                     /inference="similar to AA sequence:UniProtKB:Q07533"
                     /note="similar to uniprot|Q07533 Saccharomyces cerevisiae
                     YDL117w CYK3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447255.1"
                     /db_xref="GeneID:2888478"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FR89"
                     /translation="MTTMRVPFKVKARYGWSGQAKEDLGFLEGDVMEVSRVAGEWYYG
                     RLLRNKKCAGYFPNNFVTIVEERINSVQSVDSGRSKQAQQGQPILQQSKSGLPPIPTR
                     STNHDSSKYRSSRQAYHSTPNLPATASGYENNAPVGSNNGYSRRAEIYGMRQPGYDQL
                     AMKKRNNINDSLTKKPNVNKYEDFVDTPALPPLPQLQSSKRNGKHRQPVKSYSSNDLP
                     TSRSRDPADHFVDDQRFFDGFNSGKRSSVDTSSVSSGGLFSHSQYMDNSVTSSENSFA
                     IMSDFSATSAGSFARHRKAQSFTDSLERSENGHLQYGNSIDTKQVNDTKTGGFWKRFM
                     NKNDSNNNGVANSLRTNESFPKLPDLQTLDISPHHNDAHDWLTVKAHVNRSKSLTKYE
                     KHPRYMRALERNRDLVLHPQDAIYNGLNTNEIRGHGKPGSVDIELAGLNTQYIDSMTW
                     KRCSKNSTMRLENWVRTTFSARYSTDIEKLRGIYIFCTEMFSLIDDHGHSDFSREPAN
                     LESVLYQKYCTPYELTCLFKRLAVSLSIQCEVVIGFLKTPFAVNHEFEYNHCWLRVLV
                     NNEWRFIDVILGNITNPIHEFVNNKPAKRADDSYFLVEPLEFIYTHIPPSEYEQHIVP
                     SLDQLSILYLPLVFPSFFKNGLVLYKFSTALSYLEDNEIYECSIEIPNDIEIFSSVVV
                     NTEDKNKAKLYQKMELSLAQVRKHRTESGKRVIVIKAVLPPGVKSGALYIHSGVRGTQ
                     TTIANVHPLSMIIPLYHEGSESKYEFVSKVPNENILKLETYVMEPQNKYLFPDNEYNF
                     EVLQHPFDGIMYNSTAANQNIKQPIAIKSPSGKIYNLEKNDPHVSYGTWKKTIKVKES
                     GVWTGMILSDCGLGWANFAEWYCI"
     gene            <1027739..>1028632
                     /locus_tag="CAGL0H10538g"
                     /db_xref="GeneID:2888866"
     mRNA            <1027739..>1028632
                     /locus_tag="CAGL0H10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447256.1"
                     /db_xref="GeneID:2888866"
     CDS             1027739..1028632
                     /locus_tag="CAGL0H10538g"
                     /note="highly similar to uniprot|Q07534 Saccharomyces
                     cerevisiae YDL119c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447256.1"
                     /db_xref="GeneID:2888866"
                     /db_xref="GOA:Q6FR88"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /translation="MASSTGHLIGGFAGGLSSAVALQPLDLLKTRFQQTKGGTLWQTV
                     KSLDTPWQLWRGTLPSAIRTSVGSALYLSSLNLMRTALAKRKQFDTADSVVTGKSSNL
                     PQLSMYENLVTGAFARGTVGYITMPITIIKVRYESTLYNYKSIAEAAKSIAAQEGIRG
                     FFRGFGPTCLRDAPYSGLYVLLYEKLKHTLPTILPKSLLQLDSEGRYTAYTSTAINST
                     SAILSASMATTVTAPFDTIKTRMQLEPTKFKTFWSTLTTIVTQEHPIKIFSGLSMRLT
                     RKALSAGIAWGIYEELIKHFM"
     gene            <1029121..>1029555
                     /locus_tag="CAGL0H10560g"
                     /db_xref="GeneID:2888782"
     mRNA            <1029121..>1029555
                     /locus_tag="CAGL0H10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447257.1"
                     /db_xref="GeneID:2888782"
     CDS             1029121..1029555
                     /locus_tag="CAGL0H10560g"
                     /inference="similar to AA sequence:UniProtKB:Q07541"
                     /note="similar to uniprot|Q07541 Saccharomyces cerevisiae
                     YDL121c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447257.1"
                     /db_xref="GeneID:2888782"
                     /db_xref="GOA:Q6FR87"
                     /db_xref="UniProtKB/TrEMBL:Q6FR87"
                     /translation="MDFFKFLIVLVIVVLFILVLPWLSGIGSYSIQKAAVSNKKSPDS
                     RREKLKNKLDKSVALNFSLKDKNDESDGKSSHVSKRGEFDIDSKTGLKRRVLSRYDQD
                     PNNFDFDIDELIDEDRKEEAKEEQQRIKKFGGKSSEAYEGFV"
     gene            complement(<1029876..>1032248)
                     /locus_tag="CAGL0H10582g"
                     /db_xref="GeneID:2888756"
     mRNA            complement(<1029876..>1032248)
                     /locus_tag="CAGL0H10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447258.1"
                     /db_xref="GeneID:2888756"
     CDS             complement(1029876..1032248)
                     /locus_tag="CAGL0H10582g"
                     /inference="similar to AA sequence:UniProtKB:P25037"
                     /note="similar to uniprot|P25037 Saccharomyces cerevisiae
                     YDL122w UBP1 ubiquitin-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447258.1"
                     /db_xref="GeneID:2888756"
                     /db_xref="GOA:Q6FR86"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FR86"
                     /translation="MGVANIEYKVLKYIPFTIPIYEFVTRSYLTAIGLIILTYFLLFI
                     YKTGDQSIKARMNEFGRNLKDAGNSALRRMAPNSNYFSNIDEQILQRGGYVGGLLNDG
                     NFCFMNSVIQSLASSKELLKFLDDEIIGRYESLEKDLVADEDSVSESNEQNGKKQKAS
                     NGKVYGKSKKKHNRSVDNGDNDTEPDIQFTIAFKELLDKLNYKYYKERPYFKTNSMVN
                     KMSNSPKKSMLMAYDQEDAQEFFQTILSELEKNIKTLESRKDDKTPVPAKNLSEDDMI
                     GQAHLGRMGTVYIPSEQIDPNSYTEGSTEKSFTPFKLVTPLDGITAERIGCLQCGENG
                     GIRYSVFSGLSLNLPSENIGSTLKLSSLLNEWIKPEIIEGVECNRCALEAVREHLLSQ
                     MKEIDGSANTPAKLVDAMRTRLAELEETLKKPVIDDDDYKKLHTENMVRKCSKSKQVV
                     ISRPPALLSIHINRSVFDPRTYMIRKNNSRVLFKSRMNLEPWCCDIDEINLDARLPMS
                     KKQKVVESSEDENIGGDYYSKLHQKFEKAFEDEDEEEYDDEDEEYNNGIYESRNVSEY
                     DPLNGELSSDYSEEDEISSDEEVDALGNTIPKKKTVTLNDGSLTEISVANGNIVDGDG
                     NEDNSENEDDDDDDDDGDENYTDNDAEDDEAVDSDESNRSQDAVQAPPINLAPRYSTV
                     NPSPLTYALRSVIVHYGTHNYGHYIAYRKFRGVWWRISDESVYVVDEAEVLSTPGVFM
                     LFYEYDYDEKTGRMKDDIEYEFQLHNAENGGNKNDTEENLDQSELEKESD"
     gene            complement(<1033488..>1034738)
                     /locus_tag="CAGL0H10604g"
                     /db_xref="GeneID:2888479"
     mRNA            complement(<1033488..>1034738)
                     /locus_tag="CAGL0H10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447259.1"
                     /db_xref="GeneID:2888479"
     CDS             complement(1033488..1034738)
                     /locus_tag="CAGL0H10604g"
                     /inference="similar to AA sequence:UniProtKB:P32588"
                     /note="similar to uniprot|P32588 Saccharomyces cerevisiae
                     YNL016w PUB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447259.1"
                     /db_xref="GeneID:2888479"
                     /db_xref="GOA:Q6FR85"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FR85"
                     /translation="MSEEIKNEVIETPEEVIEKPEEVSQEVEGDNASQENDDDKPSVV
                     PASATKGGRETSDRVLYVGNLDKSITEDLLKQYFQAGGPIQNVKIIEDMKNEYVNYAF
                     VEYIRSHDANVALQTLNGVQLENKTLKINWAFETQQAAENDDTFNLFVGDLNVDVDDE
                     TLAGTFREFPTFIQAHVMWDMQTGRSRGYGFVSFSNQEEAQKAMDAMQGKDLSGRQIR
                     INWATKRERNMGNNFGNNRGSRGGNFRPYGNQGHHNRNNRNMMPPAMGMPMDGLMPMQ
                     QGQQNGQQPNVQQQQPMVPPPVNPQAIEDMIRRAPPRVTTAYIGNIPHYATEADLIPL
                     LQNFGFILDFTHYPEKGCCFIKYDTHEQAAVCIVALANFPFQGRNLRTGWGKERTNFM
                     PPQGAPGQQMPVMMDPSQAPPAPQ"
     gene            <1043943..>1047923
                     /locus_tag="CAGL0H10626g"
                     /db_xref="GeneID:2888521"
     mRNA            <1043943..>1047923
                     /locus_tag="CAGL0H10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447260.1"
                     /db_xref="GeneID:2888521"
     CDS             1043943..1047923
                     /locus_tag="CAGL0H10626g"
                     /note="some similarities with uniprot|P32768 Saccharomyces
                     cerevisiae YAR050w FLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447260.1"
                     /db_xref="GeneID:2888521"
                     /db_xref="GOA:Q6FR84"
                     /db_xref="UniProtKB/TrEMBL:Q6FR84"
                     /translation="MRFKSIFSSAALISCWAFGVAKLYQNQEIIIDSATLGSQIFEDD
                     ELMQLLNAKVTLNNFTDIRLPQGISLNSRSVLKINAPPGHGKPYSLVINGQVTIGKDS
                     KFIFDGSSLEYESQSAASSNFKFDINTGSKGVFIFTYCTMTIKLPKLSEGLIDSDSVA
                     AIHIGGTFEAPNINSPLSILGTLEVLTSETTVDGSFDDKLWRVDLGPDQIVEDGEGYR
                     YILTGNIHCQAYVSVYADIFKATKTVLHALGYRGYTVVSPMTIDLSEGPVFSGGLYLY
                     YIVLPEGQDGLTFLNFAVHEDKGIPAPTLGFMFLYSGDQTDVVATANQNIINVMNLNS
                     KKSISVIGDHNYNITTKYSDGKSIQQQGYSGVQSYPNELIVYLYAPPSEEPDYTTTID
                     KGNGEFETDVVSHITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFETDVVSH
                     ITTKDSDGKPTTIVTTIPWKPSEEADYTTTIDKGNGEFETDVVSHITTKDSDGKPTTI
                     VTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITTTDSDGNTVTYTTMMASFDQVGD
                     GVYTSAPPYSQPPVVTTTVTEDDGSSKTVVISYSPSEGEDGVTRTGTTTISTITPSGE
                     ADYTTTIDKGNGDFETDLVSHITTKDSNGNPTTIVTTIPLKPSDAGEADYTTTITSDG
                     HTITEVVSHITTTDSDGNTVTYTTTMASFDQVGDGVYTSAPPYSQPPVVTTTVTEDDG
                     SSKTVVISYSPSEGEDGVTRTGTTTISTITPSGEADYTTTIDKGNGDFETDLVSHITT
                     TDSDGKPTTIVTTIPLKPSDAGEADYTTTITSDGHTITEVVSHITTTDSDGNTVTYTT
                     MMASFDQVGDGVYTSAPPYSQPPVVTTTVTEDDGSSKTVVISYSPSEGEDGVTRTGTT
                     TISTITPSGEADYTTTIDKGNGDFETDLVSHITTTDSDGKPTTIITTVTLIEEPDYTS
                     VFVSDGHTITAVVSHVTTTNDIGQTVTTTVTVMSYDQVGEGVYTSAPAYSQPPVTTTT
                     VSANTATATVVISYFPSIGDDGVTGTGTTTVSTVSVGGEVDYTTTVDRGNGSTETDVI
                     SHITTTDSNGNPTTITTTITNAPPPLNSKANIGSDYTSTVVSNGHTIVSTVTQTVGGQ
                     SHGNTVSSAAPVTTVSGASFNAPETAGVGGIVNSQNSQSQYVADQGSGNEKPTQAPGT
                     AGGSGSGSVHQSAGNIVPSGSPSVQSPMNTASPVNGIHSSQTPHSVPSQAQQQGQGQA
                     QAPSSRQQAATTVLSPSGSSVNNIGSGFNSTQTASVLQGKGASIKVTSISILFSIITV
                     IVVGMI"
CONTIG      join(CR380954.1:1..1050361)
//
DBGET integrated database retrieval system