GenomeNet

Database: RefSeq
Entry: NC_006032
LinkDB: NC_006032
Original site: NC_006032 
LOCUS       NC_006032            1100349 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome I complete sequence.
ACCESSION   NC_006032
VERSION     NC_006032.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1100349)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1100349)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380955.
            On Aug 5, 2010 this sequence version replaced NC_006032.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1100349
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="I"
     gene            complement(<12309..>14903)
                     /locus_tag="CAGL0I00220g"
                     /db_xref="GeneID:2889307"
     mRNA            complement(<12309..>14903)
                     /locus_tag="CAGL0I00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447262.1"
                     /db_xref="GeneID:2889307"
     CDS             complement(12309..14903)
                     /locus_tag="CAGL0I00220g"
                     /note="some similarities with uniprot|P32768 Saccharomyces
                     cerevisiae YAR050w FLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447262.1"
                     /db_xref="GeneID:2889307"
                     /db_xref="GOA:Q6FR82"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6FR82"
                     /translation="MNSINILTVFLFAYFVHAKVGIPNPFEGTINNFPSGCSPNHGLY
                     NRGLTMELYNYSYIHPQSIQSYFNTSTLKKMEKGQCWDPSYLDVNYPRTGYKTHNRFA
                     KVNGIDGILDFEFNPTRSCVPSKGQLPQNYNYPLQFTLSNFTMLLYGYFKPKVTAKHT
                     FTIFADDLLFLNFGAGNAFDCCQQQDTIDDFGNYQAYALWGSDTQQNTLTVNLDANIY
                     YPIRMFYNNRDFKGALNMYFTTDESNTKINDFSGYLFNIPDSSEGCPAHISYETECGN
                     VSGAITYSTEYITESIESPNIPVTSTIFHIQVPCPSSSTSIYCSDGFYDPIANSCVKT
                     ESSEIIVATASTTYTPGPVTDTTTISTYVTHITGSDNRDTPETVFVVETPEDPQSPSN
                     SHIPSSSVSSSSVWPSSISVTEIPSSSVSTIETSNITYSQTLSTSPSTFASSNIVPSP
                     SQSYISPGDSSISSSSSFYSNSSSTDIPLTNPSSTASSVSTFNTIIPTASTTYVPGSV
                     STITTISTYTTYITGPDNRETPETVFVVETPQDPESSSSFFTSTIITPTASTTYVPGS
                     VSTITTISTYTTYITGPDNRETPETVFVVETPQDPESSSSFFTSTIITPTASTTYVPG
                     SVSTITTISTYTTYITGPDNRETPETVFVVETPQDPESSSSFFTSTIITPTASTTYVP
                     GSVSTITTISTYTTCITGPDNRETPETVFVVETPKFSEYRTLNSRTTRTRTTRTLVPQ
                     TDTTSSNIVTLQTEHSRPETVIIHLDTSFYSDVLTSHSHSNYRNFATKNTDITPCSSF
                     DTSPQNARKTEESGEMYTTVKSISFSSAISSEPIEYQLQASSITLLPVSSTYLIILTI
                     IMTAICLI"
     gene            complement(<17649..>18146)
                     /locus_tag="CAGL0I00242g"
                     /db_xref="GeneID:2889308"
     mRNA            complement(<17649..>18146)
                     /locus_tag="CAGL0I00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447263.1"
                     /db_xref="GeneID:2889308"
     CDS             complement(17649..18146)
                     /locus_tag="CAGL0I00242g"
                     /inference="similar to AA sequence:UniProtKB:P40581"
                     /note="similar to uniprot|P40581 Saccharomyces cerevisiae
                     YIR037w HYR1 glutathione peroxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447263.1"
                     /db_xref="GeneID:2889308"
                     /db_xref="GOA:Q6FR81"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6FR81"
                     /translation="MDSQSSFYDLSPHDKDNNEFPFSNLKGQVVLIVNVASKCNFTPQ
                     YNDLQYLHEKYSYRGLKIIGFPCNQFGQQEPENDEVIQKFCLSNYGVSFKILKKIKVN
                     GPNADPVYTYLKNEMPSQIGLKVIRWNFEKFLVDKHGRVRHRYSSLTSPKSLQRTIDQ
                     LLDDK"
     gene            complement(<18821..>19306)
                     /locus_tag="CAGL0I00264g"
                     /db_xref="GeneID:2889309"
     mRNA            complement(<18821..>19306)
                     /locus_tag="CAGL0I00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447264.1"
                     /db_xref="GeneID:2889309"
     CDS             complement(18821..19306)
                     /locus_tag="CAGL0I00264g"
                     /note="highly similar to uniprot|P40581 Saccharomyces
                     cerevisiae YIR037w HYR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447264.1"
                     /db_xref="GeneID:2889309"
                     /db_xref="GOA:Q6FR80"
                     /db_xref="InterPro:IPR000889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029759"
                     /db_xref="InterPro:IPR029760"
                     /db_xref="UniProtKB/TrEMBL:Q6FR80"
                     /translation="MSPFHQLRPVDGQGNIYPFEMLKGKVVLIVNTASNCGFTPQYIE
                     LENMYQKYKNEGFEILGFPCNQFGHQEPGSDAEIQKFCSSKYKVTFPIMKKIDVNGPY
                     EDPVFKYIKEQKPGMLGLKGIKWNFEKFLIDRQGNVVLRASSLTKPSTLNETIEKLLK
                     N"
     gene            complement(<20521..>22188)
                     /locus_tag="CAGL0I00286g"
                     /db_xref="GeneID:2889310"
     mRNA            complement(<20521..>22188)
                     /locus_tag="CAGL0I00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447265.1"
                     /db_xref="GeneID:2889310"
     CDS             complement(20521..22188)
                     /locus_tag="CAGL0I00286g"
                     /note="highly similar to uniprot|P23585 Saccharomyces
                     cerevisiae YMR011w HXT2 or uniprot|P39003 Saccharomyces
                     cerevisiae YDR343c HXT6 or uniprot|P39004 Saccharomyces
                     cerevisiae YDR342c HXT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447265.1"
                     /db_xref="GeneID:2889310"
                     /db_xref="GOA:Q6FR79"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FR79"
                     /translation="MSQSAISSTSATDPERQTPETKLEGEDFQLKADEASIQGAEIPR
                     KPLGAYWTVMCLCLMIAFGGFVFGWDTGTISGFVAQTDFKRRFGQRHSDGTYYLSNVR
                     TGLIVAIFNIGCAFGGLTLGRTGDLYGRKKGLVIVVSVYVVGIIIQIASVDKWYQYFI
                     GRIISGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITLGIFLGYCTNYGTKNYS
                     NSVQWRVPLGLCFAWALFMIGGMSMVPESPRFLVEKGRLEEARRSIAISNKLSMDDPG
                     VTFELDTISAGVEAERLAGSASWGELFSNKGKILPRVIMGVMIQSLQQLTGNNYFFYY
                     GTTIFKAVGLEDSFQTSIVLGIVNFASTFVGLWTVERFGRRRCLLWGSATMAACFVIF
                     ASVGVKSLYPHGRDHASSKGAGNCMIVFTCFFIFCFATTWAPIAYVIVSETYPLRVKN
                     RAMAIAVGSNWIWGFLIGFFTPFITSAINFSYGYVFMGCLVFSYFYVFFFVCETKGLT
                     LEEVNDMYEEGVLPWKSPNWVPPSRRDASYDIDAMMHDDKPWYKRFL"
     gene            complement(<24166..>24558)
                     /locus_tag="CAGL0I00308g"
                     /db_xref="GeneID:2889312"
     mRNA            complement(<24166..>24558)
                     /locus_tag="CAGL0I00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447266.1"
                     /db_xref="GeneID:2889312"
     CDS             complement(24166..24558)
                     /locus_tag="CAGL0I00308g"
                     /note="highly similar to uniprot|P38633 Saccharomyces
                     cerevisiae YGL127c SOH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447266.1"
                     /db_xref="GeneID:2889312"
                     /db_xref="GOA:Q6FR78"
                     /db_xref="InterPro:IPR008831"
                     /translation="MSDNKEDSTVDNSNSTEEVPLPTRFEVELEFVQSLANIPYVTYL
                     LTQQQLLWKDPKFKNYLKYLEYWCEPPYAQCIVYPNALFILKLLNGFMEKATVNEDGL
                     LDGLEDLPKVIQLQGNQWMNEMVERWAN"
     gene            <24968..>26083
                     /locus_tag="CAGL0I00330g"
                     /db_xref="GeneID:2889313"
     mRNA            <24968..>26083
                     /locus_tag="CAGL0I00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447267.1"
                     /db_xref="GeneID:2889313"
     CDS             24968..26083
                     /locus_tag="CAGL0I00330g"
                     /note="weakly similar to uniprot|P53012 Saccharomyces
                     cerevisiae YGL126w SCS3 inositol phospholipid synthesis
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447267.1"
                     /db_xref="GeneID:2889313"
                     /db_xref="GOA:Q6FR77"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:Q6FR77"
                     /translation="MQTESVYRWVLLGICPTILILGNIIYMAYLDGPIAVNKDGFVNR
                     ILVKRGWFWTTVIGWLCILRYDAKRQWKSSLKRYLILTLWWYVFTQGILWFDIPPIMD
                     LIFKYSGGSCNFDIYDSDGNVNLKFQDSWRRRIKSWRMIYDKVKDYQKNGKNPLAVDS
                     KLMDFVTGSIEKAIEHYSYHIKSNIMIKEISRLLSDLNITYSTEQINDFIKNFISNTT
                     VGNSSGANSTLDNSFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMR
                     VVDTRKYVMDKIKKICNEPMANASVYERRVRKLMRCLSFSASYILWENPVILLLLLLA
                     IWVWNFVITVIVFHTLTEQLSGLFFAYVVGALLYYDY"
     gene            <26900..>27403
                     /locus_tag="CAGL0I00352g"
                     /db_xref="GeneID:2889314"
     mRNA            <26900..>27403
                     /locus_tag="CAGL0I00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447268.1"
                     /db_xref="GeneID:2889314"
     CDS             26900..27403
                     /locus_tag="CAGL0I00352g"
                     /note="highly similar to uniprot|P06104 Saccharomyces
                     cerevisiae YGL058w RAD6 E2 ubiquitin-conjugating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447268.1"
                     /db_xref="GeneID:2889314"
                     /db_xref="GOA:Q6FR76"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /translation="MSTPARRRLMRDFKRMKEDSPPGVSASPLPDNVMVWNAMIIGPA
                     DTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDV
                     ASILTSIQSLFNDPNPASPANVEAATLFKDHKSQYIKRVKETVEKSWEDNMDDMDDSD
                     EDDEDDE"
     gene            complement(<27597..>28154)
                     /locus_tag="CAGL0I00374g"
                     /db_xref="GeneID:2889311"
     mRNA            complement(<27597..>28154)
                     /locus_tag="CAGL0I00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447269.1"
                     /db_xref="GeneID:2889311"
     CDS             complement(27597..28154)
                     /locus_tag="CAGL0I00374g"
                     /note="weakly similar to uniprot|P53171 Saccharomyces
                     cerevisiae YGL057c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447269.1"
                     /db_xref="GeneID:2889311"
                     /db_xref="GOA:Q6FR75"
                     /db_xref="UniProtKB/TrEMBL:Q6FR75"
                     /translation="MRPVPRSLLLKQRKRLQRVITDTQGKSNKNILLSSLSDVFQPIN
                     PIARSDVDPLSQPDKFSLFSKRQILEQSSQFDHFVDSTNLRDVSNFKIAFSTLYNNRL
                     GSKKHEWATLEYATILHNNSDWKHIPTTMKQLIYYHAYGDYGPRNSRSLVLNENPRYK
                     TKWVNPLTSSIFIYSSLIAIWALSM"
     gene            complement(<29245..>29592)
                     /locus_tag="CAGL0I00396g"
                     /db_xref="GeneID:2889315"
     mRNA            complement(<29245..>29592)
                     /locus_tag="CAGL0I00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447270.1"
                     /db_xref="GeneID:2889315"
     CDS             complement(29245..29592)
                     /locus_tag="CAGL0I00396g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447270.1"
                     /db_xref="GeneID:2889315"
                     /db_xref="GOA:Q6FR74"
                     /db_xref="UniProtKB/TrEMBL:Q6FR74"
                     /translation="MILRSGLLRPDQVVPGYDSHRTLKKKRVERATIYLLLRTSISTN
                     RSSEPRKVNKYNRWQRRSALQNSLGHFSEAMRFLFLEHSHKHSLYVRETLSLLSLLAL
                     VCHPPPEMRPKGS"
     gene            <30058..>31530
                     /locus_tag="CAGL0I00418g"
                     /db_xref="GeneID:2889318"
     mRNA            <30058..>31530
                     /locus_tag="CAGL0I00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447271.1"
                     /db_xref="GeneID:2889318"
     CDS             30058..31530
                     /locus_tag="CAGL0I00418g"
                     /note="highly similar to uniprot|P21147 Saccharomyces
                     cerevisiae YGL055w OLE1 stearoyl-CoA desaturase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447271.1"
                     /db_xref="GeneID:2889318"
                     /db_xref="GOA:Q6FR73"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6FR73"
                     /translation="MSRVETRNVTTEFQKDGLDEVDLVQANILAAGLDKKTVRVVNGL
                     GKLMGSKEMVQVEFNKDKPTSKISASTPHISEQPWTLNNWHEHLNWLNLVLVCGLPMI
                     GWYFVVSGKAKLTWQMALFATFYYALGGISITAGYHRLWSHRAYSARLPLKIFFAFFG
                     AASVQGSIKWWGHSHRIHHRYTDTLRDPYDARQGLWYSHMGWMLLKPNPKYKARADIS
                     DLTDDWVVRFQHKHYIPMMLLSGFVLPCLLGGYLLNDYLGGLIYGGFIRIFVIQQATF
                     CINSMAHYLGTQPFDDRRTPRDNWITAIVTFGEGYHNFHHEFPSDYRNAIKWYQYDPT
                     KVFIYLTSLFGLSYDLKTFSQNIIQQALIQQRQKKIDRDSKSVNWGPKLADLPAWTKE
                     EFLEKNRENDGLVIVGGIVHDVSGYITEHPGGEKLLKNALGKDATKAFSGGVYRHSNA
                     AHNTLATMRVAVMKDNKETAMRFAQKRGERAERVERAHMN"
     gene            complement(<32511..>32921)
                     /locus_tag="CAGL0I00440g"
                     /db_xref="GeneID:2889316"
     mRNA            complement(<32511..>32921)
                     /locus_tag="CAGL0I00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447272.1"
                     /db_xref="GeneID:2889316"
     CDS             complement(32511..32921)
                     /locus_tag="CAGL0I00440g"
                     /note="highly similar to uniprot|P53173 Saccharomyces
                     cerevisiae YGL054c ERV14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447272.1"
                     /db_xref="GeneID:2889316"
                     /db_xref="GOA:Q6FR72"
                     /db_xref="InterPro:IPR003377"
                     /db_xref="UniProtKB/TrEMBL:Q6FR72"
                     /translation="MGSYLFILAVVVNCINLFGQVHFTILYADLEADYINPIELCSKV
                     NKLIVPEAALHAVVSLLMLLNGYWFVFLLNLPVLAYNANKFYNKIQLLDATEIFRTLG
                     KHKRESFLKLGFYLLMFFFYLYRMIMALIADSED"
     gene            complement(<33501..>34250)
                     /locus_tag="CAGL0I00462g"
                     /db_xref="GeneID:2889317"
     mRNA            complement(<33501..>34250)
                     /locus_tag="CAGL0I00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447273.1"
                     /db_xref="GeneID:2889317"
     CDS             complement(33501..34250)
                     /locus_tag="CAGL0I00462g"
                     /inference="similar to AA sequence:UniProtKB:Q05905"
                     /note="similar to uniprot|Q05905 Saccharomyces cerevisiae
                     YLR301w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447273.1"
                     /db_xref="GeneID:2889317"
                     /db_xref="GOA:Q6FR71"
                     /translation="MSAVLFKRLVFQVGDSANERTFTLSSVSKNGHFISLRPFTKPTE
                     DEKKFPLEWVFAGTNDRVKVTPTTNADGKPVLQQDFDMGFDTNVYLNVENTHRGVINT
                     FWQNWESGCVEETGKVFPFGNDKEGIPFMELWQPIDPNSKDLVILDAGDGRKIDGPVR
                     STVLKVVDGQDFEGLMIIVGEWAQGYLADKNKSSVDGLSFVRYHVSNEKLSSGLFEYG
                     SQLSKFPTDFSNVKEGSLLTIDGLKWEVIEN"
     gene            complement(<34909..>36240)
                     /locus_tag="CAGL0I00484g"
                     /db_xref="GeneID:2889406"
     mRNA            complement(<34909..>36240)
                     /locus_tag="CAGL0I00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447274.1"
                     /db_xref="GeneID:2889406"
     CDS             complement(34909..36240)
                     /locus_tag="CAGL0I00484g"
                     /inference="similar to AA sequence:UniProtKB:P23776"
                     /note="similar to uniprot|P23776 Saccharomyces cerevisiae
                     YLR300w EXG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447274.1"
                     /db_xref="GeneID:2889406"
                     /db_xref="GOA:Q6FR70"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q6FR70"
                     /translation="MVSFSFATIVAALSVSALAKPVIAPKNKDTSLHFVNEKRYYDYD
                     SKAIGEPIRGVNIGGWFVLEPYITPSLFEAFRTNPYNDDGIPVDEYHYCEQLGEQEAR
                     NRLEYHWSTFYTEQDFADIKSKGFNLVRIPIGYWAFKDMPNDPYVKGSQEYYLDQAIQ
                     WAENNGLKVWVDLHGAVGSQNGFDNSGLRDSIDFLADENLQNTKEILKYVLQKYSQQQ
                     YLNTVIGVELINEPLGPVIDMDKMKEQYIKPAYEYLRNELQSIQDIIVHDAFQPFHYW
                     DDFMTVDTGYWGVVIDHHHYQVFSTGELQRDMGQHIQVACEWGSGILTESHWTVAGEW
                     SAALTDCTKWLNGVGIGARYDGSFWKNGVSSSFIGSCANNEDIYSWSEERKENTRKYI
                     EAQLDAFEKRGGWIFWCYKTETNIEWDASRLIEYGMFPQPLTDRRYPGQCA"
     gene            complement(<38137..>40002)
                     /locus_tag="CAGL0I00506g"
                     /db_xref="GeneID:2889319"
     mRNA            complement(<38137..>40002)
                     /locus_tag="CAGL0I00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447275.1"
                     /db_xref="GeneID:2889319"
     CDS             complement(38137..40002)
                     /locus_tag="CAGL0I00506g"
                     /inference="similar to AA sequence:UniProtKB:Q05902"
                     /note="similar to uniprot|Q05902 Saccharomyces cerevisiae
                     YLR299w ECM38 gamma-glutamyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447275.1"
                     /db_xref="GeneID:2889319"
                     /db_xref="GOA:Q6FR69"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FR69"
                     /translation="MMGIRKLIFSFLIYLQVSCLAVVDQNTKGFFTSDGDDHNIDISP
                     LPRWPSLNPDQKLLKVGRNGAISSDLELCNNLTINEIFLKYPQANAADAAVTQALCIG
                     MVNFFNSGIGGGGYVVFAKGPRAPDTTGNHLFIDFREKAPAAAHKSMFENCSLCSKVG
                     GLAVAVPGELKGLYELYKSRGSGKVTWKQLLEPIIKLGEDGWVVEEALGATLTLYEQF
                     ILERKYDWEFVLNSTKNGVKKTGDKISRPVLSKLLRELANNGSADPFYDKDGWIVKSM
                     VDKIKENQGIITSQDFDDYTVRKDKPLERKIRQGFSFAPNNDLTVLTSGGSSSGPALL
                     ASLAVMETFGDSMGGDYGDEEIFQLVETMKWMGSARSRLGDYVGKRFPDNIQEVLNPK
                     WVSKIIHAIKHQCRQSPLRTLNNYTCYDPMYDINEPHGTAHFSITDKFGNAISLTTTV
                     NLLYGSLVHDPNTGVIFNNEMDDFAQPNRSNSFDLAASIYNLIEPGKRPLSSTAPSII
                     MNELGYPDLVVGASGGSRITTSILQTIIRVYWYQMPLLESIAYPRVHHQLLPYQLEVE
                     SEAMIGSETIQALKSMGHNVLQVEPKSVVNAIQRIAGEWHAVSDYWRKRGISAVY"
     gene            <40396..>41067
                     /locus_tag="CAGL0I00528g"
                     /db_xref="GeneID:2889083"
     mRNA            <40396..>41067
                     /locus_tag="CAGL0I00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447276.1"
                     /db_xref="GeneID:2889083"
     CDS             40396..41067
                     /locus_tag="CAGL0I00528g"
                     /inference="similar to AA sequence:UniProtKB:Q05900"
                     /note="similar to uniprot|Q05900 Saccharomyces cerevisiae
                     YLR298c YHC1 associated with the U1 snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447276.1"
                     /db_xref="GeneID:2889083"
                     /db_xref="GOA:Q6FR68"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:Q6FR68"
                     /translation="MARYYCEYCHSYLTHDTLSVRKFHLMGKNHLRVRADYYRSQAIK
                     EQELDRRRCLHGKRAKVYKTKKSEQGSINHNEKLSIKLLSRKEKKKKLRVDRVYKKEL
                     NNSKINDLSKVYLGSPGYNRVFIDPNRYDIGDTVKASRLPQRANKLQEQNKYKDRNEL
                     YQGYDKQLPHLEVPKMLNIWNTSQKLTNIYYDPSTFPKSSDEIRRMPKSRNATHYKSR
                     QLQAS"
     gene            complement(<41539..>41775)
                     /locus_tag="CAGL0I00550g"
                     /db_xref="GeneID:2889300"
     mRNA            complement(<41539..>41775)
                     /locus_tag="CAGL0I00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447277.1"
                     /db_xref="GeneID:2889300"
     CDS             complement(41539..41775)
                     /locus_tag="CAGL0I00550g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447277.1"
                     /db_xref="GeneID:2889300"
                     /db_xref="GOA:Q6FR67"
                     /db_xref="UniProtKB/TrEMBL:Q6FR67"
                     /translation="MELLGYDTSAFDAMYNVIKNSLFSSGQSFHEEPIENVIALFVIC
                     SIVMIMIMSCVVIMMMLLTINNKSTENDLEAGFF"
     gene            <43780..>44097
                     /locus_tag="CAGL0I00572g"
                     /db_xref="GeneID:2889301"
     mRNA            <43780..>44097
                     /locus_tag="CAGL0I00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447278.1"
                     /db_xref="GeneID:2889301"
     CDS             43780..44097
                     /locus_tag="CAGL0I00572g"
                     /inference="similar to AA sequence:UniProtKB:Q12349"
                     /note="similar to uniprot|Q12349 Saccharomyces cerevisiae
                     YLR295c ATP14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447278.1"
                     /db_xref="GeneID:2889301"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:Q6FR66"
                     /translation="MFRTSLRQFSSCRVSRNIISDLYLKELKSVKVTPFSMKDAEGNV
                     KPWSPPAKPQAPQSELTSGNDLLKSYKEEPVETLHTQPAETEGATQIEEHWLVLSEEE
                     PAH"
     gene            <44835..>45479
                     /locus_tag="CAGL0I00594g"
                     /db_xref="GeneID:2889320"
     mRNA            <44835..>45479
                     /locus_tag="CAGL0I00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447279.1"
                     /db_xref="GeneID:2889320"
     CDS             44835..45479
                     /locus_tag="CAGL0I00594g"
                     /note="highly similar to uniprot|P32835 Saccharomyces
                     cerevisiae YLR293c GSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447279.1"
                     /db_xref="GeneID:2889320"
                     /db_xref="GOA:Q6FR65"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV
                     HPLAFHTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
     gene            <46130..>46705
                     /locus_tag="CAGL0I00616g"
                     /db_xref="GeneID:2889173"
     mRNA            <46130..>46705
                     /locus_tag="CAGL0I00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447280.1"
                     /db_xref="GeneID:2889173"
     CDS             46130..46705
                     /locus_tag="CAGL0I00616g"
                     /inference="similar to AA sequence:UniProtKB:P39742"
                     /note="similar to uniprot|P39742 Saccharomyces cerevisiae
                     YLR292c SEC72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447280.1"
                     /db_xref="GeneID:2889173"
                     /db_xref="GOA:Q6FR64"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="UniProtKB/TrEMBL:Q6FR64"
                     /translation="MALVYDENSKKISVDTEEESVLINVEQINKLTQALIGTNKPNLT
                     PEPSNESTKMIQNLFENGAQHAKMKKFPEALKSVTLAIEMAQRKRTPWEAFAVQLNEL
                     HYLMRNKVDLSLTQQRYLEALQDLEFLLNTALIHPETFIRKCDALVNLGQLEEARITC
                     ERGLSLAPEDTKLKAMMFEITRRLADYNGEI"
     gene            <47120..>47902
                     /locus_tag="CAGL0I00638g"
                     /db_xref="GeneID:2889299"
     mRNA            <47120..>47902
                     /locus_tag="CAGL0I00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447281.1"
                     /db_xref="GeneID:2889299"
     CDS             47120..47902
                     /locus_tag="CAGL0I00638g"
                     /note="highly similar to uniprot|Q05892 Saccharomyces
                     cerevisiae YLR290c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447281.1"
                     /db_xref="GeneID:2889299"
                     /db_xref="GOA:Q6FR63"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FR63"
                     /translation="MQSLLVFGGNGFLGKRICQEAIRQGLKVTSISRSGQPPSSSNAG
                     DLKWIEKVNWKSADIFEPESYASSLREADHVVHSMGILLENENYKKLLNGGSFELKFG
                     ANPLEKTDSGNFTYERMNKESVLILAKAFDTVKKANPRTSLSYISADNWNPIITDGYI
                     NSKREAERELLKFKSFRTIVARPGFMYDENRNASDKRHLVQSTLDFFNWTNKTLLGNS
                     IRCVNNMIRPTISAQQVSRALVAKINDPSFSGILYLEDLLKN"
     gene            complement(<48007..>49980)
                     /locus_tag="CAGL0I00660g"
                     /db_xref="GeneID:2889103"
     mRNA            complement(<48007..>49980)
                     /locus_tag="CAGL0I00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447282.1"
                     /db_xref="GeneID:2889103"
     CDS             complement(48007..49980)
                     /locus_tag="CAGL0I00660g"
                     /note="highly similar to uniprot|P46943 Saccharomyces
                     cerevisiae YLR289w GUF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447282.1"
                     /db_xref="GeneID:2889103"
                     /db_xref="GOA:Q6FR62"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006297"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR013842"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLKTLGLRSLCPSLGGRGFRRHPNINKYTLSLVRVRWNHHLSNA
                     EIQARIENIPQENYRNFSIVAHVDHGKSTLSDRLLEITGVIDKNSSNKQVLDKLEVER
                     ERGITIKAQTCTMFYHDKRNGEDYLLHLVDTPGHVDFRGEVSRSYASCGGALLLVDAS
                     QGVQAQTVANFYLAYSMGLKLIPVVNKIDLNVADVERAKAEIEDNFELPRDEIIGVSA
                     KTGLNVKEMLLPTIVDRIPPPTGNKKKPFRALLVDSWYDSYLGVILLVNIVDGKLKKG
                     EKVLCAHTNKKYEVKELGIMYPDRVPTGSLVVGQVGYVVLGMKDSSDAHVGDTLMHVG
                     KESVTDILPGFEEQKPMVYVGAFPSTGTEFKAMDDDINRLVLNDRSVTLERETSNALG
                     QGWRLGFLGSLHASVFRERLEKEYGSKLIITQPTVPYMVRMTDGTESIITNPDDFPDS
                     ATRRMKVEELLEPFVEATITLPQEFLGNVIKLCDANRGQQKEITYLNTRGQVVLKYHL
                     PLAHLVDDFFGKLKAASKGYASLDYEDIGYRESDVVKLELLVNGQSIDALARVLHRTE
                     VEKVGREWVQKFKEYVKSQLFEVVIQARAGTKIVARQTIKARRKDVLARLHASDVSRR
                     KKLLEKQKEGKKQMRSVGRVQINQEAYQAFLKR"
     gene            <50356..>50925
                     /locus_tag="CAGL0I00682g"
                     /db_xref="GeneID:2889104"
     mRNA            <50356..>50925
                     /locus_tag="CAGL0I00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447283.1"
                     /db_xref="GeneID:2889104"
     CDS             50356..50925
                     /locus_tag="CAGL0I00682g"
                     /inference="similar to AA sequence:UniProtKB:P28627"
                     /note="similar to uniprot|P28627 Saccharomyces cerevisiae
                     YMR150c IMP1 protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447283.1"
                     /db_xref="GeneID:2889104"
                     /db_xref="GOA:Q6FR61"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:Q6FR61"
                     /translation="MLRIIRPGTYVIQSLCFLHVFHTYFYEFTETRGESMLPTLSATK
                     DFVHVDKRYRNGKNVRLGDCIVAVKPTDPTHRVCKRISGMPGDLILVDPGVKKDLVNY
                     SRSEEAMDDNEEFRTYIRVPKGHVWVTGDNLSHSLDSRTYNALPMGLIKGKIVAANDF
                     NEPFWNPKTKKIWGFRKIPNTYEDFLSVD"
     gene            complement(<51136..>51966)
                     /locus_tag="CAGL0I00704g"
                     /db_xref="GeneID:2889329"
     mRNA            complement(<51136..>51966)
                     /locus_tag="CAGL0I00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447284.1"
                     /db_xref="GeneID:2889329"
     CDS             complement(51136..51966)
                     /locus_tag="CAGL0I00704g"
                     /inference="similar to AA sequence:UniProtKB:Q02795"
                     /note="similar to uniprot|Q02795 Saccharomyces cerevisiae
                     YMR149w SWP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447284.1"
                     /db_xref="GeneID:2889329"
                     /db_xref="GOA:Q6FR60"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:Q6FR60"
                     /translation="MRWSQLALFSIFSYITLALRLTDVNVINYTDDEKKLLTFKEVSA
                     DIVTDQQLKVIEVTIPDAIYLVTFKSETPLDQANVYLGHPDKSLEVVYPIKERAGDIY
                     LFEINMDKLDKNLLAVQKELGNKPLAVTVVAASKDDSEGVLKTLFYMQLQESMLTEEL
                     PQRELAIKKELAHTFNKPPTHAPKLFAQLFALIILATFAALVITWFAAGAVNFGNMPK
                     GNFIYFIGFVVTIVGFEYIFTQYQLGTGIFETINRAICLGVPGIWISAKFLRSVEKPL
                     "
     gene            complement(<52542..>52931)
                     /locus_tag="CAGL0I00726g"
                     /db_xref="GeneID:2889330"
     mRNA            complement(<52542..>52931)
                     /locus_tag="CAGL0I00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447285.1"
                     /db_xref="GeneID:2889330"
     CDS             complement(52542..52931)
                     /locus_tag="CAGL0I00726g"
                     /note="weakly similar to uniprot|P40219 Saccharomyces
                     cerevisiae YMR148w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447285.1"
                     /db_xref="GeneID:2889330"
                     /db_xref="GOA:Q6FR59"
                     /db_xref="UniProtKB/TrEMBL:Q6FR59"
                     /translation="MQGRLIVPLVASLVVVPLLVGATWFALCVVVCGAVSDALYRAAS
                     YLYLKSDTFMDNKYTTDDPQAHALAVAKPSPRARNKKFDLRVLQPASSPQVSPVLSSI
                     HSMHSMHSKTDTNSHTYNIARSLETGI"
     gene            <53816..>55408
                     /locus_tag="CAGL0I00748g"
                     /db_xref="GeneID:2889043"
     mRNA            <53816..>55408
                     /locus_tag="CAGL0I00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447286.1"
                     /db_xref="GeneID:2889043"
     CDS             53816..55408
                     /locus_tag="CAGL0I00748g"
                     /note="highly similar to uniprot|P40215 Saccharomyces
                     cerevisiae YMR145c NDH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447286.1"
                     /db_xref="GeneID:2889043"
                     /db_xref="GOA:Q6FR58"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6FR58"
                     /translation="MFARIVSRRLMSSTAARLNSVPKVAAKPKSSFFRTMGKWSLRAT
                     LYGALAGTGYISYSLYRESNPSKQKPQSDTFPNGSKRKTLVILGSGWGSISLLKNLDT
                     NIYNVIVVSPRNYFLFTPLLPSTPVGRVELKSIIEPVRYIARRTTGEVLYYEAEATDI
                     DPHAKTVKIKSNSQNNDYELDINYDYLVVGVGAQPTTFGIPGVYENSSFLKEISDAQE
                     IRIKIMRNIEKAASLAPNDTERERLLSFVVVGGGPTGVEFAAELRDYVDQDLRKWMPE
                     LSKEIKITLVEALPNILNMFDKKLVTYAQDLFRQEKIDLRLKTMVKKVDSTKITAKCE
                     DKTESIPYGVLVWATGNAPRDVCKGLMQKIPETQNSRRGLLINSKMQLLGAEDSIYAI
                     GDCTFYPGLFPTAQVAHQEGEYLARVFKKLHKVDQFEYMASKNNQTKENIKDLTSKIN
                     NLKAQIEDFQYNHHGALAYIGSEQAIADLAVGEAKYRLAGSFTFLFWKYAYLAMCMSF
                     KNRILVAMDWTKAYFLGRDTSA"
     gene            complement(<56013..>56969)
                     /locus_tag="CAGL0I00770g"
                     /db_xref="GeneID:2889044"
     mRNA            complement(<56013..>56969)
                     /locus_tag="CAGL0I00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447287.1"
                     /db_xref="GeneID:2889044"
     CDS             complement(56013..56969)
                     /locus_tag="CAGL0I00770g"
                     /note="weakly similar to uniprot|P40214 Saccharomyces
                     cerevisiae YMR144w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447287.1"
                     /db_xref="GeneID:2889044"
                     /db_xref="GOA:Q6FR57"
                     /db_xref="UniProtKB/TrEMBL:Q6FR57"
                     /translation="MSNIQSVINPMEDSSTSRTKQDEAYSERSMQTTLKRANEIVTQL
                     ESMDTVDHGFVKKDVLDILRTLADRLNESTKQVQQLKYKNLLLSNKTSNENQMRHEVE
                     ENLKTQQFEKLKSQLYVENVHLNEQLHIKENKVTKYKKKIIAKNKHINQLMRLLNQTP
                     QLLDSSQSESSMISNAREDTEEADTTIPITDSGRKAKPVKTETHMLNALGMLASHVLK
                     DENKADDTSGNGDETRIEEDDSVNRTILQSEVKSSNQEIMDRSPTFARSLAPILPLNK
                     KEELHSLRVVLPNIPRPEMKLDVKLPVMKRFNTLDGSVKDIS"
     gene            complement(<57970..>59106)
                     /locus_tag="CAGL0I00792g"
                     /db_xref="GeneID:2889042"
     mRNA            complement(join(<57970..58377,59083..>59106))
                     /locus_tag="CAGL0I00792g"
                     /product="40S ribosomal protein S16"
                     /transcript_id="XM_447288.1"
                     /db_xref="GeneID:2889042"
     CDS             complement(join(57970..58377,59083..59106))
                     /locus_tag="CAGL0I00792g"
                     /note="highly similar to uniprot|P40213 Saccharomyces
                     cerevisiae YMR143w RPS16A or uniprot|P40213 Saccharomyces
                     cerevisiae YDL083c RPS16B"
                     /codon_start=1
                     /product="40S ribosomal protein S16"
                     /protein_id="XP_447288.1"
                     /db_xref="GeneID:2889042"
                     /db_xref="GOA:Q6FR56"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /translation="MSTVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLLLVGLDKFANIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKFVDEQSK
                     NELKKAFTSYDRTLLIADARRPEPKKFGGKGARARFQKSYR"
     gene            complement(<60165..>60488)
                     /locus_tag="CAGL0I00814g"
                     /db_xref="GeneID:2889041"
     mRNA            complement(<60165..>60488)
                     /locus_tag="CAGL0I00814g"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_447289.1"
                     /db_xref="GeneID:2889041"
     CDS             complement(60165..60488)
                     /locus_tag="CAGL0I00814g"
                     /note="highly similar to uniprot|P05318 Saccharomyces
                     cerevisiae YDL081c RPLA1"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_447289.1"
                     /db_xref="GeneID:2889041"
                     /db_xref="GOA:Q6FR55"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:Q6FR55"
                     /translation="MSTESALAYAALILADAEVEITSEKLVTLTGAAHIPVEGIWADI
                     FAKALDGQDLKSLLVNFSAGPAAAVGGAASAGAAAGGDAAAAEEKEEEAKEESDDDMG
                     FGLFD"
     gene            complement(<61200..>62609)
                     /locus_tag="CAGL0I00836g"
                     /db_xref="GeneID:2889040"
     mRNA            complement(<61200..>62609)
                     /locus_tag="CAGL0I00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447290.1"
                     /db_xref="GeneID:2889040"
     CDS             complement(61200..62609)
                     /locus_tag="CAGL0I00836g"
                     /inference="similar to AA sequence:UniProtKB:P40210"
                     /note="similar to uniprot|P40210 Saccharomyces cerevisiae
                     YMR140w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447290.1"
                     /db_xref="GeneID:2889040"
                     /db_xref="GOA:Q6FR54"
                     /translation="MGNVPAKLDQDASSYTGRSTYTDSSSASGVGAFRGAGGTMDETR
                     ARGRRTSSLVGNILNGPTSSRNDPTGEVSKKQLSAAKKRGTKERELLKEENAKKLVIK
                     YNETVDGGYLAPHGCYSLDKMDYDSDIVRKLIIERKLAPFYIPLQDFDDSWTKDEVKK
                     IVDALPLHAPFNEHVEEYEDVPVGDLNEPHFDYLIDKKLSKKEQKKMHALIFKARLYR
                     KRLRWQESENNAYLEEKLQNRDNDIPKNSFLPNDDLKYDLYAQGSECPICFLYLPMPL
                     NYSKCCQQPICSECFVQIKRSEPHFPHDEVDPSQPQKDENEKDPNLLISEPANCPYCA
                     TPNFSITYTPPTGRKVGIGGQAPNLYKPLGTAGNAPPTYTVSSDDIRPDWETKLNKER
                     VRLARRSANATAIHVSNRLIGPQRTGSFANEDSPGVAGSTDSRSAGVANSTLEELEKQ
                     MIDEAIRLSLQDEKRKAKR"
     gene            complement(<63365..>63958)
                     /locus_tag="CAGL0I00858g"
                     /db_xref="GeneID:2889039"
     mRNA            complement(<63365..>63958)
                     /locus_tag="CAGL0I00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447291.1"
                     /db_xref="GeneID:2889039"
     CDS             complement(63365..63958)
                     /locus_tag="CAGL0I00858g"
                     /inference="similar to AA sequence:UniProtKB:P39110"
                     /note="similar to uniprot|P39110 Saccharomyces cerevisiae
                     YMR138w CIN4 GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447291.1"
                     /db_xref="GeneID:2889039"
                     /db_xref="GOA:Q6FR53"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FR53"
                     /translation="MGLLTIIKKQKLKDREIRCLILGLDNSGKSTIVNGLLPESEKCN
                     SITPTVGFQIHSIVVESAQDGKTYKVNLWDIGGQRTLRPFWDNYFDKTDVLLWCVDIA
                     SSLRFDESFNELRELVMQDRDRIGYQCKLVVAINKIDLVEQADLEHYAHDIEQKIEHI
                     LHHGQSVGESSIGHYVLCSGKTGAGIENLAQMIVDRE"
     gene            <64400..>66610
                     /locus_tag="CAGL0I00880g"
                     /db_xref="GeneID:2889037"
     mRNA            <64400..>66610
                     /locus_tag="CAGL0I00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447292.1"
                     /db_xref="GeneID:2889037"
     CDS             64400..66610
                     /locus_tag="CAGL0I00880g"
                     /note="weakly similar to uniprot|P30620 Saccharomyces
                     cerevisiae YMR137c PSO2 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447292.1"
                     /db_xref="GeneID:2889037"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:Q6FR52"
                     /translation="MSKRRSLLEVNQRELLQRTRGVENGRIRYRSSKRIHVQEQAKKQ
                     RTLTEFNIPTTSVLTVKNKRPISERVTESIELLSDEESLNGTDKNIQAFYTQETNTIV
                     IDVEDGDSSFSTECNVVDKSEVYDGCSKSLNLSNTKPSQRECYNDDHLKIKSSTGSIN
                     RGHNLKTSNSNSEKGETKTPNTSLMKTDHSDRDIKNIPQRNITTKPILECPICSKNLT
                     GMKLFQREAHCDNCFEQKPLSNFIEGRSAMVCQSKKIQTHLESTVEKEVGDKPNPISK
                     SKNPRRNRIPESFKILTFTSGYQIIVDGFTYPLKEDNKIKDFFLSHFHSDHYIGLKKS
                     WTSGNLYSSPVTYELLKYRYTPKRKTNEDNENITNCLKALKPYNRVWLTDTISVTTLD
                     ANHCPGASLFLFEEWDSMKTGILKTILHTGDFRSDDKLIEEVLKYTNHREIDEIYLDT
                     TYLLSTFTFPAQEELLNMVARFIETINNPNFRQSFFGDKQKSIFHFMSLPSSIDKKSE
                     IPMLYLVGTYSIGKEKLAIKIAETLNTKIYVQSNSIKRKMVSIYWDQCFDNSLLTDDP
                     SESQIHLVSLKVLRDFNAIDNYLKTIKELTGNKIKYDNVFGFIPTGWTFGNRYKKDFQ
                     YDGELSYDDNFKLRVKYCMDLLKQDEARPTQNFADVSSLEWLRMQYKPRERYQIFRVP
                     YSEHSSFRELLKFCISVPSKNIISTVNVDNGVNSAETSEWFKAFKYIRNKLSNN"
     gene            complement(<67387..>69090)
                     /locus_tag="CAGL0I00902g"
                     /db_xref="GeneID:2889038"
     mRNA            complement(<67387..>69090)
                     /locus_tag="CAGL0I00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447293.1"
                     /db_xref="GeneID:2889038"
     CDS             complement(67387..69090)
                     /locus_tag="CAGL0I00902g"
                     /note="weakly similar to uniprot|P40209 Saccharomyces
                     cerevisiae YMR136w GAT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447293.1"
                     /db_xref="GeneID:2889038"
                     /db_xref="GOA:Q6FR51"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FR51"
                     /translation="MNSDTNMQMMSKVSIPPIWSILKGRDDEDVTSPRYTKGKQLSML
                     SSHGSDSLETSPRTSITSHDLTQSSSSSGVSSNYTTITEAEFYSRCSTNLEKLIIEKN
                     EISKQLDSYKAVTKDSLVSSDFIKEFSDRLISIQKSIDEITKLQHDYEIATQQEKIRI
                     LACQYPSGSSRSSYVSPEQKFLPSFKNLASQPQQQQHQQQQQQNTTSSSPNQISSPTT
                     VPQTSAYQRQPVSHSIPSIHSLSNPVSSPLVPTSNRTLQLKSPNQTKILGPNELANPA
                     QQQHSYIQYTQGEYPSYGYQKQFVNAYQNTRNSEGQIFQVGNENRSKSLNVASILMDS
                     RRGSLPFPAYGNLQPTSYAVHSPIGGNLFHSSYQFSAGSPTMTGYKSATTDAMSAVPG
                     SGIINDKSPSLSNVLDSYSVTNPGPKKRGRKKKIKEGIVSSSFSSGLPIPHSLALANA
                     ETLKPQHINSLSKNINNSAGTVVMTSCLHCGENHTPEWRRGPYGNRTLCNACGLFYRK
                     AISKFGVKNANLLLRYRKRISNTANRRVPKMLKIPIGIIEEFDADPYLDSNYNTIRKE
                     E"
     gene            complement(<75399..>76223)
                     /locus_tag="CAGL0I00924g"
                     /db_xref="GeneID:2888915"
     mRNA            complement(<75399..>76223)
                     /locus_tag="CAGL0I00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447294.1"
                     /db_xref="GeneID:2888915"
     CDS             complement(75399..76223)
                     /locus_tag="CAGL0I00924g"
                     /inference="similar to AA sequence:UniProtKB:Q05584"
                     /note="similar to uniprot|Q05584 Saccharomyces cerevisiae
                     YDR272w GLO2 glyoxalase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447294.1"
                     /db_xref="GeneID:2888915"
                     /db_xref="GOA:Q6FR50"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR017782"
                     /db_xref="UniProtKB/TrEMBL:Q6FR50"
                     /translation="MHVKPIKMRWHTGGVNYSYLVSNQDQTTSWLIDPAEPHEVWPEL
                     SESERESVVALVNTHHHYDHAGGNTSLLKQFKETVGKPLQVIGGSEECDNVTLIPTHS
                     QKLKIGNLDVTCIRTPCHTQDSVCYYIRDPETDERCIFTGDTLFTAGCGRFFEGTGEE
                     MDAALNKYILEGVGKNNWSSTLVYPGHEYTKSNVKFVRSKIYPTTNVNSRFDELERFC
                     NEHEVTTGKFTLADELLFNPFMKLDDPIVRAAVGDSENQWTSAAVMDKLRKMKNAM"
     gene            complement(<76974..>77753)
                     /locus_tag="CAGL0I00946g"
                     /db_xref="GeneID:2888914"
     mRNA            complement(<76974..>77753)
                     /locus_tag="CAGL0I00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447295.1"
                     /db_xref="GeneID:2888914"
     CDS             complement(76974..77753)
                     /locus_tag="CAGL0I00946g"
                     /note="highly similar to uniprot|P38930 Saccharomyces
                     cerevisiae YOR039w CKB2 casein kinase II beta chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447295.1"
                     /db_xref="GeneID:2888914"
                     /db_xref="GOA:Q6FR49"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:Q6FR49"
                     /translation="MTERDIQMADRMSTNTSRVELDDEVMDDATDSSEYAQMWIDLFL
                     GRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYIVDELDDSIVENMSKARLEQ
                     LENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRVYCNFQPLLPVGLHDVPG
                     IDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFPDMVPKHPTARYVPKI
                     FGFELHKQAQLTRWQELQRLKLVKRLQAKEVDLSKSGGFRD"
     gene            <78375..>81368
                     /locus_tag="CAGL0I00968g"
                     /db_xref="GeneID:2888912"
     mRNA            <78375..>81368
                     /locus_tag="CAGL0I00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447296.1"
                     /db_xref="GeneID:2888912"
     CDS             78375..81368
                     /locus_tag="CAGL0I00968g"
                     /inference="similar to AA sequence:UniProtKB:P32480"
                     /note="similar to uniprot|P32480 Saccharomyces cerevisiae
                     YOR038c HIR2 histone transcription regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447296.1"
                     /db_xref="GeneID:2888912"
                     /db_xref="GOA:Q6FR48"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MRLLKYPLEGISGNVTSLVTIDAEYVVVCGSRGDIQVWHQQQLL
                     DTAFDRCTLETLKPKYSFTFELKDDEDELVFAMGDRDCLYLGTEHSVYSYSGWLKALE
                     SGHTTLENKLIYTTVSQSIITDVKWDSLLDILFVLTDRPCKIHLFDTRSANKKEITSI
                     ALDKNSKPLTGVVDPSGAGTFTVLTSDRSIVVYHINRTGDYKEVKKLSQHVLVYPLHY
                     KITMPPQADFLPIINSLKGSSGAAGSTATVLLNRNENYKVMSTLVPSASSNTKVLVHS
                     PKMYEKANLKRGTISRYNLVATSTNTDGSIMIWNTKRGKPLFAPLNISDSAINDMIWS
                     SNGLTLFAVSNDNVLYTFAFLQDDLGKTVPMEEIENIRQSNIIKEPLPIAYVITASDG
                     LGDISTSKNQGLGVAADNSSNILSTDTNTNEKNLSTVNTTEPQTNSQSSSYNNKPESK
                     LDSSKSEITSADSSDEKAKNLEARPIEAKSKKILNGKNLESKSSSVTTSDNIQKKVED
                     SKSNVSVTATEKKTKPDKKSIKSENGESKVNKAQNTISPKESNTTDNKSTTPDFKNPS
                     YQVPKDLKRKPKEDALGNAVTKRAKKDLEPVDFLDTGLLLPNVAFSRVRLSTPLIRMN
                     IDCTSSNDSKILLNIRNGSGNEQKPTIVKLLDKTVTPERTLFQDFIPKFVSLATSGDD
                     FWACSSEDGTLYIFNDVGRKIIPPLTIGVPISFLEACGKYLLCVSSIGELYCWNIASS
                     KLEFPVTTIFPLLSPSIRYSDDILTRAENITMCSVTNNGFPIATLSNGDGYMYDKNME
                     TWLLVSDGWWAYGSQYWDSTNNSNLIPDSSTKPTEGQSSTEISKASIVTLLEKKTNNE
                     LTRKGRIKNLRRFARTILMKEGFENIEEIVTLSHLENKLLVTLRLEEQHEFKKLIKLY
                     AVKLGELGYVDRLRDLFAWIISDSNDNGDLIPGINRKELVKTLLTACADLRSVQRVTI
                     DYADMLGYLPNDIFFDCESQNDTGK"
     gene            complement(<81437..>82468)
                     /locus_tag="CAGL0I00990g"
                     /db_xref="GeneID:2888913"
     mRNA            complement(<81437..>82468)
                     /locus_tag="CAGL0I00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447297.1"
                     /db_xref="GeneID:2888913"
     CDS             complement(81437..82468)
                     /locus_tag="CAGL0I00990g"
                     /inference="similar to AA sequence:UniProtKB:P38909"
                     /note="similar to uniprot|P38909 Saccharomyces cerevisiae
                     YOR037w CYC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447297.1"
                     /db_xref="GeneID:2888913"
                     /db_xref="GOA:Q6FR47"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6FR47"
                     /translation="MLKGYQALCGRRTISSVSPIKRSFSKRSIIGYSIILSASAFVTW
                     TYKDLIKQKYVETFTKTKELSPNDFTEYKITRRHDIDNCHYLIELTPLKRQNVNLWKE
                     LERNILWSIEVKQPEIMVVRNYTPLPLQLKSNGNIVPLDLNDPVESKKLLFYIKSYNN
                     GEVARWIKSLPVGSTLELRGPFIDYKFRNDLSKHHRDANGSTLINKTQLSNVPFFAGG
                     TGIVTALQPILNPYGQFNYNMTLFHSCKSIQELGCLYHLVNGLAQQNKITYHLFETSK
                     GDNIIDFKQLIPGPNTSNAGNLDTSIVCGPEGYITTVAGAKYDTSQGPIEGLLGEKGW
                     DNSNVYKMD"
     gene            complement(<82834..>83682)
                     /locus_tag="CAGL0I01012g"
                     /db_xref="GeneID:2888911"
     mRNA            complement(<82834..>83682)
                     /locus_tag="CAGL0I01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447298.1"
                     /db_xref="GeneID:2888911"
     CDS             complement(82834..83682)
                     /locus_tag="CAGL0I01012g"
                     /inference="similar to AA sequence:UniProtKB:P32854"
                     /note="similar to uniprot|P32854 Saccharomyces cerevisiae
                     YOR036w PEP12 syntaxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447298.1"
                     /db_xref="GeneID:2888911"
                     /db_xref="GOA:Q6FR46"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FR46"
                     /translation="MDSYEERESSPMFRDCPRFEELKDKISSELFEVNGRVSTLRQFT
                     ESLSRFLDNSDIDVNANVVQNINKKALTNIEVVNELLKNVNEDVKEIDNIEDSELDKP
                     QIIARDKLIRDSRFSIQESQTAQQQFSKIIKSINAEARGKLNEEQNWTALLQEDEESH
                     QTNNDNTAQRQVNFVIEREPINNEEFAYQQRLIQERDEEITNIERGITELNGIFKDLG
                     AVITHQGMMVDNIEANIYSAVENTAGASQELNKANRMQKRSSRYCLYFLMILVVMLIL
                     MILIVI"
     gene            <84159..>86510
                     /locus_tag="CAGL0I01034g"
                     /db_xref="GeneID:2889112"
     mRNA            <84159..>86510
                     /locus_tag="CAGL0I01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447299.1"
                     /db_xref="GeneID:2889112"
     CDS             84159..86510
                     /locus_tag="CAGL0I01034g"
                     /inference="similar to AA sequence:UniProtKB:P51534"
                     /note="similar to uniprot|P51534 Saccharomyces cerevisiae
                     YOR035c SHE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447299.1"
                     /db_xref="GeneID:2889112"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024660"
                     /db_xref="UniProtKB/TrEMBL:Q6FR45"
                     /translation="MSVSKDAIETLCEELDKSATISIDEKSYQEALDEIKDIIVRKKR
                     VASAQLPEIEKVLIRSYQDHTESKKFLREIIKSNVGKALDLFEMLSLPSIHVLVGIFF
                     DSEETMVLLDELRTRIHYGEDPNIKYLLSIVLQLLSKFTYVFNDFSFLVRDLCLRCRE
                     PDVSPMMLLIFTQLNYRYPDEFKVKFLETMDVLIMEAEEDIGDEPLCLIVEILTELYP
                     SLTGLCSEVLLTRGAGKMLKERATSEDSDKNFRSKLLKLLSIACIDETVRVHISEKYI
                     ETLETSMQFSEYKVLAALVLIKTWSFLKLKHIDINKLASILVDNFLDSAVLESEDTET
                     RDSNQTLVYTIEGLAYLTLKVPIKRMLRIHEVFRNEIIKLAKKESGTNPNYFGILIII
                     ANLTALPNDKTNPTNQTHSGSMAQLSMYANMGADTNKLKDNVPDSEEEVKEFQEKFIL
                     KKDLLADMKTKFNDMSPGSKQQYMRIVYNMTRVKENISSCVQQGVTTNILEYLVSKQD
                     KGVAVRLLAYRSLTRILISTDPALIFNKYSPLNAIPFLFDLIGTTESGEETQEKIELN
                     PLLENDDNIEVLDRYEALLALTNLAATPTSNGEEICKSISNTPKYWNSIVNLMLNENL
                     LIQRSTLELISNLMSHPLPVAAKFFNFSNPQSLRNFNTLVQLIELDDIASQRAIAALF
                     ANIVISVPFISEELYEKDVLISRAIRILNDQNDDIELTQRLIIFFYGLFEYAPEKPES
                     QKAKEKNLFKNANLRKALEKSLVNQNVGGEYKDAIPTMLALMS"
     gene            complement(<86656..>89184)
                     /locus_tag="CAGL0I01056g"
                     /db_xref="GeneID:2888910"
     mRNA            complement(<86656..>89184)
                     /locus_tag="CAGL0I01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447300.1"
                     /db_xref="GeneID:2888910"
     CDS             complement(86656..89184)
                     /locus_tag="CAGL0I01056g"
                     /inference="similar to AA sequence:UniProtKB:P40164"
                     /note="similar to uniprot|P40164 Saccharomyces cerevisiae
                     YNL201c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447300.1"
                     /db_xref="GeneID:2888910"
                     /db_xref="GOA:Q6FR44"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="InterPro:IPR016024"
                     /translation="MTLHSTNVTRTDSKRVKVYLLENNEWKDTGTGYCHGEVVSTELV
                     DNKREEAFLLVTNENEPHQVLLRSKLEGNIEYQRQEETLIVWKDVEGKDIALSFEESL
                     GCDTLCEFVVNVQRSIEPNISLVAVKSVDNGMGSIHEIITGPVALPSIETKQNTTTLL
                     DALKILNDNTAFEYLKTETVEYVLKNNYIDLLIAHFHKAETEKIPRDLFLISNILKTM
                     ILYNQRDIIESLVEDKRIMGVVGILEYDTEFPTSKANHRKCLESEAPSFKEIIPLENE
                     ELKTVIKKCFRLQFLKDVVLVQFLDDNNLGLITDIILDLETCIIDSLQTDPFLDNLLQ
                     LYSKDKIYNSELTDESTDLIQKRKEGIKLLHQCIQMSRNLEHMDKSKFYKVLVKKGLF
                     NLLDYAFNFEKDNNLRILATDTIIAIVEHDILLIHNVQKEISQHNDRQSLCLNGNQNE
                     AKSSEANATVDLTLLEILSTILLTDNNPGLREQVVQALNTLLHPEGCIGDGFDNQLDN
                     GLDFDDNILLRKDSNNLDDDFQEQTGMSKIPPFTLNSSQQLENQIAEYFKQFYIQIAP
                     KLFGPLIENNCMSDEERQKYVNDDVLMIHLVKLVSFICSEHERLISRKFVLENGILDS
                     ISNLINPGYRLQLRLTALRCIKNIICLDDKYYHRHMISNELYSPIMKLMEEHLLEDNL
                     ANSALQDFFRIIASECHVFKDDSELFNYSDNAYNINATELHRRSGSIPSSNFTMLNKH
                     INDKYPEVLDKLLYITFVKQLREQYKEHSKLLPNGKKRKISADNVNDFDGDKINNGKK
                     GQLSKNKVMNYNSFETHIDDRASSTDSQPATCLVGSPAAYDNAV"
     gene            <90566..>91367
                     /locus_tag="CAGL0I01078g"
                     /db_xref="GeneID:2889332"
     mRNA            join(<90566..90578,91000..>91367)
                     /locus_tag="CAGL0I01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447301.1"
                     /db_xref="GeneID:2889332"
     CDS             join(90566..90578,91000..91367)
                     /locus_tag="CAGL0I01078g"
                     /note="highly similar to uniprot|P07274 Saccharomyces
                     cerevisiae YOR122c PFY1 profilin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447301.1"
                     /db_xref="GeneID:2889332"
                     /db_xref="GOA:Q6FR43"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:Q6FR43"
                     /translation="MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEIS
                     EIVQGFDNPTGLQSNGLHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYP
                     PTVQAGEATKIVEQLADYLISVQY"
     gene            complement(<91693..>92625)
                     /locus_tag="CAGL0I01100g"
                     /db_xref="GeneID:2889333"
     mRNA            complement(<91693..>92625)
                     /locus_tag="CAGL0I01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447302.1"
                     /db_xref="GeneID:2889333"
     CDS             complement(91693..92625)
                     /locus_tag="CAGL0I01100g"
                     /note="highly similar to uniprot|P14065 Saccharomyces
                     cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
                     cerevisiae YDR368w YPR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447302.1"
                     /db_xref="GeneID:2889333"
                     /db_xref="GOA:Q6FR42"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FR42"
                     /translation="MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKA
                     GYRHIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGL
                     DYVDLYLMHWPVALKTDLIKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKEK
                     ARAIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYS
                     PLGSTDAPILKEEEITEIAKKNGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETF
                     KLSDEDFATLSNYAKKHGERRVVSPNWGPFKPFV"
     gene            <93934..>94914
                     /locus_tag="CAGL0I01122g"
                     /db_xref="GeneID:2889331"
     mRNA            <93934..>94914
                     /locus_tag="CAGL0I01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447303.1"
                     /db_xref="GeneID:2889331"
     CDS             93934..94914
                     /locus_tag="CAGL0I01122g"
                     /note="highly similar to uniprot|P38715 Saccharomyces
                     cerevisiae YHR104w GRE3 aldose reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447303.1"
                     /db_xref="GeneID:2889331"
                     /db_xref="GOA:Q6FR41"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FR41"
                     /translation="MSSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFD
                     GAEDYGNEKEVGQGIRKAIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGL
                     DYLDLFYIHFPIAFKYVPFEEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVE
                     EGLIKSIGISNFSGSLVQDLLRQCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAY
                     SSFGPQSYIELNHPLAKNTPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKS
                     SKKERLQDNLMIDEKLTLTHKELEAISKLNKNLRLNDPWDWLDGKFPIFA"
     gene            <95410..>95931
                     /locus_tag="CAGL0I01144g"
                     /db_xref="GeneID:2889335"
     mRNA            <95410..>95931
                     /locus_tag="CAGL0I01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447304.1"
                     /db_xref="GeneID:2889335"
     CDS             95410..95931
                     /locus_tag="CAGL0I01144g"
                     /inference="similar to AA sequence:UniProtKB:P38815"
                     /note="similar to uniprot|P38815 Saccharomyces cerevisiae
                     YHR105w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447304.1"
                     /db_xref="GeneID:2889335"
                     /db_xref="GOA:Q6FR40"
                     /db_xref="InterPro:IPR001683"
                     /translation="MADKVAVLDPEPITLLDTEDEPGISQSRRSSIANSNFYIERAFV
                     TNCTIISGERSTPKFAVWKVTAVLHPLNPNSSGSYRIHTYKRYSDFVEFRNALLDRVR
                     TKRPASVSEIPELPPPVKWYYSWKYNEINLNKEWLANRRKGLELFINQVLLNGNIVDI
                     AKDLVIQFLRPRK"
     gene            <96786..>97745
                     /locus_tag="CAGL0I01166g"
                     /db_xref="GeneID:2889334"
     mRNA            <96786..>97745
                     /locus_tag="CAGL0I01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447305.1"
                     /db_xref="GeneID:2889334"
     CDS             96786..97745
                     /locus_tag="CAGL0I01166g"
                     /note="highly similar to uniprot|P29509 Saccharomyces
                     cerevisiae YDR353w TRR1 thioredoxin reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447305.1"
                     /db_xref="GeneID:2889334"
                     /db_xref="GOA:Q6FR39"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /translation="MNHKKVVIIGSGPAAHTAAIYLARAEIKPTMYEGMLANGIAAGG
                     QLTTTTEIENFPGFPDGMTGSELMDRMRAQSTKFGTEIITETIAKVDLSSRPFKLWTE
                     FNEDGEPITTDAIVIATGASAKRLHIPGEETYWQQGISACAVCDGAVPIFRNKPLAVI
                     GGGDSACEEAQFLTKYGSKVYLIVRKDHLRASTIMQRRAEQNDKIEILYNTVTLEAQG
                     DGKLLNNLRIKNVKTNEETDLPVNGLFYAIGHTPATKIVEGQVETDETGYIKTIPGSS
                     LTSVPGVFAAGDVQDSKYRQAITSAGSGCMAGLDAEKYLTELE"
     gene            complement(<98195..>99370)
                     /locus_tag="CAGL0I01188g"
                     /db_xref="GeneID:2889114"
     mRNA            complement(<98195..>99370)
                     /locus_tag="CAGL0I01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447306.1"
                     /db_xref="GeneID:2889114"
     CDS             complement(98195..99370)
                     /locus_tag="CAGL0I01188g"
                     /inference="similar to AA sequence:UniProtKB:P32468"
                     /note="similar to uniprot|P32468 Saccharomyces cerevisiae
                     YHR107c CDC12 septin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447306.1"
                     /db_xref="GeneID:2889114"
                     /db_xref="GOA:Q6FR38"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FR38"
                     /translation="MAEVIGLSNLPTQRARIVTQDGGVFNMMVCGESGLGKTTFVNTL
                     FSTTLKSTEDHPRDNAIRKTVRINISRAILEESDFSLRVNVIDTPGFGDNINNDKAWQ
                     TVVDFIDDQHDSYMRQEQQPFRDTKFDLRIHAVLYFIRPTGHGLKPIDIETMKRLSSR
                     ANLIPIISKSDTLTQNEITEFKNRIRQVLEYHQIRIFTPPLEEAADQSNKQDMISFEH
                     ARSIIEAMPFHIVGSDKQYQNAAGQMVTARKYPWGLVEVENEAHCNFVLLRTLLLRTY
                     LADLIETTNEIHYETYRRLRLEVGLKEGEDQRDDDPFIPARAPARKLSHNPAYKQEEN
                     ALKKYFTDQVKAEEQRFRQWEQNIVTERSKLNSDLEEIQQKVKKMEDQVKNLQLKMR"
     gene            <99925..>101580
                     /locus_tag="CAGL0I01210g"
                     /db_xref="GeneID:2889115"
     mRNA            <99925..>101580
                     /locus_tag="CAGL0I01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447307.1"
                     /db_xref="GeneID:2889115"
     CDS             99925..101580
                     /locus_tag="CAGL0I01210g"
                     /note="weakly similar to uniprot|P38818 Saccharomyces
                     cerevisiae YHR109w CTM1 cytochrome c methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447307.1"
                     /db_xref="GeneID:2889115"
                     /db_xref="GOA:Q6FR37"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR025815"
                     /translation="MELANICNATIAKGIAVQKDSYGGYGVYIVDPGALVGCNDPKLG
                     GDKIELLRVSSVFNVKNLMEAMNALEGEYAEDGQRAADMFKSIIGSSIEELSAVSETC
                     LLVYFMMVIYLMGEQGYAVPMKISRYIDTVLLGTTVNNASNCIESMLIHYEHVALFHE
                     LDNNLQKLHKTLISKMPSKKNYSIELLRQIYSATVSRVLEIPQELHEENYMDNYVVTP
                     SLVPILDYVNHGDKTSRNAYYDVDRRKGDIILYLDLTVVNPGKLKPNTEVLITYKDIE
                     DSLAMITKYGFDPANYTTTGTKIFSCTFDKMYLSTNKFDNEIDIRNFYQWFSINPSLQ
                     FVLNSENEWLINDSLAEFERLLVPFATSSQRNEHYWIYSDGDDARKRFMEYFDIDEVE
                     DEDEAWAQLETQFKWFESSENDLMPFPPCVWTVKSKFLKEKEATGYELEKVIQNKLEN
                     SRALYNETTNQFQAYLENYLDYRIDVLQEYSPEDTENENAVSQLIARELSVLLKIRDR
                     INNNKSIFLNSEDKKYAKLPLLPTKNVERPPWLSEGDDDFDQD"
     gene            <102013..>102645
                     /locus_tag="CAGL0I01232g"
                     /db_xref="GeneID:2889116"
     mRNA            <102013..>102645
                     /locus_tag="CAGL0I01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447308.1"
                     /db_xref="GeneID:2889116"
     CDS             102013..102645
                     /locus_tag="CAGL0I01232g"
                     /inference="similar to AA sequence:UniProtKB:P38819"
                     /note="similar to uniprot|P38819 Saccharomyces cerevisiae
                     YHR110w ERP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447308.1"
                     /db_xref="GeneID:2889116"
                     /db_xref="GOA:Q6FR36"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FR36"
                     /translation="MRLQYIIFLLGCLLQTSNALHTYVKSGEMKCFYKNLKKGDVLIG
                     DLDTAVKNNGIYEEDPAVKVSVSIAETFDDDHIVLNQKNPYTGDFTFTALDNGEHRIC
                     VSPTYPDSNEPIRVYLDLEISNIEALDTKGKQNEAQLRKRVDQLNQRLNNIRMEQDVI
                     RENEASFRNQSEAANSKITFWTLVQIFILAGMCTFQVSYLKNFFVKQKVI"
     gene            <102965..>104266
                     /locus_tag="CAGL0I01254g"
                     /db_xref="GeneID:2889117"
     mRNA            <102965..>104266
                     /locus_tag="CAGL0I01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447309.1"
                     /db_xref="GeneID:2889117"
     CDS             102965..104266
                     /locus_tag="CAGL0I01254g"
                     /note="highly similar to uniprot|P38820 Saccharomyces
                     cerevisiae YHR111w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447309.1"
                     /db_xref="GeneID:2889117"
                     /db_xref="GOA:Q6FR35"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /translation="MTDQDLLAQIELLKKENAQLKEKLKSQDDEQLSLEEYSRYGRQM
                     IVEGTGGVVGQLRLKKAKVLVVGAGGLGSPSLPYLVGAGVGTIGIVDNDIVDTSNLHR
                     QTIHNTAKVGMLKCESAKQVLKDLNPHVNINTYPVRLGPENAFSIFADYDIVMDCTDT
                     PLTRYLISDVAVNLGKTVVSASGLGTEGQLTILNFNNIGPCYRCFYPVSPNPYAVSSC
                     QEGGVIGPCIGLVGTMMAVETLKIIMGVYNNENFEPFLLSYSGFPIQSLRRFKMRGRQ
                     SKCQTCGDAPVITKEAIESGIIDYNIFCGSRNYNVCAEGERLTAKEFDENYGPEFSGN
                     NKVLLDVRPSHHFDISHFNNAVNIPLKELRDMDGDISTLQSRIPNINKNSEVVVLCRY
                     GNDSQLATRMLKDEFGITNVKDVAGGFFKYIDDVDQSIPKY"
     gene            complement(<104391..>105533)
                     /locus_tag="CAGL0I01276g"
                     /db_xref="GeneID:2889118"
     mRNA            complement(<104391..>105533)
                     /locus_tag="CAGL0I01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447310.1"
                     /db_xref="GeneID:2889118"
     CDS             complement(104391..105533)
                     /locus_tag="CAGL0I01276g"
                     /note="highly similar to uniprot|P38716 Saccharomyces
                     cerevisiae YHR112c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447310.1"
                     /db_xref="GeneID:2889118"
                     /db_xref="GOA:Q6FR34"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FR34"
                     /translation="MTRQDLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWN
                     EREDLEFMDRTPIYSRLGHPNATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQ
                     LFIGQSYHGVHGIADILSRNYGLIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQS
                     FADKAHSRGALLMVDSTFAPPPLQYAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDE
                     EVSKRLKDDRIYLGTNVANLESHLLLRSLRTFEMRILKQSQNVTKIVEHLVSNRDKYS
                     KVLRQVFHSSLQDESFVKKQLIGGYTPVFSITLMNKEQCKQLPLKLKYFHHATSLGGV
                     ESLIEWRAMTDPYIDQTLIRFSIGCESADDLIADLDAAFIELEKLQ"
     gene            <106160..>107614
                     /locus_tag="CAGL0I01298g"
                     /db_xref="GeneID:2889119"
     mRNA            <106160..>107614
                     /locus_tag="CAGL0I01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447311.1"
                     /db_xref="GeneID:2889119"
     CDS             106160..107614
                     /locus_tag="CAGL0I01298g"
                     /note="highly similar to uniprot|P38821 Saccharomyces
                     cerevisiae YHR113w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447311.1"
                     /db_xref="GeneID:2889119"
                     /db_xref="GOA:Q6FR33"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:Q6FR33"
                     /translation="MRTPFFKSKEMSKSHASEFIKFLDASPTPYHAVASIRQHLVSHG
                     FKELSEKTAWHGKVEHNGKYYVTRNNSSIIAFSVGGKWKPGNPIAVTGAHTDSPALRI
                     KPISKRVSEKYAQVGVETYGGGIWHSWFDSDLALAGRVFVNDKSSGKIVSKLVDLKRP
                     LLKIPTLAIHLDREVNQKFEFNKETQLLPIAGLVKDEKNDKSKNDNNSGAIKSIVERH
                     HKELLDLVAKELELKSVEDIEDFELILYDYQGPTLGGINDEFVFSGRLDNLTSCFTSM
                     HGLTLAADTDLSNESGIRMMACFDHEEIGSSSAQGADSTFLPSVIERLSYLKADGTDA
                     ENPVTVPSYHETYSRSFFLSSDVAHAVHPNYASKYESQHKPLIGEGPVIKINANQRYM
                     TNSPGLVLVKKVAEISKVPLQLFVVANNSPCGSTIGPILASKTGIRTLDLGNPILSMH
                     SIRETGGSRDIDYQIQLFQKFFEQYTKLEDQIEV"
     gene            complement(<107768..>109270)
                     /locus_tag="CAGL0I01320g"
                     /db_xref="GeneID:2889120"
     mRNA            complement(<107768..>109270)
                     /locus_tag="CAGL0I01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447312.1"
                     /db_xref="GeneID:2889120"
     CDS             complement(107768..109270)
                     /locus_tag="CAGL0I01320g"
                     /inference="similar to AA sequence:UniProtKB:P21375"
                     /note="similar to uniprot|P21375 Saccharomyces cerevisiae
                     YJR051w OSM1 osmotic growth protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447312.1"
                     /db_xref="GeneID:2889120"
                     /db_xref="GOA:Q6FR32"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:Q6FR32"
                     /translation="MRGSRKVLVYITIIALVLLYRKINSNSMYKAVPKSPVVVIGTGL
                     AGLTTSNQLAHTYKIPVVLIDKASSIGGNSIKASSGINGAGTTTQANLNVKDSPELFL
                     EDTISSAKGKGSRPLMEKLSRDSSSAINWLQSTFNLKLDKLAQLGGHSTARTHRSSTN
                     IPPGFEIVSTLSKALKKTSEENPELVKILLNNKVTDIGIDSKGEVHSVTYTDADGNSH
                     VLETSNVVVCSGGFGYSKEFLHKFNPELVKLPTTNGKQTTGDGQNILERLGAKMVDMK
                     EIQVHPTGFIDSKDRGNNWKFLAAEALRGLGGILLHPESGKRFVNELETRDNVTAAIQ
                     RYCPKDDNRAILLMSEAVYTNYKANIDFYMSKGLIKKASVIDMVKNLKITSNVEDIVK
                     HLQHYSTASTDDFNRKLVINTFGKDVSKDTSVYYGEITPVVHFTMGGAEIDERSQVVG
                     TSGKPLAKGLYAAGEVSGGVHGANRLGGSSLLECVVYGRTAAESIASSYK"
     gene            complement(<110120..>111280)
                     /locus_tag="CAGL0I01342g"
                     /db_xref="GeneID:2889121"
     mRNA            complement(<110120..>111280)
                     /locus_tag="CAGL0I01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447313.1"
                     /db_xref="GeneID:2889121"
     CDS             complement(110120..111280)
                     /locus_tag="CAGL0I01342g"
                     /note="highly similar to uniprot|P37303 Saccharomyces
                     cerevisiae YEL046c GLY1 L-threonine aldolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447313.1"
                     /db_xref="GeneID:2889121"
                     /db_xref="GOA:Q6FR31"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:Q6FR31"
                     /translation="MTTELPPQYTSASNDLRSDTFTTPTRKMKEAALEASIGDAVYNE
                     DVDTIRLEQHVAKLAGMEAGLFCVSGTLSNQIALRAHLYQPPYSILCDYRAHVYTHEA
                     AGLAILSQAMVVPVIPSNGNYMTLEDIKSHYVPDDGDIHGAPTKVISLENTLHGIIYP
                     LEELVRIKAWCMENGLKLHCDGARIWNAAAESGVPLKQFGELFDSISICLSKSMGAPM
                     GSILVGNTKFIKKCNHFRKQQGGGVRQSGMLSRMALCNIDADWKSNLLYSHRLAHNLA
                     DFCKEKGIPLESPADTNFVFVDLRAAKMNPDVLVKKGLKYGVKLMGGRISFHYQVSEE
                     SLEKVKLALLEAFEYSKEHPFDENGATKIYRSASTEVDIEGNAIQEIKTYKY"
     gene            complement(<112055..>112666)
                     /locus_tag="CAGL0I01364g"
                     /db_xref="GeneID:2889122"
     mRNA            complement(<112055..>112666)
                     /locus_tag="CAGL0I01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447314.1"
                     /db_xref="GeneID:2889122"
     CDS             complement(112055..112666)
                     /locus_tag="CAGL0I01364g"
                     /inference="similar to AA sequence:UniProtKB:P21374"
                     /note="similar to uniprot|P21374 Saccharomyces cerevisiae
                     YJR050w UTR3 pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447314.1"
                     /db_xref="GeneID:2889122"
                     /db_xref="GOA:Q6FR30"
                     /db_xref="InterPro:IPR009360"
                     /translation="MSRNVDKSQTVLALYQEHKAESRRDYNRYKRPRVESVRDPAEAR
                     EWYKQTLREVGECTNRLYDPLLSEEQVRECNARVNQLIQESQRWSRHLRRFKQRQRPP
                     VYGGVVVNGVRYIGRARELPEARKRPTAARQFTVKRAKYVDFSDNGDFSDNGDYRGTS
                     ERLRKAHGIAQQESVLVEPPTQQQMEEYLVERRKRQLLHQLNL"
     gene            <112888..>114420
                     /locus_tag="CAGL0I01386g"
                     /db_xref="GeneID:2888954"
     mRNA            <112888..>114420
                     /locus_tag="CAGL0I01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447315.1"
                     /db_xref="GeneID:2888954"
     CDS             112888..114420
                     /locus_tag="CAGL0I01386g"
                     /inference="similar to AA sequence:UniProtKB:P21373"
                     /note="similar to uniprot|P21373 Saccharomyces cerevisiae
                     YJR049c UTR1 associated with ferric reductase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447315.1"
                     /db_xref="GeneID:2888954"
                     /db_xref="GOA:Q6FR29"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:Q6FR29"
                     /translation="MEEMKRTDSCTKEKALQKWLADAEESSSSASEYKIANQDTSRHD
                     SDVALDISNAKDMLRRISSERSPSMSMSAHNTSKSSNTHFQYASTAYGVRLLSRDISN
                     TKVELDVQNLMIVTKLNDISLYFLTRELVEWLLVHFPQVTVYVDKELEHNDKFAAQEL
                     AKDSKCRQSRIKYWTKEFIDENDVFFDLVITLGGDGTVLFVSSLFQRHVPPVMSFSLG
                     SLGFLTNFKFEDFRTDLTKILNSKVKTNLRMRLECKVYRRHEPEVDPETGKKICVVEH
                     IDTHHILNEVTIDRGPSPFISMLELYGDGNLMTVAQADGLIIATPTGSTAYSLSAGGS
                     LIYPTVNAIAVTPICPHTLSFRPIILPDSMTLKVKVSLKARGTAWAGFDGKDRCELKQ
                     GDFITISASPYVFPTVESSPIEFINSISRTMNWNVREQQKSFTHILSQKNKEKYNTEK
                     VRESKAKSEEEEIEERKLSSSAFDMSSLKEAVKEEAKEDEGDDEDETADRCLLKKTSG
                     SK"
     gene            complement(<114899..>115213)
                     /locus_tag="CAGL0I01408g"
                     /db_xref="GeneID:2888955"
     mRNA            complement(<114899..>115213)
                     /locus_tag="CAGL0I01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447316.1"
                     /db_xref="GeneID:2888955"
     CDS             complement(114899..115213)
                     /locus_tag="CAGL0I01408g"
                     /note="highly similar to uniprot|P00044 Saccharomyces
                     cerevisiae YJR048w CYC1 cytochrome-c isoform 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447316.1"
                     /db_xref="GeneID:2888955"
                     /db_xref="GOA:P25400"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /translation="MSEKKGATLFKTRCLQCHTVEKGGPNKVGPNLHGIFGRKSGQAA
                     GYSYTDANIKKNVTWDEDNMSDYLTNPKKYIPGTKMAFGGLKKEKDRKDLIAYLKKAT
                     SD"
     gene            <116167..>116640
                     /locus_tag="CAGL0I01430g"
                     /db_xref="GeneID:2888956"
     mRNA            <116167..>116640
                     /locus_tag="CAGL0I01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447317.1"
                     /db_xref="GeneID:2888956"
     CDS             116167..116640
                     /locus_tag="CAGL0I01430g"
                     /note="highly similar to uniprot|P23301 Saccharomyces
                     cerevisiae YEL034w HYP2 translation initiation factor
                     eIF5A.1 or uniprot|P19211 Saccharomyces cerevisiae YJR047c
                     ANB1 translation initiation factor eIF5A.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447317.1"
                     /db_xref="GeneID:2888956"
                     /db_xref="GOA:Q6FLR2"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR2"
                     /translation="MAEEEHTFETADAGSSTTYPMQCSALRKNGFVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRTEFQLLDIDDGFLSL
                     MNMDGDTKDDVRHPEGELGDQMQAAFDEGKDLMVTIIAAMGEEAAISFKEAPRSD"
     gene            117600..117681
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I01452r"
                     /db_xref="GeneID:2888957"
     tRNA            117600..117681
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I01452r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2888957"
     gene            complement(<117899..>119680)
                     /locus_tag="CAGL0I01474g"
                     /db_xref="GeneID:2888958"
     mRNA            complement(<117899..>119680)
                     /locus_tag="CAGL0I01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447318.1"
                     /db_xref="GeneID:2888958"
     CDS             complement(117899..119680)
                     /locus_tag="CAGL0I01474g"
                     /inference="similar to AA sequence:UniProtKB:P47112"
                     /note="similar to uniprot|P47112 Saccharomyces cerevisiae
                     YJR046w TAH11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447318.1"
                     /db_xref="GeneID:2888958"
                     /db_xref="InterPro:IPR014939"
                     /db_xref="UniProtKB/TrEMBL:Q6FR26"
                     /translation="MVSLRVGGGLTMDRVPVIDLDEVSDDVALQKVLRSILLGHDTFL
                     LKNYANREKLDLELSQLSPIDVSQGFDSNFTGALQLEDDVVLEQYIATTDAAFKFARE
                     AKDPMLRKVSSRLLKVLMYFSQLCLRSLDINGVTLDDSHHSTKLVRYYHPTEVEKAVL
                     PDGSDLEFEYEASEFNTVRTPGILSVIPVARNVRVKPSTMSNDENVWITIDEPDCLLL
                     HTGELLAKESRHMHSTSPLQINMKKNVVQLTLLPALGYKSPDANTTLAQDFLEEQILE
                     FKKVSQVYYPREFSILQLKEKISFVKALFNVAETVVSLHQMSRASNRDPLLHDLLPQI
                     SNMMNRKVSSNDFLKIVTVWPQAYKVDYNSNGELMVNLPKKDPLAMLTNNSRKLDFVK
                     KLEEWYENVTKSQEIPDDIPVYKIGKRRGSDGQGSISIANTNIKLANTRPIASPAKYI
                     SNPKEKFQNLERPHDSQENLLERLRERERRSAALLSQRKHNYEQFLTVKMKQVFEIMY
                     SLRPNEPYTATYLATLTVDSLQNSNNPVGYEEATDILDRLERLLGDILIVHTVDGGLK
                     VYRWELLDRDQFMELLDKYKKHNTTNM"
     gene            <120258..>122201
                     /locus_tag="CAGL0I01496g"
                     /db_xref="GeneID:2888959"
     mRNA            <120258..>122201
                     /locus_tag="CAGL0I01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447319.1"
                     /db_xref="GeneID:2888959"
     CDS             120258..122201
                     /locus_tag="CAGL0I01496g"
                     /note="highly similar to uniprot|P12398 Saccharomyces
                     cerevisiae YJR045c SSC1 or uniprot|P39987 Saccharomyces
                     cerevisiae YEL030w ECM10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447319.1"
                     /db_xref="GeneID:2888959"
                     /db_xref="GOA:Q6FR25"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6FR25"
                     /translation="MLGARRIVQNARVCKRLQSTKVQGQVIGIDLGTTNSAVAVMEGK
                     VPKIIENAEGARTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFEDA
                     EVQRDIKQVPYKIVKHTNGDAWVEARGQRYSPAQVGGFVLNKMKETAEAYLGKPAKNA
                     VVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKADAKVVAVFDLGG
                     GTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIVLLREIVSRFKAESGIDLENDRMAI
                     QRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTEPLIKKTI
                     DPVKKALKDANLSTSDISDVLLVGGMSRMPKVVETVKQLFGKEPSKAVNPDEAVAIGA
                     AIQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAAGQ
                     TSVEIRVFQGERELVRDNKLIGNFNLSGIPPAPKGVPQIEVTFDIDADGIINVSARDK
                     ATNKDASITVAGSSGLSDAEIEQMVNDAEKFKSQDEARRQAIETANKADQLANDTENS
                     LKEFEGKLDKAESQKVKDEVAALKELVARVQAGEEVDAEQLKTKTDELQTSSMKLFEQ
                     MYKNQGNDGNSNSGSSENPENKQ"
     gene            <123041..>123460
                     /locus_tag="CAGL0I01518g"
                     /db_xref="GeneID:2888960"
     mRNA            <123041..>123460
                     /locus_tag="CAGL0I01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447320.1"
                     /db_xref="GeneID:2888960"
     CDS             123041..123460
                     /locus_tag="CAGL0I01518g"
                     /note="highly similar to uniprot|P47111 Saccharomyces
                     cerevisiae YJR044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447320.1"
                     /db_xref="GeneID:2888960"
                     /db_xref="GOA:Q6FR24"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:Q6FR24"
                     /translation="MELRISPLTRIISLSGFLASGFLFVILSCALYHNYYPLFGTLIF
                     LLAPIPNSLFGRKGYDTSDFMSDTTNNARDFGHFLTSMMVTSGIVLPFVFYHCQLIGS
                     VSCIMSMVGGLIIYLSIIIFSWFFSTSWDSEDDNLFG"
     gene            123989..124060
                     /locus_tag="CAGL0I01540r"
                     /db_xref="GeneID:2888961"
     tRNA            123989..124060
                     /locus_tag="CAGL0I01540r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT)"
                     /db_xref="GeneID:2888961"
     gene            <124905..>125387
                     /locus_tag="CAGL0I01562g"
                     /db_xref="GeneID:2888962"
     mRNA            <124905..>125387
                     /locus_tag="CAGL0I01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447321.1"
                     /db_xref="GeneID:2888962"
     CDS             124905..125387
                     /locus_tag="CAGL0I01562g"
                     /note="highly similar to uniprot|P25515 Saccharomyces
                     cerevisiae YEL027w CUP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447321.1"
                     /db_xref="GeneID:2888962"
                     /db_xref="GOA:Q6FR23"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:Q6FR23"
                     /translation="MSELCPVYAPFFGAIGCAAAIIFTSLGAAYGTAKSGVGVCVTCV
                     LRPDLLIKSIVPIVMAGIIAIYGLVVSVLISSSLTQKQALYTGFVQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFSEVLGLYGLIVALLMNSRATQDVIC
                     "
     gene            complement(<125729..>127897)
                     /locus_tag="CAGL0I01584g"
                     /db_xref="GeneID:2889321"
     mRNA            complement(<125729..>127897)
                     /locus_tag="CAGL0I01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447322.1"
                     /db_xref="GeneID:2889321"
     CDS             complement(125729..127897)
                     /locus_tag="CAGL0I01584g"
                     /inference="similar to AA sequence:UniProtKB:P46673"
                     /note="similar to uniprot|P46673 Saccharomyces cerevisiae
                     YJR042w NUP85 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447322.1"
                     /db_xref="GeneID:2889321"
                     /db_xref="InterPro:IPR011502"
                     /db_xref="UniProtKB/TrEMBL:Q6FR22"
                     /translation="MLNDLVMDVDLDFADGQSPMRTKKANEIIRDPISGSVVIPIDAD
                     KFPKESHNSPLVFKLGNGANENIMHVKSQKDVNLYPVPLSTSDFSENFINYICNLFDI
                     YQDLGSHRIFSRPTIGVISSDYELEHTRVVNMALDSMIIELEILIASYDKLENANIAR
                     ILELEQCLVILQCLRTFQFIDSINDRATFFDSLLKWTNRTDGEPKVEYIQSIFGQSDS
                     SQVFFTEPFWKLVYQLLLRGLTEQAINTLEKSELAKYLKENCETTSTIFEDFIQLVKN
                     YPLESEEHFREWKSFALELQQNFEDADTKIPVPLRKNLLDAISITAGNRDKILQHSSF
                     WYESLTGFLLYYIPSEELIQEYVGLAVSKTPIDVTNPWETACLKILQNDIFPVLPILE
                     SLDNCTASFSAALCESKGLLIDRYTILEENSGSDDIEIDDIFSQRNGMASFLLNNFAL
                     ELCSMKMKTLWPVAIGLISLSPYNTPSSKKSTIAELIPHYPFETNDDIEWALSVCAKW
                     RLPDIAKEIYTTLGNQMLDNGNTVEAIANFSKAGQYELVKHYSWLLFENAAFQGKPME
                     DEVLSAIVDGDFNTSELIPDEVLNKVVTNAMRQSLSPYAVLSQFFSNVENERWSKALQ
                     QLMSLIEFEYLPKKYTVLLIVKYMYPLFLNDDQRMIDEETLVSLLAAIEKNWDCDDTD
                     SVIAYEKLSEEIADLPKELKSMEKLIRKKLNGKLCLNLMI"
     gene            <128683..>132156
                     /locus_tag="CAGL0I01606g"
                     /db_xref="GeneID:2889322"
     mRNA            <128683..>132156
                     /locus_tag="CAGL0I01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447323.1"
                     /db_xref="GeneID:2889322"
     CDS             128683..132156
                     /locus_tag="CAGL0I01606g"
                     /note="weakly similar to uniprot|P47108 Saccharomyces
                     cerevisiae YJR041c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447323.1"
                     /db_xref="GeneID:2889322"
                     /db_xref="GOA:Q6FR21"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="UniProtKB/TrEMBL:Q6FR21"
                     /translation="MQFESAETLTKTLRSKIITSDEVVDIVRSLDGVHPYFPKREVFV
                     IDLILDRWNNFKNTDFRENPRVWKLFNDTWVKIGDENLQKSLFKKLKFPGLLQSSLET
                     FNGIEDTAKVQEYVESVNTTCDLLIKSVTSLQLPYEANLSILAAATQICSRISYANRV
                     EFLMNLINLTNFDSQLSKLTNKLSSIFSDILLLPILDYISNFESNIIDKDIILTFKGY
                     IMSALFNADIIGLDTTNILHEFFDAKKSTISHNSAVIIFEIAMNSLSKNNFIQLESIY
                     TMIVDVHDALKPDLLQKLSSTKKTMSHEFLFKLIKDSFQSLDKVTNPQEKIRDWSLIR
                     SILKLDIEIAIELSNEILALLLKNYHFFEKECQQIWAEFIECHISAREFFGFFGRLRT
                     YYDHDHNVSKFLCAREYRLDINKRIGLLSGLHLKELISEYVADMVSTSRSKISAILLS
                     IITEGLVHLNPSQLSEYRPYFQEVYMIDDINYAEQWAVKYFLMDVFDNIIPLDMLERY
                     KNKDIQKVILESPRINLQTFMFFLKIREYISMDIKEIENALMKYLSINKSSTFAFLIL
                     KNWYTIISEEFDSQNIRNLLEMLCLNSNFSLLLEFMKDDDIFEEPNLIHKLIGYLSDN
                     LTESAALDVLKIIPIQCYEKSSRVSLIDRLASLKINESVIDALSHLLIFPTFKTRLET
                     DVGTFFELFKNSIDLNHHSEKLLTTIWYHHAHSNDSSSKDFTYNLVNLVVANLSKLID
                     VKVSFWLAYYIQIYDEKRVHSNLRKEYFKAISAYSDKQSNLMPWLLKTLYQLLIREAD
                     LSMYQDVIKDCIQKYKLDGSNSNELKISVFMIYTLKDDSDFSFILAHYLALRSQGCHA
                     MELLTGVSEYLKLTAHYSSEKYNAALHLVCCALNDNTKTFHNYLLEIVPSLMLNLSKQ
                     NHIGQKLTVRLLSATYTSITQGMMDINSLTKFISTLKEILISKPWMFDQYTVELLLPL
                     SLEICNSIIPTTDFSNVQLQNNRIFISLCRLLSTLFTVHRFKLNQRYHVIDSLLCGMM
                     KYVINSQFYGLTEECAKAFARCVITFCEPTTNTSTKNKNQTTSKVNEIKKILRKHVPI
                     LLVNYTELVIGNSIDNEIRREIDPALYSMLNVISSSELQWISTLLGSTGRQYFKSIYA
                     EYKRIGKWTEQ"
     gene            complement(<132246..>134570)
                     /locus_tag="CAGL0I01628g"
                     /db_xref="GeneID:2889323"
     mRNA            complement(<132246..>134570)
                     /locus_tag="CAGL0I01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447324.1"
                     /db_xref="GeneID:2889323"
     CDS             complement(132246..134570)
                     /locus_tag="CAGL0I01628g"
                     /inference="similar to AA sequence:UniProtKB:P37020"
                     /note="similar to uniprot|P37020 Saccharomyces cerevisiae
                     YJR040w GEF1 voltage-gated chloride channel protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447324.1"
                     /db_xref="GeneID:2889323"
                     /db_xref="GOA:Q6FR20"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:Q6FR20"
                     /translation="MASDSFDIDRHSTDDPETAAKYIDISKFNNIDETQSFDKFITID
                     RVADNRNVILLPNAEREFFNKKYNGYINWLWNRGKIFITLTAIAITIGCLAGFIQVFT
                     ETLVNWKTGYCTSNWLLNKSFCCSDVVDEEMATRGLRLVRRDEGACVAQGVWTNWSGK
                     YSSFILFVSLSLLFGTISACLIRYVAPIATGSGISEIKVWVSGFEYQQEFLNVLTLIV
                     KSVALPLTISSGLSIGKEGPSVHYAACCGFVVANYFLKDKIGFTSLSQYLTAASGAGV
                     AVAFGAPIGGVLFGLEEIASGASFNSSTLWKSYYIALVAITTLKLINPFRNGKVVLFH
                     VTYDRDWSTQEVPIFVLLGIFGGLYGIYVSTMNIRYVHFRKKFLSKWPIQEVVILVLF
                     TSVISYFNEFLKLDMTEGMGILFHECQKNDNSSPFAHRLCQIDENTHVMDFIKQLLSL
                     IIATIIRIHFTIVSYGAKVPAGIFVPSMAIGATFGRAVSLIAERFFFAPNSITPGAYA
                     FLGAAATLCGITNLTLTVVVIMFELTGAFIYIIPTMIVVAMARIVLASFGFHGGIADQ
                     MVEVNGFPFLEESDKESFMYEFNANQIMSKDLAVLPEKLTVSELHHTVFENDKLYSGY
                     PIVRSADLHENDKVCIGYILRRHILKKLEVIDTEETANDQREINLMEFPGSDFSRAAY
                     QFGDIVDKYPPIVKGTIPVEQLFDTFRQMKCKIIMVEECGILQGVITRKDILRFSRGL
                     SRELEGPKYAYDEHLNERYFAFIQKVSSLFGAKI"
     gene            complement(<134918..>138286)
                     /locus_tag="CAGL0I01650g"
                     /db_xref="GeneID:2889324"
     mRNA            complement(<134918..>138286)
                     /locus_tag="CAGL0I01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447325.1"
                     /db_xref="GeneID:2889324"
     CDS             complement(134918..138286)
                     /locus_tag="CAGL0I01650g"
                     /note="weakly similar to uniprot|P47107 Saccharomyces
                     cerevisiae YJR039w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447325.1"
                     /db_xref="GeneID:2889324"
                     /db_xref="GOA:Q6FR19"
                     /db_xref="UniProtKB/TrEMBL:Q6FR19"
                     /translation="MEQETVTAIVLRERLCQSPDALGYVELEDGSVVVVRCEWIDHYG
                     ISESVVLRSRVRCSGYIVAFCEYKSGKSGGRYLLLLNSAGTLFVRELSQDPDSGQLQD
                     GYTLQYSIDIPITATFCNLRIDNELCHIYFNATDLDVYLLKFYDKKQGIEIHEGITTD
                     GDSTRSPIYSSFGKIKTLKLCRFYEEERDVSRMELSLITYKRGRWIFETCSRQSNKLD
                     SRWSCTRCLQLPQTLHLLPFSSPNNEYVFAYIPSFGYYILSLDDIFVIPFVNGFLCDI
                     GGVLVQDLTYFEGLRRQIDITETTTSITTDLVASEDTSRLNFWFLTDKDELIVVKINI
                     IQTDALDSVTHMNRFQFEVVGIDQPTNSDISRDQISLKKIWQWQRVLGRQYSISINDQ
                     KLPTQRKRNNEGPNMIYDYKLSQVPIEILTGCDYQSNSYYLEVEYNGLPVPQPPSNGK
                     EKNIEKCWHLINKLPGTPRLSYFDGEALIWKDNCDNIYSDQTLQKEDAPFDFIVNGAK
                     IEIKNNINDITFFRLKNSTEYCFVSFDGYLNWSFSDSQFNLRDKITNPTLKNVKINTT
                     VIGNNVVLTYAIIDKHVLCFLNTELKSHTKLQIDVSRVTHFDFNTCSESTDLLLLDPE
                     GVLHIVRADSDTLISKYHFCLPNLRFAKSSKVNEWLIYSSEYIAILNYDIKLKSYTLK
                     SLFLPVTLATLVGFGDDNIYAVSESGLFIKMDRDLLDLSPKQIKNRVRLDYKLVAISF
                     LPFSYRYVVGHVEKLGNDEKDPDNIVALIDIINGTIVDEYTTTINRENRNISSMSPLF
                     YKEDNILLPELKGETSYAKKYAVSHCFAVLLSPTNLEDNLQNNNTDNLLIFSVDEDLK
                     KIKLETMVPTNSNASIVENFYYRTFMVAGDTVALYELDYLVKENRFTVQKVSNEVGGS
                     LVLGAVNIYHGISNNGYKERNRKASISRITLLDKFRGILEYSILLDDKKKPNSQPDDL
                     RLRIIPMTSKDVIPISSIIHEGDVIDKFEVAVIGDYSFFAVVYNNRKLIIFFQDTEEL
                     LGYHTFNLPATVETISSPKKVGQIQESMETPLFYLITTQGTRFNIVLTKDFQVSESAL
                     EEQESHLNELEYSDGRNDASIFPFIDTRILTNML"
     gene            <138747..>141323
                     /locus_tag="CAGL0I01672g"
                     /db_xref="GeneID:2889325"
     mRNA            <138747..>141323
                     /locus_tag="CAGL0I01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447326.1"
                     /db_xref="GeneID:2889325"
     CDS             138747..141323
                     /locus_tag="CAGL0I01672g"
                     /inference="similar to AA sequence:UniProtKB:P40985"
                     /note="similar to uniprot|P40985 Saccharomyces cerevisiae
                     YJR036c HUL4 hect domain E3 ubiquitin-protein ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447326.1"
                     /db_xref="GeneID:2889325"
                     /db_xref="GOA:Q6FR18"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:Q6FR18"
                     /translation="MFRRSKSIKKTSKQIEVISHSKTPGDEGEQLKVRVEDKRKSITV
                     TVETERLNCLCCGMVLDIPKTAEKFKCCVCHVTTYRGGQTKSETYKYKTSIDVDDLAV
                     IVKNCFNDIVERKNEMTQEEKYNVFNPVNDYIDAKFRHHQILENSFPGSSPLVDSDVN
                     TEQVLRFYKILFSLPTRRPYFRMLCRMNDLLRKANHNCTHFRWLIIILMNPGLRCCLI
                     GKAQGGFDSQEIRTISYELLKRSIGYLSNLDRQKHSKKLIKYLMRMPLSCFKEQLEVL
                     NLYLTFQFSKIMYKDNQSVRTRIQPRRMPSDGMELVNNSTYWNYHLSGSDESPNINGI
                     LESKSSEHGQKGKSVPSGDFKFSPYQYENDWHILSVTKLISFFFTANQKRNISCLQSE
                     NNGLLDTSTFYNTILDFIDYRKDFDNWRGKPNRLHFVQSKEYDGNGKQFTFCKYPFLI
                     SLGLKISIMEYEIRRIMEYEAEQAFLLSLDKGKVIDVYLKVRVRRSNISSDSLQSIKE
                     HQGDLFKSLKVEFVGEPGIDAGGLRKEWFMLLTKTLFDPRTSLFVYVPESRLIWFSNS
                     AQNEASIPDKETMELYYLFGVVMALAIFNSTILNLHFPKALYKKICGEPLKFDDYAEI
                     YPETAQNLQKLLEYDGDDFSEVFALNFETTFINDMWEINPKNIKKYNTVELCANGKNM
                     SVTSSNKEEYVKLWIDFYLNKNISTTFEKFLLGFKRVFSVSKSIKLFNFEELQRLVCG
                     DQDTNKYDFGMLKSVTKYIGGMNENMPVAKWFWEIAQEWDITKQKKLMRFVTGSDGVP
                     ATGMSTLPFKLSLLGSSDSDKLPIAHTCFNELCLWQYRSKEKLESKLKWAVTESEGFG
                     FK"
     gene            complement(<141422..>144637)
                     /locus_tag="CAGL0I01694g"
                     /db_xref="GeneID:2889326"
     mRNA            complement(<141422..>144637)
                     /locus_tag="CAGL0I01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447327.1"
                     /db_xref="GeneID:2889326"
     CDS             complement(141422..144637)
                     /locus_tag="CAGL0I01694g"
                     /inference="similar to AA sequence:UniProtKB:P40352"
                     /note="similar to uniprot|P40352 Saccharomyces cerevisiae
                     YJR035w RAD26 DNA repair and recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447327.1"
                     /db_xref="GeneID:2889326"
                     /db_xref="GOA:Q6FR17"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FR17"
                     /translation="MGNEESRINEGLDNLGVNVQSQSSLEKQIENDVQNYTIQQQIEQ
                     EEKRLERAKNALNKCLKKKKLLERRLKLTTRISVKAKLREEIAYLEENEEYTLRQDIQ
                     DVKQRLKSNLNSLNSDSQKTETDRRPDESEKDYLVRIGKITAFGSSNKFIIDNEDYAN
                     DSYPATKIKKEEDLEALAAVQMTENLDDEEHISNSFDNNDNFDDTYVDDDEYVNTDDT
                     SKDDEISVPDTRFAHGQTLDDGDELIYQKRLRKWIKHRSSKRTLDKHEHLPEWQKPHP
                     EIPDAKLNNEFKIPGEIFSLLFNYQKTGVQWLYELFQQRRGGIIGDEMGLGKTIQVTA
                     FLAALHHSNLLSGPVLIVCPATVMKQWCNEIHQWWPPFRAVILHSIGAGMNDKSNLTE
                     DEIENMIIKSELENTDFHDYENASKLKSKVETGMHMQNLISKVVADGHIIITTYVGLR
                     IHSDKLLNVNWSYCVLDEGHKIRNPDSEISLTCKKLKCKNRIILSGTPIQNNLVELWS
                     LFDFIYPGRLGTLPVFQQQFVQPINMGGYANATNTQVQTGYRCAVALRDLISPYLLRR
                     VKADVAKDLPKKKEMVLFCKLTEFQRRKYLEFLSSDELSQIKGGKRHVLYGIDILRKI
                     CNHPDLLDRDYIKNTSGYGDPKRSGKMQVVKQLLKLWKSEGHKTLLFTQSRQMLDILE
                     EFIKFKEPELSDIRYLRMDGTTSIQVRQTLVDRFNNESYDVFLLTTRVGGLGVNLTGA
                     NRIIIYDPDWNPSTDLQARERAWRIGQKREVSIYRLMISGTIEEKIYHRQIFKQFLMN
                     KVLSDPKQKRFFKTKELQDLFSLGGEQGYSTETLNEEVEKHTKKLKDESTKDSDDLDQ
                     VTNLDGVSKLESFYDGKEVSESNKEDDERLMEGLLGEKSLENIATHEQMIKSHSVGSS
                     KIVKREAERIANQALEALRISRKETKKYDIGTPTWTGKFGTAGKVNKPNLKKNIKKGT
                     GSASILSNIRKANTQVKKSPTDSDTTNADTNTNKEKLLSIINFLKKQENFEASSRDIL
                     NNLGVHINDEEDLIKTRALLKSIGNFSNNKKVWVLKSEFQP"
     gene            complement(144869..144977)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0I01716r"
                     /db_xref="GeneID:2889327"
     tRNA            complement(join(144869..144905,144941..144977))
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0I01716r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2889327"
     gene            145662..145743
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I01760r"
                     /db_xref="GeneID:2889328"
     tRNA            145662..145743
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I01760r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2889328"
     gene            <146481..>149636
                     /locus_tag="CAGL0I01782g"
                     /db_xref="GeneID:2889105"
     mRNA            <146481..>149636
                     /locus_tag="CAGL0I01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447328.1"
                     /db_xref="GeneID:2889105"
     CDS             146481..149636
                     /locus_tag="CAGL0I01782g"
                     /note="weakly similar to uniprot|P30822 Saccharomyces
                     cerevisiae YGR218w CRM1 nuclear export factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447328.1"
                     /db_xref="GeneID:2889105"
                     /db_xref="GOA:Q6FR16"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR014877"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FR16"
                     /translation="MNLIIGSDNTIDVEKYDKIVQTFYTSNSQGWAQAQQVLDEFQRN
                     EDSWLYVDKILQFSSNVQGKYIALSVLDNMVTGGWYELPQEQKLGVRNFLVGFILYVC
                     EKNKPNESFMLRKADLVLIEILKREWPDNWPSFLDELISSSQSSPQVCYNNLKILSLL
                     AEEVFKPLKKNQTKAKALQLIYNLNANAEKICNFCTELLKMDYSSEMTVASLNTIKLF
                     LLWLPKDCFNSLELWGVLTLLSRSEPSIRYHVIQCLIQVLDLDFALVETIRSNERFSS
                     SLISCFISIINQTACEIKTTDTKWYKFYLELPIDGEEYLKELAKFLTKFLINHSTAMD
                     NTPNVRGIIYEAHRCILRLMELPNIEILEYTCEYWHQLVFKSLTKQQDIGYNLTHTHP
                     LPQRRNSIDRDNFEFFEEVREYLIWNLTKPDDIHNLFASTTGLIDESEQSNLYNIQRE
                     TLIYLTNLEYTKTLGMIQNEINQWLNQPITEIGHFNSVCWSIATLAGQLPSKIEDEFI
                     ITIMKIMMQIEEYNQSQEMKTHIQYNMIYIITKYTRFLKSNWISLKAITGRLIIIIQS
                     ADTPLRDQAAIALGRLLAQCASSYIYPQEENEPPYIDIIIRQSSIILGYLSPEQQTQL
                     IKSLQIAVYMDPRSVEKQKNIHLIIHDTMNEWNAVLMKFRDGINNFNDMARLQKLNHL
                     IHVLDVTCKELKEYFNSHLERIIPDISFLLQNLSHFVITYMDDKQWKGNNNGSKNLAV
                     EIYSGILSLLNTSIDHGTNENSQSLTIRASKIVDAFLSTYSNGMGQILNGEDINLSLA
                     LLKKLGRNFDKYNKQLLTILIDSALAYGDRASPDQSITLVKSMSYIIGSCFETILALK
                     ASYCGDICQYTMLSAINSDSDVKLISWRSLISILNKFKNYKDDQIQNEFLASFYFPLL
                     QLIFSTITDKSFDVVFEEQCQLLSDLLIIASENDIVLYAFITSKNDTNFNVVQEFLLN
                     EILNNSKLKADQAHEIVLSLISLAGDRNAIKNKLEDFKAMSKEACASSADVFEEENYH
                     QYEVLIKSQAIKRHNDYTVTD"
     gene            complement(<149918..>150568)
                     /locus_tag="CAGL0I01804g"
                     /db_xref="GeneID:2889106"
     mRNA            complement(<149918..>150568)
                     /locus_tag="CAGL0I01804g"
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /transcript_id="XM_447329.1"
                     /db_xref="GeneID:2889106"
     CDS             complement(149918..150568)
                     /locus_tag="CAGL0I01804g"
                     /note="highly similar to uniprot|P32904 Saccharomyces
                     cerevisiae YHR147c MRPL6"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL16"
                     /protein_id="XP_447329.1"
                     /db_xref="GeneID:2889106"
                     /db_xref="GOA:Q6FR15"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR002358"
                     /db_xref="InterPro:IPR019906"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:Q6FR15"
                     /translation="MIRTIFGRRAFSVSRAVQSHVGSMPIYVAPEVNVSIGPMSVAKT
                     IRKGRGLLSLAQVISVEGPKGTLKLEVPDFISMEKDKDSGKVTISVKDNESKLQKSMW
                     GTVRSLVNNHIVGVTEGHMAILKFVGTGYGARLENDGKFVNIKVGASIKQGLDVPEGI
                     TVKSPSLTSLIIEGSDKQQVLLFAAKLRDFHPPEPYKGKGIYVNGETIKLKAKKIK"
     gene            <151084..>151635
                     /locus_tag="CAGL0I01826g"
                     /db_xref="GeneID:2889107"
     mRNA            <151084..>151635
                     /locus_tag="CAGL0I01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447330.1"
                     /db_xref="GeneID:2889107"
     CDS             151084..151635
                     /locus_tag="CAGL0I01826g"
                     /note="highly similar to uniprot|P32899 Saccharomyces
                     cerevisiae YHR148w IMP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447330.1"
                     /db_xref="GeneID:2889107"
                     /db_xref="GOA:Q6FR14"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q6FR14"
                     /translation="MVRKLKHHEQKLLKKVDFLDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNRICGDIRKIAHRLSLLPPSDPFRRKQEQMLLDKLYNMGILATKSKISDLENKVT
                     VSAICRRRLPVVMHRLRMAETIKDGVKFIEQGHVRVGPNLITDPAYLVTRNMEDYVTW
                     TDNSKIKKNVLKYRNQIDDFELS"
     gene            complement(<151998..>154103)
                     /locus_tag="CAGL0I01848g"
                     /db_xref="GeneID:2889108"
     mRNA            complement(<151998..>154103)
                     /locus_tag="CAGL0I01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447331.1"
                     /db_xref="GeneID:2889108"
     CDS             complement(151998..154103)
                     /locus_tag="CAGL0I01848g"
                     /inference="similar to AA sequence:UniProtKB:P32900"
                     /note="similar to uniprot|P32900 Saccharomyces cerevisiae
                     YHR149c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447331.1"
                     /db_xref="GeneID:2889108"
                     /db_xref="GOA:Q6FR13"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="UniProtKB/TrEMBL:Q6FR13"
                     /translation="MICADGRKPAMIFRRDSDSDSDGDGAGSGNSGKCEGSKQQCELP
                     TDHNLGVRVGVAVAIPVGVIIIVLVGILIVVYRRSKREEKEDHDPEFEGDNEYIPVAR
                     HGALQKHRENMMMATDPFQLPGSTGSDADLRDFAKRVQSDGFGGYQLASMSASNNASQ
                     VSLTHLDQSRGSAGPRMLMKNMRPPMTHMAYSSSSLRNATNGHSTDDSTGTSTDRSPT
                     ALSTDEKLSHNLHSNLSEKPKPSFEFETMVIESNDLDDDDDDDDDDDEYNKGRTNERN
                     NYHRDTDKYDMEDDNASEFVTELSPDEEENIQRMKSIYKVYLDRSKTIKEREDNPLPS
                     DDEQESLALNREENEDTLNALTTSNNQLAVQEGSNHGRAASSIYSELPVLSQHEKKVS
                     EVSNQMQMNDRNVVPPQTSQDITGGQQYGQPYNTAMDGATQAYPYQSQEGYNQFPQEA
                     YYQQSSQNGLYGQQIPEEGNYPQSQYIQYPQQMYQPTYNVSLQQNMMSYNNNNASQEF
                     HHPQTLETIGELPTPAYLASSESTNSLTAFKKNQKQQLHQIQTARINGTALNPMDHPE
                     MFYSPSTDTYLNNGGMQPSNGSVYSANTYRGQVNGAPLPYQLRQSVVMTNPSELSLNT
                     LHKPAGSLRNYINSNSRNNSLTTQGNPYNQPNQSRVSGILDHIDTIQPPGVGNILPHN
                     GSSSDLRKQLGSSNNYNFS"
     gene            <154612..>156261
                     /locus_tag="CAGL0I01870g"
                     /db_xref="GeneID:2889109"
     mRNA            <154612..>156261
                     /locus_tag="CAGL0I01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447332.1"
                     /db_xref="GeneID:2889109"
     CDS             154612..156261
                     /locus_tag="CAGL0I01870g"
                     /note="weakly similar to uniprot|P38848 Saccharomyces
                     cerevisiae YHR150w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447332.1"
                     /db_xref="GeneID:2889109"
                     /db_xref="GOA:Q6FR12"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6FR12"
                     /translation="MSESAVRGYINRKYGKVLETLVMAEEAIAARSNRDELTQRELVQ
                     QVMGVLVSTSLERLKPGADVVGAGDKSTYSAAAEEKELDELNEYRRSLSQDRLSKEDT
                     YFLDMFLDKLIARLIPDNLPEREHFSLVDEGDEALHGPPFSASVLASNMKKLSGKMDS
                     IFEFQDNMIRVLTWKTPTVTLTALTIFTLICFDLMNVILFPMAYIVLVQMTQGYIRRH
                     PIRRTIYIKRRAIGRSLIHDLFHGGKKTNNVLLPSNENDCNGEQENEADLGTSDDCNG
                     TSDENVVISPAAAKIDKNISTYNLNHGTKVVLTLRDMQNMTTGTVHLMDAIDKFKYGT
                     AAFVDEYKSTSVFFTLLGSVILLVLLSRFITWSLTISLSAWIGLLSIHPKVHPYVKSA
                     KNIMKKPKMKPENSPQDVAVVMEDNISGEDYNRNIILDEPPDVKYVEVYEIYKRGLLP
                     TDWEFFKFSSTIFDPTDTYRKALQLPPGVDKIEEIKPPAGWAFDENSSWIIDKNPEIW
                     AIERGLQLPVEEGFLVDPMFKRRRLVRKVIRYKKPMKIKMH"
     gene            complement(<156390..>158036)
                     /locus_tag="CAGL0I01892g"
                     /db_xref="GeneID:2889110"
     mRNA            complement(<156390..>158036)
                     /locus_tag="CAGL0I01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447333.1"
                     /db_xref="GeneID:2889110"
     CDS             complement(156390..158036)
                     /locus_tag="CAGL0I01892g"
                     /note="weakly similar to uniprot|P38849 Saccharomyces
                     cerevisiae YHR151c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447333.1"
                     /db_xref="GeneID:2889110"
                     /db_xref="GOA:Q6FR11"
                     /db_xref="InterPro:IPR001304"
                     /translation="MYWLLFLFFVHFLRHGLCDTSTRSNGSGTMNPAGINITNSTYMN
                     ATWQSNSLSHELAVRSQRDIMSNITIDQVPFPGINLNSVLFHKAFIVNNNGSHLPFNE
                     SIAFEYFQNIMVYGAQSFVVDIEVGMNYSWVLKETDVLLSDLLIQMRNFISATNNNLY
                     GNVLMLLLRVDPTIKLASARNKTIYNSRLNFTDDLFNKFPNLNITGILDNTIGRSFIY
                     TPSDFLGTYDPPYSIDNSTNFWPTLGALMYGRRKRLLAMEITNSFDALESNYIFTNHN
                     LTYDVGNVSISCPYNRDQFISASETTFKFLEARYTKSEVEMYSGCGYSPMIANRFDSA
                     NITALIDLLAPAVVWSWAVGQPILTVSVPRKTSDLVAENCAAFNFAYNNFSANWFVEN
                     CYSKKRALCRSDKQIFNWTATNVKDSYFEMDGYRGETKCPNTYSFSIPRTPLEQRSIL
                     LQFEASQFNDDTLWIDLNSISVSNCWVSGGSYASCPYQRAVSTRNFVAMMVPVTVCSF
                     VLLMMALYFSLFRIPIYDNRYNWRRVVNNYSKTEVDGVPS"
     gene            <159798..>160229
                     /locus_tag="CAGL0I01914g"
                     /db_xref="GeneID:2889111"
     mRNA            <159798..>160229
                     /locus_tag="CAGL0I01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447334.1"
                     /db_xref="GeneID:2889111"
     CDS             159798..160229
                     /locus_tag="CAGL0I01914g"
                     /note="some similarities with uniprot|P17123 Saccharomyces
                     cerevisiae YHR152w SPO12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447334.1"
                     /db_xref="GeneID:2889111"
                     /db_xref="GOA:Q6FR10"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:Q6FR10"
                     /translation="MVTYETKPVMECNEKLLNVSNSKTNTDVVTDIQGLDGSDARYTD
                     TSSLDQSQANIFNISSNKTNQKSNTNFCVGKKTKIGGAGNQTNCMRGKNTDLSLRKKF
                     ASPTDHLLSPCSKKLRDHKNSLFGTKGKPLKLKFTDLQSEQ"
     gene            complement(<160546..>161109)
                     /locus_tag="CAGL0I01936g"
                     /db_xref="GeneID:2888948"
     mRNA            complement(<160546..>161109)
                     /locus_tag="CAGL0I01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447335.1"
                     /db_xref="GeneID:2888948"
     CDS             complement(160546..161109)
                     /locus_tag="CAGL0I01936g"
                     /note="weakly similar to uniprot|P17122 Saccharomyces
                     cerevisiae YHR153c SPO16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447335.1"
                     /db_xref="GeneID:2888948"
                     /db_xref="GOA:Q6FR09"
                     /db_xref="UniProtKB/TrEMBL:Q6FR09"
                     /translation="MEVSFVNHIPDDGNILIVECTCQEFPKGYPDEELKMMAKKELKK
                     LLDKIRMQDLSLLQKDDTLLIICFDSTDITIEGWEVIVEELKEKSTLWCHREIFICSK
                     SETTKSLTMRKFIENNPIYTSFKHNLKNARPFEYDDDVKDFMVKKILSELYVSHKLTE
                     DQLEDLLAKCNNLEEVFQELGRVPSNS"
     gene            <162266..>165565
                     /locus_tag="CAGL0I01958g"
                     /db_xref="GeneID:2888947"
     mRNA            <162266..>165565
                     /locus_tag="CAGL0I01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447336.1"
                     /db_xref="GeneID:2888947"
     CDS             162266..165565
                     /locus_tag="CAGL0I01958g"
                     /note="weakly similar to uniprot|P38850 Saccharomyces
                     cerevisiae YHR154w ESC4 Establishes Silent Chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447336.1"
                     /db_xref="GeneID:2888947"
                     /db_xref="GOA:Q6FR08"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q6FR08"
                     /translation="MSIDTSIKKTQIFKHLNFLIVATNSDESKEAEELRKQLYENDCL
                     HCEIYHAYKLEYKIPQHINVKKWLIRQDFNKHEVHIVVSKTSNFELYPLFEYELLIPV
                     VTPDWIQLCIQSNRHLRTSNFSPNPRLVFKNFQMLVSKNVFNHSEYFLFSEIIHCLGG
                     TTVDYITKATTHIITTSPKDPAIIAMEKYKSSRAEPSQEANIQYVLPTWLCQVYMERH
                     LVSIKEHLIDHRRSEMETREQLNELWDDIHNFEELFDGKRDKIFMGKSFEIGDDIDLN
                     RKSYRYFCDMIKSLGGQIILSEEEKNAEAEDSGTGQSRTSADFIIRNTISDSDAGANK
                     RTLFGNIFWIVNIWNREKFFLPDTNAICLPRRRRKLFRKQDLAVTYTNYFGEQRTYLQ
                     QLIELLGGSATMELSKQNTHLICNLPFGKKYEVAMKWKESGSKIVICSHRWLEECYIS
                     GKKVPVDEAYTRLERDDNTYSLTLGQQLSPKLDSENSSDEETDIEESQVFALEYLKTS
                     QSRAHDLTGLDDISHLESSIRKKKYGKSNANENASISRTPSASISNDSSRDDEAYETA
                     PTNFLTSTELNKSAKLDKQLLITSTVDPSNLRLKDTDYAGSALCLDEDKHESNKTDAK
                     LNIEGHVALKNGAKRTSDVSSTNKVSAGNSDKNEKLSYNKTDEYSSIRESESSYKQLE
                     NMHNKSSNGMVSTNQSSPNNTQLNTDENLTTNNSDNHKGNIIVQKNTEDNGGMQEDST
                     STTMTDKSALQDEMMDNEHDVHKETMDLIQELSGGRKAKTKAARRLHEDIESLNEHEK
                     NSGKRRKVRDKNGSLLLPEEIKQLQEQEILIQQAKKTLFANPYTCNSSNQTISLNIGL
                     NAICTGFSLEDLTDIEKEILRLVGIKLQHDNVDQHIFEEQRGQRGHNRINTIFAPKRL
                     RTVKFLKSLSLSSIRYFLTPDYITALLLDIKSGKDVSKYRSPSNSFRIDSIDDELIEK
                     MQKVSGKLFFKSKIKNVNIMHDLKASPKVVGEILKCHGVDSFTILKKQYVLTDIARNT
                     RVSTDNTVDYILIASSKNQVTKFKKLIQQETNSENVSVLVVNWDWCVDCIFNAEVNLE
                     DKANIFFNKRI"
     gene            <166931..>170845
                     /locus_tag="CAGL0I01980g"
                     /db_xref="GeneID:2888950"
     mRNA            <166931..>170845
                     /locus_tag="CAGL0I01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447337.1"
                     /db_xref="GeneID:2888950"
     CDS             166931..170845
                     /locus_tag="CAGL0I01980g"
                     /inference="similar to AA sequence:UniProtKB:P38717"
                     /note="similar to uniprot|P38717 Saccharomyces cerevisiae
                     YNL257c SIP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447337.1"
                     /db_xref="GeneID:2888950"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FR07"
                     /translation="MSEAVDKAQSKDGANGTSQNGNNVTKLQMNTLLLSEAALDTPSF
                     RATVNFFDGRVKYLSDWSSETALTLQNKYRPALSEFMKVQNGLLHQLLPDPNMVANGM
                     LINQAFTPTLIDSFNKDFNKLAVGLLSIILGNDTSCSKVLNLLNGLKKKAIAPYVDKK
                     NTFDYFQQKYDSAHARYSAIEPTKVVANSTNIDATSVNSSPIPNGTSTVLEVDPSFLR
                     DEHNQLFESRKEYLKSSLDLVAAMSQLKFKLDKMLVDLIDELISESTITVNDESLNVD
                     GMELGRKTIELSPNISNYLKDYKSWVEDVIESSSFLETNMDKTIVSTYTRTVKSIAPP
                     KDLQNYNKALAEKTIAHIVSPKLGTPQKRPVSVPVTMPSKSGWLYMKTYSSSNPRKEI
                     WVKRWCFLQGTVFGMFSLSQSKTFVEESDKFGIFLTSVRFLPNYTRNFCFELKIIGRD
                     KPESDLIERSKDINIIYQADDLAELKSWIVAFHDSKKYIMAQDQKGLQYEVAFKRFSP
                     QYYEFASNAGTVVDTLLTTSHNDTLGSRDGTINLKDSIKALLSSEELKLVQDNKTFLF
                     EFIGTPIATENTGLAMLSNLMSDNHSFPDAITANIWGTSSWNDVSHMIDEQKEKPDIL
                     KSLPPLHQTLADIKYPNYYSRSLKVADVQFRTIFYSNNKHSYSLPKRFLLLRFGSIWK
                     PNKKQKFAAICYASKDYFHVYMNCSGFTYLARQDLNEICDVEYSKSEETIHLIRHDGI
                     KYDLNAYFTDPKSITAKLKFLIENRISDNPKNEGDILVKFKQIDQAFAQKSTNAKLKS
                     YMGLNSVQDSLEQQSLSKLNSSLWTIKGTTADLLKRKFQLQKEYSASYKHIYPVPCKG
                     LVHLLFGQRSDAFPRAFFLARKGSDYNITQYWAQRQLPDGTTQLVRKLQFQVNRTSSF
                     VPESPHDKEEYLAQQVTVEQVMVKMIDNCYYEIDQDPIIIQFPFAKPIKLSLKYIISE
                     RSDHDADMASRLMLSSNYADFITYYKVEFIKDINHESEIAYDQSIWEQFIYCWVLQST
                     KYEFNTIKSVIDGYLGKIGSHGKLTKAIKMGGRLGISDTIETQPSVSEKNNKNVETPH
                     RIQIQYTFTLLLKVIIKMIVFRATNFCFLIFRLFLILIHFGATTMKKINKILLAVLVI
                     SALSNVFLLGRSTVNYWSVRRAEHSFKQHMASTDGSTMQRALYVKDLDLLTNHLVTGF
                     DNVAFKKFNEENYNNQLNNFKYKDTRREIAIRRNELLVELKIMQNMEKELVKGDYRLF
                     LIEELNKCESVSVEMPDIWNTDKKLQEYCSVCKSEFTNMNIL"
     gene            complement(<171015..>171944)
                     /locus_tag="CAGL0I02002g"
                     /db_xref="GeneID:2888951"
     mRNA            complement(<171015..>171944)
                     /locus_tag="CAGL0I02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447338.1"
                     /db_xref="GeneID:2888951"
     CDS             complement(171015..171944)
                     /locus_tag="CAGL0I02002g"
                     /note="weakly similar to uniprot|P38852 Saccharomyces
                     cerevisiae YHR156c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447338.1"
                     /db_xref="GeneID:2888951"
                     /db_xref="GOA:Q6FR06"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:Q6FR06"
                     /translation="MQSKRASDEDQTSGRKRLKVYQNIQPQNNLAEGESDFENNTDDA
                     FIDDDNDDNDELESRTLNIDQFRKENIDTNSEIDDAIRESDSAFTLESFDIKEDLKEG
                     KFDESGNFIRSKSRGNSDDEEDEFWLQESVTKGDYSKNNIPMSKLVSDRPMITAVEAL
                     YQILFLMPDQDKNIIETLAQLNKDKKRFSKIQNSQCVEAVVNAINILTDSVETLERKE
                     FSNVYQMKRQDLVNAIKEEPTSKDGPYDPIKDRIWQYKWLGKDKVYGFYTCYEMQYWK
                     ENYFQNRVLVRLNSYSESDNYWVHISNSIFDTL"
     gene            complement(<172231..>173433)
                     /locus_tag="CAGL0I02024g"
                     /db_xref="GeneID:2888949"
     mRNA            complement(<172231..>173433)
                     /locus_tag="CAGL0I02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447339.1"
                     /db_xref="GeneID:2888949"
     CDS             complement(172231..173433)
                     /locus_tag="CAGL0I02024g"
                     /note="highly similar to uniprot|Q03558 Saccharomyces
                     cerevisiae YHR179w OYE2 NADPH dehydrogenase or
                     uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447339.1"
                     /db_xref="GeneID:2888949"
                     /db_xref="GOA:Q6FR05"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FR05"
                     /translation="MPFSKDFEPVAFKDTNMFKPMKVGNTTILHRAALPPLTRMRAHH
                     PGHIPNREWAVEYYKQRSQRPGTMLVTEGVFPSAQSGGYDNAPGIWSEEQMVEWRKIF
                     NAVHDNKSFAWVQLWVLGRQGFPDSLARDGLRYDSASDGIYMSAEQEELAKKSNNPQH
                     GITKDEIKQYIKDYVQGAKNAIAAGADGIEIHSANSYLLNQFIDPKSNKRTDEYGGSI
                     ENRARFTLEVVDAIVDAIGPERTAIRLSPYGTYGDMSGGAEPLIVAQYAYIIGELERR
                     AKEGKRLAYLHLVEPRVLDPFAPEGEDVYNEGTTDFAYSIWKGPIMRAGNYAIHPEVA
                     MEVLKDDRTIVGYGRYFIANPDLVDRLEKGLPLNKYDRSTFYAMSAEGYIDYPTYEEA
                     IKMGWDKQ"
     gene            complement(<175036..>176085)
                     /locus_tag="CAGL0I02046g"
                     /db_xref="GeneID:2888953"
     mRNA            complement(<175036..>176085)
                     /locus_tag="CAGL0I02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447340.1"
                     /db_xref="GeneID:2888953"
     CDS             complement(175036..176085)
                     /locus_tag="CAGL0I02046g"
                     /inference="similar to AA sequence:UniProtKB:Q06494"
                     /note="similar to uniprot|Q06494 Saccharomyces cerevisiae
                     YPR127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447340.1"
                     /db_xref="GeneID:2888953"
                     /db_xref="GOA:Q6FR04"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FR04"
                     /translation="MTTKDKIATIRKEIEKIGTGYGMMTLTNLAVPTERTQAFGAINK
                     VIEIARAQGHKAFFNVGEFYGPNYANLHLVRDFFKEYPNLREYVLISCKGAIDNKKLT
                     PKGKYEEVVASMETCIKEIGVFIDIFEPARLDFNLCKEHDVYPKETLQAVADFVDAGK
                     FGAISLSEVNGEQINAISKDFGDYLVCVEIELSMFRDTILKNGTAKACSDNALPIICY
                     SPLGRGILTGQITKNSDIPDGDFRKKLKYFSDEALAHNQEIVNFIKSEIVEKRPDEKR
                     VTLAQVALAWVRKWSYSSEYPKSKFIPIPSGSSATRVSENFEESKTQLSDTEFEKINE
                     YVNSFSPIGGSYEFI"
     gene            <176743..>177165
                     /locus_tag="CAGL0I02068g"
                     /db_xref="GeneID:2888952"
     mRNA            <176743..>177165
                     /locus_tag="CAGL0I02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447341.1"
                     /db_xref="GeneID:2888952"
     CDS             176743..177165
                     /locus_tag="CAGL0I02068g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447341.1"
                     /db_xref="GeneID:2888952"
                     /db_xref="GOA:Q6FR03"
                     /db_xref="UniProtKB/TrEMBL:Q6FR03"
                     /translation="MSTTIISISDFCRKYCISKSAKKAFQVEHSVAVENIEQKTFELL
                     MKKINESYEVCTETNTEFPHPETCLYSDHHEGPLKNDEETLTMAILESMRSDSPETKR
                     AFYLIDSEDTHYLIHSSSPPYKMIRNEWVDLDTNSPTD"
     gene            complement(<177324..>180734)
                     /locus_tag="CAGL0I02090g"
                     /db_xref="GeneID:2888980"
     mRNA            complement(<177324..>180734)
                     /locus_tag="CAGL0I02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447342.1"
                     /db_xref="GeneID:2888980"
     CDS             complement(177324..180734)
                     /locus_tag="CAGL0I02090g"
                     /note="some similarities with uniprot|P38853 Saccharomyces
                     cerevisiae YHR158c KEL1 involved in cell fusion and
                     morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447342.1"
                     /db_xref="GeneID:2888980"
                     /db_xref="GOA:Q6FR02"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FR02"
                     /translation="MAGFKFSMKQLGHHGKKNKNSAPESVPNPGGFNSSYNNDAGVNS
                     QRDVGPVPGPFRSVSGNSMGSGHSVPNQQSFARNVSGSHMDNVGAGVQQAARQNIGNS
                     MHITGFSASSTSNPHEMKQRNVSNLQQSNPHTRRILPSEPDYTPWGRIRLSNSPFPRY
                     RHVSSSHITDQGKIYVIGGLHDQSVYGDTWILTASDIDKTGAINSFKSTTIEITESTP
                     PPRVGHASTLCGNAFVVFGGDTHKVNSDGLMDDDLYLLNINSYKWTIPKPVGQRPLGR
                     YGHKIVTISAEQTKLYLFGGQFDDTYFGDLAVFDLSSFRRPDSHWVFLKPSGFNPPPL
                     TNHTMVTYQDKIWVFGGDTLEEGLINRVYLYSPTNNSWEIVETTGDIPPPMQEHAAIV
                     YKDLMCVVGGKDAEDNYLNTLYFLNLQSLKWFKLPFYKNNIPQGRSGHSVTLLKNDQI
                     LIMGGDKYDYSSSTENMHISDVDMGKGTILYTLNLADVGTVCPGIFDNTRPVTRSPTT
                     PKFSNKGEDATSPNIMVGKPPGLHQEPQILTPAQEQMQTPKQQIVMDMDKTPKDYVEK
                     EPEAAHVEGQAFGKGTIGTVISENRKPSSPVPQLIESSEDGVKRTPTIASAKQLSSGP
                     PQQKTPEKRMISDESSSKFSELDQDDSIDDEVGVAHIATSPAKNGFKMTSTENTITAA
                     MESSSPDVLLPEIKKHMSEGTEAKTVTHSSDMDDQTTMISSRHNVVEDRQSPPQLKEA
                     VDMKIDSPTLEDTSANLERAQVEKFPEVVARQVGAVVPNLVPNQSTGMASNSVLGMKK
                     ENNMSREHFENLRDELSKIKQAALEKANAADNHIRELESELNKLRAEQQKQKEDNKKM
                     EDEISQFRKRYDLLDADYKEMEDTLQQYEDILAAKVLDAEKFNGIIKVQSDKIDELKL
                     HVVNSEEFEKLKIQNEVLEKENQDLKDKLKEKDNNLDKSIVMFSGTVDELLKNWRMTS
                     KKDTSSASPVAATQSQSTKNRNIISKMNNRLDDLLVKSKELTESEEQIDSEYEQLEIK
                     NESIQSQARHSSISVKETASDIANAMNESKRKIEDYKAHTEKLQNEIDGLKGKVNHTD
                     GEISLDKQSEEKLREEIEKITAEKEELNRQMQGLKMKIQSSSDNLAIL"
     gene            <181404..>182873
                     /locus_tag="CAGL0I02112g"
                     /db_xref="GeneID:2888981"
     mRNA            <181404..>182873
                     /locus_tag="CAGL0I02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447343.1"
                     /db_xref="GeneID:2888981"
     CDS             181404..182873
                     /locus_tag="CAGL0I02112g"
                     /note="weakly similar to uniprot|P38854 Saccharomyces
                     cerevisiae YHR159w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447343.1"
                     /db_xref="GeneID:2888981"
                     /db_xref="GOA:Q6FR01"
                     /translation="MDQKFDEFIAQTESEAEIDTSSRYTTGSISPQFASPTKFKNVLP
                     HETDTQTGQRNRVAEHQHVPKSLLNASVEESHNHPLKEDKSESRQRQVSVSNSNPSSK
                     GMVNKRRSLIQPMMVPTTPETDRTRPQSQSNVASGNSANKNNLHPDTNHGIDINATTQ
                     TPSSMSMGNPKFSENFASLAPSSKRNSMHSRTSSSQSMAIDSSLGGSMDVNALLQSLA
                     NKELELLECKRKIDDLKKQLHMEENIYQNKANELQELKNKVSKNINVSGSNQPVFNKT
                     STTGRKNSRESSRRNTHVTPVKTTRNDIRQDTSLNQDMENTDDNKQSMWSKPLALFNQ
                     VDQIIQQELERTLNWDEPPTPVEETEENQEGDKSVSKSLWSFVSDLKTGLLGIEEEED
                     GHHTQQSNSNVNRPKNTHGQVMDNRKHANEDINLSIKEFKTTKKHLDDNSDTHLKQRS
                     GRTAVRKTKSGNKLNFVDDSDDGDSTLEADMVEMGSFSR"
     gene            complement(<183081..>183860)
                     /locus_tag="CAGL0I02134g"
                     /db_xref="GeneID:2888982"
     mRNA            complement(<183081..>183860)
                     /locus_tag="CAGL0I02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447344.1"
                     /db_xref="GeneID:2888982"
     CDS             complement(183081..183860)
                     /locus_tag="CAGL0I02134g"
                     /note="weakly similar to uniprot|P38855 Saccharomyces
                     cerevisiae YHR160c PEX18 peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447344.1"
                     /db_xref="GeneID:2888982"
                     /db_xref="GOA:Q6FR00"
                     /db_xref="UniProtKB/TrEMBL:Q6FR00"
                     /translation="MSACHSNPLQSLSSKTHTFTTRTRAHNYEHNHDRISNPLEREFL
                     HQDSIYDTATPVAIPIQQPRQVPRDTKKNTQWLSEFQQLSISDVPSVKPSFTRPAPTS
                     TFRIINNDVRKDSLFKFQEHPIIDRLSPEAREDYYNNEFEQLEKELENDDDVQDGDQF
                     QDLENKTYEYYNEFAFNDQSHFQQSARDILNNMSNSTHEYSSELNEKLSGSTFVNLLK
                     SIDIGDVSLQDNRQGPKELKNSNDNTTLGNKYADIPDYILE"
     gene            complement(<184878..>187013)
                     /locus_tag="CAGL0I02156g"
                     /db_xref="GeneID:2888983"
     mRNA            complement(<184878..>187013)
                     /locus_tag="CAGL0I02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447345.1"
                     /db_xref="GeneID:2888983"
     CDS             complement(184878..187013)
                     /locus_tag="CAGL0I02156g"
                     /note="weakly similar to uniprot|P38856 Saccharomyces
                     cerevisiae YHR161c YAP1801 Yeast Adaptor Protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447345.1"
                     /db_xref="GeneID:2888983"
                     /db_xref="GOA:Q6FQZ9"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ9"
                     /translation="MTTYVKLVKGATKIKMAPPKAKYVDPILMGSMNSHDFDEITHAL
                     EARLQDTAWTVVYKSLIVVHLLFRDGDGNVALDYFSHRTSVFNVDRNLPNVGSTEIRQ
                     VQKYAQYLKTRCKEFDRIRLDYVRDTKANIKINENNLGRVNTALDHVESIETQITALV
                     KNRYSHYDLENDLYLYAFKLLVQDLLMLYNALNEGIISLLEIFFELSHSNAERTLNLY
                     KRFVELTETVVKYLKSGKSVGLKIPVIKHITTKLVSSLEEHLLEDDRTQQNFKQDPDL
                     GSSSNIKRQGTIAQQRLEQVREQKRILEEKLKTQNVVFSNPNDGSQFTPNMNTMATGT
                     MAMTDQQNAYNPFGVTPSQTPQQLNSRSTSATFMNNPFASSESPMNNIFTGGAQAQAF
                     QQNAMQNTMQSIPPNNQQAFQQVYQPQDPAQQQFTGQVQPQTSQYTNPTGFQQPQQPQ
                     QPQQPQQPQLQVAHTDMFNPQQPQVSVGQIPVVTQQAYQQDFGFGTASATSGMTNQFM
                     PPSQQQQISQQQMPQQQPLTETATGSNNPFALHNASKTESQIQQRKQDMNDQSMQLKQ
                     QPATSSAINNNPFATNNPVVPTTYASTATSELVHNPFQQQNVNFTGTQATGMSQPNVM
                     QPLQQSQSFMQGPGVSSQYQQLPQQVQPVQQVQQVPQQVQQVPQQVQQVPQQVQQVPQ
                     QQFQQFQQPQAQWPAQQYPGQEGPNLIDI"
     gene            <188289..>188672
                     /locus_tag="CAGL0I02178g"
                     /db_xref="GeneID:2888984"
     mRNA            <188289..>188672
                     /locus_tag="CAGL0I02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447346.1"
                     /db_xref="GeneID:2888984"
     CDS             188289..188672
                     /locus_tag="CAGL0I02178g"
                     /note="highly similar to uniprot|P38857 Saccharomyces
                     cerevisiae YHR162w or uniprot|P53311 Saccharomyces
                     cerevisiae YGR243w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447346.1"
                     /db_xref="GeneID:2888984"
                     /db_xref="GOA:Q6FQZ8"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ8"
                     /translation="MSTINIAFRRFWQSETGPKTVHFWAPTLKWGLVIAGLTDINRPV
                     DKVSGAQNLSLLSTAVIWTRWSFVIKPKNMLLASVNSFLTLTAGYQLARIVNYRLRNG
                     DTIQQTFSYILNGAGNRNNEKLIQE"
     gene            <189157..>189894
                     /locus_tag="CAGL0I02200g"
                     /db_xref="GeneID:2888985"
     mRNA            <189157..>189894
                     /locus_tag="CAGL0I02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447347.1"
                     /db_xref="GeneID:2888985"
     CDS             189157..189894
                     /locus_tag="CAGL0I02200g"
                     /inference="similar to AA sequence:UniProtKB:P38858"
                     /note="similar to uniprot|P38858 Saccharomyces cerevisiae
                     YHR163w SOL3 or uniprot|P53315 Saccharomyces cerevisiae
                     YGR248w SOL4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447347.1"
                     /db_xref="GeneID:2888985"
                     /db_xref="GOA:Q6FQZ7"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ7"
                     /translation="MVSVNKFSEKKDLAHRLGEVVVNAQDEALKHSDVFNLAISGGSL
                     VNVLHSTLIEDKDFAPKVKWDKWRVYFCDERIVPLDHADSNYGAFKTAVLDKLEQKVQ
                     VFPIDESLVNGGEKEFQEIAEKYAAIIPKSFDLILLGCGPDGHTCSLFPGEKHAYLLQ
                     EREKRVCWCHDSPKPPPNRVTFTIPVLEDAKQLVFVAEGASKQDIMHQIFDLKNNELP
                     TALINSLFTTKVTWIVNDEAFAKVQTA"
     gene            complement(<190099..>194637)
                     /locus_tag="CAGL0I02222g"
                     /db_xref="GeneID:2888986"
     mRNA            complement(<190099..>194637)
                     /locus_tag="CAGL0I02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447348.1"
                     /db_xref="GeneID:2888986"
     CDS             complement(190099..194637)
                     /locus_tag="CAGL0I02222g"
                     /inference="similar to AA sequence:UniProtKB:P38859"
                     /note="similar to uniprot|P38859 Saccharomyces cerevisiae
                     YHR164c DNA2 DNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447348.1"
                     /db_xref="GeneID:2888986"
                     /db_xref="GOA:Q6FQZ6"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR022765"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ6"
                     /translation="MVNSGDNKKRTVDLTQSPTKPTTTKKNDEELNKKKQKPLRLRNE
                     RYKFAPIDTLSSKNKTNTVHSISVTQLRRSKKTDKIVNELSEELQESGSHDTSIPRSK
                     SMIVNSKQHGNMSNIRGHIQKQLSVPEPLTTQKMYPEEEVIWRYTPLHSDKSDKTNHD
                     PDSSELNYITNGPSSTPIVPNRWKTIINLNNMNDSDSVLNRRSETAHRYNNEEQNSRD
                     IYQVASEDQQMSGIPLDLPSSPDKGLECQNSNCRPMRTNYSSQDKSTSTDNAGDKRIH
                     DIDQGFDSDEELLQATSNTSNFHIGDTEEDDDDLLDELLSQDSKRKPIPKLNSKLASS
                     DLLEKEHNSEKCQDSDNSENSDDSLVDYLEQTQVLPSNKTPFPKNEAISYKSKDKSGY
                     NSRIDSTILHMPSWVIHKKGFQRLLIISISEMNLDKIGRQKILICKESSSSTCSVIVR
                     HPWVYLDFKEGDIIHIIEGKNCANKRLLSSDVDPVTQKVNDNLLILNPDILLSATMVG
                     TSIDCPRKALLNEFFQDCREEPSLPILIGNIVHELLQEAFRKKVTDNSITLEYMQSKL
                     NDLLDGFHFSIVLCGENKDSVKTKIMEDHFSNIFEFVKKYVSKSSYGCYVPVSGTRRT
                     EPISISDVIDIEENIVSPMYGFKGFLDASVEALVERNRFIVPLEIKTGKSRSIAHEAQ
                     GLIYTLLLKDRYEMEVDFYLLYYTRDKTMNKFPQNISSIKHVLMARNQLTTYLKHYLS
                     EISVKEIQNLKLPPVLGNSFCDNCYLKDICDVVEQLTSDISFDSKKCSAGNESSLTRQ
                     FSESQKKFFIKYNDLITKEESSYKCLSHELFLMDSIDREKDSGKCLSNLVVKSYENSL
                     TGRYPFVITFKRSYSSPIGPFFLSSQLTRDDHVLISDEGGHFGLSQGIVISVEDMEIT
                     VAVNRKLLNNNISEGDTGTKRVISALHTSLDTNALLSTQNQITYRIDKNDIQQGLSMA
                     RYNLLNLFNTPIQEPIIIKDPLTQKDRALKSSEGGDIKTRLLLVDGIPPKFRASSKSP
                     MVPYNPGTLTKFNVDQKAAIDKVMRAEDYCLILGMPGTGKTTVIAEIIHILVKNNKSV
                     LLTSYTHSAVDNIMLKLKNYNTKMCRLGSRSKIHSEIIPYIPDYSTIKTLDDYVEFID
                     NIPVVATTCLGIRDTMLSMRTKDFDYVIIDEASQIALPIALGPLRFADKFIMVGDHLQ
                     LPPLVKSESARVGGLEDSMFKILCERFPEALCELTFQYRMCDEIVKLSNHLIYDGKLR
                     CGNEEVAVQQLGINTDNLAAYINPNLSADSCWLESVLSPKNKVLFLNYDASKSITESA
                     EKDNITNAGEIELTRQCIEGMIESGVALKSIGVMTLYRAQLRALKKEFENQRYDGLEI
                     LTADQFQGRDKECIIISMVRSNAQFNGGSLLKELRRVNVAMTRAKSKLIIIGSRNTIG
                     SVNEMKSFFQLLEREGWMYDLNSDCLDAYRFPKYASVTKESTRVATNVKKLGGSKPID
                     ENSRVLRDKPIIRQVLGE"
     gene            complement(<195217..>195726)
                     /locus_tag="CAGL0I02244g"
                     /db_xref="GeneID:2888987"
     mRNA            complement(<195217..>195726)
                     /locus_tag="CAGL0I02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447349.1"
                     /db_xref="GeneID:2888987"
     CDS             complement(195217..195726)
                     /locus_tag="CAGL0I02244g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447349.1"
                     /db_xref="GeneID:2888987"
                     /db_xref="GOA:Q6FQZ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ5"
                     /translation="MIDDAGGEPLHSLECHQEAYENDELTETVDSEVALRSELHNAVL
                     LLVRLGYSFASIVEKCYVKKSFLLQVFAELGLQVPTEEEYNKITECNESSLTNVHGLM
                     KDDEQDQAKLPNSNLTDKLVRSIQHDIEELERNYLAAAVDEQTKKKLLDLRSFINSRL
                     DNIIESFSY"
     gene            complement(<196082..>203326)
                     /locus_tag="CAGL0I02266g"
                     /db_xref="GeneID:2888988"
     mRNA            complement(<196082..>203326)
                     /locus_tag="CAGL0I02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447350.1"
                     /db_xref="GeneID:2888988"
     CDS             complement(196082..203326)
                     /locus_tag="CAGL0I02266g"
                     /note="highly similar to uniprot|P33334 Saccharomyces
                     cerevisiae YHR165c PRP8 U5 snRNP protein pre-mRNA splicing
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447350.1"
                     /db_xref="GeneID:2888988"
                     /db_xref="GOA:Q6FQZ4"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ4"
                     /translation="MGSPLPPPPPPALAGFEIESDEDIQGNSVDEFALPSSPLPPPPP
                     PPPDIEDDFEDSNSLIDENGELPPPPPPPLPPPGLDAAFLNETPIEHNLHEEHINTKK
                     IRTSSNDKPKTFKKKRSRKIIKKQEKRLKKLKQGKISYSKIEMPPEHLRKIIDNHADI
                     SSRRFDHDKKSFLGALKYLPHAILKLLENMPQPWESNKEVKVLYHTAGAITFVNEIPR
                     VIEPVYIAQWSTMWVAMRKEKRDRTHFKRIRLPPFDDDEPPLSYSDHINDSDSQKGIQ
                     LQSNDPDYAQVSDWLYDSRPLEDDRTKTNGTSYKKWKLNVKDVRSLHNLSKPLLNGTH
                     DGNYYYLFDKKTFMNSKALNTFIPGGPRFEPLYPSDDTQNEDYNDFNAIDRIIFRNIL
                     RNEHILAYPNLYYSRPRSVTLNWHSHPIFCLKITKTSSDVFDVGLEHVSGLSDKNFGN
                     TEDLFDLGCELKPLMSEVDLFDDTTGDAFEMYHSPYPFNRRQGHMKRAEDISLVKRAY
                     NERPGSGEPTKVKVSHQKLLKKDVFNALKRNRKNHKNYNLLKDLKSTKFFQETHIDWL
                     EAGIQLCRQGHNMLNLLIHKRGLNYLHLDYNFNLKPTKTLTTKERKKSRFGNAFHLMR
                     EILKMIKLIVDAHLQFRLGNIDPFQLADGLYYILNHLGQLTGIYRYKYKVMHQIRACK
                     DLKHVVYSKFNKIIGKGPGCGFWHPAWRIWIFFLRGIIPILERWLSNLLIRQFEGRNN
                     DIVKTTTKQRTDAYYDLELRASVMNDILDMIPEGLRQQKARTILQHLSEAWRCWKANI
                     PWDVPGMPLPIKTIIERYVRAKADGWISSAHSNREKMKKGVHIEKNAAKRNLGRLTRL
                     WIKNEQDRQAQIEKNGPELTPVEASTIFRVMVDWLRTRSFKPIAFPSLTYKNDTKILV
                     LALENLKDSYGAKTRLNAAEREELALIEDAYDNPHETLNRVKKYLLTQRVFKPVDINM
                     VEHYHHISPVYAVDPLEKITDAYLDQYIWYEAEQKNLFPNWIKPSDSEISPLLVYKWA
                     QGINNVNGIWDVHGNKSTVLLESKLEAFVEKVDFTLLNRLLRLVMDPNLADYMVAKNN
                     VIVNFKDMSYVNKYGIIRGLQFASFLYQFYGLVMDILILGIDRANEIAGPVSAPNEFM
                     EYSSSEVADKHPLKLYMRYLDKIYMVFHFSEKEADDLTFQYLSENPDPNFEDIINYPN
                     KKCWAKDQRMRLIRQDVHLGRAVFWEVQGRIPGSIAEIKWDSSFASVYSKNNPNLLFT
                     LCGFEVRIIPKLRTDELTTVSESVWDLVEKSTQQRTAIAYLKVSQESIDIFEGVIRGI
                     LMTAGSATFSKIAAKWNTALIALFTYFREAIITTEPLLDILVKSETRIQNRVKLGLNS
                     KMPTRFPPAVFYTPKELGGLGMLSASHILIPSSDLAYSKQTDTGITHFRAGMSHEDSQ
                     SIPTIFRYIPTWENEFLDSQRVWAEYANKRLEAMSQNRRLSFEELEGSWDRGIPRIST
                     LFQRDRQTLAYDRGHRVRREFKQFSLDRPLAFWWTNAHHDGKLWNLNNYRTDVIQALG
                     GIETILEHTLFKGTGFHSWEGLFWEKASGFEDSMQFKRLTHAQRTGLSQIPNRRFTLW
                     WSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVFDICQ
                     ILDGELSSLAIENVIKESVHPRKSYKMNSSAADITLTSIDQWKVSKPTLLHNSNDDTS
                     SISSNKMWIDVQLRYGDYDSHDISRYARAKFLDYTTDNVSMYPSPTGIMICIDLAYNM
                     YDAYGNWFDGLKPLIQNGMKTIMKANPALYVLRERIRKGLQIYQSTVQEPFLNSSNYA
                     ELFNDDIKLFVDDTNVYRVSVHKTFEGNVATKAVNGCVFMLNPKSGHLFLKIIHTSVW
                     SGQKRLSQLAKWKTAEEVSALVRSLPKEEQPKQVIVTRKAMLDPLEVHMLDFPNVAIR
                     PTELKLPFSAAMSIDKLSDIVMRASEPKMVLYNIYDDWLDTISSYTAFSRLILLLRAL
                     KTNEEQAKSILLRDPTIVIKEHHLWPSFSDSQWIEIESQMRDLILAEYGKKYNVKISA
                     LTQTEIKDLILGQNIKAPSVKRQKMAELEEAKLDKEKLLEGGQSTTVTKTKAINAQGE
                     EIVVVTSSNYETESFNSKSEWKKSALANSLLHIRLKNIYVNAGEFIEEKPVYIFPKNI
                     LEKLVQISDVKLQVAAYIYGSSPKDHPNVNEIQTVVLVPQISTDRTVKFIGHPNHDDY
                     EELEGLKLLGWVNIQHEDFKFMGPSALMNHASHFSNSKHDPIMISICSVPGSISISGF
                     TASIKGLAWAMQNKDTVSEIPEGFEPNYSENAQLMLSDRISGNFFVPSTGVWNYYFMP
                     TNLPDTLDDMSIRIPVEFYNDIHRPNHFLQFADLMDDDGDLEAGQEDLFA"
     gene            complement(<203605..>205524)
                     /locus_tag="CAGL0I02288g"
                     /db_xref="GeneID:2888989"
     mRNA            complement(<203605..>205524)
                     /locus_tag="CAGL0I02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447351.1"
                     /db_xref="GeneID:2888989"
     CDS             complement(203605..205524)
                     /locus_tag="CAGL0I02288g"
                     /inference="similar to AA sequence:UniProtKB:P16522"
                     /note="similar to uniprot|P16522 Saccharomyces cerevisiae
                     YHR166c CDC23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447351.1"
                     /db_xref="GeneID:2888989"
                     /db_xref="GOA:Q6FQZ3"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007192"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ3"
                     /translation="MELSNELIRDVRWNLRKAALEMSMMKLNGSSKWAAEALNGICEE
                     VTVDQLGLESPMDKLGKHIEIKEPGNSKISGDIPNKNFLSFHDNKSNFYFNEKEYDKY
                     LYVSTMFDNKEFDRCAFYLEDATNPSLKFLKLYSMYLSWDKKTQESLENVLTIEKNSV
                     KYDNAGNRNLNIDAADDFSSFGGLKKKSIDDPHNKNDQSGVTEILNELDQYLEDVQSH
                     KVPKNSLGYALLFYLRGILLKESNSKSMAIRAYLRSLRIYSFNYSCWSDLLECITTVE
                     ESQMLLSHFMSNFQFENLENINSQSKLESNIPFKIFQLLLFKEFQGNVDEYLTTFEDL
                     LTLFPNFTFLQAQKALTSYQYMDYVNSEQIFEKIMEDDPYRLDDMDTFSNILYVMQKN
                     AKLAYLAQFVSQIDRFRPETCCVIANYYSARQEHEKSIMYFRRALTLDKKTTSAWTLM
                     GHEFVELKNSNAAIESYRRAVDIDPRDFRAWYGLGQAYEVLDMHLYSLYYFQRACILK
                     PLDKRMWQALGSCYAKVGNHAEAIKCYERALQLTTQSEQDTALLYKLALLFEQTNGID
                     KCKLLMEKCVEIERITEGLVTDESVKARLWLAKFELKTNNYVKAYDLAVGVSNGTSQE
                     MEEARSIARECRRKM"
     gene            <206035..>206805
                     /locus_tag="CAGL0I02310g"
                     /db_xref="GeneID:2888990"
     mRNA            <206035..>206805
                     /locus_tag="CAGL0I02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447352.1"
                     /db_xref="GeneID:2888990"
     CDS             206035..206805
                     /locus_tag="CAGL0I02310g"
                     /inference="similar to AA sequence:UniProtKB:O13539"
                     /note="similar to uniprot|O13539 Saccharomyces cerevisiae
                     YHR167w subunit of the THO complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447352.1"
                     /db_xref="GeneID:2888990"
                     /db_xref="InterPro:IPR018557"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ2"
                     /translation="MSEQNSEQYFEALCEQEQALQDNHEHLKSVLNILGNVVDEEASD
                     EDIVTSLGKLSKTVKVLVDSSVDLRYKKFRVTDVRFAPQAAEQSRFGGNSNDHLRQIQ
                     KSGRLREYVSVLEAIYNDSLTYINLLTKLSVNLAKQIEFADHSVSEFLLEDWKPPHEL
                     QSILEKFVDMEEDPEVLNDQLNKYMDNIKMERAKYSLENKYSLQEQLKTLESELSRWR
                     DAWVNIESLMFGDSPNSMKGMLQNIESMKKELSPTAEN"
     gene            <207292..>208923
                     /locus_tag="CAGL0I02332g"
                     /db_xref="GeneID:2889377"
     mRNA            <207292..>208923
                     /locus_tag="CAGL0I02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447353.1"
                     /db_xref="GeneID:2889377"
     CDS             207292..208923
                     /locus_tag="CAGL0I02332g"
                     /inference="similar to AA sequence:UniProtKB:P38860"
                     /note="similar to uniprot|P38860 Saccharomyces cerevisiae
                     YHR168w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447353.1"
                     /db_xref="GeneID:2889377"
                     /db_xref="GOA:Q6FQZ1"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQZ1"
                     /translation="MSIIVRPRNLIKNKSVASRLSKFYSDLPDNAPTLGENEQWLNSL
                     SSNNRIGNLKRDYDNFARFPSNESFPWTFERDSTNPKKCIVNTPLSWLTDTKYLRQFN
                     KNKHLQSNFVDVRIVKCTSGKGGDGCVSFFRDAGRSIGPPDGGDGGHGGSIYVQAESG
                     LDSLAKMRATYVASDGGSGQSGQLDGARGKDILITVPTGTVIKWCLQPKLIKELMEER
                     VNNGHYTDKIKNLLENEYYDLECFNDNRYMGELPSHIQMKRSSNTSSSWLFKEKDEQY
                     HRDKEWFVQLDKKMRLYDYGVLKSELEADKFPLFGIDLSTPTKKPICLLKGGKGGLGN
                     MHFLTNLIRNPRFAKHGRPGLDQYFLFELKMIADLGLVGLPNAGKSTLLTKISNAKPR
                     IGHWEFTTLEPSVGTISLGIQGPQFTVADIPGIIKGASQDKGMGIEFLRHIERSNGWV
                     FVISLENPDPLNDLNILINELGGQEIIKQKRVLVVANKADINHTSTESRDKYMRLKEF
                     CDSKGWDSIPISALHSHNIDKLLVKMAKCSGRLSS"
     gene            <209279..>210592
                     /locus_tag="CAGL0I02354g"
                     /db_xref="GeneID:2889378"
     mRNA            <209279..>210592
                     /locus_tag="CAGL0I02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447354.1"
                     /db_xref="GeneID:2889378"
     CDS             209279..210592
                     /locus_tag="CAGL0I02354g"
                     /note="highly similar to uniprot|P38719 Saccharomyces
                     cerevisiae YHR169w DBP8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447354.1"
                     /db_xref="GeneID:2889378"
                     /db_xref="GOA:Q6FQZ0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTEEVSRKQNFRQLGLSKWLVESLDAMRIRTPTAIQSGCIPEIL
                     KGRDCIGGAKTGSGKTIAFAGPMLTQWSEDPTGMFGIVLTPTRELAMQIAEQFTALGS
                     YMNIRVALVVGGESIVDQALQLQRKPHFIIATPGRLAHHILNSGDDTVGGLKRVKYLV
                     LDEADILLTETFSNDLKTCVGALPPKEKRQTLLFTATITDQVRALQDAPVQKGKQPLF
                     CYEVENVDNVAIPSTLNTEYVLVPEHVKEAYLYQLLTCESYANSTAIIFVNRTTAAEV
                     LRRTLKALDVRVASLHSQMPQQERTNSMHRFRANAARVLIATDVASRGLDIPTVELVI
                     NYDIPSDPDTFIHRSGRTARAGRKGDAISFITQRDVSRIEAIEARINMKMTECDKVHD
                     TAVIRKALTKVSKAKREALMAMEKENFGERRKLQKRKTQKDGKRV"
     gene            <210916..>211467
                     /locus_tag="CAGL0I02376g"
                     /db_xref="GeneID:2889379"
     mRNA            <210916..>211467
                     /locus_tag="CAGL0I02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447355.1"
                     /db_xref="GeneID:2889379"
     CDS             210916..211467
                     /locus_tag="CAGL0I02376g"
                     /inference="similar to AA sequence:UniProtKB:P53317"
                     /note="similar to uniprot|P53317 Saccharomyces cerevisiae
                     YGR251w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447355.1"
                     /db_xref="GeneID:2889379"
                     /db_xref="GOA:Q6FQY9"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY9"
                     /translation="MSRAQEIKEKLALQAAIQKSFQQDSTKVLSWLTPEGNKESGSGL
                     GETELNESKKDFFQLPVVQVGSGLSFQMESNNATTDSTDIHTIGEFIKSDKKVSSLAK
                     KKKKREEAVHEARDSIHRISKDDTKAMIALKNKMRKTNRENIRKKISTDSRQNDSDSD
                     DEPKVEITKKKTIGLLFTGKKKK"
     gene            <212135..>213694
                     /locus_tag="CAGL0I02398g"
                     /db_xref="GeneID:2889380"
     mRNA            <212135..>213694
                     /locus_tag="CAGL0I02398g"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_447356.1"
                     /db_xref="GeneID:2889380"
     CDS             212135..213694
                     /locus_tag="CAGL0I02398g"
                     /note="highly similar to uniprot|P38861 Saccharomyces
                     cerevisiae YHR170w NMD3 nonsense-mediated mRNA decay
                     protein"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_447356.1"
                     /db_xref="GeneID:2889380"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY8"
                     /translation="MNYTPMDGQMQQHQHNQQVATVLCCNCGTPIDGSSGLVMCYDCI
                     KLTVDITQGIPREANISFCRNCERFLQPPGQWIRAELESRELLAICLRRLKGLNKVRL
                     VDASFIWTEPHSRRIRIKLTVQGEAMANTIIQQTFEVEYVVIAMQCADCARSYTTNTW
                     RATVQIRQKVPHKRTFLYLEQLILKHNAHVDTINIQEAKDGLDFFYGQKNHAVKMLDF
                     LNSVVPIKFKKSEELISQDTHTGASTYKFSYSVEIVPICKDDLVVLPKKLAKSMGDIS
                     QFVLCTKVSNTLQFMDPMTLQTADLSPQVYWRTPFNALADVSQLVEFIVLDVEPTGMS
                     KGNRVLADITVARSSDLGMNDQVYYVRTHLGAICHAGDSVMGYFVGNSNYNSDLFDGL
                     NIDHVPDVVLVKKLYQRKTKKSRNWKLKRMAKEHKDIDASQDYNNRSQRQEMERAERD
                     YELFLQELEEDSELRQTINLYKNQNAAVPQEAHEEEEDEDAPQIDIDELLDELDEMTL
                     DEPEEQGEVAM"
     gene            <214100..>215971
                     /locus_tag="CAGL0I02420g"
                     /db_xref="GeneID:2889381"
     mRNA            <214100..>215971
                     /locus_tag="CAGL0I02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447357.1"
                     /db_xref="GeneID:2889381"
     CDS             214100..215971
                     /locus_tag="CAGL0I02420g"
                     /inference="similar to AA sequence:UniProtKB:P38862"
                     /note="similar to uniprot|P38862 Saccharomyces cerevisiae
                     YHR171w APG7 component of the autophagic system"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447357.1"
                     /db_xref="GeneID:2889381"
                     /db_xref="GOA:Q6FQY7"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTQKLLYVSPVESFVDTSFFQELSRLKLDIHGLSTSQITIHSYL
                     DLKNIPSVSSACHLFLDQQSFNSEDICASSERVRLEGKLYNCNSLEEFKSLDKQQYLA
                     EQGQKIYTKALEDINSAIGFSIISFADLKKYVFYYWVCTPLFQHENQQISILDGPEDI
                     DASFNDKAKVWFTNHYSNWVAIVLENGDINEYTKGLNTSSIRGLLIRDTSNKQDMPSA
                     FLRNFITIFSLDYPEAKELDVFLMRSSTIKSIKLRIRLSETEHTKLKFSGWERNSLSK
                     LMPRAVDLSALIDPLKVAEQSVDLNLKLMKWRIAPELDLDCIRNNKVLILGSGTLGCY
                     TARSLMAWGCRNITLVDNGRVSYSNPVRQPLFEFSDVGKEKAVAAAASLKRVFPLINA
                     KGVQLDIPMIGHPVKDENNERKHFDALVDLIKSHDTMFLLLDSRETRWLPTLLGKFYD
                     KIVMNAALGFDSYLIMKHGNIDDNFGCYFCNDVVVPTDSLTGRTLDQMCTVTRPGVAM
                     LAASQAVELFVSNLQSRGQENVLGECPHQIRGFVNNFTTLKLQSPAYDNCSACSRHIL
                     NEYNKRGWDFVKQALNDNNYIEELSGLRRIKEEVENMELEGGEIKIIDSEDDGFEII"
     gene            complement(<216120..>216902)
                     /locus_tag="CAGL0I02442g"
                     /db_xref="GeneID:2889382"
     mRNA            complement(<216120..>216902)
                     /locus_tag="CAGL0I02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447358.1"
                     /db_xref="GeneID:2889382"
     CDS             complement(216120..216902)
                     /locus_tag="CAGL0I02442g"
                     /note="highly similar to uniprot|P32379 Saccharomyces
                     cerevisiae YGR253c PUP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447358.1"
                     /db_xref="GeneID:2889382"
                     /db_xref="GOA:Q6FQY6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY6"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSE
                     GVVLGVEKRATSPLLESDSIEKIVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLY
                     YDEDIKIESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAEQLVLKILKQVMEEKLDENNAQ
                     LSSITKDDGFQIYSDSKTAEIIKEFKETEAQENPEQHDVDMS"
     gene            <217697..>220147
                     /locus_tag="CAGL0I02464g"
                     /db_xref="GeneID:2889383"
     mRNA            <217697..>220147
                     /locus_tag="CAGL0I02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447359.1"
                     /db_xref="GeneID:2889383"
     CDS             217697..220147
                     /locus_tag="CAGL0I02464g"
                     /inference="similar to AA sequence:UniProtKB:P38863"
                     /note="similar to uniprot|P38863 Saccharomyces cerevisiae
                     YHR172w SPC97 spindle pole body component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447359.1"
                     /db_xref="GeneID:2889383"
                     /db_xref="GOA:Q6FQY5"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY5"
                     /translation="MEVRAVEDTAELVPKPSAYGDAEEFNEPIMRRMVNYEPFCNKAP
                     KFRAYPLSQLGTPEGRRVQEALVVKDLLDTMMGLEGKYIRYNNSYDPHVDMMPAFRIS
                     KNMDKSLKQCCIKILKLSKSYIFINNCIQEWSRPSYGCILHRLTYEIRKFLKDGYLRF
                     IVERLEKEYSSNVSFSIRDMEHMINDYELSKKMEILYNLCLRLNEEMNRRLNMNLDQE
                     DFNNFKRELEDVGQAILLPTDSSLSLTPKGGNIIKVVQEMIAETLGDRNGVQFLKDIL
                     NKIGEGYLKMFDDWLINGDINDPHEEFMIRDMMKDVNVTDTNAMMTTDRLWETRYLIR
                     KDGLLESFHEELLSKILVTGKLLNIVKVTMELTSIPVDGKYALRRAGEFDFVHLLEGT
                     NLELYVSRWYSRANELCIRLFFEGYNFGRFLRDIFCNYLYVNNGNKFNKFLLRNHFDL
                     GKEYSESRSVLRRLEQSWDVEVDDRSLVQRLVSLRYSTVSFRESLLQVQRDEIAREDV
                     TMRDESSDDNDALLRASNFENVKRILFEDRHHTDEYDDHGQQGHEQGREQRREPALSN
                     IHYLEFDLVVPYPLNILINHSCMIQLRILQRYMNILAHTQLSVDKRFLDITKDTVWRY
                     RHFQEPIRTKIVKRSTVLLNKMGDTLRAVQTYYTHTVSRELHSATNIISSESRSGTIS
                     GSSSGSDGMEVTRIQDVLQDTLTNIISNTCLTSRTITIILDLVQLVESYMKFLRGLRR
                     RLVQLDAQLCHRAQVEYDEDRALESVPRLVRYTEDVFVTTRSLVSALTESMTESIGGS
                     GGVGPHEHVLVTHLHGIF"
     gene            <220865..>222178
                     /locus_tag="CAGL0I02486g"
                     /db_xref="GeneID:2889384"
     mRNA            <220865..>222178
                     /locus_tag="CAGL0I02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447360.1"
                     /db_xref="GeneID:2889384"
     CDS             220865..222178
                     /locus_tag="CAGL0I02486g"
                     /note="highly similar to uniprot|P00924 Saccharomyces
                     cerevisiae YGR254w ENO1 enolase I or uniprot|P00925
                     Saccharomyces cerevisiae YHR174w ENO2 enolase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447360.1"
                     /db_xref="GeneID:2889384"
                     /db_xref="GOA:Q6FQY4"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /translation="MAVSKVYARSVYDSRGNPTVEVELTTEKGVFRSIVPSGASTGIH
                     EALEMRDGDKSKWLGKGVENAVKNVNDVIAPAFVKANVDIKDQKAVDDLLLSLDGTAN
                     KSKLGANAILGVSMAAARAAAAEKNVPLYQHLADLSDSKTSPFVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGAKSFREAMRIGSEVYHNLKSLTKKRYGSSAGNVGDEGGVAPD
                     IQTAEEALDLIVDAIKAAGHEGKVKIGLDCASSEFFKDGKYDLDFKNPNSDASKWLSG
                     PQLADLYHSLVKKYPIVSIEDPFAEDDWEAWSHFFKTAGVQIVADDLTVTNPKRIATA
                     IEKKAADALLLKVNQIGSLSESIKAAQDSFAAGWGVMVSHRSGETEDTFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQLLRIEEELGDKAVYAGDNFHHGFKL"
     gene            <222770..>223297
                     /locus_tag="CAGL0I02508g"
                     /db_xref="GeneID:2889385"
     mRNA            <222770..>223297
                     /locus_tag="CAGL0I02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447361.1"
                     /db_xref="GeneID:2889385"
     CDS             222770..223297
                     /locus_tag="CAGL0I02508g"
                     /inference="similar to AA sequence:UniProtKB:P38865"
                     /note="similar to uniprot|P38865 Saccharomyces cerevisiae
                     YHR175w CTR2 copper transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447361.1"
                     /db_xref="GeneID:2889385"
                     /db_xref="GOA:Q6FQY3"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY3"
                     /translation="MKMDHSGMNRMGMDHSGMDHSGMNHPGMNHGGDDDMCAMSMVFT
                     WNYKNTCVVFNWWKIKTLHGLLLSCIAIALITGFYEYLKFYLYRKNRDSEAVVTSTSA
                     TNGSLNSPSPLTKRYAVSRSLWYGVQVGYSFLLMLVFMTYNGWLMLAVVVGAIWGHYH
                     WGIRCTPEAGTLACH"
     gene            <223800..>225095
                     /locus_tag="CAGL0I02530g"
                     /db_xref="GeneID:2889386"
     mRNA            <223800..>225095
                     /locus_tag="CAGL0I02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447362.1"
                     /db_xref="GeneID:2889386"
     CDS             223800..225095
                     /locus_tag="CAGL0I02530g"
                     /inference="similar to AA sequence:UniProtKB:P38866"
                     /note="similar to uniprot|P38866 Saccharomyces cerevisiae
                     YHR176w FMO flavin-containing monooxygenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447362.1"
                     /db_xref="GeneID:2889386"
                     /db_xref="GOA:Q6FQY2"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY2"
                     /translation="MTKNQKTVCIIGGGPGGLAAARVLSKDFPEAKITLIEKEEDVGG
                     VWYYPENNKEGRVMYDYLETNLSKDLMKFSGFPFKDDVPFYPRKNQVFDYLKEYYQTY
                     IKNHSNVDIELETEVINVDKKSDKWIVTTKHANSETVRELDFVIVSNGHFKEPKYPKD
                     VFGLDSWLSNGKAFHSKDFYNCEFAKDKKIIVVGNGSSGSDIANQISTVAAKVYVSVT
                     NVEDFKDKNNDPEFIVEYIPKIKSVGGDDSSVKLEDGRVIENIDYIIYATGYLYSLPF
                     FASHISEKLLKQDQSGITNLWEQCVYKEDPTLGFLLLSIMVVPFPLAESQSTILSQVF
                     QGNIDIATVTPSRDEVEHEKNYGHNFPKLSDIDFYRELQDILDKHGSNTFKPVVWDEV
                     YEKKRKESAEVKQQRNEYLAKHAQKLHKENRPYYLPDNF"
     gene            <227257..>230274
                     /locus_tag="CAGL0I02552g"
                     /db_xref="GeneID:2888916"
     mRNA            <227257..>230274
                     /locus_tag="CAGL0I02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447363.1"
                     /db_xref="GeneID:2888916"
     CDS             227257..230274
                     /locus_tag="CAGL0I02552g"
                     /note="weakly similar to uniprot|P38699 Saccharomyces
                     cerevisiae YHR178w STB5 SIN3 binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447363.1"
                     /db_xref="GeneID:2888916"
                     /db_xref="GOA:Q6FQY1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY1"
                     /translation="MSGPDKGSDSGQTANDPKQKKARNGQMETYSCARCRKLKKKCPR
                     QLPECSNCLKAREPCNYPGRAPRRTKKELRDAIMKGEVLPSMRRKHRKIEKELKTADL
                     RHLESVDDRPVNQVMGGSMPPLGAYRGGEQQYNNGPPISGIDGNDSINRGKAQSVGSY
                     QILPPQRKSKLVLDQNPKFVHSQSSALKTNEYPVPIMSPHIANQVYPEGVSSLISALN
                     TMNDNVSANTPIALSYLQLQKLHQEQQQIQQQQIQQQQQHQHLVQQHLQHVRADATSI
                     LPPVTSQTVYTPIPGPRTSQIPFGFTHGYTASAPPPLMQPYSMPTSPFESREKQQQFD
                     NIQYHPVYKIPPIAARQSPIDEIIGIENGSISIDAGSITREVVNSRMKGPHSTSWVNE
                     DGSPKPIKKSLLEKFVSAYFEHNHRLFPMVDKVTFLKKLATINSFESIEMLAVNNPEL
                     PKTFIFEIYMIMAIGCTTLQRAGKLTTDEGHLYEHLAYLAMRNFRDILHQQDITTLRC
                     LILLGIYSFFEPKGVSSWTISGIAMRLAIELGLNRPLTAKEMGDMSAVEVESRYRVFW
                     SAYCFERVVATSLGRVSAIDDEDIGIPLPRALYDSEKEDIEVTNLIISLRKMGGKIYK
                     EVHSLSAGRKDITMEQKQLIIQKLRKELDDIYEEECEKRRLKGKSRSSKRFEKSKESD
                     SDRGVTEEDVKSGNENLIGLLASDDVSMTEHGQSIDNTLESTPLPTTIPTTIVNDSVD
                     QHSTLENIPTSATSKDQIETIITKPTANIMNDQTDSDPLPKVDNKPISNNEEGPKSLK
                     EGNSEQNPSENISPEDVTLTKTDNSENKESSLRSNSNISFHISNVWLEMRYTQLQILL
                     YRPSALIPKPPIESLTVLGEFCLAAWRHTYTLYKEKLLPLNWITLFRTLTICNTILYC
                     LCQWSIDLVASTIEIQQCVEILQHFGEKWVFAMKCADVFQNISNTIVEISLSQGQDPN
                     IDKLTRELFGASNAYLEILNENNVDVSWEDRFR"
     gene            <232393..>233598
                     /locus_tag="CAGL0I02574g"
                     /db_xref="GeneID:2889387"
     mRNA            <232393..>233598
                     /locus_tag="CAGL0I02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447364.1"
                     /db_xref="GeneID:2889387"
     CDS             232393..233598
                     /locus_tag="CAGL0I02574g"
                     /note="highly similar to uniprot|Q03558 Saccharomyces
                     cerevisiae YHR179w OYE2 NADPH dehydrogenase or
                     uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447364.1"
                     /db_xref="GeneID:2889387"
                     /db_xref="GOA:Q6FQY0"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FQY0"
                     /translation="MPFVKDFKPIALKDTNMFKPIKIGNTEVAHRVVMPPLTRMRAHH
                     PGNVPNKEWAVEYYKQRSQRPGTMIITEGAFPCAQAGGYDNAPGIWSEEQVAEWTKIF
                     KAIHDNKSFVWVQLWVLGRQAFPDTLARDGLRYDSASDEVYMDKESEEKAKKSNNPQH
                     GITKDEIKQYIKDYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSI
                     ENRARFTLEVVDAIVDAIGPEKTGIRFSPYGTFGTMSGGAEPLIVAQYAYVLGELEKR
                     AKAGKKLAFVHLVEPRVTNPFFTEGQGEYKDGTNDFAYSIWTGPIIRAGNYALHPEIA
                     KEHVNNDDRTLIGYGRFFIANPDIVDRIEKGLPLNKYDRDTFYAMTTEGYLDYPTYDE
                     AIKMGWDKQ"
     gene            complement(<234648..>235250)
                     /locus_tag="CAGL0I02596g"
                     /db_xref="GeneID:2889388"
     mRNA            complement(<234648..>235250)
                     /locus_tag="CAGL0I02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447365.1"
                     /db_xref="GeneID:2889388"
     CDS             complement(234648..235250)
                     /locus_tag="CAGL0I02596g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447365.1"
                     /db_xref="GeneID:2889388"
                     /db_xref="GOA:Q6FQX9"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX9"
                     /translation="MRKNLAYDFTYCVSTLNIAGIASSDDLVLWTEDVKEIASWYPSL
                     EDSLKIKQLLGLIPDRWKSISYTTEGISTSSLENFLDYIVQKFVESKMEVFQYLKDAP
                     HVGPLNSMELESIRHVLEDMAYLYSLEFALLGFYLFLPYNIKNILGNAETPDLEWILS
                     ELDKEIKEIRIREECQIVQSFNSNAKRTKRSKHSNRQKYK"
     gene            236933..237020
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0I02618r"
                     /db_xref="GeneID:2889389"
     tRNA            join(236933..236972,236984..237020)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0I02618r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2889389"
     gene            <237396..>239216
                     /locus_tag="CAGL0I02662g"
                     /db_xref="GeneID:2889390"
     mRNA            <237396..>239216
                     /locus_tag="CAGL0I02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447366.1"
                     /db_xref="GeneID:2889390"
     CDS             237396..239216
                     /locus_tag="CAGL0I02662g"
                     /inference="similar to AA sequence:UniProtKB:P32807"
                     /note="similar to uniprot|P32807 Saccharomyces cerevisiae
                     YMR284w HDF1 high-affinity DNA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447366.1"
                     /db_xref="GeneID:2889390"
                     /db_xref="GOA:Q6FQX8"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX8"
                     /translation="MSELDFPDIDSNIFDEDSGKEDGEVNKQASFKRFEIHEGIMFCI
                     ELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVTRPSTAIGCYFYNCEREDSKESI
                     FEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYLNYNIDQNKKLNIPILLEKLFSLI
                     LETFNRNIEGQKEFNSKKVFLFTDNDLPNVESQQRSIDVLKGILKDIDDNMINFTNFF
                     ISKKDKPFNPAFYSKVLRNDRDYNSLGSQAYFGPSTKPIGVNDIKERIFQRKEIRRVV
                     FQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEAFSKRKFINPKTGE
                     DVSKQTVKIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNEDNSLVFYNNIDK
                     TLFITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLLWPSKDDDNN
                     QGFYLTKVPFIDEIRKYPTLSNININEEWEEYKNVKELTQGIISHFNLKSGYHAEEFR
                     NPALNRHYKLLHDYLLQVEIPQDDNDIRDRYLREDDTLLKITKIRERIMKDTTIDDVE
                     KRRLSKYLEVWNIYYRKFKEDTNQTSSSLLKSEKKPKLNL"
     gene            complement(<239316..>240797)
                     /locus_tag="CAGL0I02684g"
                     /db_xref="GeneID:2889021"
     mRNA            complement(<239316..>240797)
                     /locus_tag="CAGL0I02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447367.1"
                     /db_xref="GeneID:2889021"
     CDS             complement(239316..240797)
                     /locus_tag="CAGL0I02684g"
                     /inference="similar to AA sequence:UniProtKB:Q03264"
                     /note="similar to uniprot|Q03264 Saccharomyces cerevisiae
                     YMR285c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447367.1"
                     /db_xref="GeneID:2889021"
                     /db_xref="GOA:Q6FQX7"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX7"
                     /translation="MTQEEVVHVAENPAAVNAVKEVKKSKGKKKGKGKPSPEEIARIR
                     AEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQ
                     ALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLG
                     YSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALK
                     FTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQ
                     NNNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRE
                     SGEDAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYS
                     VAYHKVHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFEN
                     SNNIKIRGLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVELR"
     gene            <241613..>241882
                     /locus_tag="CAGL0I02706g"
                     /db_xref="GeneID:2889022"
     mRNA            <241613..>241882
                     /locus_tag="CAGL0I02706g"
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /transcript_id="XM_447368.1"
                     /db_xref="GeneID:2889022"
     CDS             241613..241882
                     /locus_tag="CAGL0I02706g"
                     /note="highly similar to uniprot|P20084 Saccharomyces
                     cerevisiae YMR286w MRPL33"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL33"
                     /protein_id="XP_447368.1"
                     /db_xref="GeneID:2889022"
                     /db_xref="GOA:Q6FQX6"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX6"
                     /translation="MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMA
                     GSLAKIKELISVDVTKSRLTKQQQRELRKTNPGFTVEKQEDGLLE"
     gene            complement(<242221..>242556)
                     /locus_tag="CAGL0I02728g"
                     /db_xref="GeneID:2889023"
     mRNA            complement(<242221..>242556)
                     /locus_tag="CAGL0I02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447369.1"
                     /db_xref="GeneID:2889023"
     CDS             complement(242221..242556)
                     /locus_tag="CAGL0I02728g"
                     /inference="similar to AA sequence:UniProtKB:P38824"
                     /note="similar to uniprot|P38824 Saccharomyces cerevisiae
                     YHR116w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447369.1"
                     /db_xref="GeneID:2889023"
                     /db_xref="GOA:Q6FQX5"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR010625"
                     /translation="MAADEDIIKDGNYDPHVQTDKDKVDYAPKGVDTTEYRYYPDNPE
                     STLNKYRFAMKDHSQYYDPCQESAKMSFKCLELNDYDRDQCKEYFDAYRECKKQWLEA
                     RRKDRTNWS"
     gene            complement(<242879..>244738)
                     /locus_tag="CAGL0I02750g"
                     /db_xref="GeneID:2889024"
     mRNA            complement(<242879..>244738)
                     /locus_tag="CAGL0I02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447370.1"
                     /db_xref="GeneID:2889024"
     CDS             complement(242879..244738)
                     /locus_tag="CAGL0I02750g"
                     /inference="similar to AA sequence:UniProtKB:P38822"
                     /note="similar to uniprot|P38822 Saccharomyces cerevisiae
                     YHR114w BZZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447370.1"
                     /db_xref="GeneID:2889024"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX4"
                     /translation="MSLSIGNEIKDGFKETYDWVHQNIKWLKDTEQFYRERAKLEREY
                     SEKLSKLCGEFLNRKSNISVTLSVGEKPATTPGSLEAASVVAWNEILSQTENIAKDHM
                     QLAHELDGEIGGQLSGLNSKLDITLNKIQGFNTEMVEKKDGIFNEMEKAKKNYDDACS
                     SMEATRNKHTKNPSEKNKRKVQEKETAMNNAKNEYLIKVNQANRTKDKYYFQDVPECL
                     DLLQGLNESKVLFLNDIWKRASSLEKSFTERVNKRLDASDSVVVQNKPSLNTAMFIKH
                     NVKQWREPPDFQFKPSPVWHDDEKFCVPSQLEANALVVKLAQSESEYLKYNDLAQGEL
                     SQLSALNKKKQEMASNEDNIKGNEFFEILKSYLALISPFTSHETLKLQAEVQIESIQN
                     NVPEEYDLTTTHIDTSKKKKGIFSKLKENLLNPEARPSSHGQSSTVSSHSPRINILGN
                     NRNRSGTTASTMSATSSRTDGMQSVASPTREQSNKNRVLYAYAEQDTDEVSVSVGDSF
                     TVITADDGSGWTKITNTTTGKSGLVPSSYIEIREEASHSSRGPPPAAPPSRRTTLPVR
                     TITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSYCT"
     gene            <245132..>245935
                     /locus_tag="CAGL0I02772g"
                     /db_xref="GeneID:2889025"
     mRNA            <245132..>245935
                     /locus_tag="CAGL0I02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447371.1"
                     /db_xref="GeneID:2889025"
     CDS             245132..245935
                     /locus_tag="CAGL0I02772g"
                     /inference="similar to AA sequence:UniProtKB:Q99394"
                     /note="similar to uniprot|Q99394 Saccharomyces cerevisiae
                     YOR115c TRS33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447371.1"
                     /db_xref="GeneID:2889025"
                     /db_xref="GOA:Q6FQX3"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX3"
                     /translation="MERREPTEHQSAQQQAQLFEKSLPKVNQLAFNMLLNELVPLSMA
                     VENDIHDMAVKDSNAEDVTVEVLAGDVDKKVVLKDDDTEEEKEQAPKYKIGEQSHKLI
                     QQIYNLDDEYRSNSVAERIQNVGFQIGSKLCELLVFSNNPTISFRDMDLLAVMKFVCR
                     DVWKQVYGKQIDNLKTNHRGTFYLLDYDYKPIQTFALDLDPEQQEKELKLVEPFLEIP
                     VGIIKGVLSSLGFPKDEVICVTSFVDRPDDRPRSLFPKGVSFHVQVNRR"
     gene            complement(<246151..>246909)
                     /locus_tag="CAGL0I02794g"
                     /db_xref="GeneID:2889026"
     mRNA            complement(<246151..>246909)
                     /locus_tag="CAGL0I02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447372.1"
                     /db_xref="GeneID:2889026"
     CDS             complement(246151..246909)
                     /locus_tag="CAGL0I02794g"
                     /inference="similar to AA sequence:UniProtKB:Q12219"
                     /note="similar to uniprot|Q12219 Saccharomyces cerevisiae
                     YOR114w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447372.1"
                     /db_xref="GeneID:2889026"
                     /db_xref="GOA:Q6FQX2"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX2"
                     /translation="MRFTLHLYARPSSILVSCKKAFKKSAQKDIGTVFNYYYNMQVKK
                     FGNTTLMRFNNSFKRYIRSEWDNLSATKKRLYYAMFFEQHNLSPSELTSYELARCLEI
                     EKPAASEYLMFRNRFKSKFDRLWRQNSEVNMKLIFQSGSIANNYHEFSSCRAKRSIQH
                     IDPNRDYILRFKEMCKECRRIWNTKVGEEEKKTIHEHWLNAQQEFKNTLDIEIEVIKL
                     NLEKLANAKRVGNSQAVSDHGNAMTLLMMKTSNG"
     gene            complement(<247817..>248692)
                     /locus_tag="CAGL0I02816g"
                     /db_xref="GeneID:2889027"
     mRNA            complement(<247817..>248692)
                     /locus_tag="CAGL0I02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447373.1"
                     /db_xref="GeneID:2889027"
     CDS             complement(247817..248692)
                     /locus_tag="CAGL0I02816g"
                     /inference="similar to AA sequence:UniProtKB:P41696"
                     /note="similar to uniprot|P41696 Saccharomyces cerevisiae
                     YOR113w AZF1 asparagine-rich zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447373.1"
                     /db_xref="GeneID:2889027"
                     /db_xref="GOA:Q6FQX1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX1"
                     /translation="MKDYITGEKPYECDICKKRFSRKGNLAAHKMTHGKIRPFICKLD
                     NCNKSFSQLGNMKSHQNKFHLDTLKVLTQKLATMDPDTPIPQEERELLEYFASIYKNS
                     NKGIKGRGKGSTKVSLSPEAISRASSSPVEKRRTSRRKSSRTNNGDNVMANIPSTIDS
                     LMTNENMQSVQNGIAHSDKSPNPNYSYSQFPPQAGGSLDDYPGASGYVNGAESSNNLN
                     KDENSETNSKQNSSNNLMMPLTNVSGFSFSFDNSNEPVNAPQSNEQRSQLSNISQSPV
                     NSQEPIKFKNISYKS"
     gene            complement(<248704..>250671)
                     /locus_tag="CAGL0I02838g"
                     /db_xref="GeneID:2889028"
     mRNA            complement(<248704..>250671)
                     /locus_tag="CAGL0I02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447374.1"
                     /db_xref="GeneID:2889028"
     CDS             complement(248704..250671)
                     /locus_tag="CAGL0I02838g"
                     /inference="similar to AA sequence:UniProtKB:P41696"
                     /note="similar to uniprot|P41696 Saccharomyces cerevisiae
                     YOR113w AZF1 asparagine-rich zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447374.1"
                     /db_xref="GeneID:2889028"
                     /db_xref="GOA:Q6FQX0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FQX0"
                     /translation="MVEESDPKVGGDETVKPEEQAETKVQGAPDQIRDASVQAGRSQG
                     RNDSMSYFTFNQPRFSTDSVLNPFLNMMEQGSGAPGAPGTQSGQSTQGAQGAQGTQGA
                     QGAPGAQSAQGAQSAQGPGQGPVSMNKGSIAGNAQRLSQQPDLNQIGRGFSIVNSLWP
                     PQQGSVPNAGGAVNAGVRRSVDHTQPDGSAEQSPVPPITNAQGQVARNGSQPRFKIPS
                     FASENAQSYPQAGANNAGTPGLSGYNAPGSKRNSIYFPNDVTSDQDLLNSVHVNNPDM
                     PNQQFQFQVGGYGRRDSILQSMKPPSMVPFGNNGAPIPQNEIMTGNDKTNDNFMDNMP
                     QGNIPPGARNANFKEPGFRKASSNEYEMFLNNHSYRNPYSISGEGQPLPPQGSRQNSI
                     KYNPEDLDYQYKRRNSSVRSLLYGPMQFQTAVDNSMQNINNGANMGRLSAFGEIPQNM
                     YRNVGTSINQGIAPNGEPIGQDPNLGSKRPLMEGEEGYNNWEENPKKKTKGKPRKKRT
                     TNKASSTKKNTTTKGNSGQAINQEPVNENIPDELPPETNQKEKLGTTNVDQLVLMIQA
                     RKKGVTEKVPTTEDGKLVISNDSEIIPSSVDLFGGVEKPKSATVSKQFECQYCHRCFA
                     QVTHLDVHIRSHLGKKPYQCEYCGKPLHPGW"
     gene            complement(<251050..>253080)
                     /locus_tag="CAGL0I02860g"
                     /db_xref="GeneID:2889137"
     mRNA            complement(<251050..>253080)
                     /locus_tag="CAGL0I02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447375.1"
                     /db_xref="GeneID:2889137"
     CDS             complement(251050..253080)
                     /locus_tag="CAGL0I02860g"
                     /inference="similar to AA sequence:UniProtKB:Q12453"
                     /note="similar to uniprot|Q12453 Saccharomyces cerevisiae
                     YOR112w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447375.1"
                     /db_xref="GeneID:2889137"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW9"
                     /translation="MNFTSFFKSISNFQFPYTIDEETVLLETPLWQVYNGTRKSDSLP
                     VTLFKAQRRADTEQLIANALHKAKILKIPGLCSVLEISDSDPQSTFIITERVTPFNWD
                     KLKDYSSNKDSVYLWVSQLVETLQYMKTFVLGTLNRQSLFFNSKGQLVFFGLELCSNI
                     EDSFHFGSQMKLYYSICGLQPPATEDPKIVDAVLLGSLLKNDLMKYTGMPKDWVKLVS
                     SISNGKSSIARFADQIQTTESWYGNPMIELYSELKEWHIKNLQDKMIVLNNLEALYFE
                     DPAMFKNLAPGFIENLILPELIDMIQNLVNNNGGAVPSTSHNKIVSFLAILLELATDS
                     KSYDEPFRNIVGLCFKLPDRQVRFLLLMYLPTLVEPFGPAEVCNRIYPQFVQGLSDTE
                     PKLRLETLKKIPYIVPSLNERQLNNELLRYLAKTQVDSDIEIRTWTVFIITKIASELS
                     SSMGNRASILATAFTKSLKDPEIKPRLAALHGLTETITLFDAGTIATKVLSVIAPSFM
                     DKDKLVRRKARELFKLYMARLEEAAKELDGSGEGADSTGTRIDFAEYESTRDQDAEML
                     AQFLDNLKLGSTSSVNLMKARSNNNSNISLGSTPAAPATPATPATPATPVPTSTSTGD
                     DAWEEKRRPVQRKSILSAKPKPQPKPTARKQAKKVELWDDPDVEDEGWGDDW"
     gene            complement(<253401..>254048)
                     /locus_tag="CAGL0I02882g"
                     /db_xref="GeneID:2889136"
     mRNA            complement(<253401..>254048)
                     /locus_tag="CAGL0I02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447376.1"
                     /db_xref="GeneID:2889136"
     CDS             complement(253401..254048)
                     /locus_tag="CAGL0I02882g"
                     /inference="similar to AA sequence:UniProtKB:Q99210"
                     /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
                     YOR111w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447376.1"
                     /db_xref="GeneID:2889136"
                     /db_xref="GOA:Q6FQW8"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW8"
                     /translation="MLSELLESYDFILASSSPRRYEIIHDILGIDKLDTMKPSFEEDL
                     DKSKYTNNPIQYVIDTCKGKADGICDDLKSHQKSFDKPQVVICADTIVLDANNKIYEK
                     PSSRNDLIKNLHWFCYETKEPVRVVTAVSVIVYKSPTEYRVTEFHDQTDMYFDSNIPS
                     SFIEEYSRNDAALNAAGGIMIQTSCGAMVNRIDGDYYNIMGLPLNKLVIELNRLL"
     gene            complement(<254421..>255713)
                     /locus_tag="CAGL0I02904g"
                     /db_xref="GeneID:2889139"
     mRNA            complement(<254421..>255713)
                     /locus_tag="CAGL0I02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447377.1"
                     /db_xref="GeneID:2889139"
     CDS             complement(254421..255713)
                     /locus_tag="CAGL0I02904g"
                     /inference="similar to AA sequence:UniProtKB:Q12415"
                     /note="similar to uniprot|Q12415 Saccharomyces cerevisiae
                     YOR110w TFC7 or uniprot|P53929 Saccharomyces cerevisiae
                     YNL108c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447377.1"
                     /db_xref="GeneID:2889139"
                     /db_xref="GOA:Q6FQW7"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW7"
                     /translation="MVVRTVYIARHGYRANWIIGAEVPPPPTGIAGDVQLAQHGIKQA
                     HELGRFLLTLDDQPEMIFSSPFYRCLETSTPIAELLEVPVYIERGFSEWYRPDRPVIP
                     VPADNELLSKYFHDTVRLEWHSQPAPSEKGETEEELYKRCHDALNNFIKQVEKKFPSV
                     ETIMIVTHGATKIALGLNLLQKPDCRCTIDDTHEYLRCGSCSLDKFELPSNAKETSNP
                     EEDIDVLEETEPLKRNWMCTLNGHTEFLSRGEEMNWGFHLNVEAGSDADVKSRITTET
                     AGKESVYVSVDIPSGNYKGKNVLDKKATLQYSGLEEHEPLVLINNKLYVGKWEKLVGT
                     ELAFPSTATVNKKNLRGGEDDESSSKGLNHILDEDIIADEFDNIKKEEDDKLAEDSDD
                     SSIEKQKIPEERNELENKVTEKIYRIKDRLVLEEVEII"
     gene            complement(<256224..>258227)
                     /locus_tag="CAGL0I02926g"
                     /db_xref="GeneID:2889140"
     mRNA            complement(<256224..>258227)
                     /locus_tag="CAGL0I02926g"
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /transcript_id="XM_447378.1"
                     /db_xref="GeneID:2889140"
     CDS             complement(256224..258227)
                     /locus_tag="CAGL0I02926g"
                     /note="highly similar to uniprot|Q04373 Saccharomyces
                     cerevisiae YDR496c"
                     /codon_start=1
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /protein_id="XP_447378.1"
                     /db_xref="GeneID:2889140"
                     /db_xref="GOA:Q6FQW6"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012959"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW6"
                     /translation="MAPTKKRSHTNEAVKSYKKARISVSSDEDMSDSASGSGSESGSE
                     SASSSSSADEDEEDELDFSSDEEKDDKKASAAAAAASDSDSEADSDSEAEADGDEDNE
                     KNGEENEGGNHHAEQKQLLKERKLKRKAGSEIVHIKSLWEKLRIKNPPPPKQVRDKLS
                     NEIWELSKECISDLVLKHDASRIVQTLVKYSSKERREQIVDQLKGKFYVLATSAYGKY
                     LLVKLLHYGSKRSRQAIIDELHGNLRKLMRHREGAYVVEDLFVLYATSEQRNQMIKEF
                     WGSEYAVFRESHKDLTIEEVCNSSVEKRNIIARNLIGTITASVDKGSTGFQILHAAMK
                     EYVKIANDKEISEMIELLHEQFAELVHTPEGSFVACTLISKASPKERKQILKALKPHA
                     EKLVTNEHGNIVLITAMQSVDDTVLMFKTFSPAVKDNLKDFIIDKYGRRPWLYVLKGL
                     DGKYFSPIVKNELLRYEEMSSQTSKKPKEQRRMELLNKFGPMYISCIAKNCSEILDEN
                     LGCQFISEVITSDDLYEQLSEKEQEVFQQVIDEIKVQFKGDISEEDHPIHRPFSTRLL
                     KAMIQGGRWNNKEKKLEPFTKVQGLGEEFAKDFYETIVDSTNLLEWINNADSSFTIVA
                     LHESLQKSQQGKQFMKDLKSIKKEIDTTDESNKGAQLLLKLLK"
     gene            complement(<258545..>259489)
                     /locus_tag="CAGL0I02948g"
                     /db_xref="GeneID:2889138"
     mRNA            complement(<258545..>259489)
                     /locus_tag="CAGL0I02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447379.1"
                     /db_xref="GeneID:2889138"
     CDS             complement(258545..259489)
                     /locus_tag="CAGL0I02948g"
                     /inference="similar to AA sequence:UniProtKB:P28791"
                     /note="similar to uniprot|P28791 Saccharomyces cerevisiae
                     YDR498c SEC20 secretory pathway protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447379.1"
                     /db_xref="GeneID:2889138"
                     /db_xref="GOA:Q6FQW5"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW5"
                     /translation="MKGEVQQLQQRLLAKVNEEDYEEVLSGGVGRYKELLAQYVVMIN
                     NRSAEGSLIWRPSQDARKHDSIEVQGKIDVELLSDFIEWSDWLFELRRSCIDLLLEKH
                     RSRALLEEQLRDQAIEEHTGEPAVGTHDGHGHDARDAKTGREENLAPKDKLLHKTKQL
                     TNSLSRGTQLLQSGILQSDLNLDELKQQTSSLQKVDDKYQQFESIFTRTNQLVKTLEK
                     ASHQEKRDVYMALGFLCLCISWVVWRRILKLPFKLALWILFRFFKTILTTIGLVSKHM
                     PSSPSTNSTTLESAASMAVSEAVDRLASGIASGLDDEL"
     gene            <259776..>261089
                     /locus_tag="CAGL0I02970g"
                     /db_xref="GeneID:2889143"
     mRNA            <259776..>261089
                     /locus_tag="CAGL0I02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447380.1"
                     /db_xref="GeneID:2889143"
     CDS             259776..261089
                     /locus_tag="CAGL0I02970g"
                     /note="highly similar to uniprot|P32462 Saccharomyces
                     cerevisiae YNL280c ERG24 C-14 sterol reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447380.1"
                     /db_xref="GeneID:2889143"
                     /db_xref="GOA:Q6FQW4"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW4"
                     /translation="MLNPKTKHFEFNGVVGAVAISVGLPIFTVFLNQMVRPEYYIEGW
                     FSNFNLDKVFSGLHSLDYYFVDRWDLWVYYLTWYFVLAFLDVVLPGRVMEGVELRDGT
                     KLKYKINGVALSTFMVVVVAMRWQLTQGRVPELQFLYKNHVDICVIAILFSALLATYC
                     YIASFVPLLINSPNGVGTNEKILALGGNSGNPIYDWFIGRELNPRIGPLDLKMFSELR
                     PGMLLWLLINLSCLHHHYLRTGTFNDALVLVNLLQGFYIFDGVLNEEGVLTMMDITTD
                     GFGFMLAFGDLALVPFTYSLQARYLSVSPIELGLPRVIFIVGVMALGFYIFRSANKQK
                     SDFRQGNLPHLKSIQTKRGTKLLADGWWAKSQHINYFGDWLISLSWCLTTWFQTPLTY
                     YYSLYFATLLLHRQQRDEHKCREKYGENWAEYEKQVPYKIIPYVY"
     gene            complement(<261524..>261949)
                     /locus_tag="CAGL0I02992g"
                     /db_xref="GeneID:2889141"
     mRNA            complement(<261524..>261949)
                     /locus_tag="CAGL0I02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447381.1"
                     /db_xref="GeneID:2889141"
     CDS             complement(261524..261949)
                     /locus_tag="CAGL0I02992g"
                     /inference="similar to AA sequence:UniProtKB:P53834"
                     /note="similar to uniprot|P53834 Saccharomyces cerevisiae
                     YNL281w HCH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447381.1"
                     /db_xref="GeneID:2889141"
                     /db_xref="GOA:Q6FQW3"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW3"
                     /translation="MAVLNPNNWHWIDKNTLPWSKEYFNQKFDELCVAVPEEKVVKVS
                     SVVVKGDSNVSQRKGKPICYYDLHLTMDVLLDEDNVGSVEIPEFMHDDMDFEIKMNCS
                     DAEIRDQLNKVFIPKLMELMGQYQKDLLEEHSRDLQMSN"
     gene            complement(<262249..>262731)
                     /locus_tag="CAGL0I03014g"
                     /db_xref="GeneID:2889142"
     mRNA            complement(<262249..>262731)
                     /locus_tag="CAGL0I03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447382.1"
                     /db_xref="GeneID:2889142"
     CDS             complement(262249..262731)
                     /locus_tag="CAGL0I03014g"
                     /note="weakly similar to uniprot|P53833 Saccharomyces
                     cerevisiae YNL282w POP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447382.1"
                     /db_xref="GeneID:2889142"
                     /db_xref="InterPro:IPR013241"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW2"
                     /translation="MMKRGGRVIPVLEDPYSNEKWPYCTPEQLELLDTYMDKSVLRAL
                     KNSKPGEETGVVFDIAEILRVLQSESADVYVLALWNDSMLMRQLRLLVAVKNVPLIPI
                     NKKINNKLLEHVGDSYADVLLLKKTASLDQSLANLLDSIEQPPTPFLEPVRYHPTTIS
                     "
     gene            <262992..>263828
                     /locus_tag="CAGL0I03036g"
                     /db_xref="GeneID:2889162"
     mRNA            <262992..>263828
                     /locus_tag="CAGL0I03036g"
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /transcript_id="XM_447383.1"
                     /db_xref="GeneID:2889162"
     CDS             262992..263828
                     /locus_tag="CAGL0I03036g"
                     /inference="similar to AA sequence:UniProtKB:P36520"
                     /note="similar to uniprot|P36520 Saccharomyces cerevisiae
                     YNL284c MRPL10"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /protein_id="XP_447383.1"
                     /db_xref="GeneID:2889162"
                     /db_xref="GOA:Q6FQW1"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:Q6FQW1"
                     /translation="MMLRFLGSLRNGFVTSRRYVSIMGQLHPAEGAKQSYKRLGRGPS
                     SGKGKTSGRGQKGQKARGKVKSWFEGGQTPIYKLFPKIGFTNVNARPLKVLNLQRIQE
                     FYDAGRLKLGEGEVLDMKKMKDVGLVTGPIRDGIKILAKGQFVYNLPYKVEASRASSK
                     AVKAIESAGGSFVARYFSRMGLRAHLVPNWFLEKRGRLPLPARPVKRKDIDYYSKEEN
                     RGYLVVENDPYLKMIQESKAQGRNKIRSAKTKKSALDIQLEALQENFIPPSSKSKTVG
                     LK"
     gene            complement(264175..264246)
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0I03058r"
                     /db_xref="GeneID:2889163"
     tRNA            complement(264175..264246)
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0I03058r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2889163"
     gene            complement(<264525..>265322)
                     /locus_tag="CAGL0I03080g"
                     /db_xref="GeneID:2889164"
     mRNA            complement(<264525..>265322)
                     /locus_tag="CAGL0I03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447384.1"
                     /db_xref="GeneID:2889164"
     CDS             complement(264525..265322)
                     /locus_tag="CAGL0I03080g"
                     /note="highly similar to uniprot|P03962 Saccharomyces
                     cerevisiae YEL021w URA3 orotidine-5 -phosphate
                     decarboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447384.1"
                     /db_xref="GeneID:2889164"
                     /db_xref="GOA:P33283"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /translation="MSSASYLQRAEAHPSPVASKLLKLMHEKKTNLCASLDVTTTSEL
                     LKLVDTLGPYICLLKTHVDILSDFSFENTVKPLKEMAAKHNFLIFEDRKFADIGNTVK
                     LQYTSGVYKIAEWADITNAHGVTGQGIVTGLKQGAEETTNEPRGLLMLAELSSKGSLA
                     HGEYTKGTVDIAKSDKDFVIGFIAQKDMGGRDEGFDWLIMTPGVGLDDKGDALGQQYR
                     TVDEVFSTGTDIIIVGRGLFAKGRDPKTEGERYRKAGWDAYLKRIGN"
     gene            complement(<265853..>270217)
                     /locus_tag="CAGL0I03102g"
                     /db_xref="GeneID:2889165"
     mRNA            complement(<265853..>270217)
                     /locus_tag="CAGL0I03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447385.1"
                     /db_xref="GeneID:2889165"
     CDS             complement(265853..270217)
                     /locus_tag="CAGL0I03102g"
                     /inference="similar to AA sequence:UniProtKB:P39993"
                     /note="similar to uniprot|P39993 Saccharomyces cerevisiae
                     YEL022w GEA2 or uniprot|P47102 Saccharomyces cerevisiae
                     YJR031c GEA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447385.1"
                     /db_xref="GeneID:2889165"
                     /db_xref="GOA:Q6FQV9"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV9"
                     /translation="MGGYEAAGMDAVTIVIKECISLSTTMRKFSKLTSQSGVVALLAG
                     NSEIFNDDKNIHKFSKHKQANKPNDPYLSGFIQLRLMLNKLNSLDEVDSLTVLQPFLI
                     LLTASSVSGYITSLALDSLQKFFTMNIINENSKNYKVAYRELIEALTHCRFESSSQIS
                     DDAVLFKVLLLTCNVINSPYGDVITDSLMYDVLQTILTLACNNRRSDVLRKAAEENII
                     SITYKLFSKIKNFKKSDISGIYVNDEAYANNALNGDSFGITSPSADDLSVLSTVDSPA
                     PANIDSKLEGTKDNETNDNDSSIFTKTEEISIQNADNLGTQDEEKENPNESFNSIESK
                     TNVEVQNENNRIINESEEEPYGLPVARQYLSLLLSLILPDQKIKHTTTTRIFALKLIN
                     VATEVTGDKLPLHPRLFNLVSDPIFKSVLFIIQSTDKLSLLQAALQLFTTFVVILGQR
                     LQPQIELTLKRIFAILSDDDGKSQKKTGNNTEKTKFKSPAVKELLVEQIAILWSRSPL
                     YFTSTFIDFDCNLDRTDLSIKFLKVLAKLSLPESAISTTPSVPPICLEGLISFVDDLY
                     DQLRSLDRNKYLEVSNDIPDLLKQRELKTEFIRCAEAFNKKPKNGVPMLIEKNFIRSD
                     KDRDIAEFLFENNSRLNKKTLGLYLCDPKKTGLLQEFIDFFDFKGLRVDEAIRVLLTK
                     FRLPGESQQIERIVEAFSKKYVADQNYNPEKLTVDEEEEDMESIQPDSDSVFVLSYSI
                     IMLNTDLHNPQVKEHMSFEDYSGNLKGCNNSKDFPFWYLDRIYCSIRDKEIVMPEEHH
                     GNERWFEDAWNNLISSTTVVTEVDHNSTSTTDNLTLLELEKFNKAICVELGELLVNTF
                     FKIFIIATDDHISTKMLGSIEKFAYISYFFEMKDLYNDIMHKIAVRTSLLKNPSDEMA
                     TSEQANEDLIPLVEIKIDDEEQQSIVVSNASVRIGRSFKAQLACMTLFRLFQMNEDPT
                     LLQDRIWSDIADILTALYQNLLISPDIFPDLQNRLVLSNLPRRNPDLTISRTTENRGF
                     LSTFASYLKGDEEPTEEDIEAAVKAQECVKNCGIPSSLFGNEKNITPILMRKLLGSVD
                     LEKNSENSSYFESQILFMSELVVGLFLFSKDDKETGEYIVKTLFEFSELADLSKRCVR
                     RLMTYKVLLLSILEVDPKYLDKIFSEDFLKNEVAFGEKYLHSKHGKVLIKSLLTVSEI
                     EHYRRHITNLENFWTFLRKLSVNKDYVSDIYLYADQLLKSSKHVITEKNFMWVLGLLD
                     EISSFGSVGSKWEKEYSTLVATGHKVEKENPFQELVEVSLRSINLTAHLMDQSNFPDF
                     YTNEVIIAIVQALAHQCTNPCEQLRSYAVSSLQDSLIERIQIPSDQVQSLEQILEQGI
                     LPILLPEGQNANSQHMKEVFPMITKVYFHYLKKGSTTNDTFLKVLNMFNSCVEDPEIE
                     NQLQQFIIMKKEIEAEST"
     gene            270965..271073
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0I03124r"
                     /db_xref="GeneID:2889166"
     tRNA            join(270965..271001,271037..271073)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0I03124r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2889166"
     gene            <271461..>273329
                     /locus_tag="CAGL0I03168g"
                     /db_xref="GeneID:2889167"
     mRNA            <271461..>273329
                     /locus_tag="CAGL0I03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447386.1"
                     /db_xref="GeneID:2889167"
     CDS             271461..273329
                     /locus_tag="CAGL0I03168g"
                     /inference="similar to AA sequence:UniProtKB:P39992"
                     /note="similar to uniprot|P39992 Saccharomyces cerevisiae
                     YEL023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447386.1"
                     /db_xref="GeneID:2889167"
                     /db_xref="GOA:Q6FQV8"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV8"
                     /translation="MSAANYHFQDSISHDIKKGKNIILCIDGTCENFGPHPFTNVLKL
                     YKLLENSDPSKQICYYQPGIGIAADCDPVTDFRRRFTLSSFRNMLDSMFAFNIGSHVQ
                     AAYSFLIKYYETGDRIYMFGFSRGAFIARVLAGMIEKVGLLSKGQDNLVQMAWKVYIK
                     WEYEKQPIQPNYTTTLVQEFKKTFCRNEVIKITFQGLFDSVNSVGIFRDKLFPCTQKC
                     QIVEHVRHCLSLDERRGKFKQFCIEPTLLLPKKTILSYRHYICPSQEHTPEFHNANHS
                     KLSITTKGVKLNQNKIQSNTSFVNIEGTFKYEPIEALCDSAYTSIPDLIEMWFPGDHA
                     DVGGGWALDGETMESSSNISLRWMISEAIKFGVSFNPTALKNYSDQATSVGSLFADTH
                     DYLKLHVTRHDIKLDFKKNRVDINGFDLAPLANIRAILKAGYEKKLYNAIARNDLIIK
                     AKYGARCGRLKQFLVFVWWLLEFIPVSLKLDKPDGSSREICFPNLGRSRHVPEYALLH
                     WSVFWKLRFSKNYRPTNLPKYVKNLLSEMEGLVFNKSNYRDNSAGDISKMPYIFNTNC
                     NNGREAILRQSSNLSISSTLINETLHDRVSQETREMLLKWVEEKWQHVPDDLEGYL"
     gene            complement(<273981..>274622)
                     /locus_tag="CAGL0I03190g"
                     /db_xref="GeneID:2889168"
     mRNA            complement(<273981..>274622)
                     /locus_tag="CAGL0I03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447387.1"
                     /db_xref="GeneID:2889168"
     CDS             complement(273981..274622)
                     /locus_tag="CAGL0I03190g"
                     /note="highly similar to uniprot|P08067 Saccharomyces
                     cerevisiae YEL024w RIP1 Ubiquinol-cytochrome C reductase
                     iron-sulfur protein precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447387.1"
                     /db_xref="GeneID:2889168"
                     /db_xref="GOA:Q6FQV7"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV7"
                     /translation="MSMLLRSSIKNGCRLNAARMFSTSLVANKSTYRTPNFDDVLRDD
                     QNSDKSRSYAYFMVGSLGLLSSVGAKSTVETFVSSMSASADVLAMAKVEVNLAAIPEG
                     KNVVVKWQGKPVFIRHRTAHEIDEANAVDMSVLKDPQTDADRVKDPKWLVMLGICTHL
                     GCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEVPAYEFDGEKLVVG"
     gene            <275826..>278717
                     /locus_tag="CAGL0I03212g"
                     /db_xref="GeneID:2889169"
     mRNA            <275826..>278717
                     /locus_tag="CAGL0I03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447388.1"
                     /db_xref="GeneID:2889169"
     CDS             275826..278717
                     /locus_tag="CAGL0I03212g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447388.1"
                     /db_xref="GeneID:2889169"
                     /db_xref="GOA:Q6FQV6"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV6"
                     /translation="MSYKIKFYALHGNVGVVTWNNSLYTLEDGFDLQEKVSSEVINVI
                     AINRESVYAFIDYHHAFEIHNPDQMYVSDIPVKNTVHASNLCFFSTAGTLGLLNFDNG
                     HIITEQLHSFSNMLIVDFMVEYKREFYEITLLTKSFTYNSYCLVRAKLIKENDNWGFL
                     VSDITALFSLQSMLTCNINRRLHCMTIVNEESSIFFYHNGKLKQFSTNFTFFKNDFDG
                     YRIHCSMLNKNLFELSIYSLVNCSTLETKIDLQKPESQTILNFKQVSATTEPVTDMAF
                     LNTRDIFLISINDQLLLINTRNKSKKVLSCSKKIGNSVVLDMMVQNEDQGIALITVGI
                     DMSTRSGYFQKLMHSTSHYRIKASKTIHFDNDNAIEALWITQAFGLVTFSKKYLQYSN
                     SETRLNNRPYMITPNNYIVENTIDLISAKVIPTSEGKEICLIHRFGNRIDILEINSEG
                     SLINMKSFNDQTIEDRALIFGLKDDYIYYYLDFEIKALSICDDTLDTEILCLTNAPIV
                     DGIMLKMANADAIVVSDAVGNLSIIDLETKKLEHIIQSKDNGPLQFLPLNIKTGKLIA
                     YNEECTLIIDLGTKVFEWIDCRFRTTKLVVQEHNNGYKLFYLRDKNTVDTFILEPMKN
                     HLLEICNFTVDQSRYYQCQFIPQSIISLPTTEPQHFAMSYVENEDAIITIFDSKIRNH
                     IGSLRIKVSDRANFVTKLFSLNSMDPEIENFERKKYKDLMLVQIVDIESIKIYLLELL
                     KKKIIKNHGFIILNSPINQISIRPNEIDLILDSHCINVVKILKNEKGEYTLKPKSTLD
                     VAKKQKKQFTVIKENNDLPLISPKVFILSDNILYEKNGNNCLVFDEVFISHGWSKELY
                     HIDTDKCINKEYAKIEFDVILGFNKQSETVTLLTGSTDKYQLLEISAGSNVIQVAPID
                     IKESRVVAADCSHCLFLVNCACNRLFVLDIWKDFHSHEFKYQLKRVNKN"
     gene            complement(<278940..>279320)
                     /locus_tag="CAGL0I03234g"
                     /db_xref="GeneID:2889170"
     mRNA            complement(<278940..>279320)
                     /locus_tag="CAGL0I03234g"
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /transcript_id="XM_447389.1"
                     /db_xref="GeneID:2889170"
     CDS             complement(278940..279320)
                     /locus_tag="CAGL0I03234g"
                     /note="highly similar to uniprot|P39990 Saccharomyces
                     cerevisiae YEL026w SNU13"
                     /codon_start=1
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /protein_id="XP_447389.1"
                     /db_xref="GeneID:2889170"
                     /db_xref="GOA:Q6FQV5"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /translation="MSAPNPKAFPLADEKLSQQILDVVQQAANLRQLKKGANEATKTL
                     NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
                     TTNDASAIKNQIYAVKDKIETLLI"
     gene            complement(<279779..>280867)
                     /locus_tag="CAGL0I03256g"
                     /db_xref="GeneID:2889171"
     mRNA            complement(<279779..>280867)
                     /locus_tag="CAGL0I03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447390.1"
                     /db_xref="GeneID:2889171"
     CDS             complement(279779..280867)
                     /locus_tag="CAGL0I03256g"
                     /inference="similar to AA sequence:UniProtKB:P47110"
                     /note="similar to uniprot|P47110 Saccharomyces cerevisiae
                     YJR043c POL32 polymerase-associated gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447390.1"
                     /db_xref="GeneID:2889171"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV4"
                     /translation="MDEEVKEFINDRLFHQAKPVLFTDLISKFGIGPDVAKGSMFHYY
                     KTVSDNAKFHCVVVCCLKDNRIFIVQDLAKIGQLEEDVIDCFIYAFSPTSEVIPYNEV
                     YKQSEQTLTIKNSYELVHTETNGSSVTKAPVDKPIKRENGQAKKEQTPPAAPQKPKKD
                     MGLRSTALLARMRKEREDKEQERQAELKRRREENAKRELDRDPKKAKQMDELSKMFDN
                     DDDDDLMDIDDDENDNNAIKMEEHQDNRPATAPTTASHINESKMEDILDTTAEESLLE
                     IKKDQKDSAPEMSSQVEQTDEPVKKEQEPETYVDEDGYIVTRRADPKEKKATPPVKKT
                     TPAVRAKTDPTPKPKRKQGTIESFFKRK"
     gene            complement(281221..281292)
                     /locus_tag="CAGL0I03278r"
                     /db_xref="GeneID:2889172"
     tRNA            complement(281221..281292)
                     /locus_tag="CAGL0I03278r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT)"
                     /db_xref="GeneID:2889172"
     gene            <281913..>282899
                     /locus_tag="CAGL0I03300g"
                     /db_xref="GeneID:2889053"
     mRNA            <281913..>282899
                     /locus_tag="CAGL0I03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447391.1"
                     /db_xref="GeneID:2889053"
     CDS             281913..282899
                     /locus_tag="CAGL0I03300g"
                     /inference="similar to AA sequence:UniProtKB:P39988"
                     /note="similar to uniprot|P39988 Saccharomyces cerevisiae
                     YEL029c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447391.1"
                     /db_xref="GeneID:2889053"
                     /db_xref="GOA:Q6FQV3"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV3"
                     /translation="MDKVRSVLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFS
                     NHTGYGMDKVFGSATSENDLDEILKGLMKNFPAGYDALLSGYLPNAMSVRRVGENYSR
                     YKKENPGTIWLLDPVMGDEGELYVNEDVVPEYKKLALSEDNLVDIITPNQFEMEILYG
                     QPINSQEELLTALRELHKYIPVIVVTSCNSKLFNDDDSIYCVASMRDSSAYAFRIPLI
                     KSYFTGVGDLFSALLLDRVYKLLDNEDSTTNLTLKDQINSVLNVIQNVLKVTKHMAPK
                     NINSKMGSSIDMKEMELRIIASRDLYDGNAYFDGSIHYEKSDIDYSFLTLRP"
     gene            complement(<283299..>285239)
                     /locus_tag="CAGL0I03322g"
                     /db_xref="GeneID:2889054"
     mRNA            complement(<283299..>285239)
                     /locus_tag="CAGL0I03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447392.1"
                     /db_xref="GeneID:2889054"
     CDS             complement(283299..285239)
                     /locus_tag="CAGL0I03322g"
                     /note="highly similar to uniprot|P12398 Saccharomyces
                     cerevisiae YJR045c SSC1 or uniprot|P39987 Saccharomyces
                     cerevisiae YEL030w ECM10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447392.1"
                     /db_xref="GeneID:2889054"
                     /db_xref="GOA:Q6FQV2"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV2"
                     /translation="MLSARNVMGKSMNRVATRLQSTKVQGQVIGIDLGTTNSAVAVME
                     GKVPKIIENAEGARTTPSVVAFTKEGERLVGIPAKRQAVVNPENTLFATKRLIGRRFE
                     DAEVQRDIKQVPYKIIKHSNGDAWVEARGQSYSPAQVGGFVLNKMKETAEAYLGKPAK
                     NAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKADAKVVAVFDL
                     GGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIVLLREIVSRFKAESGIDLENDRM
                     AVQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTEPLIKR
                     TIEPVKKALKDANLSTSDVSDVLLVGGMSRMPKVVETVKQLFGKEPSKAVNPDEAVAI
                     GAAIQGAVLSGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTAAA
                     GQTSVEIRVFQGERELVKDNKLIGNFNLSGIPPAPKGVPQIEVTFDIDADGIINVSAR
                     DKATNKDAAITVAGSSGLSDAEIEQMVNDAEKFKSQDEARRQAIETANKADQLANDTE
                     NSLKEFEGKLDKAEAQKVQDQINSLREIITKVQSGEEVSAEDLKTKTEELQTSSMKLF
                     EQMYKNDSGNTNAQQGEGENKQ"
     gene            complement(<285637..>287448)
                     /locus_tag="CAGL0I03344g"
                     /db_xref="GeneID:2889055"
     mRNA            complement(<285637..>287448)
                     /locus_tag="CAGL0I03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447393.1"
                     /db_xref="GeneID:2889055"
     CDS             complement(285637..287448)
                     /locus_tag="CAGL0I03344g"
                     /inference="similar to AA sequence:UniProtKB:P32770"
                     /note="similar to uniprot|P32770 Saccharomyces cerevisiae
                     YDL167c ARP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447393.1"
                     /db_xref="GeneID:2889055"
                     /db_xref="GOA:Q6FQV1"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV1"
                     /translation="MHYVVLDVQIDSSAVKPVLLRLGYQVIDPVSLEARNEPYVVDVD
                     GESIKEFIAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVS
                     SANDLGVELPEYLRYPVFFDIWKEYSIWKKNHSDSSESPQTQANGESIDSFAGKIEEL
                     VRTLDVSTEYDELKQKNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDY
                     KNFIEEQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHG
                     KMLSIPDSMFGFAIFQSHNDAEYALNLHGTVMKIVAPKGNKHIEQLLDIQPSSMRLLE
                     KVQDNLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGKLPMT
                     SVTNNMVSGYTNYNTRNLNNKSNWNNIGQDGYQYNQQQQLRQLQQMQQTYQMYAANRA
                     SNNGGKSPIQSSYRSNYNGGQSGNSSYNMPLHNYNRFNQGTSAHLPYNLTHSTSSNGY
                     ISEGNNHGHGGMSTNSGMIGGSNVPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKTKTT
                     TRDKNNQDGDTLQQEQLNQTINALAQLDRKEVSVSEN"
     gene            complement(<287811..>288449)
                     /locus_tag="CAGL0I03366g"
                     /db_xref="GeneID:2889056"
     mRNA            complement(<287811..>288449)
                     /locus_tag="CAGL0I03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447394.1"
                     /db_xref="GeneID:2889056"
     CDS             complement(287811..288449)
                     /locus_tag="CAGL0I03366g"
                     /note="highly similar to uniprot|Q12055 Saccharomyces
                     cerevisiae YDL166c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447394.1"
                     /db_xref="GeneID:2889056"
                     /db_xref="GOA:Q6FQV0"
                     /db_xref="InterPro:IPR020618"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQV0"
                     /translation="MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAE
                     EHKCYDGYDEGRKSHIVDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRS
                     ENGKLYDRLKARGYHDSKIEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENN
                     VDRINTWVDNWVEEHKDGVSSELKDGKKYASYSSEEEEETSDGEDEEASASD"
     gene            <288784..>289359
                     /locus_tag="CAGL0I03388g"
                     /db_xref="GeneID:2889174"
     mRNA            <288784..>289359
                     /locus_tag="CAGL0I03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447395.1"
                     /db_xref="GeneID:2889174"
     CDS             288784..289359
                     /locus_tag="CAGL0I03388g"
                     /note="highly similar to uniprot|P06100 Saccharomyces
                     cerevisiae YDL165w CDC36 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447395.1"
                     /db_xref="GeneID:2889174"
                     /db_xref="GOA:Q6FQU9"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU9"
                     /translation="MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIP
                     RDSKHHRVLDTFQSPWAETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQ
                     RVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAAD
                     GLSERGSYVFFDPQRWEKCQRDFPLFYSAIM"
     gene            complement(<289606..>291780)
                     /locus_tag="CAGL0I03410g"
                     /db_xref="GeneID:2889175"
     mRNA            complement(<289606..>291780)
                     /locus_tag="CAGL0I03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447396.1"
                     /db_xref="GeneID:2889175"
     CDS             complement(289606..291780)
                     /locus_tag="CAGL0I03410g"
                     /note="highly similar to uniprot|P04819 Saccharomyces
                     cerevisiae YDL164c CDC9 DNA ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447396.1"
                     /db_xref="GeneID:2889175"
                     /db_xref="GOA:Q6FQU8"
                     /db_xref="InterPro:IPR000977"
                     /db_xref="InterPro:IPR012308"
                     /db_xref="InterPro:IPR012309"
                     /db_xref="InterPro:IPR012310"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR016059"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU8"
                     /translation="MFSRLAPPIRFISARIIKEPTRPLIVMKRQATLARFFSSVKKDA
                     DGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGSLTATKNGNQGKEEHEGTP
                     IASTPRQVDSKFFCKVPYSDLCNLFEEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIP
                     VTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQQIKNQYREIGDLGQIALEA
                     RNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLIKRMLTACQGTEAKFLIR
                     SLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEPSMDVVEQAEQKIRDAFCQVPNYE
                     LVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQGQTFTSEYKYDGE
                     RAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTTSLILDCEAVAWDKEQN
                     KILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPLSKRREVLHEVTKP
                     VEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYEPSKRSRNWLKL
                     KKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCCKIGTGFSEE
                     MLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGSSV
                     YDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN"
     gene            complement(<292162..>292611)
                     /locus_tag="CAGL0I03432g"
                     /db_xref="GeneID:2889176"
     mRNA            complement(<292162..>292611)
                     /locus_tag="CAGL0I03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447397.1"
                     /db_xref="GeneID:2889176"
     CDS             complement(292162..292611)
                     /locus_tag="CAGL0I03432g"
                     /note="some similarities with KLLA0C16709g Kluyveromyces
                     lactis and DEHA0G05016g Debaryomyces hansenii and
                     CA5994|IPF677 Candida albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447397.1"
                     /db_xref="GeneID:2889176"
                     /db_xref="GOA:Q6FQU7"
                     /db_xref="InterPro:IPR018552"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU7"
                     /translation="MEGDPSESQRWLGSIKLVGCSVCFACWCSLLWIFLAGWKFDHWN
                     CNYWNCDHWKCEIWKCEIWTIPIMDVPQDTIARVLQVAAFKDKKTRIESDVVDALQRY
                     IDVFAREAVLRSIEHHDASQEGLEQEQDKEITHTDLENIAGLLLLDM"
     gene            <292823..>293734
                     /locus_tag="CAGL0I03454g"
                     /db_xref="GeneID:2889177"
     mRNA            <292823..>293734
                     /locus_tag="CAGL0I03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447398.1"
                     /db_xref="GeneID:2889177"
     CDS             292823..293734
                     /locus_tag="CAGL0I03454g"
                     /inference="similar to AA sequence:UniProtKB:Q04491"
                     /note="similar to uniprot|Q04491 Saccharomyces cerevisiae
                     YLR208w SEC13 protein transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447398.1"
                     /db_xref="GeneID:2889177"
                     /db_xref="GOA:Q6FQU6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MVKIENAHEGVIHHAALNYYGTRLATCSSDKTVKIFEINDVNNS
                     SSLLETLVGHEGPVWYADWCHPSLGENLLATCGYDGKVLIWKESGHGGKMQIIGKHAV
                     HSASVNCVKWAPHEYGLILLCGSADGKISVVELKDGQIASTKILDNAHKFGVNSISWA
                     PLMKTDSSDDGDETTAVKQFISGGNDNLVKIWKFDDDQETYVVADTLEGHKDAVTAVD
                     WSPTTLLQSYVASVSNDKQCLVWTQDHSSKKNDWKKISVNEGKFEQKLGSVSWSLSGN
                     LLAVSDDDKNVTIWKESGDGKWEEVVN"
     gene            complement(<294849..>296372)
                     /locus_tag="CAGL0I03476g"
                     /db_xref="GeneID:2889178"
     mRNA            complement(<294849..>296372)
                     /locus_tag="CAGL0I03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447399.1"
                     /db_xref="GeneID:2889178"
     CDS             complement(294849..296372)
                     /locus_tag="CAGL0I03476g"
                     /note="highly similar to uniprot|P39517 Saccharomyces
                     cerevisiae YDL160c DHH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447399.1"
                     /db_xref="GeneID:2889178"
                     /db_xref="GOA:Q6FQU5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSEDNSWKTQLNLPKKDTRPQTDDVLNTKGNSFEDFYLKRELLM
                     GIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEKIKPKLNKIQA
                     LIMVPTRELALQTSQVIRTLGRHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGRV
                     LDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQVLTFLPKAHQSLLFSATFPLTV
                     KEFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCN
                     STNRVELLAKKITDLGYSCYYSHARMKQQDRNKVFHDFRQGKVRTLVCSDLLTRGIDI
                     QAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIA
                     AIPATIDKSLYVAEDDTAVPVPVPIEDPHIVHQRRMQEQQQQQQQQQGQQGQQQGYPG
                     QQAFIPPQQGQPQFMPVPQQYMQMNQQQGMPPNQQQPPAMGYPPQQLPTGYVAQQRY"
     gene            <297344..>298699
                     /locus_tag="CAGL0I03498g"
                     /db_xref="GeneID:2889179"
     mRNA            <297344..>298699
                     /locus_tag="CAGL0I03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447400.1"
                     /db_xref="GeneID:2889179"
     CDS             297344..298699
                     /locus_tag="CAGL0I03498g"
                     /inference="similar to AA sequence:UniProtKB:P06784"
                     /note="similar to uniprot|P06784 Saccharomyces cerevisiae
                     YDL159w STE7 ser/thr/tyr protein kinase of MAP kinase
                     kinase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447400.1"
                     /db_xref="GeneID:2889179"
                     /db_xref="GOA:Q6FQU4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU4"
                     /translation="MFKVKTLERRNLKQLSLGGGCLGGSAHAGSEELRHECNGNKLIV
                     EDMALAVGSDEHIEPHSGSGSASASSMSGLSIHDHAGDAAKPATLAVDGHSGCNYDLR
                     DLVQLGKLGSGNSGTVMKVLHVPSSRVIAKKTIVIEQNNAIVKQQIYRELTIMRSVAE
                     HRNIVEFYGAHNLSSDSINGSNDVVILMEYMNCGSLDTITRTYKSLQRRGILAANRSY
                     PVQEWFSKPVIISRIAYSVLNGLSYLYENYKIIHRDIKPSNVLINSKGRIKLCDFGVS
                     RKLNNSIADTFVGTSTYMSPERIQGNKYTTKGDVWSLGLMLIELLTGEFPLGGHNDTP
                     DGILDLLQRIVNEPAPKLPSSVIKVLPPDMVNFIDLCCVKVEKDRGSLQELLKHPFIV
                     RFRTKESTDAFKLWTKDIRRWMQEERNYKKETSEHSMLLKKQHNTNDTRHSRHMTSSL
                     K"
     gene            complement(<299170..>299490)
                     /locus_tag="CAGL0I03520g"
                     /db_xref="GeneID:2889180"
     mRNA            complement(<299170..>299490)
                     /locus_tag="CAGL0I03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447401.1"
                     /db_xref="GeneID:2889180"
     CDS             complement(299170..299490)
                     /locus_tag="CAGL0I03520g"
                     /inference="similar to AA sequence:UniProtKB:Q12082"
                     /note="similar to uniprot|Q12082 Saccharomyces cerevisiae
                     YDL157c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447401.1"
                     /db_xref="GeneID:2889180"
                     /db_xref="GOA:Q6FQU3"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU3"
                     /translation="MSNILSVFNPPPSRELDEEETRDCVPCQVMSTVFGIGFGSYLVS
                     GRAFKYSEAEKKKGISLEEFNKRNPMWWRRSLKGLGSIFIIMGLARGTEGWLWNKEKE
                     YKKF"
     gene            <299881..>301485
                     /locus_tag="CAGL0I03542g"
                     /db_xref="GeneID:2889181"
     mRNA            <299881..>301485
                     /locus_tag="CAGL0I03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447402.1"
                     /db_xref="GeneID:2889181"
     CDS             299881..301485
                     /locus_tag="CAGL0I03542g"
                     /inference="similar to AA sequence:UniProtKB:Q12510"
                     /note="similar to uniprot|Q12510 Saccharomyces cerevisiae
                     YDL156w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447402.1"
                     /db_xref="GeneID:2889181"
                     /db_xref="GOA:Q6FQU2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /translation="MVAELTEFQKKRLENIKRNNDLLKKLQLQGTANKIKREAGVDTV
                     SRHEERLKKKKKIVNAKKQSEKEASPKTAMPTRRSRRLMGQQVKNEEGIPNVSDTQLL
                     KMNRNKELEDLKDIKETAVIGDVKLSDLIKTEEGSNEDELLAKFKQFANKNFSSGDFF
                     DIIKKRQKETENDSDLTKMQEDFDLHMYDVFQPNEIKITNERITSMFFHPSTDKKLIV
                     GGDTSGTVGLWNVRDEPLAENGEDDLVEPDITKVKFFTKNVGKIECFPTDTSTLLITS
                     YDGSIRTLGLKDLKSADIMTLRNSYEEPLGISDCQFSYDNSQVLFLTTLGGEFTQLDL
                     RAKPTETKFWRLSDKKIGSMAINPQRPYEIATGSLDRTLRIWDVRKTVETPEWSQYED
                     YHSHEIVSTFDSRLSVSAVSYSPTDGTLVCNGYDDTIRLFDVNGELPEDLDEKNKTVL
                     KHNCQSGRWTSILKARFKPDQNVFAIANMGRAIDIYNSSGQQLAHLTTATVPAVLGWH
                     PLKNWIAGGNSSGKVFLFTDELNTSK"
     gene            <302137..>303537
                     /locus_tag="CAGL0I03564g"
                     /db_xref="GeneID:2889182"
     mRNA            <302137..>303537
                     /locus_tag="CAGL0I03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447403.1"
                     /db_xref="GeneID:2889182"
     CDS             302137..303537
                     /locus_tag="CAGL0I03564g"
                     /inference="similar to AA sequence:UniProtKB:P24870"
                     /note="similar to uniprot|P24870 Saccharomyces cerevisiae
                     YDL155w CLB3 cyclin or uniprot|P24871 Saccharomyces
                     cerevisiae YLR210w CLB4 cyclin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447403.1"
                     /db_xref="GeneID:2889182"
                     /db_xref="GOA:Q6FQU1"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU1"
                     /translation="MQTGNEENAVPSWYSVPGKEVHSDKAHEHRVALSDVTGLANSNF
                     MHEKLHSNRCSGEPSSTARNSLEINLNHAVESDQENMVSIYASNTLDTPNSNDVSSLL
                     EDQQLESIRRVTQHMSNTSNGDDSDSTTVANKDSHQGDNSNNTSDDALRNEYSEPPVN
                     DDIRRTLMKAYQTYKLAYLDDSDEDNYDPVMVVELASGIFDYMKQLEIKYRPDPYYMD
                     LQSELKPSYRSTLLDWIVQVDERFQLLPETLFLTINIIDRFLSKAAIKLNKFQLVGAV
                     SMFIAAKYEEINCPTMKDFLYMLDNAYTKEEMIDAERFILNTLDFSIGWPGPMSFLRR
                     ISKADDYDYNIRTLAKYLLETTIMDARLIGTPPSWLASGAYFLSKTILSYGNEERDAE
                     ERSVYETGWTLKHVFYSGYTQEQVFPLSSLILENCRHAQERHSAIWTKYSDRRYHRSS
                     VMVDKWIEVAESKMNS"
     gene            <303943..>306546
                     /locus_tag="CAGL0I03586g"
                     /db_xref="GeneID:2889183"
     mRNA            <303943..>306546
                     /locus_tag="CAGL0I03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447404.1"
                     /db_xref="GeneID:2889183"
     CDS             303943..306546
                     /locus_tag="CAGL0I03586g"
                     /inference="similar to AA sequence:UniProtKB:Q12175"
                     /note="similar to uniprot|Q12175 Saccharomyces cerevisiae
                     YDL154w MSH5 meiosis-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447404.1"
                     /db_xref="GeneID:2889183"
                     /db_xref="GOA:Q6FQU0"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQU0"
                     /translation="MSSSTSWLQTLLPKEEESNSISQIDSSEEIWALDNETIICFDIQ
                     GNKIGCVVFNFEYAQLSIMPSDLDIQNNEYMIILGERNSKKHSLELLLNRILRQFDVT
                     HVLISSRFNNEMYHTILSYCTDVGLKFKTASTRYFKSNEDIIAKLQDSGERSFKAWLL
                     EADKYSNITVRALIGLFWWDAEVNQGRKQMNTGLEIPKFEKLSFINLDGMVYVDYLTL
                     SALRILQPLVKPYANIENCNAAFSLVELFTNVKSKIGKKLLKNWLKLPINEMDELVER
                     IQTTELILYPENYSCFIEIIHILNNLPDVKNSFTKLDEDIFASSAWSGIFNFLRHSVT
                     IISRIRRIDKKIESQLITKLQNTEIASLVDTIDYLNSVINYNKLFTDKEVEIVENINF
                     EYDQFKKVYTRLEAMLKTIVDDIIEELLSDSKNRLDHLNLAEGLNALYIPQLGFLVTI
                     ENTRVHYWGEVWGSLNWQLVFKDNSHHYYKNSMVTSLDDEFGDLMTKIFELKLEILAN
                     VRENLVKHRSLLIDISEIFGRLEVLISFAILANERNYCKPILKKDKSVVKITQGRHPL
                     LETLSDNFIPNDIILDGGMLKDINWFSSGRQRIAVVTGANASGKTIFLEQIALIVYMA
                     HIGCYVPADTAEIGLVDMILTKFKSFDSISTSMSSFERDSKQLSKIMSLATKRSIIFI
                     DEYGKGTDTISGPSLLAAIIQRYSQLPGAPRLLISTHFYEIFQKSSLLKHRGSIKFLT
                     TKIVLNNCEVENLVTENEGIVFFYQIVEGICDSSLGIYCAKICGIKKEIINMAELVHK
                     QFSLGQKLDLSQFEVTDTEMEIFLKCQTIIKRFISWDLNTEYITEDLLRSKLNSILSC
                     STKEVMQINSE"
     gene            complement(<306677..>308464)
                     /locus_tag="CAGL0I03608g"
                     /db_xref="GeneID:2889144"
     mRNA            complement(<306677..>308464)
                     /locus_tag="CAGL0I03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447405.1"
                     /db_xref="GeneID:2889144"
     CDS             complement(306677..308464)
                     /locus_tag="CAGL0I03608g"
                     /inference="similar to AA sequence:UniProtKB:Q12136"
                     /note="similar to uniprot|Q12136 Saccharomyces cerevisiae
                     YDL153c SAS10 involved in silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447405.1"
                     /db_xref="GeneID:2889144"
                     /db_xref="GOA:Q6FQT9"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT9"
                     /translation="MAKKSRASQREARDDDYGLNEVDDFAEKREKVLLGDSQYYRDDS
                     DEERLLEDNEEEEVMAMTDGDESDEDMDGAEAYKKVFGRKLEHDMPEVEDDDETMLNN
                     ENAWGSKNEYYGADDLDDEETAKEIEKEALRQQKKHLSELHMNDYFDDVIEEEWSKDA
                     KNFDMKEFKASTKQSASEISAKSILKMDDAEKKQYLNTLFPEFLPLSKELKKLTAQYE
                     DISKNQESEVKKLQAIALSSYLSTLSSYFAIFLHELNSNEDFSTMKDHPVMEAILTSK
                     EVWRQASELPELDGKDNTDGEISDEEQNDRITDINNSDTNNLDSEAEGSEEEIEEDQE
                     ESEVDIDDFEAYVQQSRISRKSSKKSKESSNNSEADSSSEDDENMDYIEDKIADIDAQ
                     DKKRRKKTLRFYTSKIDQQEKKTNERYTGDDDVPYKERLFERQQRLLEEARKRGLEAP
                     KSADLDNEDYESNEESISNQVNDKSSAEYYEQILKGKKNRKEGRMKAHIEARIAARDG
                     KLNEIAEEVGENGKRAINYQILKNKGLTPKRKKDNRNSRVKKRKKYAAAQKKLKSVRA
                     VYSGGQSGAYEGEKTGIKKNLTKSVKFKN"
     gene            <308811..>310094
                     /locus_tag="CAGL0I03630g"
                     /db_xref="GeneID:2889145"
     mRNA            <308811..>310094
                     /locus_tag="CAGL0I03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447406.1"
                     /db_xref="GeneID:2889145"
     CDS             308811..310094
                     /locus_tag="CAGL0I03630g"
                     /inference="similar to AA sequence:UniProtKB:P25441"
                     /note="similar to uniprot|P25441 Saccharomyces cerevisiae
                     YDL150w RPC53 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447406.1"
                     /db_xref="GeneID:2889145"
                     /db_xref="GOA:Q6FQT8"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT8"
                     /translation="MSGRLPSLKDSGASKPLKFKPKAVARRTKEEREASVPKLKPDEV
                     EVDKNRRKRAPPTANKKRVPKYLNNTHVISSGPMAAGTYSSNSGSMNRGFGSPIIKTD
                     EETSSLIQKSLESLENGNGDDEDEDMEGQRTRARKLNMGKELSYKQYILHEKEIEDDD
                     NEDDVDLTTAEGEATEELETRRIEQLFPVRPLRVRHEDTETLHKTIQETYSEIATREA
                     TPAPQSVTQIKEDPEHANSLQDVLVKKENELQNKLEELYIENGVDGQSRELNLEKIQI
                     QNDYIKILKNIEKINDKPNKFMVFQLPPKLPEFKVKPSKREANNEQAPTSIDDKSNTD
                     DKPGKKAKQQEPEPELNGKIGSLRIHKSGKLTIKIGDVVMDISRGAETTFIQDIVKIN
                     EHEDTNQDKDPEEQLPPSIECLGTVTGRAVVQPSI"
     gene            <310647..>313433
                     /locus_tag="CAGL0I03652g"
                     /db_xref="GeneID:2889146"
     mRNA            <310647..>313433
                     /locus_tag="CAGL0I03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447407.1"
                     /db_xref="GeneID:2889146"
     CDS             310647..313433
                     /locus_tag="CAGL0I03652g"
                     /inference="similar to AA sequence:UniProtKB:Q12142"
                     /note="similar to uniprot|Q12142 Saccharomyces cerevisiae
                     YDL149w APG9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447407.1"
                     /db_xref="GeneID:2889146"
                     /db_xref="GOA:Q6FQT7"
                     /db_xref="InterPro:IPR007241"
                     /translation="MEQSGHEPGKNTFLSRVFGLQSDDVSTSIHTQELSTIPLDEDES
                     NHGALVESEDDEDHNDGVRLLESDPGTSTQDSLESDTSEEDERINGINSDSQVIDTSR
                     PLLSKKETMELHPFGSQNGRIMESSIKLGQPSSDEEDLINVNESLQPDLENRINPIYH
                     EDKLDKALGNSSKNIRTSTFLDRVLKPNDVKKNSTKKRQNSHNYNPTSTYTNSSSNTF
                     LNTVKGEKSSKKYKLKRPNILNALSVVNNMPERRLNTLSPKERALWKWANVDNLDLFL
                     QDAYNYYLGNGFHCIILQKVLNILTLLFVVFVSSFMGYCVDYSKLPTSTRFSEIKIDH
                     CYSQNITGFTKFLLFLFYGFVILKVIQLYFDINNIREMKLFYHYLLNISDDELQTIPW
                     QNIIQQLMYLKDQNALTANVVAVKAKNKLNAHGIANRIMRKENYLIALYNNDILDLRF
                     PIPFFGSQPLTKTLEWNINLCVMGYVFNEAGFIKQGFLKATQKEYFANELRKRFMLAG
                     FLNIILSPFLVSYFVLLYFFRYFNEYKTSPENIGARQYTPMAEWKFREYNELYHIFRK
                     RIGLSNPLASKYVDQFPKEKTNILLKFVSFISGSFVAILAILALWDPENFLNFEVTHD
                     KTVLFYITVLGAIWSISQGSVSTEYHVFDPEETLRELAEYTHYLPDSWKDRYHTEGVK
                     QEFCELYNLRITVLLRELASLITTPFILWFSLPNSAGKMVDFFRESSVYVDGLGYVCK
                     YAVYDGDADAVKKHFGTDGNETTEQDAATEEQDIDSEPDEATKKMMQSYMYFLDDYEN
                     DDNLLGKYQIPKKRRESFDNTQYDVSNSNQKNQDDDSDMILANRYTWRKQFKPGQKPE
                     LFRIGNHVLNDKTFTQQGSNHLGIDESYARSQISNTAEESNRSSLYNSKYKSPTKGVL
                     GLVKEYYKKSDVGR"
     gene            <313907..>315244
                     /locus_tag="CAGL0I03674g"
                     /db_xref="GeneID:2889147"
     mRNA            <313907..>315244
                     /locus_tag="CAGL0I03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447408.1"
                     /db_xref="GeneID:2889147"
     CDS             313907..315244
                     /locus_tag="CAGL0I03674g"
                     /note="highly similar to uniprot|Q12250 Saccharomyces
                     cerevisiae YDL147w RPN5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447408.1"
                     /db_xref="GeneID:2889147"
                     /db_xref="GOA:Q6FQT6"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT6"
                     /translation="MSRDAPIKAEKDYTSVLKEEFPIIDKLAKSDANAALDKLLVLEK
                     KTRQAADLTSSKDVLAKIVDVLVEKDNWDELDEQLTLLSKKHGQLKLSIQYMVQKIMQ
                     ALDENKKIPLKTRIKTIETIRTVTENKIFVEVERARVTRELTNIRKEEGDIAKAADIL
                     CELQVETYGSMDMFEKIQFILEQMELSILKGDYSQATVFSRKILKKTFKNEKYESLKL
                     QYYELLIKIGLHKNDYLEVAQYFQEIYETKSVKEDEEKWKPALSRMVYFLILAPYGNL
                     QNDLIHKIQLDNNLKKLEQQESLVRLFTTKEFMKWPVVKKTYEPVLIQDTVAFGGKDN
                     KHHWDELKDRVVEHNLRVISEYYTRITLARLNELLDLTESETETFISNLVNQGVIYAK
                     VNRPAKIVNFEKPLNSCELLNEWSDNVNQLLENIETIGHLITKEEIMHGLKAK"
     gene            <315821..>317254
                     /locus_tag="CAGL0I03696g"
                     /db_xref="GeneID:2889148"
     mRNA            <315821..>317254
                     /locus_tag="CAGL0I03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447409.1"
                     /db_xref="GeneID:2889148"
     CDS             315821..317254
                     /locus_tag="CAGL0I03696g"
                     /inference="similar to AA sequence:UniProtKB:Q12342"
                     /note="similar to uniprot|Q12342 Saccharomyces cerevisiae
                     YDL146w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447409.1"
                     /db_xref="GeneID:2889148"
                     /db_xref="GOA:Q6FQT5"
                     /db_xref="InterPro:IPR018556"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT5"
                     /translation="MVHIDGEDTSKPVKSRDEKIKFWAALESTVHDEGSSSDTNRVNS
                     NLVKFLKMATDNYNEFIVTEQDLFRMCLTIAESELFTKNTKFCISKLLSLLNIDLLEM
                     NMKFIIVYILLYECKRNVNSLVTMLEFQGFNVFYNTLYTAFAYIQKYGTDRGIAEHEI
                     TNSQLEEWSDVDHIILDEMKKISTVLMEILFIIFKYGKCSVANVQLVDDFFTYFLINS
                     IRSDVTDDLFNNAQFKLALALNEQYIVFSKKFEMENKIFKYLLNSSVSKRFVELLLLK
                     FNRLMDSSLQVMMCKVIYLIVTSTDNDVAMNYFYLNDLNVLIDVLIRELQNMNGREEY
                     WRATILRVLLPLLKNTELCRTHYRKDDLVELLTYLSKPENICDNGVITQEQEVTIRLA
                     KKCLNGVEWLENDTSDDDAISSNSLESSQSSVESLSNSLANHSTNNRPRLTRGSLELS
                     AESLTMRKERAKGPPPPPPPPRSRKKC"
     gene            complement(<317565..>321170)
                     /locus_tag="CAGL0I03718g"
                     /db_xref="GeneID:2889149"
     mRNA            complement(<317565..>321170)
                     /locus_tag="CAGL0I03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447410.1"
                     /db_xref="GeneID:2889149"
     CDS             complement(317565..321170)
                     /locus_tag="CAGL0I03718g"
                     /note="highly similar to uniprot|P53622 Saccharomyces
                     cerevisiae YDL145c RET1 Coatomer alpha subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447410.1"
                     /db_xref="GeneID:2889149"
                     /db_xref="GOA:Q6FQT4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT4"
                     /translation="MKLLTKFESKSTRAKGIAFHPSRPWALVALFSSTIQLWDYRMGT
                     LLHRFEGHEGPVRAVDFHPTQPIFVSAGDDASIKVWSLETNRCLYTLTGHLDYVRTVF
                     FHSELPWVISASDDQTVRIWNWQNRKELACLTGHNHFVMCAQFHQTEDLVVSASLDET
                     VRVWDISGLRKKHSAPGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFH
                     PTLPLIVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNVDCVVFHPDQNLILSVAEDKT
                     LRIWDLDKRTPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRERPAATTYQ
                     NQLFFVNKEKQLQSFDYGKKVTSLPYVTLTKLGQAWNSFHSISYNPSQHSVLINEGTD
                     KFGLVVLPKQPTGAVEPTSVIEDSGSCATFVARNRFAVYNKSSQSIEVRTLDNKITKT
                     IHVEDPVNDMLYAAPGTVLLLHPKEVVLFDVQQGKKVAQMHVKNVKYVSWSQDGQYLA
                     MMSKHTITIVNKRLELINSMHETIRIKSAAWDESNVLVYTTLNHIRYSLLNGDHGIIK
                     TLEKTLYIHKVQGKYVYALNRDGEMEVLNIDPTEYRFKKALVNKNFPEVLRIIRNSNL
                     VGQNIISYLQKSGYPEIALQFVQDPQARFDLAIEYGNLDVASEEAKKLNNDATWNILS
                     KEALAQGNIALTEMIYQTQNAFDKLSFLYTITGDQNKLAKMENIAQNHGATSSILMNS
                     FYSNSIDSRAKVFQTAGSLPLAFAVAKANGNDELAAYYLEEAGLDEQDVVLPDGITPS
                     NSVKTPAITEPLTSWPLKEAELSYFEKAVLGQIEEYDADEPSSDKETTTAAGHEEEAF
                     FDDEEIIGDEEDAWDLGDDDLQIGNDEVEAEANDVDASQDEDTETAQWVKNSKLASVL
                     VASGAFEAAAQALHKQVGVVDFEPLRSYFIDIYEGSRTYMTGTPEELPPIVGHIRSNA
                     DTDIPEEALPKVPGMDIVSAKINEGFKLFKANKLEEAIETFREVIYRVLFLTLEDDDE
                     EELAHKALETAKEYILGLSIELERRSLAPEDVKRNLELAAYFTRSKLVPAHRCNALQV
                     AMSQNFKNKNYVQASYFASEFLKLMSSGPRADQARKIKDKADSLAHDAVEINFDPYAE
                     FDICAATHTPIYKDAAVVEDPLTGAKYHANHKGDIDSIAKISKIGAPSSGLRIRL"
     gene            complement(<321853..>322914)
                     /locus_tag="CAGL0I03740g"
                     /db_xref="GeneID:2889150"
     mRNA            complement(<321853..>322914)
                     /locus_tag="CAGL0I03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447411.1"
                     /db_xref="GeneID:2889150"
     CDS             complement(321853..322914)
                     /locus_tag="CAGL0I03740g"
                     /inference="similar to AA sequence:UniProtKB:Q07589"
                     /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
                     YDL144c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447411.1"
                     /db_xref="GeneID:2889150"
                     /db_xref="GOA:Q6FQT3"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT3"
                     /translation="MSVNVVVVGAGGVGVVSALSLFHAGKSEVSLVVRSDYSAVVERG
                     YRIDSCDYGQLDGWRPHHVYKDVHEAAASGTFFDYVVVTTKNIPDGPNSSTMPVLVEP
                     FLLGNAKVDPERLTSVLLIQNGIDIEKHLVSTLKPEDYNNYVVLSGVEIVGTTKVGKA
                     QIKHIGQDHLSVGAFDPSNPAAVESAKRFTKIYDAGDKNFVEFDERVRYSRWKKLLYN
                     AAINTTTAIVGLDVPRTLAYGHDDSTRNALFLPAMRDIVNIAASEGIVIEEKFIDFFL
                     NISAKHMFTPSMCVDVQKGQLMELEVILGNPLRVAEANGVEAPTLTFLYNLLSIIQGK
                     LKEQNGLVEFDETTCSIKK"
     gene            <323419..>325008
                     /locus_tag="CAGL0I03762g"
                     /db_xref="GeneID:2889151"
     mRNA            <323419..>325008
                     /locus_tag="CAGL0I03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447412.1"
                     /db_xref="GeneID:2889151"
     CDS             323419..325008
                     /locus_tag="CAGL0I03762g"
                     /note="highly similar to uniprot|P39078 Saccharomyces
                     cerevisiae YDL143w CCT4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447412.1"
                     /db_xref="GeneID:2889151"
                     /db_xref="GOA:Q6FQT2"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /translation="MVAQKSVSNATFKNKEKPQEVRRANIVAARAVADAIRTSLGPKG
                     MDKMIKTSRGEIIISNDGHTILKQMAILHPVAKMLVDVSAAQDSEAGDGTTSVVILTG
                     ALLGAADRLLNKGIHPTIIAESFQKAARRSVETLLEICHPVSLDDREDLIRAASTSLS
                     SKIVSQYSSFLSPLAVDAVLSITEKDSKTVDLNDIRLVKKVGGTIGDTEMVDGVVLTQ
                     TVVKTAGGPTMKEKAKIGLIQFQISPPKPDTENNIVVSDYRQMDKILKEERAYLLNIC
                     KKIKKAKCNVLLIQKSILRDAVNDLALHFLAKLGIMVIKDIEREEIEFLSKSLGCKPI
                     SDVELFTEDRLGSADLVEEIDSDGTKIVKFSGVKGVNAKPTVSVIIRGANSMILDETE
                     RSLHDALCVIRCLVKERGLIAGGGAPEIEISRRLERESRSMEGVEAYIWQEFAQALEV
                     IPTTLAENAGLNSIKVITELRSRHENGDVNEGISVRRSGTTNTYEEHILQPVLVSTSA
                     ITLASECVKSILRIDDITFSR"
     gene            complement(<325276..>326088)
                     /locus_tag="CAGL0I03784g"
                     /db_xref="GeneID:2889256"
     mRNA            complement(<325276..>326088)
                     /locus_tag="CAGL0I03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447413.1"
                     /db_xref="GeneID:2889256"
     CDS             complement(325276..326088)
                     /locus_tag="CAGL0I03784g"
                     /inference="similar to AA sequence:UniProtKB:Q07560"
                     /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
                     YDL142c PGS1 cardiolipin synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447413.1"
                     /db_xref="GeneID:2889256"
                     /db_xref="GOA:Q6FQT1"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT1"
                     /translation="MSIPMLPAILSKNVGLRSIRCVRGGYLRVVLGASIGMRPYSDLK
                     VNKKDFLTIPNVITITRIATTPMIGYFLLNNQLVPALSLFAYSSITDFLDGYIARRYN
                     MKSDAGTILDPMADKLLMIITTAALALPPGPQVIPIGIASLILGRDILMGFSAIFIRY
                     ASLKQKYHFVTWKSFWDFFKYPSAVVKPLTISKWNTFLQMIYLGLAVFIMILDQYDTK
                     VQEANEQKDTTLDINTLKTGFSWLGYIVGATTVISGTSYVFSKSAVTFIKKI"
     gene            <326663..>328735
                     /locus_tag="CAGL0I03806g"
                     /db_xref="GeneID:2889255"
     mRNA            <326663..>328735
                     /locus_tag="CAGL0I03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447414.1"
                     /db_xref="GeneID:2889255"
     CDS             326663..328735
                     /locus_tag="CAGL0I03806g"
                     /inference="similar to AA sequence:UniProtKB:P48445"
                     /note="similar to uniprot|P48445 Saccharomyces cerevisiae
                     YDL141w BPL1 biotin holocarboxylase synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447414.1"
                     /db_xref="GeneID:2889255"
                     /db_xref="GOA:Q6FQT0"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FQT0"
                     /translation="MNVLVYEGRGTTPGSVRHVVDSLRMFLEPYYAVSTVTSKTLEQE
                     PWMGKAAVLVFPGGRDLPYVADCKRIIPKIRNFVQNYGGTYIGFCAGGYFGSSRVEFA
                     KGDPNLEVVGNRDLKFYPGITRGPVFGSFEYNSEQGAKAVKLELEDGSEFYTYYNGGS
                     CFVDANKYENVKVLAHYGDKPSIPFTDDPASTAKKAAAVVLCKIGKGQALLTGPHPEF
                     SPKILERSEDEKLQKEIIGILKENEEARLRFMKHILAQAGLKVNDFPNSGRPSHLTPM
                     LLGVNSNSNSGLVQEFTRNIENNINDFIVSDGHTQIECESDTFMIYNGYDNFFDAAKL
                     LTEYEDIEKSPKAILFPDDNGTIPPREFSGDFDFDVYYKHLNPNNTLGSLLLYGEIVT
                     STSTILNNNKKILQCIPDNSMLHVGSIQLSGRGRGNNVWVNPRGVCASTAVLNLPTTS
                     PRTGNPLSVVFIQYLAMLAYCKAIRSYAPGYEDLPVRIKWPNDLYAVDPKYYYNNNLK
                     FLSSGFSNRQIPLSDIEPAYVKISGLLVNTNFINGQYSLLVGCGLNVYSDAPTTSLKM
                     WIDILNKEREIARLDPLPPIQVEKLLALYMNNLQVILANFIDHGAKVVLPEYYRLWLH
                     TDQIVTLSDHNNVRAIVKGITQDYGMLIAHELVSGSDTQTTGNVYHLQPDGNSFDIFR
                     GLIAKKAT"
     gene            complement(<328922..>334069)
                     /locus_tag="CAGL0I03828g"
                     /db_xref="GeneID:2889258"
     mRNA            complement(<328922..>334069)
                     /locus_tag="CAGL0I03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447415.1"
                     /db_xref="GeneID:2889258"
     CDS             complement(328922..334069)
                     /locus_tag="CAGL0I03828g"
                     /note="highly similar to uniprot|P04050 Saccharomyces
                     cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447415.1"
                     /db_xref="GeneID:2889258"
                     /db_xref="GOA:Q6FQS9"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS9"
                     /translation="MVGQQYSSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDET
                     QTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKV
                     CESLCMHCGKLLLDEHNEQMRQAIQIKDPKKRFNAVWSLCKTKMVCETDVPSEDDPTK
                     LISRGGCGNTQPTIRKDGLKLVGSWKKDKSTGDADEPEQRVLSTEEILNIFKHISPED
                     SYRLGFNEEFARPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISL
                     ETLEHNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLV
                     RNGPNEHPGAKYVIRDNGDRIDLRYSKRSGDVQLQYGWKVERHIMDDDPVLFNRQPSL
                     HKMSMMAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGVIPTPAII
                     KPKPLWSGKQILSVAIPKGIHLQRFDEGTTLLSPKDNGMLVIDGEIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQTMREISET
                     IAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAEMNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSNSLEPSLLE
                     SGSEIIGDLKVQMALDEEYKQLVKDRRFLRTIFSDGESSWPLPVNIRRIIQNAQQTFR
                     IDHTKPSDLTIPEIINSVRDLQDRLLVLRSKSEIIKKAQDDAVTLFCCLLRSRLATRR
                     VLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSV
                     TVASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAAMND
                     KDLTMGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKK
                     IENTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVP
                     GVDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ
                     GGLTSVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPI
                     GTGAFDVMIDEESLVKYMPEQKITELEDGQDGGATPYSNEAGLVNTDIDVKDELMFSP
                     LVDAGSSDAMSGGFTAYGGAEYGGATSPFGAYGDAPASPGFGGVSSPGFSPTSPAYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS
                     YSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPGSPTYSPKDEDEKKDN"
     gene            complement(<335328..>335936)
                     /locus_tag="CAGL0I03850g"
                     /db_xref="GeneID:2889259"
     mRNA            complement(<335328..>335936)
                     /locus_tag="CAGL0I03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447416.1"
                     /db_xref="GeneID:2889259"
     CDS             complement(335328..335936)
                     /locus_tag="CAGL0I03850g"
                     /note="some similarities with uniprot|Q12334 Saccharomyces
                     cerevisiae YDL139c SCM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447416.1"
                     /db_xref="GeneID:2889259"
                     /db_xref="GOA:Q6FQS8"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS8"
                     /translation="MSNSKIKIKKNKKNGKSLKQLHKALSGLLQKDNKPQKKDVSIDK
                     KHSKRENSCERGSKDDPYKEVKKKNGRAYIYSKENQLIPKLTDEEVMEKHKLADQRMK
                     TVWSNIIDKYSNVVDEGDVIDLQSGEIITDNGHIRNLNTGFTSSRGKETRYTSVVKDI
                     LLDENVPAHDSYDEYSIWEDNNAEEEEAVFTDPEEPLTSESE"
     gene            <337985..>340273
                     /locus_tag="CAGL0I03872g"
                     /db_xref="GeneID:2889257"
     mRNA            <337985..>340273
                     /locus_tag="CAGL0I03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447417.1"
                     /db_xref="GeneID:2889257"
     CDS             337985..340273
                     /locus_tag="CAGL0I03872g"
                     /note="some similarities with uniprot|Q12300 Saccharomyces
                     cerevisiae YDL138w RGT2 or uniprot|P10870 Saccharomyces
                     cerevisiae YDL194w SNF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447417.1"
                     /db_xref="GeneID:2889257"
                     /db_xref="GOA:Q6FQS7"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS7"
                     /translation="MDSSFEILPYRGDDQIPRVDSGGLRRRASQTINTNHDDTCVDID
                     AYNSGIDVSSKNEYLGINTADDDNEYGNGGMQNYEGPVNEQAIHCQTNDISENENNLQ
                     LLGQPLPLRSTMMTTFVGLFVAVGGFLYGYDTGLINSITDMKYVKEHIAPNHSFFTTT
                     QISMLVSFLSLGTFVGALIAPWISDIYGRKSTIIFSTMIIFSIGNSLQVAAGGLALLI
                     VGRVISGIGIGIISAVVPLYQAEAAQKHMRGAIITTYQLAITLGLLVSSAVSQGTESI
                     NAPSSYRVPIGLQYVWSVVLGVGMVFLPESPRYYIMKDEIEEAARSLSFLRGISLEDP
                     RLLEELVEIKANYDYESSFGPVSIWDCFRSSEQRPKQVLRMFTGISIQAFQQFSGINF
                     IFYYGVYFFNKTGIKSSYLVSFVTYAVNVAFNIPGMFLIDYLGRRKVLIFGGIAMTAC
                     NFIIAIVGVSAKSIVSNNVMIAFICVFIAAFSSTWGGVVWVISAELFPLGVRSKCTAI
                     CAAANWLVNFVCALMTPYIVDTGSNYTSSMGTKIYFIWGSLNALGTIVAYLTVYETRG
                     LTLEEINELYVNSPTPFASNEWNRKIRTESTIPPMVHDHELDNHIVPTMDNILHSRNP
                     NQPYSSDENQDVIVGEDKLDLEQGYNKEIHNHRDDNNVSPIPFLQEQNGKEFSNGADF
                     SPSTHSTFALTEHIPANYVELGNGFGLNTYRGGPPSISDSSDDDHCTHWQSPENGSPI
                     YHEILSSNDTNSGTYNKNSENL"
     gene            <340957..>341934
                     /locus_tag="CAGL0I03894g"
                     /db_xref="GeneID:2889261"
     mRNA            <340957..>341934
                     /locus_tag="CAGL0I03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447418.1"
                     /db_xref="GeneID:2889261"
     CDS             340957..341934
                     /locus_tag="CAGL0I03894g"
                     /note="some similarities with uniprot|Q12063 Saccharomyces
                     cerevisiae YDL193w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447418.1"
                     /db_xref="GeneID:2889261"
                     /db_xref="GOA:Q6FQS6"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS6"
                     /translation="MTKESTLAQIQEISTMVSEHTNDGKLRLKSSIPKPLEASEVEYI
                     AKKASWDRKMGKLEYIFYKSLLVILFTIYGVFRFFQYRYNRLRLSILTIVNNPANTPQ
                     LIKQDVKGLKKLPKQLGAILEDKPSYTVGGGLKGLLEEGSEIVCWSVCADIKHVSLYD
                     YNGLLATNVDEFRKAVHHKLAKYYGPQNIPSFTVKVPHLHKVYEDISKVGDEEKKSVI
                     EISLLSAFDGRKTIVELFKTVSDLKDKKEIQSSDLTMELLNTQLIELVGQEPDLILCF
                     GPRLDLTGYPPWHIRLAEMHWEMDNNEVLYAVFIRGLRNYSSAKMNVGK"
     gene            <343014..>343559
                     /locus_tag="CAGL0I03916g"
                     /db_xref="GeneID:2889260"
     mRNA            <343014..>343559
                     /locus_tag="CAGL0I03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447419.1"
                     /db_xref="GeneID:2889260"
     CDS             343014..343559
                     /locus_tag="CAGL0I03916g"
                     /note="highly similar to uniprot|P11076 Saccharomyces
                     cerevisiae YDL192w ARF1 or uniprot|P19146 Saccharomyces
                     cerevisiae YDL137w ARF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447419.1"
                     /db_xref="GeneID:2889260"
                     /db_xref="GOA:Q6FQS5"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS5"
                     /translation="MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCA
                     TTGEGLYEGLEWLSNNLNNKE"
     gene            complement(<344321..>345427)
                     /locus_tag="CAGL0I03938g"
                     /db_xref="GeneID:2889092"
     mRNA            complement(<344321..>345427)
                     /locus_tag="CAGL0I03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447420.1"
                     /db_xref="GeneID:2889092"
     CDS             complement(344321..345427)
                     /locus_tag="CAGL0I03938g"
                     /note="highly similar to uniprot|P23594 Saccharomyces
                     cerevisiae YDL134c PPH21 protein ser/thr phosphatase or
                     uniprot|P23595 Saccharomyces cerevisiae YDL188c PPH22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447420.1"
                     /db_xref="GeneID:2889092"
                     /db_xref="GOA:Q6FQS4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS4"
                     /translation="MDMDMDVPMHDAVDQLTPTEGNAEAANDSIGDEVDEAFKDAHPS
                     QGAVLDSGKGGNKGFELNSSNINQLDQWIEHLGKCEILSEDDVSKLCKMAVEVLQFEE
                     NVQPINVPVTICGDVHGQFHDLIELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLV
                     AMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALV
                     DNKIFCLHGGLSPMIETVDQVRELNRIQEVPHEGPMCDLLWSDPDDRGGWGISPRGAG
                     FTFGQDISEQFNHTNDLSLVARAHQLVMEGYAWSHQQNVVTIFSAPNYCYRCGNQAAI
                     MEVDENHNRQFLQYDPSVRPGEPTVSRKTPDYFL"
     gene            <346238..>349339
                     /locus_tag="CAGL0I03960g"
                     /db_xref="GeneID:2889093"
     mRNA            <346238..>349339
                     /locus_tag="CAGL0I03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447421.1"
                     /db_xref="GeneID:2889093"
     CDS             346238..349339
                     /locus_tag="CAGL0I03960g"
                     /inference="similar to AA sequence:UniProtKB:P17255"
                     /note="similar to uniprot|P17255 Saccharomyces cerevisiae
                     YDL185w TFP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447421.1"
                     /db_xref="GeneID:2889093"
                     /db_xref="GOA:Q6FQS3"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR006141"
                     /db_xref="InterPro:IPR007868"
                     /db_xref="InterPro:IPR007869"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027434"
                     /db_xref="InterPro:IPR028992"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS3"
                     /translation="MAGAMENARKELKRLSLDDEAGESQYGAIYSVSGPVIVAENMIG
                     CAMYELVKVGHDNLVGEVIRIDGDKATIQVYEETAGVTVGDPVLRTGKPLSVELGPGL
                     METIYDGIQRPLKAIKESSQSIYIPRGIDTPALSRDIKWQFTPGTFKTGDHISGGDIF
                     GTVFENSLVESHKILLPPRARGTITWIAPAGEYTVDEKILEVEFDGNKYDYTMFHTWP
                     VRVPRPVAEKLSADYPLLTGQRVLDSLFPCVQGGTTCIPGAFGCGKTVISQSLSKYSN
                     SDTIIYVGCFAKGTQVLMADGSNQSIENIKIGDKVMGQDGKPRNVTALPRGYDDMYNV
                     ELDGETDLSYTCNSNHTLVLKTEQNVLLAGNTVSYFALGALIDETNGRAVEIVQEVQE
                     TFESNISASDFAANINREPISWTLEIRDIDYLSERVRMFTKQSVNPVLLETPTLAKQL
                     ESNESTATNLAYLLGTWIASKATTAGTISVPTTKADLLSKVKSALSSLSIDYSSESIN
                     SVSTYRRTQSIPLMENGKHVGNANITAEQEIEETMEVLSLNVTNHSSKLFHDLALSMI
                     NQDGSRSIPSAFTHEQLCVRESFVAGILDMQGCNIENGVEIDSSINGLAKLSRSLGLR
                     CNKSSNLLKLSGNMSNISAQSTNNWTSTEDNSSAYKAQLMDFSVQKLPKDNYYGVTLD
                     DDSDHQFLLSNLVLVHNCGERGNEMAEVLMEFPELYTEMSGRKEPIMKRTTLVANTSN
                     MPVAAREASIYTGITLAEYFRDQGKNVSMIADSSSRWAEALREISGRLGEMPADQGFP
                     AYLGAKLASFYERAGKSVTLGSPNRVGSVSIVAAVSPAGGDFSDPVTTATLGITQVFW
                     GLDKKLAQRKHFPSINTSVSYSKYTNVLNKFYDSNYPEFPTLRDRMKEILSNAEELEQ
                     VVQLVGKSALSDSDKITLDVAALIKEDFLQQNGYSTYDAFCPIWKTFDMMRSFIAYHD
                     EAQKAVSNGANWTKLSEAVSDVKHSVSSSKFFEPSRGEQEVHEEFEKLLSNMQERFAE
                     STD"
     gene            complement(<351694..>352557)
                     /locus_tag="CAGL0I04004g"
                     /db_xref="GeneID:2889095"
     mRNA            complement(<351694..>352557)
                     /locus_tag="CAGL0I04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447423.1"
                     /db_xref="GeneID:2889095"
     CDS             complement(351694..352557)
                     /locus_tag="CAGL0I04004g"
                     /note="some similarities with uniprot|P48569 Saccharomyces
                     cerevisiae YDL183c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447423.1"
                     /db_xref="GeneID:2889095"
                     /db_xref="GOA:Q6FQS1"
                     /db_xref="InterPro:IPR018786"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS1"
                     /translation="MLRSVRSRVQIRLYHQHFESRTLQQYLKDPIKLLVLPVKEKDVF
                     VYYKHGDDLVNRQSRIIRSEKWIIDKSLKLWSKLENSSKSYNKKIVLYITKLLDTVPW
                     SEDSLISVPNESSLLKRLKDDGDRITLKEYQQSSELTKSHLLPLHIYYPIDGPSIPTS
                     QLIKSLRELSENGLAYHKKHMIYCALGLPLTIPLVLLPVVPNVPGFYLMYRLYCNLKA
                     FLGARHLQKIVNEEASDIFFYSVPTVMSEGDNGLTEEKLPIVLDQLEVQEIENKLKKA
                     IRQSHGSVKED"
     gene            complement(<353515..>353946)
                     /locus_tag="CAGL0I04026g"
                     /db_xref="GeneID:2889096"
     mRNA            complement(<353515..>353946)
                     /locus_tag="CAGL0I04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447424.1"
                     /db_xref="GeneID:2889096"
     CDS             complement(353515..353946)
                     /locus_tag="CAGL0I04026g"
                     /note="some similarities with uniprot|Q07362 Saccharomyces
                     cerevisiae YDL053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447424.1"
                     /db_xref="GeneID:2889096"
                     /db_xref="GOA:Q6FQS0"
                     /db_xref="UniProtKB/TrEMBL:Q6FQS0"
                     /translation="MSTPAPVQKPKLTGWAQAASRAIPKQSLLKNQQQTVIVKAPTPT
                     QKSHQERRSGNESSASTSPTSSVSGQPKKQRPYNRDEVREYMQSLFKEQSRNAKTYKQ
                     VLKETQLGDLTETSDWGTVTNKNTRNKKYGTLAEIARVLRN"
     gene            <355215..>356225
                     /locus_tag="CAGL0I04048g"
                     /db_xref="GeneID:2889097"
     mRNA            <355215..>356225
                     /locus_tag="CAGL0I04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447425.1"
                     /db_xref="GeneID:2889097"
     CDS             355215..356225
                     /locus_tag="CAGL0I04048g"
                     /note="highly similar to uniprot|P09201 Saccharomyces
                     cerevisiae YLR377c FBP1 fructose-1 6-bisphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447425.1"
                     /db_xref="GeneID:2889097"
                     /db_xref="GOA:Q6FQR9"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR9"
                     /translation="MGSHEGIDTDVISLPRFIIEYQKRVHNATGEFTLVLNALQFAFK
                     FIAHAIRRAELIHLGGLFGTSNATGDEQKKLDVIGDEIFINTMESSNCVKILVSEEQE
                     DMIVFEHNTGNYAVCCDPIDGSSNLDAGVSVGTIVSLFKLQPGSTGKVEDVLRPGTEM
                     VAACYAMYGASTHLVLTMGDGVNGFTLDTNLGEFILTEPDMRVPMYRQIYSINEGNTY
                     YWNDNIKSFINFLKEPQDDGKPFSARYVGSMVSDMHRTFLYGGIYAYPEDKKNPKGKL
                     RLLYEAFPMAFLMEQAGGKAVTDRGERILDLTPTHIHDKSSIWVGSPGEIDKFLKHIG
                     KA"
     gene            complement(<356476..>357390)
                     /locus_tag="CAGL0I04070g"
                     /db_xref="GeneID:2889098"
     mRNA            complement(<356476..>357390)
                     /locus_tag="CAGL0I04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447426.1"
                     /db_xref="GeneID:2889098"
     CDS             complement(356476..357390)
                     /locus_tag="CAGL0I04070g"
                     /inference="similar to AA sequence:UniProtKB:P33333"
                     /note="similar to uniprot|P33333 Saccharomyces cerevisiae
                     YDL052c SLC1 fatty acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447426.1"
                     /db_xref="GeneID:2889098"
                     /db_xref="GOA:Q6FQR8"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR8"
                     /translation="MGFFSIALYYLRTVSWVLILMVAAAYGTVASVFLTLIGKQHLAQ
                     WATARFYYYAMSMLMGIDVKIINEDVLKGKPFIAVSNHQSTLDILFLGRIFPQGCTVT
                     AKKSLKYVPFLGWFMALSGTYFLDRSNREKSVSTLNRGLQNIREKKRALWIFPEGTRS
                     YSTTPKILPFKKGAFHLAQQGQIPIVPVVISNTSTIMCSKYNVFNRGCITCKVLDPIP
                     TKDLKKEEVGELAEKVRNMMEKEIMDLGYSKAINDTNLPPEAIEYMQKNNKKPSSVES
                     TTEYGSIKKDEATVMVSSGSNSHLEQLS"
     gene            <358219..>359889
                     /locus_tag="CAGL0I04092g"
                     /db_xref="GeneID:2889099"
     mRNA            <358219..>359889
                     /locus_tag="CAGL0I04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447427.1"
                     /db_xref="GeneID:2889099"
     CDS             358219..359889
                     /locus_tag="CAGL0I04092g"
                     /note="weakly similar to uniprot|P53075 Saccharomyces
                     cerevisiae YGL228w SHE10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447427.1"
                     /db_xref="GeneID:2889099"
                     /db_xref="GOA:Q6FQR7"
                     /translation="MRFLTKFLLFLATVYFGLKYACESPLRAQYPQLQLACHYSQPAL
                     WNDYLLKNSPAYKNSVHPQLVVAKGKYEELVQPHVKDVCKRVHTQLDRIDKKKYCDLA
                     HSYANLAYQKAQFYYSISAGKYVHDFCKSDLYNKNLKRHVERAKEDLSKAYHLAVVRI
                     PQLFTRENVEKFTSSASAYINEKTESLKKEAKQITSDVKKTVESEIKKRTTSSESEEE
                     PIVSTSTIVKTITRTRHSSSSTTSTKSAEETSEKNLETKEEEDITDIEIDHQAQLQRD
                     FDKWTSNIDKKVKMVNKMLVRDVKKHLKPKIDANDKLFKDKLKVLHKEANDNFQLINK
                     AIQDINCTQGIDPETGKQIYFDSEGKSQIEKYITREMIRTMLNDTQTTLNSLVADIEN
                     DVSKILEDFKKIAENSREQHLTTFEEWGDIMINEWSKKLAYLDVLAPHEDAEHEGKSK
                     TELSEKNWKKFMAIKKQILDARDKMAKRQIKISEFKLLLDNVQNTLQAVTNENGEYLY
                     ILRAQANLAFQERERLEKEAEEAKLRKEAGEVNESSEEEQIVEEPISA"
     gene            <360592..>363324
                     /locus_tag="CAGL0I04114g"
                     /db_xref="GeneID:2889100"
     mRNA            <360592..>363324
                     /locus_tag="CAGL0I04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447428.1"
                     /db_xref="GeneID:2889100"
     CDS             360592..363324
                     /locus_tag="CAGL0I04114g"
                     /inference="similar to AA sequence:UniProtKB:P53076"
                     /note="similar to uniprot|P53076 Saccharomyces cerevisiae
                     YGL227w VID30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447428.1"
                     /db_xref="GeneID:2889100"
                     /db_xref="GOA:Q6FQR6"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR6"
                     /translation="MTGHLDEVDREFIKSLFPEYLLEQPVAYDLLWIYRENKKIFCKT
                     PYFHHSKDEDRNGLLTSSILPPKLSYRTKKEIWQKLMNLGVLGTLSFDAANDEYLVQA
                     YKYFYSDNNNEKSHMKVPGSATKSKFSKDIKKTMNEADDSLQRVHDVLDQYYLNSVSG
                     ENINVDSSIDPVERHSVRWRDHDDIHSESERANERDETEAEEEADQIEDEDEDVEENS
                     NDEDDDDDDEDEGEEEDEDAVDISEEGQERDLQTTSARDSIGSSDRLSRRAHSYSAKD
                     NASRLYPALNTQKYMSKKKNNSTTPNVYNLMGYFLPTQWMHKENNSILVSSDGITELR
                     ANPNWQPFISNDRGDIFARNRLRNALTSSQKTEFVTTYADEIVSNKKVAIFYYEVRVL
                     DVTSSKSAHNSNIVVGYKIANDSDDEIDLEKIDEKALLELVKNFGAGDNNELGGLADI
                     GGTLMGRADSTATDPAPGLAKKNTLDETFVGYCGLSGNISITSKEKPYSKPYGRDDVI
                     GCGINYVNGSVFFTKNGVFLGEAVSSLMNVNAIPYIALKSGNSVRTNFGLYEEFVFDI
                     NQYQKNWKRVAYKNIFKASITSHQFPDTKNTLIDESQMEIDDDADESQLSLLQKGLIL
                     GKDNRISENMVLKPDDLLLNTLNTQDGSMISNLNVMINDYLIHEGLIDVAKGFLKDLQ
                     KFSLTNPYDNQIQIEEREIIKHNESQIIREENVLRIRQELRKLINQREIEKCITFLND
                     KIPDLLGNNVELHFELRVVQYLIQLSNSPKIDSNILIEAGQNLSREFVFNNTIPQELR
                     DKFQDQLSNVSSLLVYEDPLTEAPDELSYYFSPEYLQDRLFQLTNSTILKHMKKSSEC
                     ALDNIVSYSRAMSLTLLNLNAKGKATVYEDDDAKLVDTARYYKLINIDGDLLSL"
     gene            complement(<363465..>364049)
                     /locus_tag="CAGL0I04125g"
                     /db_xref="GeneID:9488007"
     mRNA            complement(join(<363465..363710,364029..>364049))
                     /locus_tag="CAGL0I04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999510.1"
                     /db_xref="GeneID:9488007"
     CDS             complement(join(363465..363710,364029..364049))
                     /locus_tag="CAGL0I04125g"
                     /note="highly similar to uniprot|Q92316 Saccharomyces
                     cerevisiae YGL226ca OST5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999556.1"
                     /db_xref="GeneID:9488007"
                     /db_xref="GOA:B4UN13"
                     /db_xref="InterPro:IPR020294"
                     /db_xref="UniProtKB/TrEMBL:B4UN13"
                     /translation="MSYNALFLQEKYETSTPFTPFIELSRQPKLAFVTLLLALLTISL
                     ALATAGSSKGFVQKFIYYTILTAIGSLFFGIGTVFLSNSFGVYV"
     gene            <364420..>364824
                     /locus_tag="CAGL0I04136g"
                     /db_xref="GeneID:2889101"
     mRNA            <364420..>364824
                     /locus_tag="CAGL0I04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447429.1"
                     /db_xref="GeneID:2889101"
     CDS             364420..364824
                     /locus_tag="CAGL0I04136g"
                     /note="weakly similar to uniprot|P53077 Saccharomyces
                     cerevisiae YGL226w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447429.1"
                     /db_xref="GeneID:2889101"
                     /db_xref="GOA:Q6FQR5"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR5"
                     /translation="MPSTSARLGINYRLNSTLSWADEDEVYEPPNREIMQVPQKWSTY
                     DYDLKEEIVEYLEWKQEDRWHEMSIPERRAAYYISFGEWGPRYTGQTKYDTSYVMLRG
                     LFNLILFSSAGMAFYNLKKDKEMKKKIADLDT"
     gene            366330..366400
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0I04158r"
                     /db_xref="GeneID:2889102"
     tRNA            366330..366400
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0I04158r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2889102"
     gene            <367258..>368055
                     /locus_tag="CAGL0I04180g"
                     /db_xref="GeneID:2889368"
     mRNA            <367258..>368055
                     /locus_tag="CAGL0I04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447430.1"
                     /db_xref="GeneID:2889368"
     CDS             367258..368055
                     /locus_tag="CAGL0I04180g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447430.1"
                     /db_xref="GeneID:2889368"
                     /db_xref="GOA:P41772"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="PDB:1CO4"
                     /translation="MVVINGVKYACDSCIKSHKAAQCEHNDRPLKILKPRGRPPTTCD
                     HCKDMRKTKNVNPSGSCNCSKLEKIRQEKGITIEEDMLMSGNMDMCLCVRGEPCRCHA
                     RRKRTQKSNKKDNLSINSPTNNSPSPALSVNIGGMVVANDDILKSLGPIQNVDLTAPL
                     DFPPNGIDNKPMESFYTQTSKSDAVDSLEFDHLMNMQMRNDNSLSFPMSANQNEVGYQ
                     FNNEGNNSMNSTMKNTITQMDQGNSHSMTLHDIDEILNNGIELGNVN"
     gene            complement(<368221..>369498)
                     /locus_tag="CAGL0I04202g"
                     /db_xref="GeneID:2889073"
     mRNA            complement(<368221..>369498)
                     /locus_tag="CAGL0I04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447431.1"
                     /db_xref="GeneID:2889073"
     CDS             complement(368221..369498)
                     /locus_tag="CAGL0I04202g"
                     /note="highly similar to uniprot|P53107 Saccharomyces
                     cerevisiae YGL164c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447431.1"
                     /db_xref="GeneID:2889073"
                     /db_xref="GOA:Q6FQR3"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR3"
                     /translation="MDEILAKAGSQAVTFAIKSGVSIASTYAIKTITGFILKIPKDDA
                     KRIEKLRIKLQNRIEIVSYAIDLIRLVAARGNTNLESTLRLTSDLRVEIDQFDDKIHE
                     LTEKVEGSRTAKTQKDSINAVELYIKDLLDRIEEITPFINLSLTTSGANLSSNLTNTV
                     SPGLLLSASNYVVKNNDMFAGEDVQVGPTFETTYFSVFYHLPSEKHNNIRVTWKEDMK
                     RGITRIIRRKDETNKFNYVLRIDQSFDDGRYHNTENDEEKPRSLEMNICQIVKLFFSV
                     SGKLLKLPERDSPVLVIKTDKNIKGKGIHSNSSTEDIEWFALGSYESTDSDSSSDEDS
                     SDEDNSANYEDANSSNSNIIPSNERSSSISLLEYILRLVSLQFNDDMSILEVKDERLS
                     VYLNDENPNAIRETNSSINKIDEKLERVTLSDS"
     gene            complement(<369858..>372686)
                     /locus_tag="CAGL0I04224g"
                     /db_xref="GeneID:2889074"
     mRNA            complement(<369858..>372686)
                     /locus_tag="CAGL0I04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447432.1"
                     /db_xref="GeneID:2889074"
     CDS             complement(369858..372686)
                     /locus_tag="CAGL0I04224g"
                     /note="highly similar to uniprot|P32863 Saccharomyces
                     cerevisiae YGL163c RAD54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447432.1"
                     /db_xref="GeneID:2889074"
                     /db_xref="GOA:Q6FQR2"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR2"
                     /translation="MARRRLPDRPPNGIGAGERPRLVPRPINVDESISKLTKPFKVPV
                     KSQRSQTVPANSDLSRQRQLRQRSQTVSYAGLDVDSKDEVDGKENIYDELGERVIKKR
                     RVDALSARRLMEDPTRLDTIEVTLKKSFHVPIKGYVQRHSLPLTLGTKVKVIPEPRPL
                     HDPTDEFAIVLYDPSVDGEMIIQDDTETVQNVQSSEDQNAQEAEAEKSKYKHPKILSN
                     GVKNKTLQELLGNSPFNPTESMKKKFANVPVVIDPKLAKILRPHQVEGVKFLYRCVTG
                     LVMKDFLDQQLASQSSNINFLECSDDDVCSKEVSPIDGGGAHDNSEANNDEAGNAIQN
                     AKKNVKSKKQKKTITKKQQSENDFLEALKKSQSNNRGAYGCIMADEMGLGKTLQCIAL
                     MWTLLRQGPQGKRLISKCIIVCPSSLVNNWANELVKWLGPNTLSPLAVDGKKSSLASG
                     ATSVAEAIKNWAQAQGRNIVKPVLIISYDTLRRNVKQLQNTEVGLLLADEGHRLKNGD
                     SLTFTALDSINCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGTRNEFRRNFEIPILR
                     SRDADATDNDVKSGEQKLQLLSNIVSKFIIRRTNDILSKYLPCKYEHVIFVNLTPFQK
                     QVYNMLIKSRDIKKVVKGDGGSQPLKAIGVLKKLCNHPDLIKLDEELDNYNDLDIPDD
                     YSIPTGKSRDVQTQFSGKFAILERFLHKIKTESDDKIVLISNYTQTLDLIERMCRNRH
                     YASVRLDGTMSINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDW
                     NPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVE
                     RLFSVDNLRQLFQFNDKTICDTHETFQCKRCNKHGQQIMRAAAMLYGDATTWNHLNHK
                     ALEKTNDHLLKNEFYHNDISYAFQYISH"
     gene            <377568..>378641
                     /locus_tag="CAGL0I04246g"
                     /db_xref="GeneID:2889075"
     mRNA            <377568..>378641
                     /locus_tag="CAGL0I04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447433.1"
                     /db_xref="GeneID:2889075"
     CDS             377568..378641
                     /locus_tag="CAGL0I04246g"
                     /note="weakly similar to uniprot|P53032 Saccharomyces
                     cerevisiae YGL162w SUT1 hypoxic protein involved in sterol
                     uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447433.1"
                     /db_xref="GeneID:2889075"
                     /db_xref="GOA:Q6FQR1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR1"
                     /translation="MALSASFTIINRDTSLPPLLLPNVNSSNNFNNPNYHDGGYESQK
                     LMALHGNNQFLSPPMPPQLIKNVNIHSSSNSFTGLTDPISNSSSVTSLSPSPSISPSG
                     SISLPTPSNGSASINSTLDDLASLAAKNTRSGPKSKRSSKGKLTKNNSRGRGKNNAAA
                     HHIAKRQRVGPSCDKCRVKKIKCNATSNILVQDLDIVSLFSTKLHYEFSPEEILNENS
                     EVNQYMRRKHIIDAPSIQNLKECIRKNQNPQNKTLVKHIDKLIIFQPCDSCQKKKNNL
                     LITANSTPIEIRQNPKFQKTHELLISHCNCTFSKGFTRSDISIYTKITYHQKKGKSIG
                     FMHEDAGSSIYNMTTADYFAASL"
     gene            complement(<379149..>380153)
                     /locus_tag="CAGL0I04268g"
                     /db_xref="GeneID:2889076"
     mRNA            complement(<379149..>380153)
                     /locus_tag="CAGL0I04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447434.1"
                     /db_xref="GeneID:2889076"
     CDS             complement(379149..380153)
                     /locus_tag="CAGL0I04268g"
                     /note="weakly similar to uniprot|P53108 Saccharomyces
                     cerevisiae YGL161c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447434.1"
                     /db_xref="GeneID:2889076"
                     /db_xref="GOA:Q6FQR0"
                     /db_xref="UniProtKB/TrEMBL:Q6FQR0"
                     /translation="MMSDSDRLFDIDDGMDGVDDFISEPNPFEEHANTSHNKYGSGTG
                     DNIMGDESGKTVNDLPPAYDNTIALEPQRVAPDRDGSIPQGKLPPGLLNYYSRYFQLS
                     NEGLKKRIMYPRSFYQDSRDPEEQNFEIDDEDEDEASVLSDLYGPVWITATAVMAKFV
                     VVTLVEIVKDGLVLGVPRQAAEDGSYLPSTFWEKQFVNLIHSIWLYYAHTFISPLLIY
                     RGFQNHYDGMKMKSRYELISIYGYSNLIWVSISVILGVLEGFSQPVARSTKWLEFIIF
                     GLGLIPVFFYILRESMYRIQNKVVPTSELFKEIYKVPFVVVLFLLIVFWLIYGILILI
                     "
     gene            <380844..>382112
                     /locus_tag="CAGL0I04290g"
                     /db_xref="GeneID:2889077"
     mRNA            <380844..>382112
                     /locus_tag="CAGL0I04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447435.1"
                     /db_xref="GeneID:2889077"
     CDS             380844..382112
                     /locus_tag="CAGL0I04290g"
                     /inference="similar to AA sequence:UniProtKB:P32579"
                     /note="similar to uniprot|P32579 Saccharomyces cerevisiae
                     YGL169w SUA5 translation initiation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447435.1"
                     /db_xref="GeneID:2889077"
                     /db_xref="GOA:Q6FQQ9"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ9"
                     /translation="MTLLHKLSTFCKMSQPLRTEVLKVDALSIVFPENAHIDGKLPEV
                     NDAPSRDALLKAAHIIRDTEETVAFPTETVYGLGGSSLNDNSVRNIYKAKNRPSDNPL
                     ITHVSSIDQLNRKIYNDYEDGDILRNIPKIYHPLIEKLWPGPLTILLPIPPERNVSLS
                     KLTTGDQPTFAVRIPANSIARALIALADTPIAAPSANASTRPSPTLASHVYHDLKGRI
                     PLIIDGGACNVGVESTVVDGLCLPPALLRPGGFTYEDILHLGGESWRNCKVENKKTLS
                     EGEKVRTPGMKYKHYAPSAKVIVLLPNDSDTQMQLIDKMKVFLSSHQPDIIDKKVAIM
                     TTLKLTPILNEISLFASSNYKGTKTEFLVSELGASGEAIQANLFAALRKADETDNVDT
                     IIVEGISETSEGLAVMNRLRKASGGNIVTI"
     gene            complement(<382354..>385209)
                     /locus_tag="CAGL0I04312g"
                     /db_xref="GeneID:2889045"
     mRNA            complement(<382354..>385209)
                     /locus_tag="CAGL0I04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447436.1"
                     /db_xref="GeneID:2889045"
     CDS             complement(382354..385209)
                     /locus_tag="CAGL0I04312g"
                     /note="highly similar to uniprot|P13586 Saccharomyces
                     cerevisiae YGL167c PMR1 Ca2+-transporting P-type ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447436.1"
                     /db_xref="GeneID:2889045"
                     /db_xref="GOA:Q6FQQ8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ8"
                     /translation="MSDNPFTYYDKDKDAGGSSASLNSQEKEILEATNAALTKPNPSL
                     EYCTLSVEETLHKLDTDAKLGLSSVEEATKRRQYYGPNEISVDDDESLVKKFLSNFVE
                     DRLILLLMGSAIISVFLGNIDDAISITMAIVIVVTVGFVQEYRSEKSLEALNKLVPQE
                     CHLIRGGRESNVLATNLVPGDLVRFRIGDRIPADIRIIECNDLTIDESNLTGETDPVH
                     KSYKALSRDSYNDQPNSIVPVAERTNIAYMGTLVKEGNGRGIVVGTGRETSFGNVFEM
                     MSSIEKPKTPLQLTMDKLGKDLSLASFVVIGIICVVGIIQGRSWLEMFQISVSLAVAA
                     IPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVS
                     KIWCLGSMANKLNVLSLDKNKGGNLKNYLTDDVKTTLLCGNLCNNASYSQEHAKYLGN
                     PTDVALLEQLQKFELADVRSEYTKVKELSFNSKRKMMATKIQDNEKKTTLFIKGAFER
                     ILDKSSSYLTEKGKIEKLTAGHRETIIDCANTLASEGLRVLAFAKRAMTDSSSKLVED
                     DISDLVFTGLIGMNDPPRSSVKFAIDQFLQGGIHIIMITGDSENTAVNIARQIGIPVI
                     DPKLSVLSGDKLNEMTDDQLANVIDHVNIFARATPEHKLNIVRALRRRGDVVAMTGDG
                     VNDAPALKLADIGVSMGRMGTDVAKEASDMILTDDDFSTILTAIEEGKGIFNNIQNFL
                     SFQLSTSIAALSLVALSTAFMLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKK
                     PPRKRTDKILTAELLKRLIGTASCIILGTVYVFVKEMAEDGQVTARDTTMTFTCFVFF
                     DMFNALACRHTTKSIFEIGFFTNKMFNLAVGFSLLGQMCAIYIPFFQAIFKTESLAFS
                     DLIFLAMISSSVFIIDEIRKYWVKKNSHMDPLRYSIV"
     gene            <386697..>386870
                     /locus_tag="CAGL0I04328g"
                     /db_xref="GeneID:9488008"
     mRNA            <386697..>386870
                     /locus_tag="CAGL0I04328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999511.1"
                     /db_xref="GeneID:9488008"
     CDS             386697..386870
                     /locus_tag="CAGL0I04328g"
                     /inference="similar to AA sequence:UniProtKB:Q3E7A3"
                     /note="similar to uniprot|Q3E7A3 Saccharomyces cerevisiae
                     YJL133C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999557.1"
                     /db_xref="GeneID:9488008"
                     /db_xref="GOA:B4UN14"
                     /db_xref="UniProtKB/TrEMBL:B4UN14"
                     /translation="MNQTKLTQTAARILKNSSIFRKSPGNSFATFKEYRETAKTYGPL
                     SASLATKRNLTNK"
     gene            complement(<387102..>388379)
                     /locus_tag="CAGL0I04334g"
                     /db_xref="GeneID:2889046"
     mRNA            complement(<387102..>388379)
                     /locus_tag="CAGL0I04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447437.1"
                     /db_xref="GeneID:2889046"
     CDS             complement(387102..388379)
                     /locus_tag="CAGL0I04334g"
                     /inference="similar to AA sequence:UniProtKB:P47013"
                     /note="similar to uniprot|P47013 Saccharomyces cerevisiae
                     YJL134w LCB3 or uniprot|P23501 Saccharomyces cerevisiae
                     YKR053c YSR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447437.1"
                     /db_xref="GeneID:2889046"
                     /db_xref="GOA:Q6FQQ7"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ7"
                     /translation="MEHQPVITLNDVNGNSTDVLVSHNVKSRIRARSRALSNPNDYQE
                     LNVLNDPGNHPDEHYKAMSPIRFKVRSWLRKYVDNQSETLYYWQSRWRCKFLDLYFSY
                     TSLMGSHTFYVLFLPLPVYFGYFEFTRDMVYILGYSIYLSGFLKDYCCLPRPRSPPLH
                     RITLSAYTAKEYGAPSSHTANATGVSLLFLIALMQSTRYSGFSKAFLFAMVMFYYLTL
                     VLGRIYCGMHGVLDLVSGTAVGVFCCIVRVATSWLLSEWDYGKELWFPVLSVVWGLTI
                     LFKHIQPIDECPCFEDSVAFMGVVSGLEVSDWVIRHFFDDRSLIYAFTNEYTYGQLAS
                     RLGFGVLLVVLWKYILSKPLVYSVFLKTICRMPDDRQEKQHLKIELTANSGEECIRYV
                     GVAHIDIIGRFIIYAGIPISVMLVSPLILKWSP"
     gene            <389225..>390415
                     /locus_tag="CAGL0I04356g"
                     /db_xref="GeneID:2889047"
     mRNA            <389225..>390415
                     /locus_tag="CAGL0I04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447438.1"
                     /db_xref="GeneID:2889047"
     CDS             389225..390415
                     /locus_tag="CAGL0I04356g"
                     /note="highly similar to uniprot|P10081 Saccharomyces
                     cerevisiae YKR059w TIF1 or uniprot|P10081 Saccharomyces
                     cerevisiae YJL138c TIF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447438.1"
                     /db_xref="GeneID:2889047"
                     /db_xref="GOA:Q6FQQ6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSTDQMTQLDESQIETNYDKVVYEFDDMNLNEKLLRGVFGYGFN
                     KPSAIQQRAIMPIIEGNDVLAQAQSGTGKTGTFSIAALQRIDPAIKAPQALMLAPTRE
                     LALQIQKVVMALGFHMDIKVHACIGGTSFVEDAEGLRDAQIVVGTPGRVFDNIQRRKF
                     KVDNIKMFILDEADEMLSTGFKEQIYQIFTMLPPTTQVVLLSATMPRDVLEVTAKFMQ
                     NPVRILVKKDELTLEGIKQFYVNVEEEQFKYDCLTDLYDSISVTQAVIFCNTRRKVEE
                     LTQRLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVI
                     NYDLPTNKENYIHRIGRGGRFGRKGVAINFIVNEDVQALRELEQFYSTQIEELPSDIG
                     TLFT"
     gene            <391429..>392703
                     /locus_tag="CAGL0I04378g"
                     /db_xref="GeneID:2889048"
     mRNA            <391429..>392703
                     /locus_tag="CAGL0I04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447439.1"
                     /db_xref="GeneID:2889048"
     CDS             391429..392703
                     /locus_tag="CAGL0I04378g"
                     /inference="similar to AA sequence:UniProtKB:P33550"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061w KTR2 mannosyltransferase or uniprot|P26725
                     Saccharomyces cerevisiae YJL139c YUR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447439.1"
                     /db_xref="GeneID:2889048"
                     /db_xref="GOA:Q6FQQ5"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ5"
                     /translation="MHAHQVNIKAVILLTTLTVLVWLPSFREWNRILSLRSKDQHYLD
                     KSALIRSKYLQKTRDTIYKPLKMSSHTAADNNNLITTSMDINNFEKQNATFVMLARNS
                     DVNDAVEAIKSLESRFNHKYHYDWAFFNDVPFDEDFIRRTTEVASGKTQYGLIPKDNW
                     DIPSWINKTTMNNNMNIFNEENMLYGSSISYRNMCRYNSGFFFRQKLLDGYDYYMRVD
                     PDVHFLCDLPYDPFEMMVVNHKKYGFVITMHEIGSTIPTLWDTVKKFISQHSDLINKN
                     NLLGFLTDKNDLGKNKFKAHFQDDYNLCHFWTNLEVGDLNFFRSDKYLKFFDFLDANG
                     GFYYERWGDAPIHSIAAALFLDKDEIIHFEEIGYHHMPYYHCPMPNAFWDSHKCACSR
                     SGQFNVINNEINCLPRYWKHNGKTFVKEPGHF"
     gene            complement(<392939..>393586)
                     /locus_tag="CAGL0I04400g"
                     /db_xref="GeneID:2889049"
     mRNA            complement(<392939..>393586)
                     /locus_tag="CAGL0I04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447440.1"
                     /db_xref="GeneID:2889049"
     CDS             complement(392939..393586)
                     /locus_tag="CAGL0I04400g"
                     /note="highly similar to uniprot|P20433 Saccharomyces
                     cerevisiae YJL140w RPB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447440.1"
                     /db_xref="GeneID:2889049"
                     /db_xref="GOA:Q6FQQ4"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ4"
                     /translation="MNISASTIQPHRRLKKVEEDENAATLQLGREFQLTQINHHGEEE
                     DLIALNLSEARLIIKEALIGRRQSYRKNLKMNKKKKTQRNNDDDSTAVEDDDKDEDDD
                     DDEALMHTETREKELESIDALLEQTTGGNNKDLKNSMEYLTNFSRFRDQETVAAVLQL
                     LKSTGLHPFEVAQLGTLACDTADEAKTLIPSLTNKISDDDLERILKELSNLETLY"
     gene            <394159..>395427
                     /locus_tag="CAGL0I04422g"
                     /db_xref="GeneID:2889050"
     mRNA            <394159..>395427
                     /locus_tag="CAGL0I04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447441.1"
                     /db_xref="GeneID:2889050"
     CDS             394159..395427
                     /locus_tag="CAGL0I04422g"
                     /note="some similarities with uniprot|P22209 Saccharomyces
                     cerevisiae YAR018c KIN3 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447441.1"
                     /db_xref="GeneID:2889050"
                     /db_xref="GOA:Q6FQQ3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ3"
                     /translation="MYKNQPQHYARSDYQVVKEIGRGSFGSVHKVIHVPTQQVLVRKD
                     IKYGHMNSKERQQLIAECTILSQLKHENIVEFYSWDFNEQQEVLYLYMEYCSRGDLSG
                     MIKHYKQEHKYIPEKVVWGILAQMLTALYKCHYGEELPSLTTIYDRMKPPSKGRNIVI
                     HRDLKPGNIFLSYDDNSSDSTDKADIAQSNWYRKPNNRGGDESKLTTDYSQVVVKVGD
                     FGLAKSLATSVDFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVIYEMCSLHPPFL
                     AKNYLELQTKIKTGKFDNIPEYYSKGLNAIIHSMIDVNMKTRPSTFELLQDIQVRTAR
                     KSLQLERFEKNLLAYENELVNIEKILEKQAMEYDKEVSQLREQFTKAVEERAREIING
                     KKGPSIPDSINNYAATRIAKPAYHWQTRYR"
     gene            complement(<395589..>396509)
                     /locus_tag="CAGL0I04444g"
                     /db_xref="GeneID:2889051"
     mRNA            complement(<395589..>396509)
                     /locus_tag="CAGL0I04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447442.1"
                     /db_xref="GeneID:2889051"
     CDS             complement(395589..396509)
                     /locus_tag="CAGL0I04444g"
                     /note="highly similar to uniprot|P27616 Saccharomyces
                     cerevisiae YAR015w ADE1
                     phosphoribosylamidoimidazole-succinocarboxamide synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447442.1"
                     /db_xref="GeneID:2889051"
                     /db_xref="GOA:Q6FQQ2"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ2"
                     /translation="MVTVSETQLDGLLPLVARGKVRDIYEVDEHTLLFVATDRISAYD
                     VIMENTIPDKGVLLTKLSEFWFEFLKDEVRNHLIAIPQGKTVFDLLPAALSQDKYRSQ
                     LEGRALLVRKHKLIPLEVIVRGFITGSAWKEYKAKGTVHTLPQPAGLQESQEFPQPIF
                     TPSTKAEQGEHDENISPDQAAELVGEDLKNRIEQLAIRLYSKCKEYAKTKGIIIADTK
                     FEFGYDDKTDEIILVDEVLTPDSSRFWNGENYAIGKSQDSYDKQFLRDWLTSNDLNGK
                     PGVKMPEDIVTRTRAKYVEAFEALTGEKWQ"
     gene            <397172..>399460
                     /locus_tag="CAGL0I04466g"
                     /db_xref="GeneID:2889052"
     mRNA            <397172..>399460
                     /locus_tag="CAGL0I04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447443.1"
                     /db_xref="GeneID:2889052"
     CDS             397172..399460
                     /locus_tag="CAGL0I04466g"
                     /note="some similarities with uniprot|P27637 Saccharomyces
                     cerevisiae YAR014c FUN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447443.1"
                     /db_xref="GeneID:2889052"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ1"
                     /translation="MEYAKPRSFAASSGKQLPLLHDPELVDDYKDILKLKPYAREEDS
                     GSNMGSVVVTPTERTAEMPAAAESPAVEAPAVDAPAVEVEEVEELEEVKDTDIAQEGL
                     DSIRASMISGTSSRYSVGSEMPARHLRQSSEEPLDGLTDPASYSDDDDIHGHGHDYEG
                     AHGGTYDDENDNTYNYSDSDFEDNLEQRMKEIDHEDETDADGAGSPTAPATSRFSHNS
                     DDDEDAENKIDGLHFESSDDSSSDDNLLYAEEDFEEEEDYTPLPPPKELDPDKLYALY
                     PFQGPDSSHCQLEQDEPCILLNDQDAYWWLVKRCSDKKIGFAPAEILETFPERLARLN
                     CWKNENMSTHSFINSDGTIERRYDVIDDETDENLENRDSGLKNYGKGNKSVSFNNVVE
                     YAERILDDVFSESDEESNSVKHHDEFSEGKLGHNALYTNDNIIDDDDVSEVVSDVSFG
                     QNNMAPLNIKKVRKHTEDQTLEKTTDSGDAHLENSSISNAMMRKDGLGKGDSDKDFEE
                     HVSTKSDNVPKLSEMDRDGTGEDFKNSKFQLPHTEISNNNKKHKELDNKLDAKSPSIR
                     VDDVSEAIESIGEEDHIDDDSEEDEVMKVFEAPMAPFAGNSSSQMPNSNSDYSISTIG
                     EYSPSSAENVIDSPNPQSLEDQTLIPSSKAVRDITHLMKKEDDEDDEHIHIDHTEEDN
                     RELLSVSSSDAENEFATDVTTHCLGSSASVSSAFSKNLPSRSGSSITSESGKHHPMVE
                     KLYGSMFERMDSLFQKLDEVVQ"
     gene            <399960..>402713
                     /locus_tag="CAGL0I04488g"
                     /db_xref="GeneID:2889030"
     mRNA            <399960..>402713
                     /locus_tag="CAGL0I04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447444.1"
                     /db_xref="GeneID:2889030"
     CDS             399960..402713
                     /locus_tag="CAGL0I04488g"
                     /note="highly similar to uniprot|P38217 Saccharomyces
                     cerevisiae YBR017c KAP104 beta-karyopherin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447444.1"
                     /db_xref="GeneID:2889030"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FQQ0"
                     /translation="MSSGWRPDDVAVVQLATLLKSCMSPNHDERTVAMDSLQQFQHQP
                     EFFNYLCYILIEGEASEVLKSNFNAADLQNNRATAGMLLKNSMLEKGGFGKGDHDLDY
                     VKSNIVHGLYDNNLLVSNVTGIVITTLFSTYYRQHREDETGINLLSQLLELVSNNNEA
                     SVKALSKIMEDSAQFFQLEWAGNVKPIQSLITSFLGFISDVNMSNTIKAESIKCINTI
                     IPLQTQSFTVKIDEFLSSVFHLAQTNEDDEVRTQICISFSSLLEFRPDKLADNFNGIV
                     QFMLHIIGTVHEEKVAIEACEFLHAFATNNNIPEHLVQPFVPDIVPVLLAKMVYNEDT
                     ILLLESSNDEDANEDDKDEDIKPIAPRIVKKNDKTDSQGNNVADDDEEDDDDDGDDDV
                     DTQWTLRKCSASTLDVLTNILPHAVLEIAFPYLKEHLTSDKWYIREATVLALGAMADG
                     GMNYFNNELPILIPFLVEQLKDHWAPVRKITCWTLSRFSPWIIKDNVQFLVPVMEPII
                     VTLMDRKKDVQEAAISSIATFIENCDPELIETILYTELLENFDKCFRFYKKRNLIILY
                     DAVGRFADKCELDDRAMQIILPHLIQKWESLGDSDKELWPLLECLSCVASSLGEKFAP
                     MAPEVYSRAYRILFNCIDIEKRSQNDPSITVPEKDFIITSIDLIDGIVQGLGEHSQML
                     LFPNDGQYQLLDIMLECLQDVTHEVRQSTYALLGDIVYFYKPDIVISKLSEFLKLINM
                     ELVLNSSEEDTSGIPALINAIWALGLISERIDLSSCIVEMSKALLDLFIGSKIIDEAV
                     IENLAITIGRFGLTHPEVFCNSMFATDEALRKWCEISMKIENDEEKNYAYMGFTKIVN
                     ILDNGNLMSPATVHKYIKGLMVNVDFQPFVNDLFDFFIRHSNQINNLHLKDDEIAFLK
                     QFS"
     gene            complement(<403225..>403722)
                     /locus_tag="CAGL0I04510g"
                     /db_xref="GeneID:2889029"
     mRNA            complement(join(<403225..403527,403675..>403722))
                     /locus_tag="CAGL0I04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447445.1"
                     /db_xref="GeneID:2889029"
     CDS             complement(join(403225..403527,403675..403722))
                     /locus_tag="CAGL0I04510g"
                     /inference="similar to AA sequence:UniProtKB:P38216"
                     /note="similar to uniprot|P38216 Saccharomyces cerevisiae
                     YBR016w and similar to uniprot|Q12489 Saccharomyces
                     cerevisiae YDL012c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447445.1"
                     /db_xref="GeneID:2889029"
                     /db_xref="GOA:Q6FQP9"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP9"
                     /translation="MSAQEYYNGAGDSKQQYSRPTAPPPSQGQGKDSSRGYYQAPPQA
                     PQYQQQPPQGQYYQGGPPPQQQYYQQQGYPQQGQHGQQPIYVQQQPPQRGNDDCMTAC
                     LAALCICCTLDLLF"
     gene            <404659..>406497
                     /locus_tag="CAGL0I04532g"
                     /db_xref="GeneID:2889032"
     mRNA            <404659..>406497
                     /locus_tag="CAGL0I04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447446.1"
                     /db_xref="GeneID:2889032"
     CDS             404659..406497
                     /locus_tag="CAGL0I04532g"
                     /inference="similar to AA sequence:UniProtKB:P38069"
                     /note="similar to uniprot|P38069 Saccharomyces cerevisiae
                     YBR015c TTP1 type II membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447446.1"
                     /db_xref="GeneID:2889032"
                     /db_xref="GOA:Q6FQP8"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP8"
                     /translation="MFNRRFAKLVKLVLITVSIVGGLYYLSGFIDGDTSTALGNRLSQ
                     EYMDSFWKTYDSSKSSYGSSLLGGSGEKGETDFRSPEAKLKIKDFYKTVFEHILDYSP
                     AGKTAREFDDSCFDSGDISTRPDSYKNWKKLSYHQLSHCMKISPSEINHLRGNHKSYV
                     DKINELVLPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTTLPVEVFIPPDEGEST
                     FCESVLPQYNAKCIYISDILPDDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPV
                     KKIDHIFESQIFRSAGLILWPDFWRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEV
                     YTKPDGDLSEVPFHDMEGTLPDPSTESGQLLISKAKHLPTLLLSLYYNVNGPNWYYPI
                     FSQRTAGEGDKETFISAASFYSLSYYQVKTSVGVDGYFRHDGSGYRGVGMLQHDFIQD
                     SKQYMEAFEYSNTKYNNLRSEKGSISYDPSYDPNEFFDKFFSRKKPDGGDESKADVMF
                     VHCNLPKFDPYVSWDTNDLVYQTKHFRSFNNKKVIAQFDIELENFKFFNETLCPYENG
                     KGKFKYLDNKLSEERWPQMCDYISKRLQYLKESHNEALGLEKATEA"
     gene            <407790..>408470
                     /locus_tag="CAGL0I04554g"
                     /db_xref="GeneID:2889033"
     mRNA            <407790..>408470
                     /locus_tag="CAGL0I04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447447.1"
                     /db_xref="GeneID:2889033"
     CDS             407790..408470
                     /locus_tag="CAGL0I04554g"
                     /note="some similarities with uniprot|P38068 Saccharomyces
                     cerevisiae YBR014c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447447.1"
                     /db_xref="GeneID:2889033"
                     /db_xref="GOA:Q6FQP7"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP7"
                     /translation="MLTGVLFTILYFLSHFSGPSSADSAFRQVGPGSRNSKGGGNLGP
                     PIMEAEMNGNTNNIEKAEAGNKAMDTTSNSGTSNENAQLPGSKDQTDSNSNSLSNKEG
                     QEDAEEAADAEYSPAKEFQKLVKSAPIVIFSKSYCPFSKNLKKLLDKNYRLDPAYVAV
                     EVDQHPNGDKLYSYIKKLTGRNTVPNLIANGDSKGGFDDMLALHNSNELESKLIEWGV
                     GELQVSKV"
     gene            <408872..>409321
                     /locus_tag="CAGL0I04576g"
                     /db_xref="GeneID:2889031"
     mRNA            <408872..>409321
                     /locus_tag="CAGL0I04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447448.1"
                     /db_xref="GeneID:2889031"
     CDS             408872..409321
                     /locus_tag="CAGL0I04576g"
                     /inference="similar to AA sequence:UniProtKB:Q12157"
                     /note="similar to uniprot|Q12157 Saccharomyces cerevisiae
                     YDL008w APC11 subunit of the anaphase promoting complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447448.1"
                     /db_xref="GeneID:2889031"
                     /db_xref="GOA:Q6FQP6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP6"
                     /translation="MRIELTEVHGVFNWVWDIPKNEDRLDESMADEDEDVCGICRASY
                     HAPCPNCRYPGESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKI
                     NEPHIPLFKEIEIKRYRQLQEEIEAGNYDALEEANIPPREDVEMASA"
     gene            <409866..>411563
                     /locus_tag="CAGL0I04598g"
                     /db_xref="GeneID:2889036"
     mRNA            <409866..>411563
                     /locus_tag="CAGL0I04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447449.1"
                     /db_xref="GeneID:2889036"
     CDS             409866..411563
                     /locus_tag="CAGL0I04598g"
                     /inference="similar to AA sequence:UniProtKB:P38228"
                     /note="similar to uniprot|P38228 Saccharomyces cerevisiae
                     YBR044c TCM62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447449.1"
                     /db_xref="GeneID:2889036"
                     /db_xref="GOA:Q6FQP5"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP5"
                     /translation="MTTIVRILRRGLKTIHTPVHSLNDQKIRQQLISGIGRLNQILES
                     SYNHRNILHKGKYKTYPQFVSSKDNVRFQKVIRDYLDSSAVNEIKSGNTGKDFDSKLA
                     TIGLNLFMDVNGANINPLASLLTYEMLSHYNKYPEKETIEGFELAINTVRQFLRENKI
                     PVTSPDDILTLVGRLVHDVREFETSKEILEALNYNLNSDDIVRVVKGNKTFDEVEFSK
                     GCRLSSGVIDKNELYLRSLDLPQKKLVSIDQQMCVLVYDGTLREANKILPTLHYLQKM
                     DKKLLLLVTGECVGDALTAITIHNNKCKRQQKNHRTIIINYYSKDYGNKSIQENTDLQ
                     EFLKLPEGIDSIYSPHFSNEIPSKICADKYYGSIESLKATTGESYLYNDDLPESLRDK
                     ESQFLKQTVTLHVGGYNEFEIEQRRNQMDNLFNNFLCRAIADGFIPNNGSALCKSIPH
                     LAELTKSSSSESLLTKSAVSAIMSIIRQYSERSIINQEGLSKFEAGDIISEITNLTDF
                     KLVKTSIQEKPKDCSAIGLVEPWITTDLTLRNALNYTRLLASCNTAISLILEKPKKK"
     gene            <412007..>413200
                     /locus_tag="CAGL0I04620g"
                     /db_xref="GeneID:2889034"
     mRNA            <412007..>413200
                     /locus_tag="CAGL0I04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447450.1"
                     /db_xref="GeneID:2889034"
     CDS             412007..413200
                     /locus_tag="CAGL0I04620g"
                     /inference="similar to AA sequence:UniProtKB:P38226"
                     /note="similar to uniprot|P38226 Saccharomyces cerevisiae
                     YBR042c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447450.1"
                     /db_xref="GeneID:2889034"
                     /db_xref="GOA:Q6FQP4"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP4"
                     /translation="MRKEQGQTGFARRTIVPVVSVVSFLSCCVVLLVIQVTAKLRFSQ
                     NKTRLTHVYNYTKKQFIVLLTSILRIVAPCEIRVTTDNGSIPKGTFYQDSSSGRLRAN
                     LLERSITISNHQIYTDWVFLWWLAYAGDKAGNVFIMLKKSLRKIPVLGYGMENFNFIF
                     MNRKWAYDRVNMSNHLSAIEADSLGCGPISGNKPVKVNSDGEEVWDMKSSAQRNIKWP
                     YNLILFPEGTNLSAHTRKVNEAYAEKIGRVPYRHVLLPRATGLRFCLQKLRNSVDVVY
                     DTTIGYSGILSTEYGQDAYSLKNIFFRGKYPKLVDIHVRSFKLSDIPIDDEIDFIEWL
                     FKVWEEKDKMMEYFYEHGTFENMTDNQESVLVDCSIKNYEFFPVFIIPFCFVLLTYWI
                     VRSIF"
     gene            complement(<413484..>415502)
                     /locus_tag="CAGL0I04642g"
                     /db_xref="GeneID:2889035"
     mRNA            complement(<413484..>415502)
                     /locus_tag="CAGL0I04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447451.1"
                     /db_xref="GeneID:2889035"
     CDS             complement(413484..415502)
                     /locus_tag="CAGL0I04642g"
                     /inference="similar to AA sequence:UniProtKB:P38225"
                     /note="similar to uniprot|P38225 Saccharomyces cerevisiae
                     YBR041w FAT1 very long-chain fatty acyl-CoA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447451.1"
                     /db_xref="GeneID:2889035"
                     /db_xref="GOA:Q6FQP3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP3"
                     /translation="MPAPFKIIIFLIGRIFWVLFKLVKIILYPIKELLSWSLGDWFNR
                     LDAENHIREDIYIIPYFFKAVFQYIWSVRKHRFQCWYQFEEQVRTNGHRPLISYPKPL
                     AEKGEYELQTYSYKETYDIVLRLSYVMKNSYKVNAGDYIGIDCTNKPLFMFLWLASWN
                     LGAIPAFLNYNTIGSPLVHSLKISNISKVFIDPDASKPIKQTEEEILNAIPGIQLNYL
                     QEQELMAILNDVNSPQFLQDPIIRSPEGLTDFKPAMLIYTSGTTGLPKSAIMSWRKAH
                     VGCQLFGHVLHMDNTSTVFTAMPLFHSTAALLGACAILSKGGCLAISNKFSATNFWKQ
                     VYLTQATHVQYVGEICRYLLHSPESKYEHMHTAKIAYGNGLRPDIWQDFRKRFNLEVI
                     GEFYAATEAPFATTTFQRGDFGVGACRSYGTIINWFLQYQQTLVKMDPNDDSIIYRNS
                     KGLCEVPDVGEPGEMLMRIFFPRKPETSFQGYLGNEKATKSKVLRDVFRKGDAWYRCG
                     DLLKADKYGQWYFLDRMGDTFRWKSENVSTMEVEDQLTTASKNEITQVVVVGIKVPKY
                     EGRAGFAVLKLKNHDYDSSEKIKLLNNWLSTLNKTLPKYALPLFVKFVREIRMTDNHK
                     ISKKDYRDQKLPHGLDGKDEIFWLKNYNEYKLLTNEDWKDIENNVAKL"
     gene            complement(<416100..>416981)
                     /locus_tag="CAGL0I04664g"
                     /db_xref="GeneID:2889359"
     mRNA            complement(<416100..>416981)
                     /locus_tag="CAGL0I04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447452.1"
                     /db_xref="GeneID:2889359"
     CDS             complement(416100..416981)
                     /locus_tag="CAGL0I04664g"
                     /inference="similar to AA sequence:UniProtKB:P38224"
                     /note="similar to uniprot|P38224 Saccharomyces cerevisiae
                     YBR040w FIG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447452.1"
                     /db_xref="GeneID:2889359"
                     /db_xref="GOA:Q6FQP2"
                     /db_xref="InterPro:IPR016509"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP2"
                     /translation="MITLSALFFIAKRMPRMIVLLLTFINIFLLVFLLVGCYSPSHIN
                     TYLSRFTFASDSTLYPMIKQSFTHNAKTTGFENVVVKVGYLRTCIDKVPRVYNMDNNS
                     IATKCYSGKTIENESIYSDITLQLFNVPKSSQSSNTTTSTPVTLNLLELAQITAAKVV
                     HPHLLIATVAFTVLEFIGMTYYLIPLLPFKNWINIYNIVLASLLLLLWTIGVMWEHVA
                     TRATAKLIPPASLGIIKSHRGRKAASMAWLIFSFQLINTILLWFLYIRDRKSEVSDLD
                     LDLNYNFSTNSSMTEKT"
     gene            complement(<417543..>418433)
                     /locus_tag="CAGL0I04686g"
                     /db_xref="GeneID:2889360"
     mRNA            complement(<417543..>418433)
                     /locus_tag="CAGL0I04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447453.1"
                     /db_xref="GeneID:2889360"
     CDS             complement(417543..418433)
                     /locus_tag="CAGL0I04686g"
                     /note="highly similar to uniprot|P38077 Saccharomyces
                     cerevisiae YBR039w ATP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447453.1"
                     /db_xref="GeneID:2889360"
                     /db_xref="GOA:Q6FQP1"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP1"
                     /translation="MLSRNIINGSRSIAWASTRNYATLKEVETRLKSIKNIEKITKTM
                     KIVASTRLSKAEKAKLAAKKMDAADKQFYNNAETKPLEAEGETPKELVIAITSDKGLC
                     GAIHSQLAKAVRRHLAEAPQADVVTIGDKIKTQLLRSNPDNLKFSINGVGKEAPTFEE
                     SSLIADKILTELNAGIYPKISIYYNDPISSLSFEPTSKPVFNPETIEQSPSYSKFEID
                     ADNKVSRDLFEYTLANQIMTAMAEGYAAEISARRNAMDNASKNAGDMINRYSILYNRT
                     RQAVITNELVDIITGASSLE"
     gene            complement(<420914..>420932)
                     /gene="TLC1"
                     /locus_tag="CAGL0I04700r"
                     /db_xref="GeneID:3868820"
     ncRNA           complement(<420914..>420932)
                     /ncRNA_class="telomerase_RNA"
                     /gene="TLC1"
                     /locus_tag="CAGL0I04700r"
                     /product="telomerase RNA"
                     /note="CAGL0I04700r: noncoding RNA telomerase RNA"
                     /transcript_id="XR_002648366.1"
                     /db_xref="GeneID:3868820"
     gene            <422462..>423145
                     /locus_tag="CAGL0I04708g"
                     /db_xref="GeneID:2889361"
     mRNA            <422462..>423145
                     /locus_tag="CAGL0I04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447454.1"
                     /db_xref="GeneID:2889361"
     CDS             422462..423145
                     /locus_tag="CAGL0I04708g"
                     /note="highly similar to uniprot|P38075 Saccharomyces
                     cerevisiae YBR035c PDX3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447454.1"
                     /db_xref="GeneID:2889361"
                     /db_xref="GOA:Q6FQP0"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:Q6FQP0"
                     /translation="MSEKETTQQPIIFAPETYQYDKYSLNEGQLKDDPIDQFVEWFDD
                     AKNDPRETLPEAITFSSAELPSGRVSSRVLLFKELDHRGFTIYSNWKTSGKAHDIATN
                     PNVAINFFWRDLQRQIRIEGFSEHVNRETSERYFQTRPRGSKIGAWSSPQSTVLKDRN
                     ELEHIVQENENRFKGVEDVPCPDYWGGLRVVPLRIEFWQGRPSRLHDRFVYERKTEHD
                     PWELHRIAP"
     gene            <423658..>424704
                     /locus_tag="CAGL0I04730g"
                     /db_xref="GeneID:2889362"
     mRNA            <423658..>424704
                     /locus_tag="CAGL0I04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447455.1"
                     /db_xref="GeneID:2889362"
     CDS             423658..424704
                     /locus_tag="CAGL0I04730g"
                     /note="highly similar to uniprot|P38074 Saccharomyces
                     cerevisiae YBR034c HMT1 hnRNP methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447455.1"
                     /db_xref="GeneID:2889362"
                     /db_xref="GOA:Q6FQN9"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN9"
                     /translation="MSKTTVAESATDKQNLNQYEQHYFTSYDHYGIHEEMLQDTVRTL
                     SYRNAIIQNKDMFKDKVVLDVGCGTGILSMFAAKNGAKHVIGVDMSSIIEMARNLVEL
                     NGFSDKITLLRGKLEDVELPFPKVDIIISEWMGYFLLYESMLDTVLYARDRYLVEGGL
                     IFPDKCSIHVAGLEDAQYKDEKINYWHDVYGFDYSPFIPLIMKEPIVDTVERNAVNTT
                     RSQLIEFDLNTVTIADLAFKSKFKVQAKRQDVISGLISWFDIEFPAPKGQKPVTFSTG
                     AHAPYTHWKQTVFYFPDDLECETNDVLEGELVCAPNKQNNRDLDVKISYNFKPVGIDA
                     SSRTKKNEATFIMH"
     gene            <425468..>426763
                     /locus_tag="CAGL0I04752g"
                     /db_xref="GeneID:2889363"
     mRNA            <425468..>426763
                     /locus_tag="CAGL0I04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447456.1"
                     /db_xref="GeneID:2889363"
     CDS             425468..426763
                     /locus_tag="CAGL0I04752g"
                     /inference="similar to AA sequence:UniProtKB:P38221"
                     /note="similar to uniprot|P38221 Saccharomyces cerevisiae
                     YBR029c CDS1 CDP-diacylglycerol synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447456.1"
                     /db_xref="GeneID:2889363"
                     /db_xref="GOA:Q6FQN8"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN8"
                     /translation="MAKKSNAKRLATKKANAATVASNAATDATEKKPESRKYNFLIRT
                     IWTFIMIGGFFAVLASGHIWCVMLILLCQIAIFMECIAVTSGSSRERDLPLTKTLNWY
                     FLITTIYYLEGSSLFRFLEPAFYKYTLLRMVVEHHKFICYCFYVFGVVLFVCSLRKGH
                     LKFQFASLCITHMVMLFVVAQAYLVTKNVLNGLFWFLLPCGLVIVNDIFAYLCGITLG
                     RTKLIAISPKKTLEGFLGAWFFTALASIILTRLLSPYMYLTCPVQDLHTNFFSNLTCD
                     LNPVFLKQDYKTPPFIAEKYGINVITVKPIYFHALNLATFASLVAPFGGFFASGLKRA
                     FKVKDFGHSIPGHGGITDRVDCQILMGSFTYLYYTTFINERGITIESIISTILINFNE
                     KQIIEIVLRLNKKLLESGLLEKKEFKSIGQIYSKCADRL"
     gene            complement(<427445..>428716)
                     /locus_tag="CAGL0I04774g"
                     /db_xref="GeneID:2889364"
     mRNA            complement(<427445..>428716)
                     /locus_tag="CAGL0I04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447457.1"
                     /db_xref="GeneID:2889364"
     CDS             complement(427445..428716)
                     /locus_tag="CAGL0I04774g"
                     /inference="similar to AA sequence:UniProtKB:P35206"
                     /note="similar to uniprot|P35206 Saccharomyces cerevisiae
                     YBR036c CSG2 calcium dependent regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447457.1"
                     /db_xref="GeneID:2889364"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN7"
                     /translation="MSNSLLWFTGVIGYVIQTKCISTIQSRQVVATSASEQDAAGVDT
                     GNTSSGTYILTLYLTFIYFASWTFLMPIAKMWKEFKQSTEPDQADLVPIVEGDEDPEH
                     RNTNRMLLQYYQRQANKNNQIVSWRNFTYFLKLIVLTALLIIALVTYNLALSMSPAFD
                     VALIQNTSIFEIVTLLYGVCGLARRQNVFRNFIIMLTALIGILIISYTKATCDMLSGK
                     LSINKDTGELSDPFLFDRLKSSLLCGLGALTIGPFAVLWNRWFGGRSRSSSVLTKTLP
                     QSSVSHSLLEHIKARNAVNSFVKQCTHLSFIGLVGMIVLFPFLPAIPTSSETVSFLYS
                     DRTFWLSAMVGIVFGVIPCLLSLLLLNRNASPEYLTTCNLGAIIFMGISDWISEPTQT
                     TIIRWEVIGYIILTICCLILSFTFNEKKMQH"
     gene            complement(<429791..>430675)
                     /locus_tag="CAGL0I04796g"
                     /db_xref="GeneID:2889365"
     mRNA            complement(<429791..>430675)
                     /locus_tag="CAGL0I04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447458.1"
                     /db_xref="GeneID:2889365"
     CDS             complement(429791..430675)
                     /locus_tag="CAGL0I04796g"
                     /inference="similar to AA sequence:UniProtKB:P23833"
                     /note="similar to uniprot|P23833 Saccharomyces cerevisiae
                     YBR037c SCO1 involved in stabilization of COX1P and COX2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447458.1"
                     /db_xref="GeneID:2889365"
                     /db_xref="GOA:Q6FQN6"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN6"
                     /translation="MIRNVTNIARTRLLTRRVMQQPARPILAATRTFCNSAVVREKKL
                     SRVPLTGRPKGSEPEHGIETSNSIEFSTGKAIALFLVVGGVSYYVFTNEKKKLEARKE
                     AEANRGYGKPSLGGPFTLVDTEGKEFTEKNLRGKFSIVYFGFSHCPDICPDELDKLGE
                     WLDVLDKKHDIHLQPIFITCDPARDSPEVLKQYLSDFHDGIIGLTGTYDQVKHACKQY
                     RVYFSTPPNVKPGQDYLVDHSIFFYLMDPEGNFVEALGRNYDETTGVDKIVQQVRAYQ
                     PESERNKAKNSWLSFLNK"
     gene            <431844..>434588
                     /locus_tag="CAGL0I04818g"
                     /db_xref="GeneID:2889366"
     mRNA            <431844..>434588
                     /locus_tag="CAGL0I04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447459.1"
                     /db_xref="GeneID:2889366"
     CDS             431844..434588
                     /locus_tag="CAGL0I04818g"
                     /note="highly similar to uniprot|P14180 Saccharomyces
                     cerevisiae YBR038w CHS2 chitin synthase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447459.1"
                     /db_xref="GeneID:2889366"
                     /db_xref="GOA:Q6FQN5"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN5"
                     /translation="MTRNPFMVDSSPQRLTRFHTNNSTDELYDSQSFQGLPQSPSRAA
                     LRYSPERRNRQQFYRDSNHNSPAVDRYTSNLQQSPHRPTETVIPMRPYENTYMSPTRF
                     PSQSSKYTASTATALSFHDEFKDKDDVSSYAYDDQSTIYTSNTFNETKFELNHPTRQP
                     YVRRANSEMKKRNHEVPLAKSKAILKLDNPIPKDLLDTLPRRDSPEFTEMRYTACTVE
                     PDDFLAEGYGLRFAEMNRECQIAICITMYNEDKFALARTIHSIMKNVAHLCSRERSSV
                     WGPNGWKKVSVILISDGRAKVNQGSLDYLAAIGLYQEDMAKASVNGDPVKAHIFELTT
                     QVSINADLDYESQGIVPVQMVFCLKEENKKKINSHRWLFNAFCPVLQPNVVTLVDVGT
                     RLNTTAVYHLWKVFDMDSNVAGAAGQIKTMKGKWGLKLLNPLVASQNFEYKISNIMDK
                     PLESVFGYITVLPGALSAYRYRALENHSDGTGPLNSYFLGESQEGSSYDVFTANMYLA
                     EDRILCWELIAKRDANWVLKYVKEATGETDVPEDIPEFISQRRRWLNGAMFAALYAHL
                     HFFQIWKTKHSFLRKFFLHIEFFYQFVQMTFSWFSIANFVLTFYYLAGSMNRVIKHGE
                     ALFIFFKYLIFCDLASLFIISMGNRPQGAKVLFILSMILLTICAAYSLICGFVFAIIA
                     LKSQSEPHHIFVNVVISLLSTYGAYAFCSFMYLDPWHVFSSSIQYFLTLPAFTCTLQI
                     FAFCNTHDVSWGTKGSTQESKQLSKAIVVQGPDGTQIVETDWPQEVDKKFLEIKSRLK
                     EVEYEDVHVDESQKRNDYYRDIRTRIVMIWMLSNLILIMSIIQAYPPERINNGYLIFI
                     LWSVAALAGFRAVGSISFLFMKYLRMGVKYMHKRQRGTAKGVHMKAPKINIFNKEGST
                     "
     gene            <434911..>438105
                     /locus_tag="CAGL0I04840g"
                     /db_xref="GeneID:2889367"
     mRNA            <434911..>438105
                     /locus_tag="CAGL0I04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447460.1"
                     /db_xref="GeneID:2889367"
     CDS             434911..438105
                     /locus_tag="CAGL0I04840g"
                     /note="some similarities with uniprot|P29465 Saccharomyces
                     cerevisiae YBR023c CHS3 chitin synthase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447460.1"
                     /db_xref="GeneID:2889367"
                     /db_xref="GOA:Q6FQN4"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN4"
                     /translation="MVMTAIAGDKFLYPKLNKIVPFTLFSHHSPDLENPLLESELNTT
                     ENTKESISVINPGSKKRHKARCRRNGRNELFQSKVRGWHFYCRVVTIFIPSKVLKFCG
                     IRTVEQQRAWREKVGLISIILAIGAIVIYISFIFTNTACGYKQPKILHRNVSDSFIRI
                     NGRAYPFNWANIPESTPILISYYGLFAPKSYGGKDASLLFQNVNGNCHGIIKPRENCT
                     IPHDNNGNLAWYFPCVVLSKDDYMSWDPEIEIENKPSNCHISEFERDSYYYLEYPVNI
                     YYTWDDIKNSNRSLVVYNNYVLDLKILQMLYKYDLDVPPKLLELGSLPINGYDISVTL
                     TTNYDKKLARCLIDIATVGLIDAEPLGCIVANIILYLFLIFIMSIVILKFVIACYFRW
                     VVAKAQGSFKVNNKTMIRIMRDIEDWAEDINKKAPIMNVNFLPENTSLITRKRDIVEG
                     ISLHPKRMSNPTSILSGPNSSNVKSTTYLKPNLKIGNSISQNFDSFIRKGENYCLCSF
                     PETSNYRDSLLKSLNDGNLDPSIIHKNVVKPNNIIHGSSDGFLNTICFVTCYSEGVRE
                     LRSTLDALCTTTYPNTHKLIILVCDGQVTGAHNKKLTSEIALNMITDFIEDPNEVIPY
                     SYLSIASGAKRFNMAKVYGGYYKYDSDTVEESQQQQVPIVLVSKCGSFYEIHSSPKPG
                     NRGKRDSQIILMSLLQRAICNERMSELEFQLLKVIWQVGGKMIMEYETVLMVDADTRV
                     FPDSIRHMCAEMAKDTNIMGLCGETKIANKKESWVTAIQVFEYYISHHHSKAFESIFG
                     SVLCLPGCFSMFRIKSPKDKEQTCWVPILANPDIVECYSNNSTDTLHQKNLLLLGEDR
                     YLSSLLLRKFPNRKQVFVPKAACKTVVPSKFLVLLSQRRRWINSTIHNLVDLLRHDNL
                     CGTFCFSMQFVVLLELLGTILLPFAILSTIYVIIYSALFAPLPMLTLVLLLVILGLPG
                     VFIVITTTKLVYVVWMLVYLVALPIWNLILPVYAFWKFDDFSWGETRATKDGKRNDIN
                     ETADTFNHTAVNMMTWKEHALDEKARGSRYPFAV"
     gene            complement(<438338..>442861)
                     /locus_tag="CAGL0I04862g"
                     /db_xref="GeneID:2889250"
     mRNA            complement(<438338..>442861)
                     /locus_tag="CAGL0I04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447461.1"
                     /db_xref="GeneID:2889250"
     CDS             complement(438338..442861)
                     /locus_tag="CAGL0I04862g"
                     /note="highly similar to uniprot|P32568 Saccharomyces
                     cerevisiae YDR011w SNQ2 multidrug resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447461.1"
                     /db_xref="GeneID:2889250"
                     /db_xref="GOA:Q6FQN3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN3"
                     /translation="MSSSSEISVAGSDVSFEGRLTQHGRHEETPADQLTKILSGRSHE
                     DADGDDAHSDNRSILSRSRRSSTAELSPEMVGRVQSLADVLSRHTSRSGGNIDLSQLS
                     ESDRFDAERIIGSFVRDADEQGIHLRKAGVTLEHVSARGADSTAMEGATFGNVLCLPY
                     TIYKAIRDKSGSKMRTILNDVSGLARAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGG
                     VEGEIMYDGIPQKEMMKRYKPDVIYNGEQDVHFPHLTVQQTLDFAIACKTPSKRVNDV
                     SREEYIASTRDLHATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCW
                     DNATRGLDASTALEYAKAIRITTNLLGSTAFVTIYQASENIYETFDKVTVLYTGRQIY
                     FGPIDEAKDYFYRMGYECPPRQVTAEFLTALTDVNGYHKIRPGYENKVPRTAEEFERY
                     WQESPEYRQLLIDIDQYKKEIDTEKTKEIYDQSMQQEKSKHARKKSYYTVSFWEQIRL
                     CTKRGFQRIYGDKAYTVITICSAIIQSLVSGSLYYNTPSSTSGAFSRGGVLYFCLLYY
                     SLMGLANLSFEHRPILQKHKIYSLYHPAAEALGSTIANFPFRMIGMTCFLIIIYFLSG
                     LNRTASSFFRVYLFLTMCSESINALFELIAAGCDNISQANSISGIVMMSISLYSTYMI
                     QLPSMRPWFKWISYILPIRYAFESMLLAEFHGRHMGCGGTLVPSGPGYENIASENQVC
                     AFVGSKPGQSWVLGDDYLRLQFEYEYKHEWRNFGIMWCFLLGYIALKALITEIKRPVK
                     GGGDALIFKKGTRKYHMKLDEEDGELHEIDTKEKFSSRSGSSTTSEDEIFEELESKGI
                     FIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRNVGII
                     TGDMLVNGKPIDISFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPEEEKMEH
                     VERIIKVLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDS
                     QSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFGDIGDNSK
                     TLLSYFERNGARKCSPSENPAEYILEAIGAGATASVTEDWHQIWKNSDEFISTEKEVD
                     HLIDQLSNQKTESEFGDAPTKYATSYAYQFKWVLIRTSMSLWRNLDYIMSKMMLMTVG
                     GLYIGFTFYDPGDSYTGLQNTLFAAFISIILSAPAMNQIQARAIAARELFEVRESKSN
                     MFHWSLLLITQYLSEIPYHFLFSAIFFVSSYFPLRTHFQASASAVYYLNYSIMFQLYY
                     IGFGLCVLYMAPNLQSANVILGLCLSFLIAFCGVVQPVSLMPGFWTFMWKTSPYTYFV
                     QNMVGILLHNKPVICRKKELSIFDPPAGQTCQEFTQAFLDKRGGYIANPNATTACEYC
                     IYEVGDDYLKHISASYSYLWRNFGLYWAYIGFNICAMVAIYYIFHVRGVSFKFDRVFK
                     LFSRITRRGKKSN"
     gene            <446336..>447637
                     /locus_tag="CAGL0I04884g"
                     /db_xref="GeneID:2889251"
     mRNA            <446336..>447637
                     /locus_tag="CAGL0I04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447462.1"
                     /db_xref="GeneID:2889251"
     CDS             446336..447637
                     /locus_tag="CAGL0I04884g"
                     /note="highly similar to uniprot|P40327 Saccharomyces
                     cerevisiae YDL007w YTA5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447462.1"
                     /db_xref="GeneID:2889251"
                     /db_xref="GOA:Q6FQN2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN2"
                     /translation="MGQGVSQDKKKKKGGKPKYEPPVQSKFGRKKRKGGPATAEKLPN
                     VVPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEKKQEEEKKQLEEIRGNPLSI
                     GTLEEIIDDDHAIVTSPTMPDYYVSILSFVDKELLEPGCSVLLHHKTMSIVGVLQDDA
                     DPMVSVMKIDKSPTESYSDIGGLESQIQEIKESVELPLTHPELYEEMGIKPPKGVILY
                     GAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAPSIVF
                     IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESLDPAL
                     IRPGRIDRKILFENPDLSTKRKILGIHTSKMNLSSDVDLENLVTSKDDLSGADIQAMC
                     TEAGLLALRERRMQVTAEDFKQAKERVMKNKIEENLEGLYL"
     gene            <448237..>448854
                     /locus_tag="CAGL0I04906g"
                     /db_xref="GeneID:2889252"
     mRNA            <448237..>448854
                     /locus_tag="CAGL0I04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447463.1"
                     /db_xref="GeneID:2889252"
     CDS             448237..448854
                     /locus_tag="CAGL0I04906g"
                     /note="highly similar to uniprot|P25451 Saccharomyces
                     cerevisiae YER094c PUP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447463.1"
                     /db_xref="GeneID:2889252"
                     /db_xref="GOA:Q6FQN1"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FQN1"
                     /translation="MSDPSSINGGIVVAMAGKDCVAIACDLRLGNQSLGVSNNFEKVF
                     NYGHVFFGITGLATDVTTLNELFRYKTNLYKLREDRPIEPETFTQLVSSTLYERRFGP
                     YFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEA
                     EDLFETISQALLNAADRDALSGWGAVVYIIKKDKVVKRYLKMRQD"
     gene            <449135..>449619
                     /locus_tag="CAGL0I04928g"
                     /db_xref="GeneID:2889253"
     mRNA            join(<449135..449267,449339..>449619)
                     /locus_tag="CAGL0I04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447464.1"
                     /db_xref="GeneID:2889253"
     CDS             join(449135..449267,449339..449619)
                     /locus_tag="CAGL0I04928g"
                     /inference="similar to AA sequence:UniProtKB:P87275"
                     /note="similar to uniprot|P87275 Saccharomyces cerevisiae
                     YER093ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447464.1"
                     /db_xref="GeneID:2889253"
                     /db_xref="GOA:Q6FQN0"
                     /translation="MTVPEIISDGKSTRRNLQKLLFFGATSATLAIAALTSRSIATRK
                     YIPTFFQLNTKIPTFSSKSEAQAALGLSSGLSLGIFAITTTGFCWALDISSASDFKQR
                     MKTLFNTIDEKEYMNDSDPETNKIIEELEALINKK"
     gene            <450298..>454617
                     /locus_tag="CAGL0I04950g"
                     /db_xref="GeneID:2889254"
     mRNA            <450298..>454617
                     /locus_tag="CAGL0I04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447465.1"
                     /db_xref="GeneID:2889254"
     CDS             450298..454617
                     /locus_tag="CAGL0I04950g"
                     /inference="similar to AA sequence:UniProtKB:P40061"
                     /note="similar to uniprot|P40061 Saccharomyces cerevisiae
                     YER093c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447465.1"
                     /db_xref="GeneID:2889254"
                     /db_xref="GOA:Q6FQM9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM9"
                     /translation="MDHISKSEVSDLGFPFASAYNRSSTEDETNTKGIHRSKSTSTAS
                     NLQNKNRNKQNLVLSTSFVSTRRLDNTPISPITVSQNKRHRNSITKTILGLKNEVSNL
                     QHELTELKKKKEDTERLRSSTASDIYAGGYSTDHLQKHSIRIKANAQIRELDKHILKL
                     EKQMKASKDQMEHLRRPDSDLETLKTNSENLSREDLHTAEEDLGTGIFRIGTQKSQLS
                     EEQSKKKNDTNEDEMIAHESIDPDHLDSSFDDTVSMSEQTVNLESATWLVSNYLESFQ
                     ESNVSTDFVLEKANGLVDLLKQNPDIRSNLVLDSFMPSIQRLLLRDDNLITSAAYRVC
                     RHLIDGKNFIDLLFKLHIDTFIIISLSYDNSHQLEREQAFKLIRAFVEYNHGISKGIL
                     QAVISCIEKSDDPLKNMALETLLELCYISPEMVKECHGTRILEGILQEYYSFSLANIV
                     LDTILNLMSNHNTRKYFIKDFDISVLATIFADVNPKSSINIEKIQNSTILMAKALKSF
                     NGCMLFSMNNFQPLRELLAFFQVPNCAPYLIDLFLDILRIKSLPYRPRNKGVQQFRMQ
                     PSEYYRECVSLNQKIALKIMILEQGGFQENINNLISVLTNNDTNSTLATKARYLLSEY
                     LNLKLNLVDKKFPINKNPQIIEDNAKTYEETFEFAKMATKMSRHRNTVGMNFIQYVEK
                     NKAFVQNYKENTLVREVDDLRFRRMVYDSKVLQTKDFVNWNWNIIQELFEGPLMNSTH
                     LDELAKSTKFIRRLLVFYRPLRLRFSNVNKTAKLAQKYIHVGCLFFKMLTSTNEGLKL
                     LMDDTKIIPQLASLLFRALEGNTSGNIFNENTLKNKIVSGYFKFIGVLTETKGGIKVL
                     ARWNFFTVIYKMFQFQSKFASKCLFLVLADLHLQHSAHCRTVMGKALVVEDEEVRISA
                     TKRLGELLIELNGSKVASEIDLENKLNVQHYKMELLTRQLYDLSPKVVAVADRALYEY
                     ILTGNESEESSGSTFKLFLNQMVFIRSPILFEILGRPYGFQLFNEIDFVKDERDSWLE
                     KKNIEYVDIVEEFMEQSPRNKRNNHYEQRDRLPLHFYESLAKTEDGILFLSQTGDFLT
                     FMNIIKDYVRTEMDDEGIDIIKNLKACLWCCGFIGSTELGIGLLDNYSLVDDIVNVAY
                     KASVTSVRYTAFYTLGLISKTLEGCEILDQLGWNCCISVIGKPIGIALPNRLDRFLSF
                     NEEPWNILETYEEHLIDMNIQTGELITTGSAIKFDLFKLLAEKNALENPFHKDDNDMD
                     LSNDSSTDNVLANSRPSDAISYLDSASSSITRSVSNERANTTFSAAVFRDEESQGSPK
                     QHSNQIAINNTPHSVSQILDMENSDDERITNVLNVVSQLGNHIMSNKAMKVITDMNAK
                     YGSDVFGHSLLFMKVLQMMSTFRFKPPVRKFLCGLIINKRNLGILIDRESKNQKLSKL
                     QNN"
     gene            complement(<454872..>455255)
                     /locus_tag="CAGL0I04972g"
                     /db_xref="GeneID:2889084"
     mRNA            complement(<454872..>455255)
                     /locus_tag="CAGL0I04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447466.1"
                     /db_xref="GeneID:2889084"
     CDS             complement(454872..455255)
                     /locus_tag="CAGL0I04972g"
                     /inference="similar to AA sequence:UniProtKB:P40060"
                     /note="similar to uniprot|P40060 Saccharomyces cerevisiae
                     YER092w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447466.1"
                     /db_xref="GeneID:2889084"
                     /db_xref="GOA:Q6FQM8"
                     /db_xref="InterPro:IPR020366"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM8"
                     /translation="MPAIDREALEKEYRKLTARNDDIIRQEATSKKEYATFSRKETSI
                     ITLLQSLEPTLQDMHELKNNEPRLISEETIAKVPGLSWYNEQIKLVQESGDKDDFDVP
                     PELRESYELFKGLALLPKDGKSLSE"
     gene            <457287..>459590
                     /locus_tag="CAGL0I04994g"
                     /db_xref="GeneID:2889085"
     mRNA            <457287..>459590
                     /locus_tag="CAGL0I04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447467.1"
                     /db_xref="GeneID:2889085"
     CDS             457287..459590
                     /locus_tag="CAGL0I04994g"
                     /note="highly similar to uniprot|P05694 Saccharomyces
                     cerevisiae YER091c MET6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447467.1"
                     /db_xref="GeneID:2889085"
                     /db_xref="GOA:Q6FQM7"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM7"
                     /translation="MVKSAVLGFPRIGPNRELKKITEAYWAGKVSVDELFKVGKEIRE
                     SNWKLQQAAGVDIIPSNDFSFYDQVLDLSLLFNAIPERYTKYGLAPIDTLFAMGRGLQ
                     RKATETEKAVDVTALEMVKWFDSNYHYVRPTFSHSTQFKLNGQKPVDEFLEAKALGIQ
                     TRPVLLGPVSYLFLGKADKDSLDLQPLSLLEKLLPVYIEILSKLKEAGATEVQLDEPI
                     LVLDLPQEAQDAIKTAYTKLGAAANIPKITLATYFGTVVPNLKAIQGLPVDAFHFDFV
                     RAPQQFDEVIAAIGQNQKLSVGIVDGRNIWKNNFAKSSDFVKAAINKLGEDRVIVATS
                     SSLLHTPVDLENESKLNPEIKSWFSFATQKLDEVVVIAKNVSGQDVSAALDANAKLIA
                     SRAASNITNDPAVQKRVASIDSKMSTRLAPFAERLAEQKEIFKLPLFPTTTIGSFPQT
                     KDIRINRNKFTKGTITAEEYEKFINSEIEKVIRFQEEVGLDVLVHGEPERNDMVQYFG
                     EQINGYAFTTNGWVQSYGSRYVRPPIIVGDLSRPKAMTVKESVYAQSITDKPVKGMLT
                     GPVTCLRWSFPRDDIDQKTQAMQLALALRDEVKDLESAGIKVIQVDEPAIREGLPLRE
                     GAERSAYYVWAAEAFRVATSDVSNKTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKD
                     DANYIAEFKNYPNHIGLGLFDIHSPRVPSKEEFISKIETILKTYPAEKFWVNPDCGLK
                     TRGWDETRQSLTNMVEAAKYYRAKYSN"
     gene            complement(<460019..>461539)
                     /locus_tag="CAGL0I05016g"
                     /db_xref="GeneID:2889086"
     mRNA            complement(<460019..>461539)
                     /locus_tag="CAGL0I05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447468.1"
                     /db_xref="GeneID:2889086"
     CDS             complement(460019..461539)
                     /locus_tag="CAGL0I05016g"
                     /note="highly similar to uniprot|P00899 Saccharomyces
                     cerevisiae YER090w TRP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447468.1"
                     /db_xref="GeneID:2889086"
                     /db_xref="GOA:Q6FQM6"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM6"
                     /translation="MQIQPDLPTLKGLYEQNNALDEGINMYPVYAFLPALDLTPHVAY
                     LKLAQLNNKDRTESFLLESAKTTDELDRYSFIGVSPRKIIKTGPTEGIETDPLDVLEE
                     EMSQFKLATNVPGLPKLSGGAIGYISYDCIRYFEPKTKRDLKDVLQLPEAYLMMCDTI
                     IAFDHVFQRFQIMHNINTKKQSLEEGYSHAVEIINDIIKRMTDDSKPIPYPEQPPIKM
                     DRSFQSNIGQEGYENHVGNLIEHIKKGDIIQAVPSQRVARPTDLHPFNIYRHLRTVNP
                     SPYLFYIDCLDFQIIGASPELLCKSDSKNKVITHPIAGTIKRGATTEEDDELGNQLRN
                     SLKDRAEHVMLVDLARNDINRVCDPKTTNVDKLLTIQKFSHVQHLVSQVSGTLRPDKT
                     RFDAFRSIFPAGTVSGAPKVKAMELISELEGERRGVYAGAVGNWSYDGKTMDTCIALR
                     TMVYKNGTAYLQAGGGIVFDSDKYDEYIETMNKMMANHNTIVQAEKIWAEKVGTTN"
     gene            <462705..>464084
                     /locus_tag="CAGL0I05038g"
                     /db_xref="GeneID:2889087"
     mRNA            <462705..>464084
                     /locus_tag="CAGL0I05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447469.1"
                     /db_xref="GeneID:2889087"
     CDS             462705..464084
                     /locus_tag="CAGL0I05038g"
                     /inference="similar to AA sequence:UniProtKB:P34221"
                     /note="similar to uniprot|P34221 Saccharomyces cerevisiae
                     YBL056w PTC3 ser/thr protein phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447469.1"
                     /db_xref="GeneID:2889087"
                     /db_xref="GOA:Q6FQM5"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM5"
                     /translation="MGQILSNPVIDKEHHSGADLLTAFGLCAMQGWRMSMEDAHIVEP
                     NVLPETDDEHIAFYSIFDGHGGSAVAQFCGSKMVSILTSQESFKEKKLKQALIDTYLK
                     TDEELLKDPEMRNDHSGCTATSILVSKLQQTLVCGNSGDSRTVLSINGVAKALSFDHK
                     PTLTSERSRIVAADGFVEMDRVNGNLALSRAIGDFEFKSNDKLGPHEQIVTCVPDIVE
                     HRLNYDNDEFVILACDGIWDCLSSQECVDLVHHGIMKGDMSLNDISSRIIDVCCSPTT
                     EGTGIGCDNVSIVVVALLKENETINAWFERMRNKGYKPPHSFEEQRRSIFSYYQFPED
                     DEKVFDVTTKKPQDRFNQDSEISTGDEDERNKMEIDEDDNDRSGAQKKTGASIPVDLL
                     SLEALLNGAGNIQLNQGPDNVSYISGSSLTDMINSLSRAAAMANNTRDSDSEEEDTKI
                     IEDVSDKQE"
     gene            <470638..>472476
                     /locus_tag="CAGL0I05060g"
                     /db_xref="GeneID:2889088"
     mRNA            <470638..>472476
                     /locus_tag="CAGL0I05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447470.1"
                     /db_xref="GeneID:2889088"
     CDS             470638..472476
                     /locus_tag="CAGL0I05060g"
                     /note="some similarities with uniprot|P40059 Saccharomyces
                     cerevisiae YER088c DOT6 involved in derepression of
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447470.1"
                     /db_xref="GeneID:2889088"
                     /db_xref="GOA:Q6FQM4"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM4"
                     /translation="MTSAKNPTSWDTHDDMLLRHLKEIKNLGWKEISLYFDNRTPNAC
                     QFRWRRLKSGNLKSNKSALIDVTNMHVPMNYYERNVKMGIASANSSSDASPSSGSPKG
                     PPANDYVVQSIPISPQHQLQTTAAFAVPHPQGSFTQPALPSSYQRDVIDQSGYVANTE
                     QETRFSRPKSFSHSMTGTFSTPSYPVNSPNSLSKYHQPLSRMNSDDENVGFIPKVIVK
                     SRRGSSILPGPFDQSNPFQNQQLHYSTKQQNMGSGSALQSPNGSSNANSYFPAALNTT
                     LNGSKARKNSFVNWSRRNSFNFSSTSNSRRSSIIQAPNSIGGPLPSSLSHTEVYSSNP
                     NSRRHSVQKITDSRGSTSSITSPSAASAVYSASNNYMDTPVTNANMTTFNKTSRQASI
                     PMANRRQSVALSTFNNKTASNYNIMPWTREEELLLIDCHAKQMSPSEMSVVLPTKSDA
                     EIRARLSLISQFQAPIDVQQRPILEQPRPQFPRQLSGPALQNNTVQQKGNCSNDSTVV
                     DEVDPLIKADVNQTVTPTSESSKDVSPAPVFSPNPNDSTSSISACSSSMSMNGKHIGE
                     NCSTAVNYSVGVNDGHFPSPALSNEKLTNLNERKLPTISTLLNNAV"
     gene            complement(<473462..>475276)
                     /locus_tag="CAGL0I05082g"
                     /db_xref="GeneID:2889089"
     mRNA            complement(<473462..>475276)
                     /locus_tag="CAGL0I05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447471.1"
                     /db_xref="GeneID:2889089"
     CDS             complement(473462..475276)
                     /locus_tag="CAGL0I05082g"
                     /note="some similarities with uniprot|P34217 Saccharomyces
                     cerevisiae YBL051c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447471.1"
                     /db_xref="GeneID:2889089"
                     /db_xref="GOA:Q6FQM3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM3"
                     /translation="MKVQEEVDKSVGLLIPSNFRGDTTNASYDNDTEMMSDAEKTVTS
                     AGNDLSNNTNTSNDDDDDIIPTAIVIKNIPFALKREQLLDFMTSLDLPLPYAFNYHFD
                     NGTFRGLAFANYNSEVDTAKVVNELNEKEVGGRNLRVEYKKVLPQEERERIERERRLK
                     HQNQKKAQWKQQQQQQQQQQQQQQHQHQHQQQQQQQQVTNNNVSTSAGGYRNVLQNSD
                     GSNSDLTNSPMHNNNSVGTIDHHRGSVISIESSINGNNSNPNSSPLDQPQNHLHSMPN
                     SAGKCFAPLPTGVSPLANNVVLSSSSNNPLALDMNDPDTLEIYSQLLLFKDREHLYTE
                     LIYPSGIANSLRRILDLCCSALGLIESSDPNFITIRRKTNNYDFQKQLGESSGTMVDH
                     GMIDQPLNSTSTGGESLSSSQSYTSLSNTRLSLSLVNSTNTSDYIPTMNQHGISKSTA
                     LFPQAVTNDSPNVRYANSASGQSGSSILHASSYMDPHNQTSTTSSGLNISGFFNGRSS
                     SISGQGMSSNYMLQRQRVPVPFFSNQNNSDLRVNGYNSQKSTKIGVMGAGQGLGPHLT
                     NGSTVSAATNMTTNYGIIQGNELFNEYEQQPPISRGIW"
     gene            <478339..>478596
                     /locus_tag="CAGL0I05098g"
                     /db_xref="GeneID:9488009"
     mRNA            <478339..>478596
                     /locus_tag="CAGL0I05098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999512.1"
                     /db_xref="GeneID:9488009"
     CDS             478339..478596
                     /locus_tag="CAGL0I05098g"
                     /inference="similar to AA sequence:UniProtKB:P52870"
                     /note="similar to uniprot|P52870 Saccharomyces cerevisiae
                     YER087cb SBH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999558.1"
                     /db_xref="GeneID:9488009"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:B4UN15"
                     /translation="MSSSAVSAGSEKPIQRKGKTASEKNSREGTPGTPALKNSNSILK
                     IYSDEAKGLRVDPLVVLFLAVGFIFSVVGLHVISKITSKIF"
     gene            complement(<479047..>480705)
                     /locus_tag="CAGL0I05104g"
                     /db_xref="GeneID:2889090"
     mRNA            complement(<479047..>480705)
                     /locus_tag="CAGL0I05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447472.1"
                     /db_xref="GeneID:2889090"
     CDS             complement(479047..480705)
                     /locus_tag="CAGL0I05104g"
                     /inference="similar to AA sequence:UniProtKB:P39965"
                     /note="similar to uniprot|P39965 Saccharomyces cerevisiae
                     YER087w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447472.1"
                     /db_xref="GeneID:2889090"
                     /db_xref="GOA:Q6FQM2"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM2"
                     /translation="MLKFAVFSRGMANRALLPRKVDIQSLKDIPTLDVLQNLGFIRRT
                     QSGLFNWLPLGLRTLHKLEALVRKRMDEDASAIEVSLSSLSPKINWEKTGRWDKSNEL
                     FKVKDNNAFEYCLTPTCEEDITSLMKNYIKSYKDLPITAYQISRKYRDEKRPRGGLLR
                     GREFIMKDAYSFASSEEQAIEIFNKMDSVYDRIFSDLKIPYKAAYADSGEIGGDLSKE
                     YHFLNSFGEDTVFSCDSCGTSSTIEKCNSLPEEDGMYSGDVGVVYGLSEDHTTLVCFY
                     YPAERQFNWNLAQSVMENDLDMALKDVGNDKILEMYQSENEDYMFSKILRVMDVRINS
                     RSNFPDFPLSKYLKNNFGQIDGISIVDATDKEICGKCEDGTLHASNSIEVGHIFHLGD
                     KYSKPFEVNFKDENNSDDSIVSMGCYGIGISRLIGAAAEIGRDHMGLRWPQVIAPYQV
                     SVVTSNNEGMVAINDMKKSLMKNLDTFDLDDLHRSTGFGGRIALSHAIGIPICVIIGT
                     KSWPNVEIEVRGKKWDNGDDTPIEKKSVHYSDVIDTVNELLLDL"
     gene            complement(<481145..>482860)
                     /locus_tag="CAGL0I05126g"
                     /db_xref="GeneID:2889091"
     mRNA            complement(<481145..>482860)
                     /locus_tag="CAGL0I05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447473.1"
                     /db_xref="GeneID:2889091"
     CDS             complement(481145..482860)
                     /locus_tag="CAGL0I05126g"
                     /note="highly similar to uniprot|P00927 Saccharomyces
                     cerevisiae YER086w ILV1 anabolic serine and threonine
                     dehydratase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447473.1"
                     /db_xref="GeneID:2889091"
                     /db_xref="GOA:Q6FQM1"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM1"
                     /translation="MIPKLLCGNTLLSASVTTSRSVYGLSTRYFTQDLAPSLVKLHSE
                     LKPDELLTDNTPDYVRLVLRSSVYDVIKESPISHGVGLSSRLNTNVQLKREDLLPVFS
                     FKLRGAYNMIAKLDDTQRNQGVIACSAGNHAQGVAYAARHLDIPATIVMPVSTPSIKY
                     QNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTNIPPFDHPYVIAGQGTVAMEILRQ
                     VYNSNKIGAVFVPVGGGGLIAGVGAYLKRVTPHIKIIGVETHDAATLHTSLQRNKRTN
                     LASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDEICAAVKDVFEDTRSIVEPSG
                     ALAVAGMKKYITQLHPEIDHSKQTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLV
                     TIPDVPGSFKKMQKVIHPRAVTEFCYRYNEHRHESSSEVPKAYIYTSFSVVDREKEIK
                     QVMQQLNTLGFEAVDISDNELAKSHGRYLVGGASKVPNERIISFEFPERPGALTRFLA
                     GLSESWNLTLFHYRNHGADIGKVLAGISVPPRENLTFQKFLEDLGYKYQDETENMVYQ
                     RLLKY"
     gene            complement(<486625..>488349)
                     /locus_tag="CAGL0I05148g"
                     /db_xref="GeneID:2889196"
     mRNA            complement(<486625..>488349)
                     /locus_tag="CAGL0I05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447474.1"
                     /db_xref="GeneID:2889196"
     CDS             complement(486625..488349)
                     /locus_tag="CAGL0I05148g"
                     /inference="similar to AA sequence:UniProtKB:P32891"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174c DLD1 D-lactate ferricytochrome C oxidoreductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447474.1"
                     /db_xref="GeneID:2889196"
                     /db_xref="GOA:Q6FQM0"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:Q6FQM0"
                     /translation="MLGSKLGRLYKINARVSTNLARHCGRRAYATGKSTIPTNIKPLA
                     LGASLIVGSSIGYYIGQLNCHDVVSTESTSRGSTVSLQSLEPVKYCEDIDKVITKLKE
                     ELNNNEDKYSVVESNLAQHTDTYFNTHHAVDAKSQVPLIILYPETTEEVSKLVKICND
                     NHVPMIPFGGGTSLEGHFMPTRGPHLVVTIDVSKYMNNVVVLHKDDLDVTVQAGVPWE
                     DLNDYLEPHGLMFGCDPGPGALIGGCIANSCSGTNAFKYGTMKENVVSLTVVLPDGTV
                     VKTKNRPRKSSAGYNLNGLFTGSEGTLGIITEATVKCHVKDKFESIAVVSFKTIRDAA
                     ACSSELIQRGIKLNAMELLDDSLMRIINKSESTDRNDWVEEPTMFFKIAGRTQNSVND
                     LIKEVQNVAKETNSTAFQFANSVDEKLELWEARKVALWSVIDAAKSAGGPNAKVWTTD
                     VAVPISQFATVINDTKSDILESGLTYGIVGHAGDGNFHCFIVYNSGEEENKCHQLVDN
                     MVTRALKADGTCTGEHGIGLGKRDYLSQELGQEPIDLMRAIKMAIDPHRVMNPDKIFP
                     IDPSEPNL"
     gene            <490959..>493064
                     /locus_tag="CAGL0I05170g"
                     /db_xref="GeneID:2889195"
     mRNA            <490959..>493064
                     /locus_tag="CAGL0I05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447475.1"
                     /db_xref="GeneID:2889195"
     CDS             490959..493064
                     /locus_tag="CAGL0I05170g"
                     /note="some similarities with uniprot|P40535 Saccharomyces
                     cerevisiae YIL036w CST6 ATF/CREB activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447475.1"
                     /db_xref="GeneID:2889195"
                     /db_xref="GOA:Q6FQL9"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL9"
                     /translation="MFGAQHGIENQESIQNKRMKTMNTMKRKSSDMQESEQISADNQQ
                     DTDNNSILDATAAAVAANNAFNMNLLMNMHMNNLHSLNNVNTNPSFMAYQQRKQERRE
                     KESQKILQQQREQQQKQQQQQQQLQLQQSQQQQQQQQQQQQQREIQQQQQNIDDQMRA
                     SNEQLGNRSTSSSQQQLHQQLHQQYFGDMIIRSGILGNNDAGMMMSQMNMGSFGAENG
                     NQNGMNDTLGSGIDNSNVVGNRNSSAIGQNMQNMIGENQGGIGLGQSSANGDYQKEIG
                     VNNVFIKQEDSNSNLYQSSMSQAIKNSAMNQGHISPGNKDIDDDSMNNKYKNMRDSIN
                     NNPHLIHDKNIQQNLSPFYSPFGVDVSHLPMTSPPIFQNVGYGGDVHPRRRISISNGQ
                     ISQLGEDIETVENLYNTQPPPMPQNRFQQAANNGIGEKPKKIRTDSTIDTEKQAQMNM
                     YLGRNSGFPPESNNFNDYMMSTDSISSSNEQMMAHSQPPETNLSVSFNADNLRSNTTD
                     VVGGDTHKAIGQVIKSPPSLSASPLSSVMKNDSGTQRHSTDSFTRGVNPGTQMQNGNI
                     NQKQGQYEQQQVRQNYNQNTYSNDEPLPGTTAWKKARLLERNRIAASKCRQRKKVAQM
                     QLQKEYDELHKENSIIKRKLQYYEKLVSKFKKFSEAHISKCDKHDKESLRMIEEMLMI
                     DSDINEVNESGLIVSMSER"
     gene            complement(<493635..>494756)
                     /locus_tag="CAGL0I05192g"
                     /db_xref="GeneID:2889198"
     mRNA            complement(<493635..>494756)
                     /locus_tag="CAGL0I05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447476.1"
                     /db_xref="GeneID:2889198"
     CDS             complement(493635..494756)
                     /locus_tag="CAGL0I05192g"
                     /note="highly similar to uniprot|P15790 Saccharomyces
                     cerevisiae YIL035c CKA1 casein kinase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447476.1"
                     /db_xref="GeneID:2889198"
                     /db_xref="GOA:Q6FQL8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL8"
                     /translation="MRCRVWSEARVYSKVNNEKNEDYWNYEDAAVTWSNNVKDYEIEM
                     KVGRGKYSEVFQGVQLASRKHIVIKMLKPVKKKKIRREIKILTNLSNEKNPPTAQEFN
                     RDLYFSNRDENILKQIRPYIYELPHHGHENIIQLFDVIRDPISRTPALVFEHVNNMDF
                     RVLYPKLSDIDIRYYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKQRKLRLIDWGLA
                     EFYHVNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFQKEPFFHGTS
                     NTDQLVKIVRVLGSDDFEKYLIKYQITLPREFHDMDQYIRRPWYRFVNDQNRHLSDNE
                     DVIDLLDNLLRYDHQERLTAKEAMGHPWFEPIRRAETKE"
     gene            complement(<495363..>496175)
                     /locus_tag="CAGL0I05214g"
                     /db_xref="GeneID:2889199"
     mRNA            complement(<495363..>496175)
                     /locus_tag="CAGL0I05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447477.1"
                     /db_xref="GeneID:2889199"
     CDS             complement(495363..496175)
                     /locus_tag="CAGL0I05214g"
                     /inference="similar to AA sequence:UniProtKB:P13517"
                     /note="similar to uniprot|P13517 Saccharomyces cerevisiae
                     YIL034c CAP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447477.1"
                     /db_xref="GeneID:2889199"
                     /db_xref="GOA:Q6FQL7"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /translation="MDEKYDAALDLLRRLNPNNLTENLQRIIGLEPELAEDLLSSIDV
                     PLKVQQDSKQSGRPFLCCDYNRDVDSYRSPWSNEYFPELSAEDLQESPFPSESLRSLE
                     VLANDSFDVYRDLYYEGGISSVYLWDLDEEGEFAGVVLFKKEGSNKESWDSIHVIEAT
                     KGNDDETFTYRLTSTIILALDNKQNDTSLAGNLTRQTEKEAKIDTSNTDISHITNLGT
                     LIEDIESQLRTQLEIVYFEKTRDIFHQTRSQKSTTDSQEQQQKEVIKGLQNL"
     gene            complement(<496714..>497928)
                     /locus_tag="CAGL0I05236g"
                     /db_xref="GeneID:2889197"
     mRNA            complement(<496714..>497928)
                     /locus_tag="CAGL0I05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447478.1"
                     /db_xref="GeneID:2889197"
     CDS             complement(496714..497928)
                     /locus_tag="CAGL0I05236g"
                     /inference="similar to AA sequence:UniProtKB:P07278"
                     /note="similar to uniprot|P07278 Saccharomyces cerevisiae
                     YIL033c SRA1 cAMP dependent protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447478.1"
                     /db_xref="GeneID:2889197"
                     /db_xref="GOA:Q6FQL6"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /translation="MVSEECRSGLAAFQTAVNENSPDDFFQYGANYFNKKLEEQRKLS
                     RRSAVSGFKSPFASSDPHAKESDNGLFKNSFGSGPFGGNDDPKSNSNSNDSGNGMRSQ
                     GQGPTDRNSPEALGNAPIPNNFNALRRTSVSGETLQPDHFDDWQPEHYKEKSEEQLKR
                     LEKSIGKNFLFNKLDSDSKKLVINCLEEKRVSKGTEIIKQGDEGDYFYVVETGTVEFF
                     VNNEKVNTSGAGSSFGELALMYNSPRAATVVAQTDCTLWALDRLTFRKILLGSSFKKR
                     LMYDDLLKNMEVLKSLSTYDRAKLADALDTKIYNAGDVIIREGDRGENFYLIEYGACD
                     VTKEKEGLVTQLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQRLLGPAVE
                     VLKLNDPTRKHD"
     gene            <498808..>500331
                     /locus_tag="CAGL0I05258g"
                     /db_xref="GeneID:2889202"
     mRNA            <498808..>500331
                     /locus_tag="CAGL0I05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447479.1"
                     /db_xref="GeneID:2889202"
     CDS             498808..500331
                     /locus_tag="CAGL0I05258g"
                     /inference="similar to AA sequence:UniProtKB:P43609"
                     /note="similar to uniprot|P43609 Saccharomyces cerevisiae
                     YFR037c RSC8 subunit of the RSC complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447479.1"
                     /db_xref="GeneID:2889202"
                     /db_xref="GOA:Q6FQL5"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL5"
                     /translation="MSTAEYCRVLQVRVKQRIHQSNMASVGDTVGSGEAVVGGAEKRK
                     MSYVEEAEKLQEKTYRFMAKQTHPVIIPSYASWFDLCSVHQIEKDAVPDFFNGSSPIY
                     KTPKSYMEARNFMVNTFRLAPYEYLTITAVRRNLTLDVASVMKIHSLLENWGLINYQV
                     DPRAKQTLRGKKYFGNYKTVLDVPESLQPHLTDENMKDVAVDISVQMKQYNSTNDYNL
                     LVSNHNSHSLTKPKIYVCFTCGNDIGQVMYHNLRAKEMNICSRCFKEGHFSSNFQASD
                     FIKLNNVNNTNDKIWTDEELLLLLEGIELYEDKWDKIADHVGHFKTVEECVQKFLILP
                     IEDRFIRDTISSETKRKNVGVSVSQDNISAFKDLIENNASEPVNPIENETYEKLERLT
                     TILVEKITDKLSVIDEADSKLIATKGTFFKDSEKLLNDKISLNKQTIELNNELKSKKI
                     YKTIKSSNSKDIHLVLKDNSEIRHEQELDSSHLSKLVSRDSDAVSIRNSEAYRPLVL"
     gene            <500748..>501794
                     /locus_tag="CAGL0I05280g"
                     /db_xref="GeneID:2889200"
     mRNA            <500748..>501794
                     /locus_tag="CAGL0I05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447480.1"
                     /db_xref="GeneID:2889200"
     CDS             500748..501794
                     /locus_tag="CAGL0I05280g"
                     /note="weakly similar to uniprot|P40544 Saccharomyces
                     cerevisiae YIL023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447480.1"
                     /db_xref="GeneID:2889200"
                     /db_xref="GOA:Q6FQL4"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL4"
                     /translation="MIAIGILVLSLCSQFCIGHSIEGKHDHGSGSGHSHSHTHPGDDN
                     SYIQQFTFDVLEKYVFQYSPKVNALLASTIIQATPCLLVLLVPGLRNITNMNDESILI
                     TALEAFAFGTLMGDIFCHLIPESFQLFPAHEVGSSLFYGFLGFLVLDKLMKMLNEDDS
                     ELGHSHGHSHSHSHTQKSDNDESTNEKESKPHSAKNTNATKYIHVISGLLHHSVDGLV
                     LASSFYVSTATGAITTVAILFHEVPHELGDFSIMLSSGFTYWGAFKAQMTIGMSAIVG
                     TLFSCYLNETGQSTFNFETDRLLPITAGGFIFMATTGLLPRILAHKPTSNYSTFSIQL
                     LCILVGFYTMSAMD"
     gene            <502432..>505713
                     /locus_tag="CAGL0I05302g"
                     /db_xref="GeneID:2889201"
     mRNA            <502432..>505713
                     /locus_tag="CAGL0I05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447481.1"
                     /db_xref="GeneID:2889201"
     CDS             502432..505713
                     /locus_tag="CAGL0I05302g"
                     /inference="similar to AA sequence:UniProtKB:P40541"
                     /note="similar to uniprot|P40541 Saccharomyces cerevisiae
                     YIL026c IRR1 essential protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447481.1"
                     /db_xref="GeneID:2889201"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013721"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR020839"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL3"
                     /translation="MSNIRRSARLQSRTADEDGYDSDENTAKYIESDESVTSESDSGE
                     DEDQDDDDYMEGKKARQSRGVKRSGRAQSSTTATKRTRVKSSSKSRNTKNNSELRADQ
                     ERYLEIMKEFKPTELYEILSTDPDIAVEDVLREYMETYKENRDEFLQTFINLLLNCCG
                     AVTQVEKHDIRNNESSADTITEVQLAFQRQKIHEFHLVLSKDFKKKAKYPALYQNIEE
                     FMSKFLEIADDMQLLYTEVPFGDDDSGEFTPLVTDLFTWISAFSVSKIRCFRYIATFI
                     LYCFEDYLTNYTVELERDYLSRLTKQLSMEQKKKRQNKSTITKISNSIEELTSKKRQT
                     DILIDNISKIAFIHRFKDVDDSIRKMSVEHLTTWIINNPEKFLKVSYLKYYGWLMSDD
                     SSVVRSQVLRSLPLIISGHNGHVTDNAAIRQFYERFKDILLEIAMKDIDMEVRLLAVQ
                     VLAEVSSLGYLEIQEIVMISSLIFDDKDVKISSHSKNSRFLAAVARFLSNVCKENVKN
                     MLQSLESSDNVGGIPVKSLINIGYFMRLLSTALSYYLNQKHETNPSQKVHILFQAAEF
                     LFPYFGSHISNICKLLIIDEGSSELAAIKNLNETFNQNSIDSYDNAKNTSTQLLVLPD
                     NRNNIILYITVLNGLCHGGYESKVANKAVVYESVIPHIASLLSVLPVQSIDILGPILR
                     IIEIFQYEEWINVGLEKDLIKIVEKIGKLLNELTLSTSPNDLTYNSFACAINKLSEFQ
                     ISAIDNVWRNAITSIKFELKKFLDQHMPLSKKLDSKNFTELTRSLYENYINKLTLLGK
                     NYPVEIENDLVEKIMNQFISRISNYSDLINKEFNEIVSFKLLTVIVTWHIHTWSALLR
                     DEQGNDLRTTISERTVNTIAHVISALNDVIVSVPTEYANKSDLRDLIYFKWIASNSLI
                     DIILAINMFVLNIPDSKTSWKLTFNKHLPKYLADNANKAFLEVFLLLEGLYADEFDLR
                     LERMDDEDVNFNDLSDIELFQNNEKELLLFTIKLKALMKLDLLSSKVVSRISLNKDII
                     GPLFMKVIDNSIFETSDAPVIVPQHASRNLNPSNEQIVDTHNSLEEDNNNNTFPEMIK
                     QSSEL"
     gene            <506095..>506502
                     /locus_tag="CAGL0I05324g"
                     /db_xref="GeneID:2889262"
     mRNA            <506095..>506502
                     /locus_tag="CAGL0I05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447482.1"
                     /db_xref="GeneID:2889262"
     CDS             506095..506502
                     /locus_tag="CAGL0I05324g"
                     /inference="similar to AA sequence:UniProtKB:P40540"
                     /note="similar to uniprot|P40540 Saccharomyces cerevisiae
                     YIL027c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447482.1"
                     /db_xref="GeneID:2889262"
                     /db_xref="GOA:Q6FQL2"
                     /db_xref="InterPro:IPR018937"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL2"
                     /translation="MGLVSKSLYAVSLLQLLHAGFSSYEFHQVMKKHNRVGAQLPQDI
                     KFEVLCAIIIFTLGVFLSFEVLQYYPLRGEEKPLGPKQYLLDIKLNKSSNIDNLVGVD
                     PNGEVSYTPSFVDIKEKREQVQKWLNEIPKKSN"
     gene            506977..507049
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0I05346r"
                     /db_xref="GeneID:2889263"
     tRNA            506977..507049
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0I05346r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2889263"
     gene            complement(507221..507294)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0I05368r"
                     /db_xref="GeneID:2889264"
     tRNA            complement(507221..507294)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0I05368r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2889264"
     gene            complement(<508677..>510041)
                     /locus_tag="CAGL0I05390g"
                     /db_xref="GeneID:2889265"
     mRNA            complement(<508677..>510041)
                     /locus_tag="CAGL0I05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447483.1"
                     /db_xref="GeneID:2889265"
     CDS             complement(508677..510041)
                     /locus_tag="CAGL0I05390g"
                     /inference="similar to AA sequence:UniProtKB:Q12505"
                     /note="similar to uniprot|Q12505 Saccharomyces cerevisiae
                     YPL026c SKS1 suppressor kinase of SNF3 and similar to
                     uniprot|Q03785 Saccharomyces cerevisiae YDR247w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447483.1"
                     /db_xref="GeneID:2889265"
                     /db_xref="GOA:Q6FQL1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL1"
                     /translation="MFADFRINNFRLIDRIGSGAYGLVFKARNTIDNKIYAIKAILRA
                     EYTNRTLKNHVNESHAKQKQNLEFLLYAFFQKNHHELYLPAVDLDSILALTKEQLDQV
                     PHYKEIALHLSVHDHPNIVSIHNVFESSIATFIVMDYYENDLFTSIVDKQYFANDGLL
                     VKDVFLKICTALQYCHSMGVYHCDIKPENILLDASDNVYLCDFGLATDSKYLAPNVCV
                     GSFYYMAPERILYSSAPLETETAVLPTATSDIWSLGIILINLVCMRNPWLKAHQGEDA
                     TFQFFIENNKILQKILPISDELLDVLGDILCLEPCRRIALDVLMAKIRSIKKLTPDGP
                     LSQIPEIEPHKPIAAMTISQDLDDEDEVDELHPDFSEQTRMLSGAATPFEEITVTGTS
                     TCSTTTAISSSYENSGMLCKGDFTIATDEFTSHQKLLEEKLLKLQSESLTTTGNSGNW
                     LPEY"
     gene            <512839..>515919
                     /locus_tag="CAGL0I05412g"
                     /db_xref="GeneID:2889266"
     mRNA            <512839..>515919
                     /locus_tag="CAGL0I05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447484.1"
                     /db_xref="GeneID:2889266"
     CDS             512839..515919
                     /locus_tag="CAGL0I05412g"
                     /inference="similar to AA sequence:UniProtKB:P35729"
                     /note="similar to uniprot|P35729 Saccharomyces cerevisiae
                     YKL057c NUP120 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447484.1"
                     /db_xref="GeneID:2889266"
                     /db_xref="InterPro:IPR021717"
                     /db_xref="UniProtKB/TrEMBL:Q6FQL0"
                     /translation="MAQLAKVDLDLLQICQGNGEFVHLLENSKGSPESFASAYSQSMR
                     LTNGEFLCYHISTDYKSISFYNFKNASDGRTIIIHLPAKLMHEHHTLVVEEQEGVIVV
                     DVILESSAFLTMRLPLEYIFGIENVLDDNWLSMQSPYDFTVRRPHLLHKVSQDFFVVF
                     LEDGGLLGLRQHNENYLEPLLFNDYSYIQTLTSMFSRKKKQPADRAVACLVIHDKYLV
                     VLTRLCHLKIWDLGSFHLVQEYNLTENFNGTLETIEYESNGNYISTLNDVIVIYLPIG
                     NGVFKFGRLSFTNDGERKPTFNMFSSIDANMKKSTIWSFVDMKLTDPLELNFTSTTFN
                     LIILWKSGSNSKLQILNIKDSSFSDFEWIEASNKSLQNFQTEEISALIQNYDFDKALY
                     KLKSHYSDMTFKEADSLLLANNIVYSENNETQQQQYLANLDTLLRDINNNHSEIASFT
                     IYKNDMILVNTHNLYNHGFYKINSSLENIYFNLSEITDNDDQFAKYFKLLNLFFSTIS
                     RDAILSTSDKFNDIAIRKHEHSTNISTAFSQIFNECLKSKFEKNNVKTLFAELATYDI
                     IEILNELIENHLKDTSYHLDNFVEAFTGNVMNSSIIIENLYHQIVVQNKLLQLVLLSF
                     LFLDFDTNIFGDKIETLLDINYKQTFFMSFYEFDSKLTQSSMSMHTLQYPHGVQIFSS
                     SELAGYLEFEIATLYSTPIVDSRLYIAFMQEYVLNWREKMEPPQKAINFFKYILEPLY
                     RRNEIDEEFLLAMSMFNCGRFEQAYEFFTMNDYMLHLANKLPPFLKNVQQNSLWYELL
                     KTFTESSTNAHYYLQLSLLFKTYNRLDLALKCVSKSVEYSMKHPSVEEAPEFSKTQHL
                     AYLDLLVEFKMYEEVIDVLRMSQTVLDKSTRKECFYKLLSNSCHGPNFFTILLNSCNT
                     QEGSKPCLSHRDFVIIDEILINSLKSNKWEDCKKIFTFRLTNNRDREAAEIVYEYLQD
                     LVPQQYQEKQKCYLFILNVLKTFDNVEDQWIIYDGKVKKLIDLKTEFCKLSSAI"
     gene            complement(<516462..>516824)
                     /locus_tag="CAGL0I05434g"
                     /db_xref="GeneID:2889267"
     mRNA            complement(<516462..>516824)
                     /locus_tag="CAGL0I05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447485.1"
                     /db_xref="GeneID:2889267"
     CDS             complement(516462..516824)
                     /locus_tag="CAGL0I05434g"
                     /note="highly similar to uniprot|P32774 Saccharomyces
                     cerevisiae YKL058w TOA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447485.1"
                     /db_xref="GeneID:2889267"
                     /db_xref="GOA:Q6FQK9"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK9"
                     /translation="MAVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETF
                     DKVVSETLKDNAQSKLTVKGNLDTYGFCDDVWTFIVKKCQVTVEGPASALNPTDEPQT
                     TLSVDKLRIVACNSKKSD"
     gene            <517269..>518633
                     /locus_tag="CAGL0I05456g"
                     /db_xref="GeneID:2889268"
     mRNA            <517269..>518633
                     /locus_tag="CAGL0I05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447486.1"
                     /db_xref="GeneID:2889268"
     CDS             517269..518633
                     /locus_tag="CAGL0I05456g"
                     /inference="similar to AA sequence:UniProtKB:P35728"
                     /note="similar to uniprot|P35728 Saccharomyces cerevisiae
                     YKL059c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447486.1"
                     /db_xref="GeneID:2889268"
                     /db_xref="GOA:Q6FQK8"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK8"
                     /translation="MSSTIFYRFRSQKDSSRVLFDGTGLTVFDLKREIILDNKLGDGT
                     DFQLRVYNPDTDEEYEDDAQVIPRSTTVVVRRSPAAKTFSIHSRNKGGLAATMGNATR
                     YITGRPRVFQQQAGGSIQPQQQQRAGSEAAAVSGMTEEERIASMFATQENQWEQAQQE
                     MSTATPVMSKPITSGANAENDGPPPPGYMCYRCGSRNHWINNCPTNTDPNFEGKRIRR
                     TTGIPKTFLKSVEVNPETMTPQEMAEKKIMVTDEGKFVVQVADKQSWEDYQRKIKNRL
                     IDSDAAIYQPGHFSDLPEELKCNLTGGLLKQPVRTTACCDKLVSKKIMEDTLLDSDFV
                     CPLCDKEDVLLDSLVEDEEIQKKVNEFLKDHEDQNENSKRKADGQTDNGEAKKAKVDE
                     NEINSETLNSSAVNSPEKKNESPQKPLPMPIPPVPFGMPAFPMPFMPFMPPQQNSNQN
                     SSNQ"
     gene            complement(<518933..>519673)
                     /locus_tag="CAGL0I05478g"
                     /db_xref="GeneID:2889269"
     mRNA            complement(<518933..>519673)
                     /locus_tag="CAGL0I05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447487.1"
                     /db_xref="GeneID:2889269"
     CDS             complement(518933..519673)
                     /locus_tag="CAGL0I05478g"
                     /note="highly similar to uniprot|P33296 Saccharomyces
                     cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447487.1"
                     /db_xref="GeneID:2889269"
                     /db_xref="GOA:Q6FQK7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /translation="MATKQAQKRLTKEYKMMVENPPPFIIARPNEENILEWHYVISGP
                     PDTPYDGGQYHGTLTFPSDYPYKPPAIRMITPNGRFKENTRLCLSMSDYHPDTWNPGW
                     SVATILNGLLSFMTGDESTTGSITTTQQEKKILAKKSMYYNTFNSTRFKLVFPEIVEK
                     NITELQRRKQEEKDMSMFEKKEDPLVKAAREKAIEVKDIVNPEDRIRAEQALKELEKQ
                     HNDKPNGSSSMFYIGVALFLFLVGLFMK"
     gene            <520414..>521373
                     /locus_tag="CAGL0I05500g"
                     /db_xref="GeneID:2889113"
     mRNA            <520414..>521373
                     /locus_tag="CAGL0I05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447488.1"
                     /db_xref="GeneID:2889113"
     CDS             520414..521373
                     /locus_tag="CAGL0I05500g"
                     /note="highly similar to uniprot|P38620 Saccharomyces
                     cerevisiae YER099c PRS2 ribose-phosphate
                     pyrophosphokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447488.1"
                     /db_xref="GeneID:2889113"
                     /db_xref="GOA:Q6FQK6"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK6"
                     /translation="MSTNSIKLLAGNSHPELAELLSRRLGIPLSKVGVYQYSNTETSV
                     TIGESIRDEDVYIIQTGIGAQEVNDFLMELLILIHACKTASVRRITAVIPNFPYARQD
                     KKDKSRAPITAKLIAKMLETAGCDHVITMDLHASQIQGFFHIPVDNLYAEPSVLNYIR
                     TKTDLKNTILVSPDAGGAKRVASLADKLDLNFALIHKERQKANEVSRMVLVGDVQGKS
                     CLLIDDMADTCGTLVKACDTLLEHGAKEVIAIVTHGIFSGSAREKLANSKLSKIVCTN
                     TVPVDIDLPIVDQVDISPTLAEAIKRLHNGESVSYLFTHAPPA"
     gene            complement(<521749..>523923)
                     /locus_tag="CAGL0I05522g"
                     /db_xref="GeneID:2889270"
     mRNA            complement(<521749..>523923)
                     /locus_tag="CAGL0I05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447489.1"
                     /db_xref="GeneID:2889270"
     CDS             complement(521749..523923)
                     /locus_tag="CAGL0I05522g"
                     /note="some similarities with uniprot|P39967 Saccharomyces
                     cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
                     cerevisiae YBL067c UBP13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447489.1"
                     /db_xref="GeneID:2889270"
                     /db_xref="GOA:Q6FQK5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK5"
                     /translation="MFKKLLHITPDFHPDSRKSSPVQKEDSFKRKSGERIGDNYRPRI
                     IPNAAASQRKSIIGQSDYDLANGTTNYNDLANEARNYVAIPQEQLLHRYEHDSQIPTI
                     VDTNVTKLMPFGDGSNKVFGYENFGHTCYCNSVLQCIYNLPEFRKSILQFPQRYPLKS
                     RVRVEEFHSLHERNYINEVVGQQEQEAISINESVTSLNSHQTQTRSTNTQPELSTKSQ
                     SNKTIDDDKKKENRKSFFKDLYKIRTTSSNATDSGYLGDKSIYTEYSADSSPKDDDTD
                     KESYSNTTYDSTNSQSKPSQPQSKPAGYFDTVGEKLHGDCRKVIVGNPELNKTYSQTY
                     FNVSESSNDLNIEIRKKLALIHGPVINIDHLLYKDQPHFLYYALKDIMECITENRYLS
                     GVVSPAEFVKLLKRQNPLFNSTMQQDAHEFLNFLLNNISDFAGKYKSNYLKSSNEEEC
                     EISHDFVKDQFEGVLLNRIKCLTCDCVSANEEPFLDFPIEIQNDEAINIQDTFRSFYQ
                     REILCGPNKFYCNECCGLQEAEKTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYP
                     LTLTVCSCFDNSLCKTYELTGVVLHVGASPTHGHYVSICKHEKYGWLMYDDETIESIP
                     EEAVTSHVGEPNNPITAYVLFYSEKIQNKKTQLSDELAYNNNINKLMSYETWLRNKDM
                     VEKQCTTNYSNITTNLSKHSKCAPKIAQHSKRRPKFLTFIST"
     gene            complement(<524948..>526099)
                     /locus_tag="CAGL0I05544g"
                     /db_xref="GeneID:2889271"
     mRNA            complement(<524948..>526099)
                     /locus_tag="CAGL0I05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447490.1"
                     /db_xref="GeneID:2889271"
     CDS             complement(524948..526099)
                     /locus_tag="CAGL0I05544g"
                     /note="highly similar to uniprot|P25454 Saccharomyces
                     cerevisiae YER095w RAD51 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447490.1"
                     /db_xref="GeneID:2889271"
                     /db_xref="GOA:Q6FQK4"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR016467"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK4"
                     /translation="MTEVHEDHGVPDSQVNVSPISTAPAETTQSSTNRSMDYNSGEQL
                     FHQEQYEEGMEEDAALASFVPLEKLQVNGITSTDIKKLRESGLHTVEAVAYAPKKDLL
                     EIKGISETKADRLLNEAARLVPMGFVTAADFHMRRSEMICLTTGSKNLDTLLGGGIET
                     GSITELFGEFRTGKSQLCHSLAVTCQIPLDLGGGEGKCLYIDTEGTFRPVRLVSIAQR
                     FGLDPDDALNNVAYARAYNADHQMRLLDAAAQMMSESRFSLIVVDSVMALYRTDFSGR
                     GELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMSFNPDPKKPIGGNIMA
                     HSSTTRLGFKKGKGCQRYCKVVDSPCLPEAECVFAIYEDGIGDPREEDE"
     gene            complement(<527038..>527676)
                     /locus_tag="CAGL0I05566g"
                     /db_xref="GeneID:2889336"
     mRNA            complement(<527038..>527676)
                     /locus_tag="CAGL0I05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447491.1"
                     /db_xref="GeneID:2889336"
     CDS             complement(527038..527676)
                     /locus_tag="CAGL0I05566g"
                     /note="highly similar to uniprot|P32897 Saccharomyces
                     cerevisiae YNR017w MAS6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447491.1"
                     /db_xref="GeneID:2889336"
                     /db_xref="GOA:Q6FQK3"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005681"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK3"
                     /translation="MSSWLFGKVGGNVEKKEEQKDDKLGFDSSQLTDISTLISAPGAL
                     DPARLHPLAGLERGVEYLDLEEEQLSTMEGSQGLIPSRGWTDDLCYGTGAVYLIALGI
                     GGVSGFIQGVKNIPPNSPGKLQLNTILNHVTKRGPFLGNNAGVLALSYNLINSSIDAF
                     RGKHDTPGSIVAGALTGALFKSSKGLKPMAYASAIVATTAGAWSAAKHKVLE"
     gene            complement(<528542..>529657)
                     /locus_tag="CAGL0I05588g"
                     /db_xref="GeneID:2889337"
     mRNA            complement(<528542..>529657)
                     /locus_tag="CAGL0I05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447492.1"
                     /db_xref="GeneID:2889337"
     CDS             complement(528542..529657)
                     /locus_tag="CAGL0I05588g"
                     /inference="similar to AA sequence:UniProtKB:P53720"
                     /note="similar to uniprot|P53720 Saccharomyces cerevisiae
                     YNR015w SMM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447492.1"
                     /db_xref="GeneID:2889337"
                     /db_xref="GOA:Q6FQK2"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK2"
                     /translation="MDMYAGKLVLAPMVRAGELPTRLMALKYGAGLVWSPEIIDKKLI
                     QTQRVENSSLSSVDYVMPSGVLVFRTVPSLERGKLIFQIGSADPALAKEAALKVIQDV
                     DGIDLNCGCPKHFSIHAGMGSALLKKPEKLCSILKELVEHVGTPHGKPISCKIRLLED
                     EASTLELVKMICDTGIRNLTVHCRTTPMRNRETPIRDYIDSIFSVCKKAGVSLLINGA
                     IRHREEFEQLFSYNPEIGGMIAEAAESNPTVFSKDVLPWHQTVKEFLEIAKKYENNIG
                     NTKYMLSRLVPGKSKFFQYYAQCKTVEDLDHISSLIDDNGEPKGDPSEYLIKRREEEK
                     LLKRQEGERKALERKLAKQQKRELEVESDSNKKPKLD"
     gene            complement(<529962..>530369)
                     /locus_tag="CAGL0I05610g"
                     /db_xref="GeneID:2889338"
     mRNA            complement(<529962..>530369)
                     /locus_tag="CAGL0I05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447493.1"
                     /db_xref="GeneID:2889338"
     CDS             complement(529962..530369)
                     /locus_tag="CAGL0I05610g"
                     /note="some similarities with uniprot|P53719 Saccharomyces
                     cerevisiae YNR014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447493.1"
                     /db_xref="GeneID:2889338"
                     /db_xref="GOA:Q6FQK1"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK1"
                     /translation="MSEAMNDYYTPLNTPLEAHLVYHDDKAELNVRTPASSRQGSITS
                     LSSSMCDTEAKDCSCSGCVSPLVQCESYTDTTSLSRTNSNINSNMNSNMNSNMNSNMN
                     SMNSMSSTVRGCRKHHHRRPSMALKFDKPIVYK"
     gene            <531308..>533968
                     /locus_tag="CAGL0I05632g"
                     /db_xref="GeneID:2889339"
     mRNA            <531308..>533968
                     /locus_tag="CAGL0I05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447494.1"
                     /db_xref="GeneID:2889339"
     CDS             531308..533968
                     /locus_tag="CAGL0I05632g"
                     /inference="similar to AA sequence:UniProtKB:P27514"
                     /note="similar to uniprot|P27514 Saccharomyces cerevisiae
                     YNR013c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447494.1"
                     /db_xref="GeneID:2889339"
                     /db_xref="GOA:Q6FQK0"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:Q6FQK0"
                     /translation="MKFSHSLQFNSVPEWSSKYIAYSQLKKLIYSLQKEKLYSSTPDL
                     STAASESSELQPLLDVPEDENSSYVRRFVQALDHEVKKIEKFYLSQETGLIANYNELK
                     DDVHEYEQELTSANFLYPSQSLTGAVPTGGNAKKLRRRRLSSTSSMESNNSGLPLSVD
                     SAPGAIVPPEHHRPSIEAQKSRSSTVNNNSLNLSNFEPLNPQLQHKVTLKKRLVMVYT
                     QLSELKDFIDLNKTGFTKICKKFDKSLDTAIKKPYLKQLELKTHVFNPETFAKIEQTI
                     RETIITYARLSEDQLPITIESISQQTGNPDVEHQALALEEDELVDYENAEKELSEHLR
                     DHVVWERNTVWKDMMNLERKSQTAKTQDKGPGSFGQFRKKKLLIKETDDGVAFETGTD
                     AAGKIVPPVTISDAVRLPLVNYVKLLLQSQKAVSFLFIFSIFLILLKSSPFDDIKQKN
                     CFAILVFASLLWATETIPLFVTSLLIPFLVVVLPVLKDPNTDGPMSAKDSSQFILSTM
                     WSSVIMLLLGGFTLAAALSKYNIAKVLSTYILYSAGTNPHLILLTNMGVALFVSMWVS
                     NVAAPVLCYSIIQPMLRTLPTKSTYAKSLILGIALASNIGGMASPIASPQNIFAIGVM
                     DPPPSWGEWFVVSIPVCTVSVVAIWLLLTLTFPLESSLKILRLHPTHDPFTLKQWFVS
                     IISITTIVLWCLSNKLSGVLGEMGIISIIPLVVFFGTGLLTSDDFNNFMWTIVILAMG
                     GTTLGKAVSSSGLLSTIASMIKESVEKQHIFVIVLIFGLVILTMATFVSHTVAAMIIV
                     PLMGEIGSDLPGGDHSRLLIMVAAFLCSGAMGLPTSGFPNVTAISMIDEVGDRYLTVG
                     TFIKRGVPAGFITYFVVVTLGYSLMKLIGL"
     gene            complement(<534119..>535549)
                     /locus_tag="CAGL0I05654g"
                     /db_xref="GeneID:2889340"
     mRNA            complement(<534119..>535549)
                     /locus_tag="CAGL0I05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447495.1"
                     /db_xref="GeneID:2889340"
     CDS             complement(534119..535549)
                     /locus_tag="CAGL0I05654g"
                     /inference="similar to AA sequence:UniProtKB:P27515"
                     /note="similar to uniprot|P27515 Saccharomyces cerevisiae
                     YNR012w URK1 uridine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447495.1"
                     /db_xref="GeneID:2889340"
                     /db_xref="GOA:Q6FQJ9"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ9"
                     /translation="MHDMTGNSTEARRSSVHLNDQHKYIPPWTTPYIIGVGGTSGSGK
                     TSVANKIVSSINVPWTVLISLDNFYKPLNEAERERAFNNEYDFDEPNAIDLDLAYDCI
                     LSLKEGKKTSIPVYSFTHHNRDPHKQIPIYGASVIVLEGIYALYDQRLLDLMDLKVYV
                     DADLDICLARRLSRDIVARGRDLQGCLLQWERYVKPDAVKYVKPTMAKADAIIPSMSD
                     NTVAVKLLIKHIESKLELKSEEHMTELVKLGQSGTGPLSDYKNLEVLPQTNQIKAIHT
                     ILLDRNVDRDEFSFQFDRIATLLLANTLNDIPVQKPETIITPDGFSVPGQRRCCFDEV
                     TAISTIRSGDCFMKAVKKAFPAMAIGKLLIQSDSLTGEPQLHCEFIPEDISKYRKILI
                     MDSQIISGAAMIMAVQVLLDHKVDIENIHILVYMATELGIRRIINAFGNRIKITAGIV
                     VERNEIKNKKASWALTRFVDNKYFGC"
     gene            <535983..>538259
                     /locus_tag="CAGL0I05676g"
                     /db_xref="GeneID:2889341"
     mRNA            <535983..>538259
                     /locus_tag="CAGL0I05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447496.1"
                     /db_xref="GeneID:2889341"
     CDS             535983..538259
                     /locus_tag="CAGL0I05676g"
                     /note="some similarities with uniprot|P20095 Saccharomyces
                     cerevisiae YNR011c PRP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447496.1"
                     /db_xref="GeneID:2889341"
                     /db_xref="GOA:Q6FQJ8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ8"
                     /translation="MKSEQDRNRSKNCKSRYGPHRDASGSGTQSKGNHVKKSTSRYNK
                     GDNWEDRQLKHALKNPKVDDIVVAGQEQYDFVFDSDAMIDFSKEDEIDGYDDEEYEKK
                     LLEALDKESARVQSMKDSRKSLPVYQFRQELLDVIRNNQVVIIVGETGSGKTTQLPQY
                     LVEDGFTKGNKYQIAVTQPRRVAATSVAARVADEMDVKLGQEVGYSIRFEDKTTPNKT
                     LLKYMTDGMLLREFLVDRTISKYSCIMIDEAHERTIATDLLLGLIKTILKDRPDLRII
                     ISSATMNAAKFSKFYDDCPIFKVPGRRFPVDIHYTLQPESNYLNAAITTIFQIHTTQE
                     LPGDILVFLTGQEEIETMKDKLDAIMAKLGSRIPQMLITPIYANLPQEQQSRIFQPTP
                     VNCRKVVLATNIAETSLTIDGIKYVVDPGFVKENSYLPSAGMSQLLTVPCSKASVDQR
                     AGRAGRVGPGKCFRLFTKWSYQNELEMMPKPEILRTNLSQTVLLLLSLGVKDLINFPL
                     LDKPTIPSLKKSLENLYILGALNSKGQITKLGKIITEFPCEPEFAKVLYSAAVDERCT
                     GVLEECLTIVSMLHETSSIFSGQKKEAVAAIIGEVESDHMLYLEVYNQWKNANYSRMW
                     CQDHKVQHKTLSRVRNIRNQLVRCCKKLKLDSIEKTTSELDVTERVTKSFISGFPANI
                     VQLGTMGYQTMGKSTGGLPINIHPSSVVFQNQLDSKKPPKHLLYQQLMLTSKEYIRDC
                     IPIKEVSWLKEMVPQLFS"
     gene            <539916..>542789
                     /locus_tag="CAGL0I05698g"
                     /db_xref="GeneID:2889342"
     mRNA            <539916..>542789
                     /locus_tag="CAGL0I05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447497.1"
                     /db_xref="GeneID:2889342"
     CDS             539916..542789
                     /locus_tag="CAGL0I05698g"
                     /inference="similar to AA sequence:UniProtKB:P16862"
                     /note="similar to uniprot|P16862 Saccharomyces cerevisiae
                     YMR205c PFK2 or uniprot|P16861 Saccharomyces cerevisiae
                     YGR240c PFK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447497.1"
                     /db_xref="GeneID:2889342"
                     /db_xref="GOA:Q6FQJ7"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ7"
                     /translation="MVKNSMVHGVTRVDLTAYSAESFENAIQFYLAFLVLDELDQNED
                     GGVVLANSHVYIKISYKEDGEMERKVNDRLMNLIEKTTSGDWRAVSSNVLVYTVDDIG
                     LVKETLKRIGLPHQAYPTELTPAQIYTLDPLGNVVGFTGNKLAIATEIPFVLPTEEDD
                     ESELSSKESSYTNLTSLMRTTSGYPSLPFGHSRTHRNIAILTSGGDAPGMNSVIRAVV
                     RTALFKGCRVYIVREGLEGLVKGYIEEFFWEDVGGWNSQGGTNIGTAKSNAFLQRRGR
                     LLAARNLIIHDIDSLIVCGGDGSLAAADIFKHEWHSLISELLSSHLIKIEQLHSHKHL
                     TICGISASIDNDIPVTDASIGAYSALDRICKALDYIQVTAESTSRAYVVEIMGGNCGW
                     LTLLAGIATAADYIFLPECPQQKEDWRTHLQRIVKRNRRNGRRNTLVLLCEGAVAADS
                     TPITSRDVHQVLSEELDIDTRITVLGHVQRGGAPVAYDRILATLQGVEAVSVILESTP
                     DTPSYLIAVKENKILRKDLQDAVRQTFKISTSLKDREFEKAFRAKEAEFIEHYHNFLA
                     INAADQDKKLVKSASLLNIAIINIGAPAGGMNSAVYAMASYCMWKGHRPIAIYNGWSG
                     LARHESIRSLKWSEIVGWQSRGGSEIGTNRETPNEADVGMIAYYFQKYKIDGLIIVGG
                     FEGFESLRQLEKARELFPAFRIPMVLIPATLSNNVPGTEYSLGSDTALNSLTEFCDNI
                     GISSAATKDKAYVVEVQGGNSGYLATLTSIAIGACATYVPEEGISLVQLSEDIETISK
                     SFDCVQTGDHAGKIILKSQNASKAMSAEKLANIITEEAAGKFEAKSVIPGHLQQGGTP
                     SPIDRTRATKLAIRAVDFILEKSKVLKSQDDVIYEHTKELTESAVVLGVKGSNILFTS
                     VKQLYLFETNVRDRMPKVIHWDGIRTLSDHMAGRRRIYEDEDN"
     gene            complement(<543158..>544306)
                     /locus_tag="CAGL0I05720g"
                     /db_xref="GeneID:2889343"
     mRNA            complement(<543158..>544306)
                     /locus_tag="CAGL0I05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447498.1"
                     /db_xref="GeneID:2889343"
     CDS             complement(543158..544306)
                     /locus_tag="CAGL0I05720g"
                     /note="highly similar to uniprot|P23644 Saccharomyces
                     cerevisiae YMR203w TOM40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447498.1"
                     /db_xref="GeneID:2889343"
                     /db_xref="GOA:Q6FQJ6"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ6"
                     /translation="MSAPEVSKITAIPPISLNEDREKSSFWSANPLSSFVIDTYRQLH
                     AHRQSLSLVNPGTVENLNKEVSRDVFLSQYFFTGLRADLNKAFTLNPAFQTSHTFSIG
                     STSLPNYAFSALFANDNLFMQGNIDNDFSLSGRMNYGWNKNNISKINLQIANGQPTMC
                     QLEQDYQASDSSLNFKSLNPSISSNGTLTGVYVGSLLQSISPQLAVGLEVLYSRADAK
                     TPADSGVSYLTRYVSPKQDWIFSGQLQANGALVASFWRKVAPNVEAGIETTLQAGMIP
                     ITDPVMGTPIGIQPTIEGSTTIGAKYEYRQSVYRGSVDSNGKIGCFLERKILPTLSVL
                     FCGEIDQFKQESKIGCGLQFETAGNQELLMMQQGLDADGNPLQALPEM"
     gene            complement(<544936..>545394)
                     /locus_tag="CAGL0I05742g"
                     /db_xref="GeneID:2889346"
     mRNA            complement(<544936..>545394)
                     /locus_tag="CAGL0I05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447499.1"
                     /db_xref="GeneID:2889346"
     CDS             complement(544936..545394)
                     /locus_tag="CAGL0I05742g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447499.1"
                     /db_xref="GeneID:2889346"
                     /db_xref="GOA:Q6FQJ5"
                     /db_xref="InterPro:IPR011425"
                     /translation="MTAPRLISKYRIQIHRISENMVLNNDGLKEISTLLVSASDREPE
                     VKLEKTKDNSSSDITTPPAEFIPSIFFSLHKIRKDPNNVSSQLETSTGFIRHRIKRCK
                     ALLQENEEVRNLLANSIEEWENIIADKEQQLRVKAKVLRDLDARIEKITN"
     gene            complement(<546028..>546909)
                     /locus_tag="CAGL0I05764g"
                     /db_xref="GeneID:2889344"
     mRNA            complement(<546028..>546909)
                     /locus_tag="CAGL0I05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447500.1"
                     /db_xref="GeneID:2889344"
     CDS             complement(546028..546909)
                     /locus_tag="CAGL0I05764g"
                     /note="weakly similar to uniprot|P53718 Saccharomyces
                     cerevisiae YNR009w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447500.1"
                     /db_xref="GeneID:2889344"
                     /db_xref="GOA:Q6FQJ4"
                     /db_xref="InterPro:IPR013734"
                     /translation="MVMSLERLPLQEYTKSAMNNLATSGPVIMTSLTEGSSLSKNSVG
                     MGLGMKLPSIHSLINQKNSYNPFQTTLHSKSFSVGDPIKANNSKPLGVTLTSTDSNKR
                     LNTSISALLTDNKSPGKANKPETEKETMNHLVQEDTVDKAHYTELSKKLQIRLQLAYY
                     KYRTKQEHVKFNELKALHSSKPKKASKKNTKRRKLVVSHGNFKTPAKRKEHKLYTTNT
                     HNLQDVSTDISMSSSTSSLMSKRDSSLQFHDSNDTTNDFTTPIRNANKRHLGQKQDTP
                     MSVKAAKSLIFLYSSKV"
     gene            complement(<547982..>550024)
                     /locus_tag="CAGL0I05786g"
                     /db_xref="GeneID:2889345"
     mRNA            complement(<547982..>550024)
                     /locus_tag="CAGL0I05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447501.1"
                     /db_xref="GeneID:2889345"
     CDS             complement(547982..550024)
                     /locus_tag="CAGL0I05786g"
                     /note="some similarities with uniprot|P40345 Saccharomyces
                     cerevisiae YNR008w LRO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447501.1"
                     /db_xref="GeneID:2889345"
                     /db_xref="GOA:Q6FQJ3"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ3"
                     /translation="MVARHRNRKREVSRSSVYESSDVTSETGVRGDTVEYDIDTEQPI
                     HLNRHELQRRASTASRHSKEGDDQDENEKDEQLLDRIIPRRQRKRWRDSKRFVFSMGA
                     LLGLLISVYFGAVHVHGNNKELLDGIMNFDVFRDYFDDWKDILPDGFTNFLTDIQTNY
                     LAASSVQNLTQSFGVGKQYLAEYNVTTRHPVVMVPGVISTGIESWGVIGDEECDSSPH
                     FRKRLWGSFYMLRTMVLDKVCWLKHVKLDPETGLDPPNFTLRAAQGFESSDFFIAGYW
                     IWNKVLQNLGVVGYDPNKMTTASYDWRLAYLDLERRDKYFSKLKSQVELFYQSTGEKV
                     CLVGHSMGSQVVFYFLKWVEAEGPEYGNGGKDWVAKHIDSFINVAGTLLGAPKAVPAL
                     ISGEMKDTIQLNAIAMYGLEKFFSRKERLEMIQTWGGIPSMLPKGGNLIWGDMDFAAE
                     DSQHNNTDTYGNFIRFENVSNDDEFKKNLTMNDSIELVRRLSPKWLKERIDEQYSFGY
                     SKTEDELKENEKNHKYWTNPLEVPLPNAPDMKIYCFYGLNNPTERAYVYKEQKTDNQS
                     SLNLTIDYDSSQPVYFTEGDGTVPVITHAMCHKWAQGQSAYNPAGMNVTIVELKHQPD
                     RFDIRGGPNSAEHVDILGSAELNEYILRVATGNGDSIEQRILSNMSEWVKEINFPL"
     gene            <550402..>551331
                     /locus_tag="CAGL0I05808g"
                     /db_xref="GeneID:2889347"
     mRNA            <550402..>551331
                     /locus_tag="CAGL0I05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447502.1"
                     /db_xref="GeneID:2889347"
     CDS             550402..551331
                     /locus_tag="CAGL0I05808g"
                     /inference="similar to AA sequence:UniProtKB:P40344"
                     /note="similar to uniprot|P40344 Saccharomyces cerevisiae
                     YNR007c AUT1 essential for autophagocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447502.1"
                     /db_xref="GeneID:2889347"
                     /db_xref="GOA:Q6FQJ2"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /translation="MIRSALSNWREYLTPVSHKSTFLTTGQITPEEFVQAGDYLCHMF
                     PTWKWNDMADDNKYRDFLPKDKQFLVIRKVPCSERAQAVVTMDEIENGTSTDAFSAAD
                     DEDNDDDSIEIIPVSKSSSGADNDVNDIDELMEEMELEEDDDIVANKTNEMLRYYDLF
                     ITYSTSYRVPKMYIVGFNGNGTPLTPKEMFEDITPDYRKKTATIEKLPFYKRNVPSVS
                     IHPCKHANVMKVLLDKISVVKERQREEEMQKNAEVGAPKSAGSDDGDNENWEDLQQDI
                     DDSLRVDLYLVVFLKFITSVTPTIQHDYTMEGW"
     gene            complement(<551583..>553394)
                     /locus_tag="CAGL0I05830g"
                     /db_xref="GeneID:2889348"
     mRNA            complement(<551583..>553394)
                     /locus_tag="CAGL0I05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447503.1"
                     /db_xref="GeneID:2889348"
     CDS             complement(551583..553394)
                     /locus_tag="CAGL0I05830g"
                     /inference="similar to AA sequence:UniProtKB:P40343"
                     /note="similar to uniprot|P40343 Saccharomyces cerevisiae
                     YNR006w VPS27 vacuolar protein sorting-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447503.1"
                     /db_xref="GeneID:2889348"
                     /db_xref="GOA:Q6FQJ1"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017073"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR018205"
                     /translation="MATTSSEEFSEVIERATSESIPNGELNLPVALEISDILRSRRIA
                     PKDGMRCLKKRITNTTNNPNTQLSSWKLVEICIKNGGIPFLREICSREFMDTMEHTIL
                     KYDDSDEVVELVTTMLYELYLAFQNDSQLNYVSRVYDKLRQRGVKFPEGAPISSNVNA
                     LFDSKTPADWIDSDACMICSKKFSLLNRRHHCRSCGGVFCQDHSSKSIPLPDLGIYDS
                     VRVCDNCYDDYDYKKGSGSQGKKRKHRKSHRHATEDEDEDLRKAIELSLRASNSSVEP
                     VIPVVESEPQIPAVEEEDPDLKAAIEASLREAEEEKRRREEHAQQQNTNAYPQQFRPP
                     ANELTPADEEDIYLFASLVERMKTRPPSEILDDPQLQQLAQKVFASKPRLGNTLNSKI
                     QKYNTLVDMNGKISHIMNTYDNLLEQELRNINLSERFNVPQAQADPYSQYSQYNQPAI
                     QNNTSQTNNVVNNKPLSQRESEPQYTAPTDSQTIESKAYERQLENLVQPPSNVNNERV
                     ASEPPYPNEELNDITSIQLNSERAGKYEENAVPPGSIPYPIENDDQDETTRTKKNDNI
                     TNFDFPTVPARKLPENNVEQVEDKPQDSQEEALLIEL"
     gene            complement(<554011..>555597)
                     /locus_tag="CAGL0I05852g"
                     /db_xref="GeneID:2889222"
     mRNA            complement(<554011..>555597)
                     /locus_tag="CAGL0I05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447504.1"
                     /db_xref="GeneID:2889222"
     CDS             complement(554011..555597)
                     /locus_tag="CAGL0I05852g"
                     /inference="similar to AA sequence:UniProtKB:P20438"
                     /note="similar to uniprot|P20438 Saccharomyces cerevisiae
                     YPL256c CLN2 cyclin or uniprot|P20437 Saccharomyces
                     cerevisiae YMR199w CLN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447504.1"
                     /db_xref="GeneID:2889222"
                     /db_xref="GOA:Q6FQJ0"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:Q6FQJ0"
                     /translation="MTNGQSLGLIVTAKQKYYPIELSNAELLAHYEMIQEYQQDISAN
                     VLEQSMKFKPNPKLIDQQPEMKPEDTREAIVTFLFELSVMTRVTNGIFVQAVRLYDRY
                     CSKRVVLKDQAKLVVATCLWLAAKTWGGCNHIINNVIVPTGGRFYGPNPRARIPRLSE
                     LVLYCGGSNNFDESMFLQMERHILDTLNWDVYEPMLNDYVLNADENCLIQYELYERQL
                     EHRRKRQSQASTDSDATVDDIDLDIKGHSIEEDDEDEELKSKIQLINLKRFLMELASF
                     KYEFLSFELFEVAQGIFHIINRFASSDQGPFLATPATNMEKQSKLETLFIDAITETPK
                     SLAEVYKNQPGISAFITSINNYKSILQKKLELAASLDLSRTIPVSCNYESISSSNMPS
                     PVYSAQSHTPMRNVSANSENSIFSVMEQSSPITPQMYSFEHKPGGSVCGSSPSVSSLV
                     NYRTKRGYDQDISDTSMNMENKENIHPNGVASHIAPPRAKFVGTGMYHSPSDSSHNAG
                     ANSSRSSLISLPVANVNSIM"
     gene            complement(<558102..>558845)
                     /locus_tag="CAGL0I05874g"
                     /db_xref="GeneID:2889223"
     mRNA            complement(<558102..>558845)
                     /locus_tag="CAGL0I05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447505.1"
                     /db_xref="GeneID:2889223"
     CDS             complement(558102..558845)
                     /locus_tag="CAGL0I05874g"
                     /note="highly similar to uniprot|P41277 Saccharomyces
                     cerevisiae YIL053w RHR2 or uniprot|P40106 Saccharomyces
                     cerevisiae YER062c GPP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447505.1"
                     /db_xref="GeneID:2889223"
                     /db_xref="GOA:Q6FQI9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI9"
                     /translation="MPEPITLRVNAALFDVDGTIIISQPALAAFWRDFGKDKPYFDAE
                     HVIHVSHGWRTYDAIAKFAPDFADEETVTKLEGEIPDKYGKEAIEVAGAVKLCNSFNE
                     LPKEKWAVATSGTREMASKWFAVLGIKKPTYFITANDVKKGKPNPEPYLKGREGLGYP
                     INTHYPEKSKVVVFEDAPAGIAAGKAAGCKIIGIATTFSASSLREKGCDIVIKDHRSV
                     RVAGYDKETDEVILVFDDYLYVRDDIQKW"
     gene            <560169..>562505
                     /locus_tag="CAGL0I05896g"
                     /db_xref="GeneID:2889224"
     mRNA            <560169..>562505
                     /locus_tag="CAGL0I05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447506.1"
                     /db_xref="GeneID:2889224"
     CDS             560169..562505
                     /locus_tag="CAGL0I05896g"
                     /note="some similarities with uniprot|P14680 Saccharomyces
                     cerevisiae YJL141c YAK1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447506.1"
                     /db_xref="GeneID:2889224"
                     /db_xref="GOA:Q6FQI8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI8"
                     /translation="MVQIYYNENQALEPMQHNQANGIWKASYMDEANADSKRFAFTNP
                     WGNEKIDEDEAMSYNYSSANSTADVDMNSDMYKRRKSSLVVPPSRAAAPNPFQYETMQ
                     NSTGTAQRAMYPESSAYQQQRQIMVPHQQQGQLASRFNSRFVPSLYNPQEFQRRQSLA
                     TAQFSTPSSLHGSASNQAFNTGSGNNGVNLNYASANVTTNNSSTYLSAMTPNVPMEMG
                     NIPLASPHRRLSAFPTSGTTNSSLQPPFKQLRRDEGSPRQIVIPQMHRCHSKNDLQPC
                     INPNPKFRRASLHSNTISPLIGLTKSLLTTYALCSPDFTYQTSKNPKRVLTKPSEGKY
                     NNGYDNVNSDYILYVNDVLGTEQNRKYLVLDILGQGTFGQVVKCQNLQTKEIIAVKVV
                     KSRSEYLNQSISEAKILELLNEKIDPNNKHHFLRMHDSFVHKNHLCLVFELLSNNLYE
                     LLKQNKFHGLSIQLIRTFTIQILDSLCVLKDSKLIHCDLKPENILLCSPDKPDLKVID
                     FGSSCEETRTVYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGSS
                     EFNQLTRIITTLGYPPTWMIDMGKSSHKFLKKLNTLNLDMTNINDVEAQNNNANYTTA
                     NRMQKNQPTAKYRLKTIEEFNRDNNASEKVGKQYFKWALLEDIIRNYRIHKNIQKSPE
                     LIEQEMKNRECLIHFLKGILNLNPLERWTPQQAAMHPFITQQPFTGKWFPPGSFNTMN
                     TSNFGSQPRQEGNNSNNMKPNSQEGPTKEFTNLKIIED"
     gene            complement(<563497..>563982)
                     /locus_tag="CAGL0I05918g"
                     /db_xref="GeneID:2889225"
     mRNA            complement(<563497..>563982)
                     /locus_tag="CAGL0I05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447507.1"
                     /db_xref="GeneID:2889225"
     CDS             complement(563497..563982)
                     /locus_tag="CAGL0I05918g"
                     /note="highly similar to uniprot|P39515 Saccharomyces
                     cerevisiae YJL143w TIM17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447507.1"
                     /db_xref="GeneID:2889225"
                     /db_xref="GOA:Q6FQI7"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005678"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI7"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGAIGGVVWHGIKGFRNSPLG
                     ERGLGAMSAVKARAPVLGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIAGFFTGGAL
                     AVRGGWKHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPEGAGSAPPQPLQ
                     A"
     gene            complement(<564527..>564775)
                     /locus_tag="CAGL0I05934g"
                     /db_xref="GeneID:9488010"
     mRNA            complement(<564527..>564775)
                     /locus_tag="CAGL0I05934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999513.1"
                     /db_xref="GeneID:9488010"
     CDS             complement(564527..564775)
                     /locus_tag="CAGL0I05934g"
                     /inference="similar to AA sequence:UniProtKB:P47009"
                     /note="similar to uniprot|P47009 Saccharomyces cerevisiae
                     YJL144w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999559.1"
                     /db_xref="GeneID:9488010"
                     /db_xref="GOA:B4UN16"
                     /db_xref="UniProtKB/TrEMBL:B4UN16"
                     /translation="MIYSNNDTNHRRVMRSKKEEPIYFGREQTEDADRLGDFAVTNQP
                     RSPVVYYFIEIRQPRYSNYTDNSNHGRTAGSADNSSPI"
     gene            complement(<565844..>566725)
                     /locus_tag="CAGL0I05940g"
                     /db_xref="GeneID:2889226"
     mRNA            complement(<565844..>566725)
                     /locus_tag="CAGL0I05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447508.1"
                     /db_xref="GeneID:2889226"
     CDS             complement(565844..566725)
                     /locus_tag="CAGL0I05940g"
                     /inference="similar to AA sequence:UniProtKB:P47008"
                     /note="similar to uniprot|P47008 Saccharomyces cerevisiae
                     YJL145w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447508.1"
                     /db_xref="GeneID:2889226"
                     /db_xref="GOA:Q6FQI6"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /translation="MKFENDNEKQVFDKLSRSLGNIIETKCDGYDELYGHKICKEIGS
                     ADEVQQYYNEDIAQSLLFKLCKAYQFNYDEIVTHLVKILKWRKKFNPLSCAFKETHNK
                     ELEDVGILTWYPEEEPNKRVVTWNLYGKLVKKKELFKDVQKFLRYRIGLMEKGIQLLN
                     FQDEENCYMTQVHDYKTVSVWRMDSDMKSCVKEVINTFQTYYPELLYAKYFVNVPSVF
                     AWAYDIIKTFVDENTRKKFVVLNDGKKLGKYLKQCPGDQFGGSSKSTIFEQNVKKVKP
                     TAYASYLLERQEIEDVE"
     gene            complement(<567117..>568832)
                     /locus_tag="CAGL0I05962g"
                     /db_xref="GeneID:2889227"
     mRNA            complement(<567117..>568832)
                     /locus_tag="CAGL0I05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447509.1"
                     /db_xref="GeneID:2889227"
     CDS             complement(567117..568832)
                     /locus_tag="CAGL0I05962g"
                     /note="some similarities with uniprot|P46958 Saccharomyces
                     cerevisiae YJL146w IDS2 IME2-dependent signaling protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447509.1"
                     /db_xref="GeneID:2889227"
                     /db_xref="GOA:Q6FQI5"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI5"
                     /translation="MDYHAGEEFSGELDAALRKSWSESQREVSVGDDQEVQEFFKNGG
                     RVGNALSGIIASPIGTPSNMSQYEMDMDTESDVATTSSAVPQESSAIDVRRDNEGAPV
                     FNQNMGTVIMRNTFDETRHSPSPHSSALHNDLHMTQIRDLSQNTTNDPQSHMNYSTNI
                     PENTMRVTKEDSHEQNSHHGRKPRKSRHSHGSDSSQQDTDYQIFKHHYSIPENKKESV
                     SNILNDLNLGSSTDSSDINGSGIDSKRSSNSISTARRSSVKDIQWMRQLLNPRSSFSG
                     TSGNEPSIANPRNGSVETRSSYTSTSSNGSISESSKCWVTVIDNDSMVPAVVVLQRSL
                     QRCGSKYELVVLHPSSYNPEHLHEYGVRTTVAFNQCMPPFLLMTQDNSNRSIDVDLNL
                     VHSNWNKLSIFTSLVGTYDLICYISPSCMILQSIDDLLDSKEIFDEIDNEMCVLLTNQ
                     DSQNPNSNDPQIIIFKPNNEVSLCIKEFFTIYGDDKEDKINKSLRLKDLGVLKELFGE
                     TWGYISSDNYCRTLMQDEACPTNGAMRIIDFKALKPWEHMKELENIGQESLCHKWWSF
                     FSTQI"
     gene            <569761..>570963
                     /locus_tag="CAGL0I05984g"
                     /db_xref="GeneID:2889228"
     mRNA            <569761..>570963
                     /locus_tag="CAGL0I05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447510.1"
                     /db_xref="GeneID:2889228"
     CDS             569761..570963
                     /locus_tag="CAGL0I05984g"
                     /note="weakly similar to uniprot|P47007 Saccharomyces
                     cerevisiae YJL147c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447510.1"
                     /db_xref="GeneID:2889228"
                     /db_xref="GOA:Q6FQI4"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI4"
                     /translation="MAGGAQRRFFSQIVRLLKSKSKSNHKVLVDDAQLKETLKYIIED
                     KRVLPGGLRSLLPGSLEGTDEDVQKHSERLASLLNATLPTVSDKKRQVESHYDLLFGQ
                     LKNMVEESLHDTGKSSHNRTLSAHNQMNKSETLFNRLILLLLTGGDTVSTKSIAELIL
                     SPDFKEYSKVWDNIKLFPESKRLDISILLYYSSKNKNIMDAYEEEWISRYHDLNVITQ
                     RLFWRFMDPLGKVSECCERIRYWQPRDTIVMYQSLYSTAHFLPTEFHYVDNLQLSNNQ
                     IFFIKALRFLAQYRQRSLLQVPREPVNATTKQTKTAKNWASDIVKLSIQNKLSLDKRL
                     KDDSEMVPVYSYRFLRALDVNLQEICGLDSLNDENLAHLQADLNTLLTSLHEEEQTLK
                     SHMSLFFV"
     gene            complement(<571191..>571922)
                     /locus_tag="CAGL0I06006g"
                     /db_xref="GeneID:2889229"
     mRNA            complement(<571191..>571922)
                     /locus_tag="CAGL0I06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447511.1"
                     /db_xref="GeneID:2889229"
     CDS             complement(571191..571922)
                     /locus_tag="CAGL0I06006g"
                     /inference="similar to AA sequence:UniProtKB:P47006"
                     /note="similar to uniprot|P47006 Saccharomyces cerevisiae
                     YJL148w RPA34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447511.1"
                     /db_xref="GeneID:2889229"
                     /db_xref="InterPro:IPR013240"
                     /db_xref="PDB:3NFF"
                     /db_xref="PDB:3NFG"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI3"
                     /translation="MSKIDRLSKEYVSDSDSDDEVVAKYQPPSDYKQCKHLKSFPVSE
                     LKGDNKELWLLKVPANIDISQLKSLPLDTDATVSTVELGSKNFNVLQNTSTQEGSDNT
                     NLSLLIPSEKKKETLKVATSKDNKSVYFDRVFTISETARIPSIDIEKVKVPRKDVPKV
                     EGLITRHFATGYDAKDFGIEEVVAPKKRSKSDADEDISRHNHELTESPSKHKKHKKEK
                     KEKKDKKDKKDKKDKKDKKSKDKSK"
     gene            complement(<572526..>574262)
                     /locus_tag="CAGL0I06028g"
                     /db_xref="GeneID:2889370"
     mRNA            complement(<572526..>574262)
                     /locus_tag="CAGL0I06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447512.1"
                     /db_xref="GeneID:2889370"
     CDS             complement(572526..574262)
                     /locus_tag="CAGL0I06028g"
                     /note="some similarities with uniprot|P47005 Saccharomyces
                     cerevisiae YJL149w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447512.1"
                     /db_xref="GeneID:2889370"
                     /db_xref="GOA:Q6FQI2"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI2"
                     /translation="MEFPLLKLSDGLLQELLSHCPQQDRLNLCLVNKRLHRLVSKLVY
                     RRIYLNDSNVVRSDFMNLAVNWSLFSIPSFLNEDESRAIANGKLAKLIQTFHRNPENT
                     LHLVQWIRINWDLDPVLQKQVLNMLCANGHSLQRLENVIDPSCNDIIALGKVSAANVT
                     SFDMAPPNSLPELSVPQDYIPNLSHYLRQRISSKLSHMTLFIDPIKLFNYLYPLNEKL
                     QIIDLKLHWRREFFPQKYFSEQTNTLIKPGEQRKSLTKLSEVFDIRSLKILTIISWNE
                     SLISREIEIIEEFKEFVYLEDLSLISIKQDIKVLVSLFSELKRLKRLKMDFLEDYVPE
                     PTSPQIFLAILLNCKDLQFIDLRFEGVDLPIITLQESKFELTQKCYCSSCMHVFENIL
                     KDKIFHFEEDYELNDIHDIAAKDIFKMMRYLSLLPYSKACDCYPSVRTQPMNLTEFVS
                     KINANILLYRQSRSQLVKKSEYDDEDDFNSFHLPHRPLTKDDIVKCYHALIHHFKSTY
                     FTFLRGFPKLRFLMLNDIPTITVEEDGERIFQPIFYHSGYQTNLTGWSKQFKKNTNAS
                     EPNDVAKKATVI"
     gene            <575188..>576804
                     /locus_tag="CAGL0I06050g"
                     /db_xref="GeneID:2889369"
     mRNA            <575188..>576804
                     /locus_tag="CAGL0I06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447513.1"
                     /db_xref="GeneID:2889369"
     CDS             575188..576804
                     /locus_tag="CAGL0I06050g"
                     /note="highly similar to uniprot|P11986 Saccharomyces
                     cerevisiae YJL153c INO1 myo-inositol-1-phosphate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447513.1"
                     /db_xref="GeneID:2889369"
                     /db_xref="GOA:Q6FQI1"
                     /db_xref="InterPro:IPR002587"
                     /db_xref="InterPro:IPR013021"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTVNKGISIRVNNVGDKVSYKENELLTNYTYHTNVVHTNSDKTQ
                     FEVTPLDKNYQFKVDLNKPERLGVMLVGLGGNNGSTMMAAVLANKHNVCFRTRDKEGL
                     TEPNYYGSLTQSSTIKLGVDSKGKDVYVPFNSLVPMVNPNDFVVSGWDINGATMDQAM
                     ERASVLEVDLRNKLAPMMKDHKPLKSVYYPDFIAANQDERADNCLNVDPQTGKVTTTG
                     KWEHLNHIRNDIRTFKQQNDLDKVIILWTANTERYVEILPGVNDTMENLLEAIKNDHT
                     EIAPSTIFAAASILEHCPYINGSPQNTFVPGLIELAEKNDSLIAGDDFKSGQTKMKSV
                     LAQFLVDAGIRPVSIASYNHLGNNDGYNLSSPQQFRSKEISKASVVDDIIESNPILYN
                     DKLGNKIDHCIVIKYMHAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLII
                     DLIVMTEFCSRVTYRNVDGQDGAEAKGDFENFYPVLSFLSYWLKAPLTKPGYQPINGL
                     NKQRTALENFLRLLIGLPAIDELRFEERLK"
     gene            <577324..>580149
                     /locus_tag="CAGL0I06072g"
                     /db_xref="GeneID:2889372"
     mRNA            <577324..>580149
                     /locus_tag="CAGL0I06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447514.1"
                     /db_xref="GeneID:2889372"
     CDS             577324..580149
                     /locus_tag="CAGL0I06072g"
                     /inference="similar to AA sequence:UniProtKB:P34110"
                     /note="similar to uniprot|P34110 Saccharomyces cerevisiae
                     YJL154c VPS35 protein-sorting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447514.1"
                     /db_xref="GeneID:2889372"
                     /db_xref="GOA:Q6FQI0"
                     /db_xref="InterPro:IPR005378"
                     /db_xref="UniProtKB/TrEMBL:Q6FQI0"
                     /translation="MSYSDSVETAASVISQQTGLMNRCLGQNKLMEALQHCSVMLTEL
                     RNPNLTPKQYYELYVMIFDSLSVLSTYLVENHPKYHHLADLYELVQYTGNVVPRLYLM
                     ITVGTSYLRIPDAPVIEILKDMIEMCRGVQNPIRGLFLRYYLSQRTKELLPDDELEFN
                     ANFIMNNFIEMNKLWVRLQHQGPLRKRELRTKERKELQILVGSQLVRLSQIIDDNFDM
                     YDKQILPTILEQVVQCRDFVSQEYLMDVICQVFSDEFHLQTASTLLKTTLQLNPDVSM
                     NKIVLILIERLNSFKGRKVEEENEKQKQASEIKDKNEHGTVENGSSANGESSKTNEKE
                     IPDINSKPLPDVDIFDVFANYLELLNKERPDLSLQQFIPLIESVIKLTLQWYPDNLKN
                     INRLFTFTAQKYKDYGKMIPKDIDTLMIKLLTFENSTCEGNERDSFFFYRILTECDSF
                     PELLGLQSVETQRVAISEILDYLTINITDDIEVKTNISTPLSTTADSSDITPQGKLFI
                     INTKSELEKLLSLSDSLIHKTDKVNKRTSTEGNDQLSAGALPDDDFEYDIVEEKLARF
                     CHIICKSLTLSPTLNSVESQIECYLTMKNHYYKAGKKCLYTYPAIITNFWKLVRRCNI
                     MLKEGQQKEEERKTIENNIKQIFKFISRAMNDMFNVCGPIAYDTVYKMNLECAALADQ
                     LSLSEISYDFFSQAFTIYEESINDSKDQFQAILLMTQTLQKTRSLHKEDYYDSLIVRC
                     TLHGSKLLKKQDQCRSVYLCSHMWWATELSAIGEEEGVTTNFFREGKRVLECLQRALR
                     VSDSIMDNVQSCELMIEILNRCLYYFIHGNEKDTHITVKYINGLIELIKTNIKALQTE
                     AESYMSDDPSHEISHLESAVSQLKMQDYVMGLDGSLVQVSNGMNSPTSEATVKATLQI
                     PIQHFARTCSYIREQGAIDERFQVIEL"
     gene            <580628..>581980
                     /locus_tag="CAGL0I06094g"
                     /db_xref="GeneID:2889373"
     mRNA            <580628..>581980
                     /locus_tag="CAGL0I06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447515.1"
                     /db_xref="GeneID:2889373"
     CDS             580628..581980
                     /locus_tag="CAGL0I06094g"
                     /note="highly similar to uniprot|P32604 Saccharomyces
                     cerevisiae YJL155c FBP26 fructose-2 6-bisphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447515.1"
                     /db_xref="GeneID:2889373"
                     /db_xref="GOA:Q6FQH9"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH9"
                     /translation="MPVTTISNMNDSRICVVMVGLPARGKSFISQKILRYLSWLSINA
                     KCFNVGNYRYKAGVIKPDAKFFDFNNPEGYRVREEAAQQAVSDMLKWYEEENGVVAVL
                     DATNSTRKRRDWILEICAQNNIMPMFIESWCDNEKIVETNVIDISTTSPDYEGSDPEE
                     SKRDLYNRIACYRDAYETLSLENDNNMTFVKLVNIEDEIIINKIQSYLQSRIVFYVMN
                     IRPKPRTIWLSRHGESIYNVEKKIGGDSLLSPRGVQYSKKLKELVDEHVGDAPLTVWT
                     STLVRTQQTAQHLPYKKLQWKALDELDAGVCDGMTYEEIEEVYPEDFKARDEDKYEYR
                     YRGGESYRDVVVRLEPVIMELERQENVLIITHQAVLRCIYAYFMNVPQEESPWMSIPL
                     HTLIKLEPRAYGTKVTRIKANIPAVSTYKEKGTSQVGESAADLSKFQKLLVDAPELKN
                     "
     gene            <582481..>584523
                     /locus_tag="CAGL0I06116g"
                     /db_xref="GeneID:2889371"
     mRNA            <582481..>584523
                     /locus_tag="CAGL0I06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447516.1"
                     /db_xref="GeneID:2889371"
     CDS             582481..584523
                     /locus_tag="CAGL0I06116g"
                     /inference="similar to AA sequence:UniProtKB:P47002"
                     /note="similar to uniprot|P47002 Saccharomyces cerevisiae
                     YJL156c SSY5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447516.1"
                     /db_xref="GeneID:2889371"
                     /db_xref="GOA:Q6FQH8"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR012985"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH8"
                     /translation="MVKKLFGFNKKNGIRGHSESDKEKNEGVGSRNNSTDNKAESSIH
                     DDRSTRISSSVQSSSIFSKGRRTYNSGDSSLRSSTGKNGNPVNEYRDLGTPLRIIDSS
                     RYASLATVNEEEQSTTDQSLDCPVVYSNQNSNKEILTMSNESHYLVKAIKNLENNLLD
                     LMDDVHQNVTNISRAVICATEYFKNFIQETSLPSLTNGTVNYRVKMESCPSVRGITKI
                     IFHFYDNLLNTEAYSNSRSILFRRYLSFLKKLEIQQDTTERDAQAMVLPSLKIFPIDD
                     SCNLPHKDRIYEIMEDIIKSDTKLLSEDEGSFIAAVLRGVEKDASILSIVFGLPTIRQ
                     EHQEMIKALYGLFPDVHFYCIQDYIKPAATTAIMPELKGTQQLNNINKEEQSYRFSPP
                     YRTLENGNTPPISLSISTQNSLKMSGTLGGYVYPQVDSDSKLAQYAGATFAITCAHVV
                     LAESQDYPEVAVPSRVLQKSYHKTLLEESSRYPQGSKEQRAFADEALQVERSMKLQNQ
                     EKFGQVVWGERSIINQRLSDFAIIKVNPSMDCKNFLGNNLAQVPDPTLKFENVYVKKK
                     IMKIQPGTKVFKIGASTGYTTGVVNAVKLIYWADGKLQSSEFIVSSPQPLFASGGDSG
                     AWILTKLEDRVGLGVLGMLHSYDGERKQFGLFTPIGDILERLHTVTGIYWDIDRMA"
     gene            <585873..>588320
                     /locus_tag="CAGL0I06138g"
                     /db_xref="GeneID:2889376"
     mRNA            <585873..>588320
                     /locus_tag="CAGL0I06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447517.1"
                     /db_xref="GeneID:2889376"
     CDS             585873..588320
                     /locus_tag="CAGL0I06138g"
                     /note="weakly similar to uniprot|P21268 Saccharomyces
                     cerevisiae YJL157c FAR1 cyclin-dependent kinase inhibitor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447517.1"
                     /db_xref="GeneID:2889376"
                     /db_xref="GOA:Q6FQH7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH7"
                     /translation="MFLRTPVKIQTSEKSIHTPPRDDDTLLRGPAKKLFRSFTEKSDN
                     HSKHQNSSPQDVFLPNQMYLRTPDMSPEGKSTSKKRNIPKPLDFSQITTPPQSLKKTS
                     ANYHRDNWGQSHIKLSPLTTKPSHKKMVTSTSTIMRENVSESFSYGKNNYNRLSLDTV
                     PSQRESLLSGSSTCSSLKKYNNQKCSICDEEMTVTFKGEKILELDCGHLSHYDCFMAI
                     FEETHSINELPICQICGSQCQPCDEDIFSDITSQLLTLKRSLGISNTNSNHGMNSIAA
                     RAIFEREQQVTPVERIIKPSQITSAGFKTPTLSCTPAIEKPVEEEDGYETDIFVSSSS
                     TSSMIINGLTIDLEEKLSNSDSEDVEELLPLVTKPYDDTIQLEFPEPCMDVDMKSACQ
                     FSNRTGLKKSICSQENPQFNEFAFRRNLSDYIHNLLSITSFDSTGDLHMFSNFAFSTD
                     GEFWTQPILVFLFEKCLTLFEADSRNIIGQLPVNQISSTSELRHNNEEIIVIDLKSCL
                     FPQIFLKNHEVAFYKQEKIKKWLYYLTDIGRVRPPLIDLTDCSINVIPIELSISYEQE
                     VLRQRINQKSMPQPWDSDLLKRKLCLVVCIDLHKSDPNESNASDILGKILNTLCLDDM
                     LGLVLVGKNGNGEVGPYGTFIGPVNKKWEGWIDVIRDIELWLSDDHNYEFISTEEKIK
                     VILHTCRRITTMMQSDSDSSNVLRNLVIIQAGEDKLEETLLNISDGAKKDYDSVTQTN
                     HFSISTCKATDITSHINTLRSDDKLDVTISNEENVMWLGHMQEGRVYHYKNSFKGNVT
                     LEWRDKDSIHHKTEFTL"
     gene            <590802..>591503
                     /locus_tag="CAGL0I06160g"
                     /db_xref="GeneID:2889374"
     mRNA            <590802..>591503
                     /locus_tag="CAGL0I06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447518.1"
                     /db_xref="GeneID:2889374"
     CDS             590802..591503
                     /locus_tag="CAGL0I06160g"
                     /note="highly similar to uniprot|P47001 Saccharomyces
                     cerevisiae YJL158c CIS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447518.1"
                     /db_xref="GeneID:2889374"
                     /db_xref="GOA:Q6FQH6"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH6"
                     /translation="MQFKNVALTAAVASVAAADGYTPGNPWSTLTPSGTVACAKPEYT
                     ASFGIAVKPISSSVAKRAVVSQIGDGQIQATSAAPKPTNAAASQVADGQVQQKTTSTT
                     KATTTLAPSSSKTSSTSTSTSCAATPLTIKESSCKNDGTLQLTLKGGVLTDGKGRVGS
                     IVSNRQFQFDGPPPQAGAIYAGGWSITEQGNLALGNSDVFYQCLSGNFYNLYDQKIAE
                     QCSPINLEVVSLVDC"
     gene            complement(<592439..>593461)
                     /locus_tag="CAGL0I06182g"
                     /db_xref="GeneID:2889375"
     mRNA            complement(<592439..>593461)
                     /locus_tag="CAGL0I06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447519.1"
                     /db_xref="GeneID:2889375"
     CDS             complement(592439..593461)
                     /locus_tag="CAGL0I06182g"
                     /note="highly similar to uniprot|Q03178 Saccharomyces
                     cerevisiae YKL164c PIR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447519.1"
                     /db_xref="GeneID:2889375"
                     /db_xref="GOA:Q6FQH5"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH5"
                     /translation="MQYKKTLAASALATSALAAYVPGQPWSTLTPSATFKGGITDYAS
                     TFGIAVQPIATPASVAKRAVSQIGDGQVQATTKTTSTLAPKAPISQIGDGQIQATTKT
                     QAAPVSQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTQ
                     AAPVSQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTAVSQIGDGQIQATKTATAGAS
                     QIQDGQVQASNQGKAPNDPVGAVSCKVDGTLEMNLKGGILTDGKGRIGSIVANRQFQF
                     DGPPPQAGAIFAAGWSLTPQGNLALGDNDVFYQCLSGNFYNLYDQHIGSQCTPVHLSA
                     IDLIKC"
     gene            <595682..>596731
                     /locus_tag="CAGL0I06204g"
                     /db_xref="GeneID:2889152"
     mRNA            <595682..>596731
                     /locus_tag="CAGL0I06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447520.1"
                     /db_xref="GeneID:2889152"
     CDS             595682..596731
                     /locus_tag="CAGL0I06204g"
                     /note="highly similar to uniprot|Q03178 Saccharomyces
                     cerevisiae YKL164c PIR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447520.1"
                     /db_xref="GeneID:2889152"
                     /db_xref="GOA:Q6FQH4"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH4"
                     /translation="MQYKKTLAASALATSALAAYVPGKPWSTLTPSATFKGGITDYAS
                     TFGIAVQPIATPASVAKRAVSQIGDGQVQATTKTTSTLAPKAPISQIGDGQIQATTKT
                     QAAPVSQIGDGQIQATTKTKAAPVSQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTQ
                     AAPVSQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTKATGVSQIGDGQIQATKTGST
                     TPSQPPMNNSTIPVPNNNATLPVNAKDPVRAESCKVDGTLEMNLKGGILTDGKGRIGS
                     IVANRQFQFDGPPPQAGAIFAAGWSLTPEGNLAIGDNDVFYQCLSGNFYNLYDQHIGS
                     QCTPVHLSAIDLIKC"
     gene            <597520..>598887
                     /locus_tag="CAGL0I06226g"
                     /db_xref="GeneID:2889153"
     mRNA            <597520..>598887
                     /locus_tag="CAGL0I06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447521.1"
                     /db_xref="GeneID:2889153"
     CDS             597520..598887
                     /locus_tag="CAGL0I06226g"
                     /note="some similarities with uniprot|P46997 Saccharomyces
                     cerevisiae YJL162c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447521.1"
                     /db_xref="GeneID:2889153"
                     /db_xref="GOA:Q6FQH3"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /translation="MSINDVTIDTSTYYSILGVPTNASTNEIRKSYMKLAKKLHPDKT
                     KSEHTAELFKLVVDAHSILNNDQLRAEYDKKLILEGRFELHQHGAKQKNKDIRKGYTF
                     KRNSKPYEQQPYGFGVQVPKGPHEESNYEANSNPHNENSSNNDTKMKSTNLHDTLSKD
                     SEDKHGTDDASDIQPPTKSNDIANEVGSKRKSNSKDIHQDHSSNIGLNPLKKKKLEKK
                     AVHATTTESRRYMRKKSEKKATPPIQPLADLQINDDWEKLREVLQRIEKEDSRGGKEF
                     TLDIDVNEQMYNLSMESSDDEHTIPTKKRAKVGSNIQGNSRYFAQTAAYDMNQINANL
                     GTRNTEDDRQASSKISITEIDDILDLLKERVPSPPKLGHLGVQRDQQNRALEYIKYTD
                     ELKKRILYVLSNSSTTEAMQHFNRHTQSVLAHKTMELRLCEKLTEIQKCQQGVIEYFS
                     RTALG"
     gene            <600351..>602792
                     /locus_tag="CAGL0I06248g"
                     /db_xref="GeneID:2889154"
     mRNA            <600351..>602792
                     /locus_tag="CAGL0I06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447522.1"
                     /db_xref="GeneID:2889154"
     CDS             600351..602792
                     /locus_tag="CAGL0I06248g"
                     /inference="similar to AA sequence:UniProtKB:P38970"
                     /note="similar to uniprot|P38970 Saccharomyces cerevisiae
                     YJL165c HAL5 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447522.1"
                     /db_xref="GeneID:2889154"
                     /db_xref="GOA:Q6FQH2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /translation="MGESNTAAPPSRSRSLSASIKGLFGKNSISSNEINGKKEAFVQS
                     GTREDQRYNEEHHLKKIDTKASVPKKDTQLSPLSAPGSYLKKSTSIASSLHLNSGKQS
                     VTSSRAQSISSDGNGFLSQESFISEEHEDDIDDTTYYDKSTRGFTNLSKEVESYSISR
                     KNSIQQSRKASVDDNEVDKRNAHFPDSDTTIDSVLGDKNKNQKVMNQINSISNISRSG
                     SVPANPPILSSKSRRGSNAMSIRSPSVRSTASIVSGNSNSEVITPSSKPATQNISEDG
                     NIKKTDNTLKCVINSKHFKVYENGFHEHHLPVIDLVKGDSTDSLNSSTVSKGTEGIEI
                     NRQKSSFSLTGIFKKKNGDKMNELLDTEPFGNASSLMPTKAFCPRYKTKDGSMIEEPL
                     EQETTHKKIPKIVNPYAAVGSEELKLITTLSDKIKKGLKNKDGQSRSGSQSGSASSSL
                     HTSPVASSTSLSSKFHHALVTCSEKYGDPVGVIGHGTYGVVRVCSRPLLISDSAPFPS
                     YCNDKKLFFAIKVLKPKDDEQLEKFSTRVTSEFIIGHSLSRRHKAHALQNKVCPSKRL
                     AHKAQRKLDWECPNILRVIDLMETNNTFIEVMELCPAGDLHSLLVSRSQSGNAIGSLH
                     PLEADCFMKQLLRGVQYMHDHGIAHCDLKPENLLFHPNGLLKICDFGTSSVFQTAWEK
                     HVHFQNGVIGSEPYVAPEVFQLGKDYDPRLIDCWSCGIVYCTMVFGQYLWKIAIENKD
                     SLYASFISQMKDENQFSLFEELRHVNADLNKLRKNVLYNMFQTNPEKRITVDKILHSS
                     WMKHTRCCVSYNHSV"
     gene            complement(<603314..>603598)
                     /locus_tag="CAGL0I06270g"
                     /db_xref="GeneID:2889155"
     mRNA            complement(<603314..>603598)
                     /locus_tag="CAGL0I06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447523.1"
                     /db_xref="GeneID:2889155"
     CDS             complement(603314..603598)
                     /locus_tag="CAGL0I06270g"
                     /note="highly similar to uniprot|P08525 Saccharomyces
                     cerevisiae YJL166w QCR8 ubiquinol--cytochrome-c reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447523.1"
                     /db_xref="GeneID:2889155"
                     /db_xref="GOA:Q6FQH1"
                     /db_xref="InterPro:IPR004205"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH1"
                     /translation="MSPPGAKAYMGWWGHLGSPKQKGITSYSVSPYAQKPLAHSMHNA
                     VFNTFRRVKSQALYVLIPAGIYYYWWINSRDYNEYLYTKAGREELERVNN"
     gene            <604448..>605224
                     /locus_tag="CAGL0I06292g"
                     /db_xref="GeneID:2889156"
     mRNA            <604448..>605224
                     /locus_tag="CAGL0I06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447524.1"
                     /db_xref="GeneID:2889156"
     CDS             604448..605224
                     /locus_tag="CAGL0I06292g"
                     /inference="similar to AA sequence:UniProtKB:P32800"
                     /note="similar to uniprot|P32800 Saccharomyces cerevisiae
                     YJL210w PAS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447524.1"
                     /db_xref="GeneID:2889156"
                     /db_xref="GOA:Q6FQH0"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="UniProtKB/TrEMBL:Q6FQH0"
                     /translation="MSRVAQLDSVVLDQEVDHLIWNIFQKDFKVSKYAEECQFLLRCL
                     VFICGSKSVDGVNTTTYGSRLSGVYYLCRKRTLFVSNILIHYLYRKLSNLYFSSNNIS
                     ERTLRLYRWISTLYGVLDLTTFLRFLLSDGNTKYLSLTNRLLGIVTSVDMLSPSSFYQ
                     DTVYAGLEYQNRQLLWNALLEVFNSTLMNSNKYLWDTRKKRDKPANETTCPECNGFPV
                     NPYRSSCCRANYCYICGMKALAREHCTNCGNTKPAMQQVY"
     gene            <605636..>607507
                     /locus_tag="CAGL0I06314g"
                     /db_xref="GeneID:2889157"
     mRNA            <605636..>607507
                     /locus_tag="CAGL0I06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447525.1"
                     /db_xref="GeneID:2889157"
     CDS             605636..607507
                     /locus_tag="CAGL0I06314g"
                     /inference="similar to AA sequence:UniProtKB:P07252"
                     /note="similar to uniprot|P07252 Saccharomyces cerevisiae
                     YJL209w CBP1 apo-cytochrome b pre-mRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447525.1"
                     /db_xref="GeneID:2889157"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG9"
                     /translation="MMNRFLQSSRLRFAIYNPSKVRSITTLSFNDLKDPKVFSKSEIK
                     NIQSYWVDQGNPYAERSSSLLVNCSVSELSKYLSRFSHRSFLVRELYRRELIYNSQEN
                     PEICQELIRNITKNSPVKLETCNDILAFIVQDSIRTNDVVMAVRLFLLFHKLNPSKAV
                     DGSIIQVLFSALAVKEPGDDSKSIRVCMNILNDLNNYDIDFKLKTGTVVRLIDKVLNL
                     KDNILGKAFAEKFIESNFFRSLSNDGKLEVLYCMIENGYNNKNDSQVVINWFRAKKYC
                     DQFSSLKVDIIHMLLKLANKENGYSYIGNDIIENLEPRYYCNSRLLLPEIIKFVTRTA
                     DLKKIQTLLNIIEQNISASNYNTVWLSKDNLCALLKMYLDFGDSQGVDNTLKHISDTY
                     GRIEAINHEVLISHLLEEGGLSKVKKAISLLFSLEGNSFLICAPKLLSYLLQSDQLAH
                     EAVVPNRHLLVNEIVEKAEIYDREYRTNFWDHLVELYFLKLLESGDSGNGDIRKSLLL
                     AKLIFINSVNSKTSPTYNPFSETSPDMLVVRLKQANMVEVLKRIAQVSFRTGNEDILQ
                     WSCAQLFGEGFTTSEVIVGIVSSKIENGISNTPKTYEQFWNMIDNEMQAPRLYEILK"
     gene            complement(<607677..>608645)
                     /locus_tag="CAGL0I06336g"
                     /db_xref="GeneID:2889158"
     mRNA            complement(<607677..>608645)
                     /locus_tag="CAGL0I06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447526.1"
                     /db_xref="GeneID:2889158"
     CDS             complement(607677..608645)
                     /locus_tag="CAGL0I06336g"
                     /inference="similar to AA sequence:UniProtKB:P08466"
                     /note="similar to uniprot|P08466 Saccharomyces cerevisiae
                     YJL208c NUC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447526.1"
                     /db_xref="GeneID:2889158"
                     /db_xref="GOA:Q6FQG8"
                     /db_xref="InterPro:IPR001604"
                     /db_xref="InterPro:IPR018524"
                     /db_xref="InterPro:IPR020821"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG8"
                     /translation="MLARHITLGVSGLALGSGITYLVLNRENKRTNLPSTGVKSGIVI
                     DPKTKINASGFFKYGFPGPVHDLENRGAFVSCYNRQTRNPYWVVEHMTPESLSQREGD
                     RKNSYFVEDEAIPEIFRSKLADYFRSGYDRGHQVPAADMKFSQEAMDSTFYLTNISPQ
                     VGEGFNRDYWAHLEYFCRGLTKKYDSVRVVTGPLYLPKWDPIEKKHKVTYEVIGNPPN
                     VAVPTHFFKLIVAEKPKTNNSTNNIAVAAFVLPNDRIPNETKLTDFEVPVNALERSTG
                     LEFLKNVPEKQRKKLCEEVNCQIVVRDFSKFANNKNKMLPPAPKVK"
     gene            complement(<608945..>614890)
                     /locus_tag="CAGL0I06358g"
                     /db_xref="GeneID:2889159"
     mRNA            complement(<608945..>614890)
                     /locus_tag="CAGL0I06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447527.1"
                     /db_xref="GeneID:2889159"
     CDS             complement(608945..614890)
                     /locus_tag="CAGL0I06358g"
                     /inference="similar to AA sequence:UniProtKB:P39526"
                     /note="similar to uniprot|P39526 Saccharomyces cerevisiae
                     YJL207c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447527.1"
                     /db_xref="GeneID:2889159"
                     /db_xref="GOA:Q6FQG7"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG7"
                     /translation="MAAQSLLELIRASNDLNSTLMKWTIDCIEYAATLDDESKIISTE
                     DMETIKIKKNEITEYIKYSTSLESEENQNSHLVILKLSYLCTLLLKLLQDEEGGAIFD
                     MAELLTKILNDEIVCSTEDDSDKKKKKKLSSSKSSTHSIAKDIASTILIQMNETFPKD
                     LSTLAPIIMTTALKCLKKNIEKSKYRHATYMTTLMQLINRVVRFANERDVDQQIYAKI
                     SKFSKSIFDSMATDNQEYPIEFIASLLDIWSHHYTSDTYIKEHKNDLLEHIHSKLCVS
                     IMGIYAFSNDKTRIVFARTIADILFSLHFSKQLISLEDALDFYVQLFCESKSRDIKSG
                     CFESLIHFISLNNNVNHSYLKGTNYLKIVKHLSTIFLDYNIKKKHLDSLSRYMRYFTY
                     MHRIFLPRIGESSKCQMLLNIVAIKTDDSEGGTEEVIKTLSQSVENQWATMVQLNLLT
                     LLLEDLSSTFATDKSLALKMKDALEELVVSNIFALRIFSTETFVTFLKQFPSFISDVI
                     EKGLTALTKNFENTENFDFSVNHGLAYMIANLIKICDSDFVPYELIMRITVFATSYIK
                     NHTTTTNGDVYFKGLICWILMTGLMNYPDEQYINMQKPQLQLFWKVLLTHTFSYNSED
                     ELYKNLEIRNHAMACLISFLNNCKIDEDLANQVSYLLTKCSNFNHSVSTKSKNIDNAL
                     IQNEHRILQVYLCLRKFIKSDFNSSLLILILRNFSDVNLYTMKTTSILNSVKKIGGKK
                     SDSKDDDKDPVVDYSVSSLLRQSDPFAYGLSSKIFDDQNGKESIEYPMSELKYTDIKH
                     WFQPYEFEVKRAVSPTILFDSLSMLYKNLPPLDHDVVRVTTSLIDSSMELFATVFPYL
                     NRKIQYSVIESLNLSMFSKMTVPMRSVAVSANVCTTLHDTLTHIHNSNLTLDNDVGQL
                     LLESIRKIEFFNDSYIATKKANCVGLIIAAMCRGVNEEDAKALLNDQTAKIINQIAET
                     DEPYLRTFEILSLANIYKYTLQASFFSTILDVIKTLIKDPHPVVHYWSLKALNIFLEK
                     HYQLDTSETGTILELLDEILLTDKYGIFGSSIINANYFSEYNSHHLVGEITCTITEIL
                     GPNLSFLNEIESEIFKELSVSLLLSNDIVSQYMALKIYENISTFKVVGLLKDNLFIKI
                     ITDILDNNISIGIGSNVFNSALTINNEVFPSSASTTACLKVLEIVTQLIRLQKGSLLP
                     EKLEVVTWRILNLFPSNEIVISYFEEYLLNTMSEIPNWLAKLVKIFNTSADRLFEDSN
                     IAKRAQKLDKDSENYKSNKEYSEGFANEVNETSGKEVTNDHIHWRFRKVLTRMILQVC
                     HEGFSSDSIQENIREQIPTLIKLAHQLSSISNEEMRLGGLNIIKLLLTRYAYIKDADT
                     NDYVLGIQEAQITSAIMPSFNWGSSPEVIRLAIEVAGDLITSDVIPLGNLPRVSKLLV
                     SGLSFFSDSTTNMKVMGIEVQTQKAKRKIELGILNAWADIVQTAYVNEDKELISFSKE
                     YWPILVPLWIVSLREYIMIKYEEEKKQVTKETSQSGSVNKKQLYDSVWLNFIQGISCV
                     MEHDLSVVLKSLDENELEGFTYILVIQCFEEIVRNIDNSLVKLDVLRVLSCILKCPLP
                     LDFIFEEDLNTEITDILSRLVTTGSLQEKTFLIEILDSLMKKYISINDTHELFLSGID
                     KMYELLRLIMLIIKDLLPFVQHTVSETTNSGKELNSMEVNLLRKTFKVLEQNIPSFDA
                     IFKLDLYACLLFVIGRIFLSDSNEALVPVILPLLKSIITDLVKSNEQKMLDIFYFSLE
                     EQLVNSITSESSMATYLLMITNGYNSIAESTLDTIADHLIAGLKDENSIDLTAHAIRS
                     ILKQSNSLPACSYLTRKLLPLMYNDVVKGSINSVSANIIISLVVYFATTISKDEKTSF
                     SKSVSIAILFIIAHAKSFPNHKDIAIRELNRIVSLEPTIVKEIIASLNDDQKAALDTM
                     AGLKTDIKQPANDHTVNLKSFAR"
     gene            complement(<615944..>619534)
                     /locus_tag="CAGL0I06380g"
                     /db_xref="GeneID:2889160"
     mRNA            complement(<615944..>619534)
                     /locus_tag="CAGL0I06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447528.1"
                     /db_xref="GeneID:2889160"
     CDS             complement(615944..619534)
                     /locus_tag="CAGL0I06380g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447528.1"
                     /db_xref="GeneID:2889160"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG6"
                     /translation="MAFKSFKYKLYAKGYHHSTATAAQSSTSFFDNGYYYYQQMRNRQ
                     VLHHVVPEEVGASTALHPAVVANNNFNNLECVLALHHDHDDSNAVNAASAVTANVATG
                     DGTDLTLGGRKHKSKNKRMVGLCKRNDNSKTQFVQKRFISNATNIESRASAAHFTPAE
                     ALQTADLLELEKEYNWEKDTDDDLNPQTYLSTHIDQINKHFVKGNYNIINALYKSLKR
                     NGIAIQDREVLTKVLISLARREMDDLDIDNKVFELLSCYQDIITNRIKPNLEIYNIVL
                     ETLFKSSIVAFKNKNGNGIDFYKIGSELLQTIMAAKDMNLSNDVINYCLLSTNLYPSF
                     IQLSALQQYINILPNYKKDSFYYISCLSYARLNNDLDSIKKLYEDYRQLLIDDPTDMS
                     IREDQYKVYSMFVSGLVECGELNLASKFLETFISKIRAENGSAENISTMLSTFIISVS
                     KIDCNKAHILWSKFNRLSWVPEFSYEFYLTLLANCFQDWGLTKKVYEYMFPMRRVFKE
                     NRENLSEYLLYPMGLESVLNSLMDFALQLKDTQIVLKLLEEAIVKGFTFETGIYPFIF
                     AYLKEVKCPEDYLLRLIQNQGELLLKSEKPEDVFMFFNAIADNFASQSLKSAITEMDL
                     FTESCRNFHLVDSNKINFQGFLSIFENSWNCPKTHSNYAKLIQLHAILVTRLLDFETF
                     PLVEHNEHLSQLKLRVIEKFQTLCTNYMNLNFDPNHISETTCEALRLIDAPENLINYF
                     SHPGDWDKSYPLSLGSMIRVSPSTGIKEYKKLLDDGYCFDYDTYKTLLSNNMSDLHIC
                     RQILKQLPIDEVDECKYISNILAFHATSTELTNLLLTDEKSIKYILPNMRDSSMVNFI
                     KNCGNIEVVVNRINFPEKFRGIAVQAERKETIKYIYGQLFKEKCYQEIIEYNKSCPVL
                     DLNVLLKSFIRTGDYGSFLALFDKYRDTLGSNGLDLQVEYLINNGQIDSAIEVVRSSN
                     LRTPHKTMDLFSFANFLKSFECDVAMHNAPENTLQLANILSTQNSFAGILSVFDMVRS
                     SGKLQSSEINLPSVKNELLSQMFNNLDDAVSFFGNIDGSIQEVFRTKLQSLLRFKAYL
                     KLPILSNRQIHQLVSIWSAIDPFAIDALFNNIVESFYLDDKVRILYLNEGITYPFNMN
                     ELNSIIDQIAFSFADRNDQENVQKARTFKIFLETNYIPSTIKFKENIAYS"
     gene            <620231..>621529
                     /locus_tag="CAGL0I06402g"
                     /db_xref="GeneID:2889161"
     mRNA            <620231..>621529
                     /locus_tag="CAGL0I06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447529.1"
                     /db_xref="GeneID:2889161"
     CDS             620231..621529
                     /locus_tag="CAGL0I06402g"
                     /note="highly similar to uniprot|P52917 Saccharomyces
                     cerevisiae YPR173c VPS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447529.1"
                     /db_xref="GeneID:2889161"
                     /db_xref="GOA:Q6FQG5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG5"
                     /translation="MSTGDFLSKGIDLVQKAIEYDTATQYEEAYTAYYNGLDYLMLAL
                     KYEKNPKSKELIRAKFTEYLQRAEQLKQHLDEEQEAKKKESTSVGAGSGSGSGSGKDD
                     EDTEDGKKLRGALSGAILSEKPNVKWEDVAGLEGAKEALKEAVILPVKFPHLFKGNRK
                     PTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGESEKLVKQLFTMAR
                     ENKPSIIFIDEVDALTGQRGEGESEASRRIKTELLVQMNGVGNDSHGVLVLGATNIPW
                     QLDSAIRRRFERRIYIPLPDVAARTKMFEINVGETPCSLTKEDYRNLGQMTDGYSGSD
                     IAVAVKDALMEPIRKIQGATHFRDISDDPDHRKLTPCSPGDEGAIEMSWTDIEADELE
                     EPVLTIKDFLKAIKNTRPTVNEEDLKKQEDFTKDFGQEGN"
     gene            complement(<621782..>622411)
                     /locus_tag="CAGL0I06424g"
                     /db_xref="GeneID:2889128"
     mRNA            complement(<621782..>622411)
                     /locus_tag="CAGL0I06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447530.1"
                     /db_xref="GeneID:2889128"
     CDS             complement(621782..622411)
                     /locus_tag="CAGL0I06424g"
                     /inference="similar to AA sequence:UniProtKB:Q06608"
                     /note="similar to uniprot|Q06608 Saccharomyces cerevisiae
                     YPR172w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447530.1"
                     /db_xref="GeneID:2889128"
                     /db_xref="GOA:Q6FQG4"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG4"
                     /translation="MPCTEKFPGHLIHLIKTSKYVHVGTCSKDCVPSVSLMNYSYIPR
                     DKTFDQENDKNDYIIFATNKDSEKYHNMVANPPVSLLFHDWITANNLSVRKASLSQTP
                     TPDPASTQLNPASGTGGGAIPNSHPSKLLNLLHELNQAELNQMSANIKGHAKIVNPAT
                     EESKFYKQLLLKTNPDAEVFILGDNTVIVKVKIESAKVTDSENNTAVYK"
     gene            complement(<622713..>624290)
                     /locus_tag="CAGL0I06446g"
                     /db_xref="GeneID:2889129"
     mRNA            complement(<622713..>624290)
                     /locus_tag="CAGL0I06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447531.1"
                     /db_xref="GeneID:2889129"
     CDS             complement(622713..624290)
                     /locus_tag="CAGL0I06446g"
                     /note="weakly similar to uniprot|Q12346 Saccharomyces
                     cerevisiae YPR171w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447531.1"
                     /db_xref="GeneID:2889129"
                     /db_xref="GOA:Q6FQG3"
                     /translation="MTKDAEVEEFLKRVEDLDGKINKPPIVKKKPQHLSTTPIENDDT
                     LDGNLVYKSAFNYEKSFGSKKPVGVIGLDKEDDRKFLVSEEDYKLLQKIKMEQQQQHL
                     SERHHRHIEPVRHIIPDRHSKPIFHNEPVIVREESEDEAPPLPSRNRASSENVVKSTT
                     SAPPLLPRRRYKDDITAKKLDVVSDNVNSSNKIKEMSSISDKNKSKPPLPEKKTFLKS
                     LEDNKLTTSNYKDQDKGPELKPTRNVDFLESVQLKSPPQSPSKMKTIEEKHFKLNSPK
                     KDGFIVSVLSSEENSRSSLSEKPSNEGNYHLSGGLTTKAEKKKPVVPPKKDIKLKDIE
                     LEKVDKTGKGGDGKQIEPEFQKIVLNKRTPPPVSKRKPSIPEALLKAQNLSKNTENKK
                     SVAQSKESIDMLPKLNKKGPPVPQRKVSMPEALKKLESMKNKNSTTENVQKDNGEESE
                     ISDSEPESINNKLESVLKRANTSGQIGSKHIGHLPPRAATTGDLLSKKEPHTTQSLSH
                     PNKSRSRGPKRKLPTKI"
     gene            complement(<624574..>625110)
                     /locus_tag="CAGL0I06457g"
                     /db_xref="GeneID:9488011"
     mRNA            complement(join(<624574..624682,624846..624976,
                     625093..>625110))
                     /locus_tag="CAGL0I06457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999514.1"
                     /db_xref="GeneID:9488011"
     CDS             complement(join(624574..624682,624846..624976,
                     625093..625110))
                     /locus_tag="CAGL0I06457g"
                     /note="highly similar to sgd|S000028515 uniprot|P0C5R9
                     Saccharomyces cerevisiae YPR170W-B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999560.1"
                     /db_xref="GeneID:9488011"
                     /db_xref="GOA:B4UN17"
                     /db_xref="UniProtKB/TrEMBL:B4UN17"
                     /translation="MNPVVSSGKAWFCTILSAFGVVILSVIAHLFNTNHESFVGSIND
                     PEDGPAVAKTVYLAALVYLVFFVFCGFQAYLSTRRRSIKLR"
     gene            625426..625499
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0I06468r"
                     /db_xref="GeneID:2889130"
     tRNA            625426..625499
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0I06468r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2889130"
     gene            complement(<625707..>627233)
                     /locus_tag="CAGL0I06490g"
                     /db_xref="GeneID:2889131"
     mRNA            complement(<625707..>627233)
                     /locus_tag="CAGL0I06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447532.1"
                     /db_xref="GeneID:2889131"
     CDS             complement(625707..627233)
                     /locus_tag="CAGL0I06490g"
                     /inference="similar to AA sequence:UniProtKB:Q06214"
                     /note="similar to uniprot|Q06214 Saccharomyces cerevisiae
                     YPR169w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447532.1"
                     /db_xref="GeneID:2889131"
                     /db_xref="GOA:Q6FQG2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MGKKKTSVVQSDELPVIEFRYAEPLFQFVCHPEEPMVVSALATG
                     HVLCHRYDAELLTEKLREARKVQEAVKVEEKKQTLWTVVDVDAADKHPVLPSGVTLLW
                     RTKRHKGSVRALAIDHDGKHVYTIGADNVLKKADTHSGKVVKKVTLDGGSKVTKLVKS
                     ATHDFLVMGDEVGTIVVLDSNDLTTKNTLTKIHGGDAINDIFQFCKRSVYKYISLGQT
                     TLAYWDTREPKMKQPKKNSGNQTEEELSNIMCSDDQEDEILCGAFVDPIEGDTLVCGM
                     GEGTLTVWKPKKNDLEDQLTRVKIAKGESIDTVISTLQDDNCVWCGCSNGLLYKVDTK
                     RGKIVEIRKHSGLDEVGMLDLDFEYRLVSGGMDKLKIWEVPKEENSDSDSDSDINDDS
                     EAGLSSSEDSDSDSELGSGSESEVESDASSKSDSDLEECTGSDLPGDIEGSEGENNSN
                     DDDNHDDREELWKELDQPTSDEEEPPKKRSLKVKDKKNKKFKKNENNLSHGITKFDGL
                     "
     gene            <627769..>634128
                     /locus_tag="CAGL0I06512g"
                     /db_xref="GeneID:2889132"
     mRNA            <627769..>634128
                     /locus_tag="CAGL0I06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447533.1"
                     /db_xref="GeneID:2889132"
     CDS             627769..634128
                     /locus_tag="CAGL0I06512g"
                     /inference="similar to AA sequence:UniProtKB:P39960"
                     /note="similar to uniprot|P39960 Saccharomyces cerevisiae
                     YER155c BEM2 GTPase-activating protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447533.1"
                     /db_xref="GeneID:2889132"
                     /db_xref="GOA:Q6FQG1"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG1"
                     /translation="MKNLLWPKNRKSKKASAGGAGTGSDAGTDASSSLRSTSSLSVNK
                     LTHSSSHGASLDNYIAQAKRGSRSSRSSQNLLASNKSKRMSSANMRNITNPENTMSSG
                     NEQAHGSGKLGYGALGKLKGSASRSQVSLHSMRQDSAGSTHQHSKEEAGSILSDDVTS
                     IDSRRSQHLSTLDSSGKIPDHVNVNSSRTFSKSRESLQSISGKSSTSPQPTHTLLHGA
                     SDDNRNTLASIDSNITETTIISDGGPDNVNLTFENYDETVLKVGWLNKSQGQVTVPLS
                     STHSTSGVTTTAADYQPRNRESRIYETNTLDSSDDMSGKTVTTLPDSQITIPDYRVFR
                     AQLKGSLLTLYKSSLGSHVKCFDPSLKSLESDLTTKESNRQSVIPSKSKQKSSTKNDV
                     IPKSVTLKHLSVTGPHPDLKVDKHGIVIGGTVEAICHDILFTTKPIHLLHKKHSKISN
                     NNSDDDVEVQKSLVNFLIILPMLDHFIKFIITFNQFGLTFTKHKSKISSTSSQYVRIT
                     EVVDTQISNRLVLVIRTILEFTPAYLLDDNIFQSIITLIDTISLHNDAICNQIKIDVA
                     TRCNELNKLTKFSKTNINNKDGFLPMESLVDVNRFMELDPSKFAEEVHSINLEFNKVW
                     APRKDFSLLYDSKFNNKNILSLSPLIFNNKDNVHFLGRLLVTHLFSTNHRSKEQCRKT
                     AEVLNRWVLLGCKFEQLGDMVSWLAIATVICSIPILRLGAIWKYMPESTVKIILNDWV
                     PTIVQLDRRQISSKSTGSVFILAPPNLDDPNIKNNIVSYFGDLIIHADDLPNDVKIKY
                     LAKKINRTKNAFHKWQSRVDKDNSTGQAATFKSIDPNSSMVYDFWNFHIHQPPMNIND
                     IMKQSIKCEPALVNQSVYSSIGLKRSSLMTGSYLPTLFNNFLNSYSIFPKEVLIGAAG
                     VLADTNISRQSMLAAKELKISEPISQVVPGSLNYEHRYSQITGLDNIDGPVKKEIAGK
                     PLNKHHLLKSIRDAFNVDLDVFHVGDDLVFKSITTNQGKSRPSSIVIDTPKRFSQYST
                     SNSSPSTPKLNRESTTIVRLSKGFENLDLFDNVGNLSDSLKELNIDVALKSASIERIY
                     DLLVLTVSAFSRLVDSVDLTKYYKGRRSFDNNTNDLSDIGLLDFAYIKINMDNAAYTE
                     TFFNTYKSFTTTVNVLEGLARRFIGAKSCALSIEKIIGNENLDSLKDETLKSKLSQLN
                     AKKFPLWDLNVNKNETVNLGFLAKVQIGAMEAIYYLVKHHYNDFTDDMNCHTTMLDIV
                     KIIEEEITVEWEHRLKTSKENNLFDNVAHQELENLIKRLRELFNILKSTYRKQLYKPL
                     NISKTERNSSNLSEQFKTLPYEDYIAFLSEGEGDKLYLNFKNMNYDDYDSIHAWVNDI
                     NNIVTSRFAAVTRMEWFQLYQQLDLLSNASLTSFFQYPLSAKSFSTINTGNPLLNEVE
                     ITDVFEWISTLNTKTSDVNELFIDKIPSSIKVLIEMHNSLKSFFVSELANVSASLEER
                     KKVYCTILQLLNYVRWKNSSLNLFEGEIDNENIISPHIPSFIETTLCRAIVSPESRFN
                     ELLWKHAHYTLSTSDDKYSLKSISNILDDLNVSHIRAFLEIDNVYTAKPQNLCPCPGW
                     FITRLLEISQFVPNMSISNTKLVNFDKRRFVCNIIYNILEILPKDIELATTAESHRML
                     FTKLLGDNAELREKLRSKALEDAKEEGYQNTGIFNNILVDEVDKIRREHKKKESLTLQ
                     EAENQRSLNLQKNYAINKHDSLLLTSSTSNVSANSAHLLRNKRSSTASLASRSSVISG
                     TSHSGVGRKIGGFFRRPFSISGFNSTGQGIPPNGVQDKFISPDNLPHLESNILQDYKP
                     ALTIKTFEIKSIVDIINHNKVSSYAHAFRIVMQDGSEHMVQAVSSEEALEWIRLIKIS
                     KRYSFHSKKYSGQTRNKIFGVPLEDLCVRENTLIPSIVVKLLEEIELRGLDEVGLYRV
                     PGSVGSINALKNAFDEEGATNNTFTLEDDRWFEINAIAGCFKMYLRELPDSLFTNNMF
                     GDFTKVALQYKTSAIDFEAYKAEIKRLLSLLPPCYYATLERIVIHLNKVHRHLMNNRM
                     DASNLSIVFAMSFIDQDDLSSSMGPTLGAVQSILQKFITNPEDYF"
     gene            complement(<634458..>635618)
                     /locus_tag="CAGL0I06534g"
                     /db_xref="GeneID:2889133"
     mRNA            complement(<634458..>635618)
                     /locus_tag="CAGL0I06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447534.1"
                     /db_xref="GeneID:2889133"
     CDS             complement(634458..635618)
                     /locus_tag="CAGL0I06534g"
                     /inference="similar to AA sequence:UniProtKB:P39952"
                     /note="similar to uniprot|P39952 Saccharomyces cerevisiae
                     YER154w OXA1 cytochrome oxidase biogenesis protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447534.1"
                     /db_xref="GeneID:2889133"
                     /db_xref="GOA:Q6FQG0"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:Q6FQG0"
                     /translation="MLGITGLRSLARTSTLRVAARAPGRLTPVTPSWRVMMPRYMSSN
                     GKPISEITTQLPAVDELGATAADAVTQTVGTVGELSTHVGYLESIGLAQTWYWPSDLV
                     QHALEYVHAYSGLPWWGTIITVTLLVRLALVPLYVKSSDTIARNSRIKPELDKINKQL
                     MGTTDMTEGQKVAMKRKKLLADNGIKNRWLAAPMVQIPMAIGFFNGIRHMANFPVQGF
                     QDQGILWFNDLTQADPYLGLQVITAAVLISFTRLGGETGAQQFSPTMKKFFTIMPLLS
                     IPATMNLSSAVVLYFAVNGSFSVLQTLFLRNKWVRRKLNIADVVQRPLDPAQANKGIM
                     DTFRENMANARAQAERKQKMQEKEMEMQELSKKLRENQRIKIVSRKQLNKNH"
     gene            <636105..>636935
                     /locus_tag="CAGL0I06556g"
                     /db_xref="GeneID:2889134"
     mRNA            <636105..>636935
                     /locus_tag="CAGL0I06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447535.1"
                     /db_xref="GeneID:2889134"
     CDS             636105..636935
                     /locus_tag="CAGL0I06556g"
                     /note="weakly similar to uniprot|P10355 Saccharomyces
                     cerevisiae YER153c PET122 translational activator of
                     cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447535.1"
                     /db_xref="GeneID:2889134"
                     /db_xref="GOA:Q6FQF9"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF9"
                     /translation="MDVRKQLYLQCLNREFAQVLAKVRGMSTESLDYNFLQMYLGRSC
                     QWAHVPSIDYLWMRFVMKEPLLLVRPQVLCDMATIALNNDKGFLPSQLLKHYTMNYLN
                     KRHISFDDPVLYHLNRVKVESFAKGTKDRTTFMEKWKVFLQDIDDKFPTSYKFRIRDY
                     MNLSQASRTATQERLGSMLFDQDQITIKNPTSMSLLLNIILLHKGISTDYKLAIFEQF
                     LRSSNGAALIDDSIQILLRLVDGNSSQLRNLLETLKSVDVKISATTCNEIDSCKAKLQ
                     "
     gene            <637311..>638621
                     /locus_tag="CAGL0I06578g"
                     /db_xref="GeneID:2889135"
     mRNA            <637311..>638621
                     /locus_tag="CAGL0I06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447536.1"
                     /db_xref="GeneID:2889135"
     CDS             637311..638621
                     /locus_tag="CAGL0I06578g"
                     /inference="similar to AA sequence:UniProtKB:P10356"
                     /note="similar to uniprot|P10356 Saccharomyces cerevisiae
                     YER152c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447536.1"
                     /db_xref="GeneID:2889135"
                     /db_xref="GOA:Q6FQF8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF8"
                     /translation="MSMDQPARINFFKGHPSFRLLPNEEIVEATRQLLTSETRDYDDD
                     TRNRHPLTYGPDEGALWVRQQICDFNNRLFGSDSKPEFLNLSSGSSYGCLSVLLHTTL
                     PHTNFTRQAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEEL
                     YGNSNGDVSIIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDML
                     IICDDVYDLLDYSTDVHEWPRPQKRLVHIDRATAPDDNEFGNTISNATFSKIIAPGLR
                     FGYHETINDKLAAQLSRGGANVSGGTPSQLNSMIVGTILQNGSMERILGKLRETYKTR
                     SVAMWDSLQKHMPKDTHISSPKGGYFVWVTLPPGYDAKKIGKKLKDEHGVILANGSDF
                     EVIGDERGWGDRSVRLSISFLETPDIIEGCELWGKVCKEMAPSS"
     gene            <639096..>641546
                     /locus_tag="CAGL0I06600g"
                     /db_xref="GeneID:2889078"
     mRNA            <639096..>641546
                     /locus_tag="CAGL0I06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447537.1"
                     /db_xref="GeneID:2889078"
     CDS             639096..641546
                     /locus_tag="CAGL0I06600g"
                     /inference="similar to AA sequence:UniProtKB:Q01477"
                     /note="similar to uniprot|Q01477 Saccharomyces cerevisiae
                     YER151c UBP3 ubiquitin-specific proteinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447537.1"
                     /db_xref="GeneID:2889078"
                     /db_xref="GOA:Q6FQF7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF7"
                     /translation="MHDPQEESYSMYPKTSSPPPPPQANMHFPVYQTPMMYGYSQNPY
                     MYAGQAPGYHFGMMNQGQMMYQPNAIPQQPNGGAGGSKKKWNMNNNMGASSGSSANLS
                     NGKTHNYHNSSHAASYHPQSSSSTSGGSTAKNAYTPAAADPLKFNISKIKEETTSFPM
                     FFNTNEKDFAEAKAKRYHLSLKALDHEEQPIQKEPQVQSEQVKQEEQIQKKQDSQQLS
                     IEEEDIKDLKSGDKTDIVLPETTTNKENIQQGTEIKVSSPEMGNKQASGSPVEETATP
                     YITPAPTPKPAAKSWSAIASSAISKGKPSNVSSPISRPGSTHQQPQKKSKKYVPATPK
                     GLEPLGSVALRMCFDPDYVSYTLDTAKNEDKLPIREIIPRGIINNANICFMSSVLQVL
                     LYCAPFVDILNVVSTRNMNAKSGSSSAKLLDACLTIYKKFDKANYEKEKEKESEKEKP
                     GSKKSSPPAYASITEAVNPDEFYRSLSTIPKFKDLRWGHQEDAEEFLTHLLDQLHEEL
                     ISAIDSLSENEILNLLQSIHDEDLKIYIIRNLSRYKDAEFIKNMSPQLKDQINKYGTI
                     SDDSEEGNGWHEVSGSSKKGKKTKTAAKRTVEFIPSPISNLFGGQFRSVLDIPQNKES
                     QSITLDPFQTIQLDISDPGVDSLEAALKKFSEYELLPFKSSSGNDVEAKKQTFIDKLP
                     QILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDETLASSALR
                     NNSSKTYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVLKGGE
                     DNMDSRTAYILMYQNVHC"
     gene            complement(641848..641921)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0I06622r"
                     /db_xref="GeneID:2889079"
     tRNA            complement(641848..641921)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0I06622r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2889079"
     gene            complement(<644156..>644830)
                     /locus_tag="CAGL0I06644g"
                     /db_xref="GeneID:2889080"
     mRNA            complement(<644156..>644830)
                     /locus_tag="CAGL0I06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447538.1"
                     /db_xref="GeneID:2889080"
     CDS             complement(644156..644830)
                     /locus_tag="CAGL0I06644g"
                     /note="some similarities with uniprot|Q01589 Saccharomyces
                     cerevisiae YDR077w SED1 abundant cell surface
                     glycoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447538.1"
                     /db_xref="GeneID:2889080"
                     /db_xref="GOA:Q6FQF6"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF6"
                     /translation="MQLSVLLTLLGAAASVNGQFQNATSASSISSAEVSHHDDHHLHT
                     FTSTRIEVVSEFTTYCPEATTFSYNNKTVIVTKPTTLTITDCPCTMTHIERDDHHHHS
                     EEKHHSSEIAATYHNTSTTTTTTCITDCPTVGPHAVHPEDHKPVSSSVAAESKVESKA
                     ASETKKVTATHHETTGSLRTSHTENAKATKSSSSLPVTVQTTNGAGHLQMASLFLTLA
                     MMLTTF"
     gene            <645956..>647302
                     /locus_tag="CAGL0I06666g"
                     /db_xref="GeneID:2889081"
     mRNA            <645956..>647302
                     /locus_tag="CAGL0I06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447539.1"
                     /db_xref="GeneID:2889081"
     CDS             645956..647302
                     /locus_tag="CAGL0I06666g"
                     /inference="similar to AA sequence:UniProtKB:Q70DD8"
                     /note="similar to uniprot|Q70DD8 Saccharomyces cerevisiae
                     YER149c PEA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447539.1"
                     /db_xref="GeneID:2889081"
                     /db_xref="GOA:Q6FQF5"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF5"
                     /translation="MYDMDLLRRANPVLFSPERYDEYPLGYDDLMQYLSTKDITSQSD
                     PQHNRPYTYIDSLDFLLYSQDEDEIDIDLDKKLACEYALYYAQSKKRQNKHKRMSLLG
                     SRKYLDDLLYGGANHSRDWYEAVITMLENLSITELDPDTVGKLERLVKTNKSGVNVSM
                     LSHNMNGFQKPEFPRSRKQSGSGLDLMRDNNGSHSEVFSGHTLNESDDTMEEESQGII
                     QDLISYLISNSIKRGINVKPTNLNNPVEFLKGAIDEILDAKTDSLDNKPQDRSSNIDT
                     LETSVTPVNFHEADTNELKTALNDLQLAHSFLTKQFETSRLEQSQTINRLTKTNRELQ
                     DKLLKYHAKISKLEEKLKVTEDAKTQLEDAAHKINMKENLLLSSPIMAPELFSPSTPT
                     SGLNSSPSNNNSHSITVMRNEFKRMILETQDKYEKELAEEREKRLKLEKEFEELKD"
     gene            complement(<648008..>648709)
                     /locus_tag="CAGL0I06688g"
                     /db_xref="GeneID:2889082"
     mRNA            complement(<648008..>648709)
                     /locus_tag="CAGL0I06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447540.1"
                     /db_xref="GeneID:2889082"
     CDS             complement(648008..648709)
                     /locus_tag="CAGL0I06688g"
                     /note="highly similar to uniprot|P13393 Saccharomyces
                     cerevisiae YER148w SPT15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447540.1"
                     /db_xref="GeneID:2889082"
                     /db_xref="GOA:Q6FQF4"
                     /db_xref="InterPro:IPR000814"
                     /db_xref="InterPro:IPR012295"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF4"
                     /translation="MADEERMKEFQEANKAVFDPNTRQVWENQVNKTEDDAVKPEADE
                     DEDEDDAATSGIVPTLQNIVATVNLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREP
                     KTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVK
                     FPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQ
                     AFEAIYPVLSEFRKM"
     gene            <649504..>651519
                     /locus_tag="CAGL0I06710g"
                     /db_xref="GeneID:2889065"
     mRNA            <649504..>651519
                     /locus_tag="CAGL0I06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447541.1"
                     /db_xref="GeneID:2889065"
     CDS             649504..651519
                     /locus_tag="CAGL0I06710g"
                     /inference="similar to AA sequence:UniProtKB:P40090"
                     /note="similar to uniprot|P40090 Saccharomyces cerevisiae
                     YER147c protein required for sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447541.1"
                     /db_xref="GeneID:2889065"
                     /db_xref="GOA:Q6FQF3"
                     /db_xref="InterPro:IPR019440"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF3"
                     /translation="MSYSAQELWELHEEYVTCAHNCVSKVQNRDQLRQYYQLIGAGVT
                     CLVTIKEKYSLSMEHDAQVTLALVSLLVDETADYDAAEMYISSLQERLKNDKYSDDLE
                     VYRLVCHFMNFYTIPLKRKSQFHMNIALKNCNELVTYMENALESGSMQPYSEWLVVFK
                     FVVLTLSILTNKHGRLHERYKELIEYENVPKIWKYILVLHYVDYRLKQRKPIEQDILS
                     SLSEITVETAGAKLYAWRLISELLMDIYNDRNITEQLNRFKLFFKECKDKLDGSLEVN
                     VDSKAKLQLKLEPIFHYKDLKNILLLLQSVSYLLNGYDKKANFSIKFLPKVQTTTQLL
                     LEGIRNDSANSILTVDNKVSWYTTILKYVSFYKLWDYVLLKGITHEYKRNCLEIPQKD
                     HQLFLELIGRQSKLTSTGGSEELQQLTEQYTDLAGDSSVHYEVKLSSLLNCYIILSSL
                     VSEDIDKAKNISRCNDVWMSIQSIFDNCDLRDNSLWNVTILMVWIISHFEPFTANPLP
                     STDEEKSSKLEAFKGYYQNNKYNVIDKKDAGMHNNLKVKRGLLLHVLLNYIGARLFEQ
                     DLEEMTKISERCFRMANISIEDASYSKKSSKQPRVGSLNTTDIEESELDHPTNMNVEG
                     NQGIWAIRYIMGLWSLMNYTVGMRQKEVIYTRNKLSRIIASYHQAQA"
     gene            complement(<651488..>651760)
                     /locus_tag="CAGL0I06721g"
                     /db_xref="GeneID:2889066"
     mRNA            complement(<651488..>651760)
                     /locus_tag="CAGL0I06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447542.1"
                     /db_xref="GeneID:2889066"
     CDS             complement(651488..651760)
                     /locus_tag="CAGL0I06721g"
                     /inference="similar to AA sequence:UniProtKB:P40089"
                     /note="similar to uniprot|P40089 Saccharomyces cerevisiae
                     YER146w LSM5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447542.1"
                     /db_xref="GeneID:2889066"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF2"
                     /translation="MSSLDVLPLEVIDKTIDQQVHIILQSNREFSGKLVGFDEFVNVI
                     LEDPIEYTTEITANDGLKSEVVMEHHGRMLLSGNNITMLVPGGKKL"
     gene            <653622..>654848
                     /locus_tag="CAGL0I06743g"
                     /db_xref="GeneID:2889067"
     mRNA            <653622..>654848
                     /locus_tag="CAGL0I06743g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447543.1"
                     /db_xref="GeneID:2889067"
     CDS             653622..654848
                     /locus_tag="CAGL0I06743g"
                     /note="highly similar to uniprot|P40088 Saccharomyces
                     cerevisiae YER145c FTR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447543.1"
                     /db_xref="GeneID:2889067"
                     /db_xref="GOA:Q6FQF1"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="InterPro:IPR005217"
                     /db_xref="UniProtKB/TrEMBL:Q6FQF1"
                     /translation="MPNKVFNVAVFFVVFRECLEAVVIVSILLSFLKQAIGSKDIKLY
                     RKLRKHVWIGVALGFFICLVIGAGFIGAYYSLQKDIFGSTEDLWEGIFCMIATTMISM
                     MGIPMLRINKLQSKWRVKLARSLVDIPKRKRDYFRIGYLTRRYAMFILPFITVLREGL
                     EAVVFVAGAGITTKGSHASAYPLPVVVGLIAGFIVGFLLYYGTSKSSMQIFLVISTSI
                     LYLIAAGLFSRGAWYFENYRFNKATGGDASEGGDGNGSYNIAKSVYHVNCCNPELDNG
                     WDIFNALLGWQNTGYLSSILCYNIYWVVLIIVLGLMMHEERYGHLPFMRNVGMRHLNP
                     GYWIKNKKKDELTDEQKAELLNRMDNIQFNEEGDIVAHANEEEHDQESSLLRGNSNKM
                     GSKEELNFKVTTTSSD"
     gene            <655806..>658469
                     /locus_tag="CAGL0I06765g"
                     /db_xref="GeneID:2889068"
     mRNA            <655806..>658469
                     /locus_tag="CAGL0I06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447544.1"
                     /db_xref="GeneID:2889068"
     CDS             655806..658469
                     /locus_tag="CAGL0I06765g"
                     /inference="similar to AA sequence:UniProtKB:P32571"
                     /note="similar to uniprot|P32571 Saccharomyces cerevisiae
                     YDR069c DOA4 ubiquitin-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447544.1"
                     /db_xref="GeneID:2889068"
                     /db_xref="GOA:Q6FQF0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /translation="MPGIEQPVSRKNETLVKLSSLADEFVFNDEVQLNLQDVLQECVD
                     TYQNYQDEVKKIKNMDHTESEKVSELCKSAYIYYKIVHNFITKVIPHLPEFEVATGPK
                     ASKLQAELIKIYYSLFSRLESDKKISYIKNIIIKHMDTQENNHSVESHEQVKLSNKKL
                     PVNRDAIEIDKDSILQDIRYINGKRSGSGISCSELLSLMKMKEDSLLLIDVRPKLEYD
                     AHHIKTKNIICIEPISFKESYSDQQIEKTSMIPSPKHEIQLFQRRSEFQYIILYTDLE
                     EKSNFYFQQLKSLLEILLQRSFLRPIDDRKTKVLFLSDSLQNWIKNGGEIDKSQEVSK
                     IRNRSISGSGPLLNSLSERKTIGAFPDINRNSTKQMPISPLPSLPGSERTVATPPNGS
                     STLGRINSPVTHYPKAPLINDSEFHLNINNNHSPPTHLPSKDNNPLASSMPIGSDHKP
                     FMSPQNSLPLAPKPPTLESKNYNFISDRSNIIDQKQNRSRSLEPQLPPIPSTLIRKNS
                     PEKTLSCNQMMDTSFTVGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHINKQS
                     KLGSKGVLSHNFAKLLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFKDASQQD
                     CLEFCQFLLDGLHEDLNQCGANPPLKELSPEAEKMRENLSLRVASSIEWERYLTTDFS
                     IIVDLFQGQYASQLRCKVCNRTSTTYQAFSVLSVPVPSGKSCGLLDCFIEFTKTENLE
                     VDEQWFCPSCKKKQPSTKKLTITRLPRNLIIHLKRFDNMMNKNNIFVRYPQILDLTPF
                     WANDSDGKLPPGITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPEKGWI
                     YFDDTVYRPVRFQNEFISPSAYVLFYHRITS"
     gene            complement(<658666..>659946)
                     /locus_tag="CAGL0I06787g"
                     /db_xref="GeneID:2889069"
     mRNA            complement(<658666..>659946)
                     /locus_tag="CAGL0I06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447545.1"
                     /db_xref="GeneID:2889069"
     CDS             complement(658666..659946)
                     /locus_tag="CAGL0I06787g"
                     /inference="similar to AA sequence:UniProtKB:P40087"
                     /note="similar to uniprot|P40087 Saccharomyces cerevisiae
                     YER143w DDI1 induced in response to DNA alkylation damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447545.1"
                     /db_xref="GeneID:2889069"
                     /db_xref="GOA:Q6FQE9"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001995"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="InterPro:IPR029071"
                     /translation="MQLTVTNDVNGEVYGPLELSGDMMLMDLVALLEVDCAFESGKQQ
                     LYFNGKELKPDVEKTLEELGIGNDDLIVIRGQPVSSNSIANSTSAIELDDDAYVEQFR
                     LQLLSNSALRNSLRMPFADIDSLVNDPQQFKTHMGPVIIQRRRMQSAMPTNPYGIPDE
                     EYKKLMTNPEDPEHKKRLQELQDKQLIDEQLRNALEYTPEVFAQVSMLYINMEINGHP
                     VKAFVDSGAQMTIISPRLAEKTELKRFIDNRFIGEARGVGTGKILGRVHQVQVKIETQ
                     FIPCSFVVLDSNVDLLLGLDMLKRHQACIDLEKNVLRIAGTETKFLGEAEIPKGTSFD
                     AVGNPQPPVEIKESADHSKKKMKTSFTITPKVKPVKADNLLNNSSPMGNTGRTFPEKT
                     IKQLMDLGFSRQEVIQALVSTNGNAEFAASLLFQ"
     gene            <661200..>662210
                     /locus_tag="CAGL0I06809g"
                     /db_xref="GeneID:2889070"
     mRNA            <661200..>662210
                     /locus_tag="CAGL0I06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447546.1"
                     /db_xref="GeneID:2889070"
     CDS             661200..662210
                     /locus_tag="CAGL0I06809g"
                     /inference="similar to AA sequence:UniProtKB:P22134"
                     /note="similar to uniprot|P22134 Saccharomyces cerevisiae
                     YER142c MAG1 3-methyladenine DNA glycosylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447546.1"
                     /db_xref="GeneID:2889070"
                     /db_xref="GOA:Q6FQE8"
                     /db_xref="InterPro:IPR000035"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE8"
                     /translation="MTRRLRSSTKSERDAALLKSEVDTEAASAVIEAMVEPVKKKAKI
                     KKENSDADGVADSKAPEPIEIPQDFLDKHVDEFKVGLKEILEVDPTLSQYVLIKEFPL
                     FLKDRPRADDLHDKFTRLASAIISQQLSNSAARSIREKFINLYDGHFPDYKVLKVDIK
                     IPSKHEQIFKCGLSRKKCEYLESLANYFADNEEYIRNLFQDKGNDQKIMDELVSNVKG
                     IGPWSAKMFLMTGLYRMDVFAPDDVGIARGCAKYLSQHPDTLKKLMKNRREIKKSKIK
                     HKKLNWKVYDEDIVDSLALLFSPNRTIFSFIIWRMASTDIDAIIKTETDFTSSRGGGS
                     GL"
     gene            complement(<662538..>664049)
                     /locus_tag="CAGL0I06831g"
                     /db_xref="GeneID:2889071"
     mRNA            complement(<662538..>664049)
                     /locus_tag="CAGL0I06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447547.1"
                     /db_xref="GeneID:2889071"
     CDS             complement(662538..664049)
                     /locus_tag="CAGL0I06831g"
                     /note="some similarities with uniprot|P40086 Saccharomyces
                     cerevisiae YER141w COX15 cytochrome oxidase assembly
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447547.1"
                     /db_xref="GeneID:2889071"
                     /db_xref="GOA:Q6FQE7"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE7"
                     /translation="MLTRQLVRSGQRLLSKNAGILASNGVVGRSTLNSTLNWTGAKHL
                     SQKASSCGILKCVARGRWFSTANNVLRNAAAGARIIDEAALKLDSSGIPLAAKDVKTS
                     KYVAYWLIGTSGLVFGIVILGGLTRLTESGLSITEWKPILGALPPLSQKEWEEEFAKY
                     RESPEFMELNSHINLDEFKFIFFMEWFHRLWGRAIGVIFVMPALYFAATKRTSSHINK
                     RLLFLSGLLGLQGFVGWWMVKSGLDKEQLEIRQSKPTVSQYRLTTHLGAAFFLYMGMM
                     WAGWEILRELKWLKNPARALEAFKKLESPAIIPIRRVAVGLTALTFVTAMSGGMVAGL
                     DAGLLYPTFPHMGEHWIPPKRELFEDRFARKEDKSDMWWRNMLENPVTVQLNHRILAT
                     ITFTAILVAHIYCNRRKQIVPRNADITMKAMMGVLTCQVTLGALALWYYVPISIASMH
                     QGGALALLTLSLLFTAQLKAPRAPIRSTISKLHAQQLKSGSKVIQEAAKHVSK"
     gene            complement(<664381..>666018)
                     /locus_tag="CAGL0I06853g"
                     /db_xref="GeneID:2889072"
     mRNA            complement(<664381..>666018)
                     /locus_tag="CAGL0I06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447548.1"
                     /db_xref="GeneID:2889072"
     CDS             complement(664381..666018)
                     /locus_tag="CAGL0I06853g"
                     /inference="similar to AA sequence:UniProtKB:P40085"
                     /note="similar to uniprot|P40085 Saccharomyces cerevisiae
                     YER140w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447548.1"
                     /db_xref="GeneID:2889072"
                     /db_xref="GOA:Q6FQE6"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE6"
                     /translation="MTKNKDVVAGETDRKQAMSGGADNDALDETDSEFEEEDFNQHDF
                     EMEQLLNMFRIPIYLEKFMLFTLLASYDWFLYYFTELPYNVCRYHVRSIKNSLLSILG
                     RNKKQNKVQSLPKQLKKQLKEQQSKMFQDKCTMFLIIASSILLSPLDTSKVYHRIKRQ
                     STVKLYVLFSLLEMSDQLLSSVGQSLLTVVISHNCYKRLRHRQFFLLFLGVVYLTCHG
                     YVLVYQTISLNIATNSCSNALLTLLLSMQFSEIKGSVFKKIDKEGLFQIGMSDVAERF
                     KLLLFLSIIGLRNIVAKSRNISSVIPFTWCLNITSSGIQNSPTLNVIGSEIIVDWIKH
                     AYITKFNRIRPEMYDKFYFIAYRDYTQNGTQYQNRLGIPLPASVVLFLTMLRPVFFQP
                     AEDSSGMLSIVITLLGSAVIILLSKTLLHWILVQWSRSIQRRFPDGEYNTMVNSESYV
                     PGIISTGLSKMDEITRELINYEKKTDSRSPSTDSFMLSRQSPQSSREATPEPHTDFSD
                     SNRDASLLPIPILTNTATPDQSLEGVTRYKMVSKRIW"
     gene            <666380..>667057
                     /locus_tag="CAGL0I06875g"
                     /db_xref="GeneID:2889059"
     mRNA            <666380..>667057
                     /locus_tag="CAGL0I06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447549.1"
                     /db_xref="GeneID:2889059"
     CDS             666380..667057
                     /locus_tag="CAGL0I06875g"
                     /inference="similar to AA sequence:UniProtKB:P40084"
                     /note="similar to uniprot|P40084 Saccharomyces cerevisiae
                     YER139c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447549.1"
                     /db_xref="GeneID:2889059"
                     /db_xref="GOA:Q6FQE5"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE5"
                     /translation="MISKQDVCEMLRPFQKHRQLSIREGEVISLEILTLLCDDYCGDE
                     GTLKYLARLMTPELYADLVDERNLNQRCGYPLCSGAPERIRDPFSVDQVTKQFLWENN
                     PYAYLSKYCNKFHFRCSQFFQVQLSEEAIFARTGVHLLEDTQEMRQTQDDKFNVTLFE
                     ELLREKASEEDIKSLVAGLKRLGLDASQDGEDGDEQLEVDLSKWLEQIKIVENKDPPM
                     LGDLVKD"
     gene            667631..667704
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0I06897r"
                     /db_xref="GeneID:2889057"
     tRNA            667631..667704
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0I06897r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2889057"
     gene            complement(<667962..>669200)
                     /locus_tag="CAGL0I06919g"
                     /db_xref="GeneID:2889058"
     mRNA            complement(<667962..>669200)
                     /locus_tag="CAGL0I06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447550.1"
                     /db_xref="GeneID:2889058"
     CDS             complement(667962..669200)
                     /locus_tag="CAGL0I06919g"
                     /note="weakly similar to uniprot|P53079 Saccharomyces
                     cerevisiae YGL223c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447550.1"
                     /db_xref="GeneID:2889058"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE4"
                     /translation="MAQEQHEVHQLFTQQRIPEIKNHVVELAHELSTINDKFNHKMAQ
                     KYWDILEVTDEVSTLTYTLKEVDKEFGELCYNDDLYQLRKLPDLVVQSHTKSPLKQGS
                     IEDDETSSSMILVELTEWAMAVYNFISKMPTTTSEPGVNNLIDNLMEHFAKIHKQLDN
                     IISNKTYERVLATKCNQLQRYIVDAVTKNELYFTLFQWVKLNKIMEYSGFPWNVQIHE
                     VFEKSLYGYIFEEEQDLDYIVSSSTNELVKTFVRSEKFQNSLIAHTKESIEQKLKELV
                     ELMKEDKQASIEPNAGKIEIDGILYPHTISDHVNIQEIINTGNMYSMGLDSKIKMKIF
                     EVLNNLIQQIRKLGTYKCDKTLIARYKKDLLEILESVDIKDKKISTTQLTTLIGTYNS
                     SKLAQLVNSQIQAITNLSQD"
     gene            complement(<669657..>670718)
                     /locus_tag="CAGL0I06941g"
                     /db_xref="GeneID:2889062"
     mRNA            complement(<669657..>670718)
                     /locus_tag="CAGL0I06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447551.1"
                     /db_xref="GeneID:2889062"
     CDS             complement(669657..670718)
                     /locus_tag="CAGL0I06941g"
                     /note="some similarities with uniprot|P36041 Saccharomyces
                     cerevisiae YKL204w EAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447551.1"
                     /db_xref="GeneID:2889062"
                     /db_xref="GOA:Q6FQE3"
                     /translation="MSNDTMYFNSSRRLPTHSRNNSPIVAAKNNSSTRIPALNNKKPS
                     KKTEKDIEQLLSPQQLPNGQRPDFGHGPRGGKQTNGAKTKNKKKQDKELQETKDSYDN
                     LTKNLKNLLINPEKTEKTVVETLIKSNSNSATATPQKAPNTTQGITNSHGLSQNFSSP
                     LSTPMILPHNLPMNPLGNPNFPANNHYLPYNPQQLQQQQQQQNRLPVGPGPMNFDNFR
                     PGIAPVAPPQPPPGYPPGPNGPPPGMPQQLNFNGQPMYYNQPPMPVPNSAFPINQSIG
                     ASPTLPRIIPPNPMNYINPALSTPPVVKNPTSNGPVTNTKPTNKSKRNSGRKSNTFAG
                     ASFATDVPNESNLPKPSFT"
     gene            complement(<671759..>672649)
                     /locus_tag="CAGL0I06963g"
                     /db_xref="GeneID:2889060"
     mRNA            complement(<671759..>672649)
                     /locus_tag="CAGL0I06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447552.1"
                     /db_xref="GeneID:2889060"
     CDS             complement(671759..672649)
                     /locus_tag="CAGL0I06963g"
                     /inference="similar to AA sequence:UniProtKB:P53081"
                     /note="similar to uniprot|P53081 Saccharomyces cerevisiae
                     YGL221c NIF3 NGG1P-interacting factor 3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447552.1"
                     /db_xref="GeneID:2889060"
                     /db_xref="GOA:Q6FQE2"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE2"
                     /translation="MRMGALHRRQLNKALEVIRAAFPEKYADKSFDNTGLLIDCSSNE
                     ESHANNAVKMLLTVDLTSRVADEAVKQGCNLILAYHPFIFPSWNRLNPQTNVQHASAI
                     KLIQNNISVYSPHTAVDAVDGGVNDWLVESLVPKTVNITTKECIESTANTAPHDPITG
                     YGRYFKLDKAVTLQEVVDVLKKNTGLSHVQIASLPYEISGNLHHEVQTVAVCAGSGSG
                     VFRNLKETPDLYVTGELSHHEVLKYKEMGKAVILCNHSNTERGYVKTSMLQLLKRHDT
                     AGLLQDVQVSETDRDPLNIV"
     gene            <672970..>673224
                     /locus_tag="CAGL0I06985g"
                     /db_xref="GeneID:2889061"
     mRNA            <672970..>673224
                     /locus_tag="CAGL0I06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447553.1"
                     /db_xref="GeneID:2889061"
     CDS             672970..673224
                     /locus_tag="CAGL0I06985g"
                     /note="highly similar to uniprot|P53082 Saccharomyces
                     cerevisiae YGL220w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447553.1"
                     /db_xref="GeneID:2889061"
                     /db_xref="GOA:Q6FQE1"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q6FQE1"
                     /translation="MITEEHLREKLKTSIPDVYHVIVTDLSYGCGQSFDVVVVSNTFV
                     GKNKIQRSRLVNGALKEELADIHAFSCKCYSEEEWSKIVI"
     gene            complement(<673508..>675124)
                     /locus_tag="CAGL0I07007g"
                     /db_xref="GeneID:2889064"
     mRNA            complement(<673508..>675124)
                     /locus_tag="CAGL0I07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447554.1"
                     /db_xref="GeneID:2889064"
     CDS             complement(673508..675124)
                     /locus_tag="CAGL0I07007g"
                     /inference="similar to AA sequence:UniProtKB:P53083"
                     /note="similar to uniprot|P53083 Saccharomyces cerevisiae
                     YGL219c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447554.1"
                     /db_xref="GeneID:2889064"
                     /db_xref="GOA:Q6FQE0"
                     /db_xref="InterPro:IPR027536"
                     /translation="MSFRFDRSVFESADFNERLRERLTGALNPKSRRHVERADEAGNE
                     DDSSGHQRKSGGSLDILKNDIIVEKVDFSRIPNLEILDLDVGLGVSSISSGGGGSSMM
                     KGICKISIEGAMLQVRTVIESNLLMLSMADSPEFVTPTLITNDSFSLPITMTFSNIKM
                     EAISKVFFVARNSGIGISFDDVVLDFKFDCSIKILQTTIEKRLKRAMELLFKDTLPTA
                     LFNMSQSWFTNSDGSRSSAKHKKDTCDENNQPSAPKIIFEDADLQELSPANMLRLSTL
                     VSSRQTLSLHSTVSSTLSLIPGCLERQNLYRFISRMPSLSNYYSSYVDHKKERAGTPS
                     LLMNKRPSVDYLLRRSSSSGNSLMSSQAYFDKESNLLPMEVLEENAYDLDVITDIQNK
                     LYMRSTDHDEQVNHTKPRRRKIKIGKNKKDKPAYKEEIEQQEPVQSTITVSMPFEEPQ
                     IIIEHNDETEAVKEERESVLSSPKLIRSTMDKTYTNSRILNTLLQKNGNLLDEETRLR
                     AQSIDSVAHTKMGYLLGLNHIATPPPPPYY"
     gene            <675486..>677603
                     /locus_tag="CAGL0I07029g"
                     /db_xref="GeneID:2889063"
     mRNA            <675486..>677603
                     /locus_tag="CAGL0I07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447555.1"
                     /db_xref="GeneID:2889063"
     CDS             675486..677603
                     /locus_tag="CAGL0I07029g"
                     /inference="similar to AA sequence:UniProtKB:P53086"
                     /note="similar to uniprot|P53086 Saccharomyces cerevisiae
                     YGL216w KIP3 kinesin-related protein required for nuclear
                     migration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447555.1"
                     /db_xref="GeneID:2889063"
                     /db_xref="GOA:Q6FQD9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD9"
                     /translation="MEVPETRQSSIYVCVRVRPFSESESLRLAPEVGDEFDSMLDDSM
                     MGGEVSMVVGRGDFVGEVSFTEDNGRKHNRRQSLAPRRIHKIVDCVDDKMIIFDPNHR
                     NPLYKVKESVLNSMYGGANMRGSIDGDMLMGSDATASRRFKRANGNSAGSEIKFVFDK
                     LFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPENPGIVFQA
                     MEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLLKPETPSQKLIIREDTDNKITVAN
                     LSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRTPDIKEEH
                     TFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDERPRCH
                     VPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKIIRN
                     QQSLNRHVGSYLKMITEQKKEIEELRSRENKMIQFQLDKYKLSRQQIAVAITDCVNNV
                     RFQYTQVPKFQRIKLIKSLILCKRRFLQLVLLEMKKSPIQREDSSGAMASLEEQIKRK
                     IKQLENKFDSPDELDTVITNARTVDLLKLREMENWDDKIDTLTLELELDYVSEQLRND
                     ILITASQMTEKLFDEDSPLHKVELDVEGLISIDREFDEFGKQFQTEQGKKRIASNDDP
                     REMDVDRKSLLKHRLRESDLDIK"
     gene            <679280..>680626
                     /locus_tag="CAGL0I07051g"
                     /db_xref="GeneID:2889184"
     mRNA            <679280..>680626
                     /locus_tag="CAGL0I07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447556.1"
                     /db_xref="GeneID:2889184"
     CDS             679280..680626
                     /locus_tag="CAGL0I07051g"
                     /inference="similar to AA sequence:UniProtKB:P35190"
                     /note="similar to uniprot|P35190 Saccharomyces cerevisiae
                     YGL215w CLG1 cyclin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447556.1"
                     /db_xref="GeneID:2889184"
                     /db_xref="GOA:Q6FQD8"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD8"
                     /translation="MAYNYLQDPVLFNQGPQVVSHHTHSQSMNLLPSLSHPAHHRHNT
                     YSQQQMMSMMPIQQNAIYQPVMPLDQTQMHIPKMIVQDQFLPPQPQPQPPQEQVNGGV
                     SHVLDYDVEIMTQFVMKNAFFAFRTPVNDNINNTTLFTKGIISVLNATRLPSVTIYLA
                     IDYLFKYINKLADGPNTIGGNSINVIYQNTMIAFILANKFNDDKTFTNKSWSQATGMS
                     IKIINDYERDWLKTFEWKLFDDKFILYPEFVAAYKLFEEETRRDQYELQQQQQQQSPM
                     LQPKPSSTNNYLPPSIGTSTYEFGYQTPLTMYSSPTNFFYQSMPSKNDYGNEVDPYQQ
                     NYIPPAMPLVSPLSDVGRVSARDEFADNSFDYDFYNFGTNQTNNTMNYKVNSKGNLQP
                     SQAFFSNADGYHMNQPYYQQNSDITTLNMMLQHQQYNKPLYSSNLNQNCFPYSAVY"
     gene            complement(<681102..>682283)
                     /locus_tag="CAGL0I07073g"
                     /db_xref="GeneID:2889185"
     mRNA            complement(<681102..>682283)
                     /locus_tag="CAGL0I07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447557.1"
                     /db_xref="GeneID:2889185"
     CDS             complement(681102..682283)
                     /locus_tag="CAGL0I07073g"
                     /inference="similar to AA sequence:UniProtKB:Q02793"
                     /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
                     YGL213c SKI8 antiviral protein of the beta-transducin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447557.1"
                     /db_xref="GeneID:2889185"
                     /db_xref="GOA:Q6FQD7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD7"
                     /translation="MSKIFIPTANCGKAHDADIFGVAICNTFTVTCSGDGYIKLWKNK
                     LLDNEQPKDHVQKQFVHKSGVHHIDLIDTVEKGGVNVCIISCVTFSGEIVFFELTQEN
                     QLKPIKLLTEKELKKSYWAVKWLQSSDLTVCHKFAATDVKGSTYVWDLSVFQEGTADS
                     DEPQYNPHLKFQGEIPVKEPCVATALDISSNGLIATGLENGTVFVSQLTSLKPLYQFE
                     GYGLHGIDQNSNTVRNVKFSPTGRLLAVANDSGSYGNITLYETEFGERIGNFTMATHS
                     TQTSIGSFAHDGWVFGLAFNETGEFLASCGYDSKVRVWDVKLRERVSTLHITAGDIEV
                     EEDILQEDEEGNSLKHPPIFDVKFIKKGVRAGMGSDVNEGLCCVCLDRSVRWYREAGG
                     S"
     gene            <682556..>683536
                     /locus_tag="CAGL0I07095g"
                     /db_xref="GeneID:2889186"
     mRNA            <682556..>683536
                     /locus_tag="CAGL0I07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447558.1"
                     /db_xref="GeneID:2889186"
     CDS             682556..683536
                     /locus_tag="CAGL0I07095g"
                     /note="weakly similar to uniprot|P32912 Saccharomyces
                     cerevisiae YGL212w VAM7 vacuolar morphogenesis protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447558.1"
                     /db_xref="GeneID:2889186"
                     /db_xref="GOA:Q6FQD6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD6"
                     /translation="MASKGYARMRVRYRVHVDEVQVRGGVAKYGLVVSVWDQDGQEEL
                     RETTVWRRYSEFLALKKELESSCGCDIPYEFPPRTLWFGGGSKTGGTDKKVIEERKVK
                     LADFMSELLNDSFDVKWKRHKSVSNFLGMDIAQMENVKSTKSKPPQNGWMDMFHEYKM
                     EFEDCKKQEGVQRSRNAMYIRLKLNELEQILNTEELPEEERDRRSKLLTTLKQDLNEL
                     TISREDPIVPREQVVKPLPGRRMLGETIETAKYNNRDLLQVQKQMNKEQDQELEQLHK
                     IIQRQKQLSMEMNEELSQQNELLDSFQNDVDRTAMKLKQANRRARDFNDK"
     gene            <683898..>684842
                     /locus_tag="CAGL0I07117g"
                     /db_xref="GeneID:2889187"
     mRNA            <683898..>684842
                     /locus_tag="CAGL0I07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447559.1"
                     /db_xref="GeneID:2889187"
     CDS             683898..684842
                     /locus_tag="CAGL0I07117g"
                     /inference="similar to AA sequence:UniProtKB:P35202"
                     /note="similar to uniprot|P35202 Saccharomyces cerevisiae
                     YOR143c THI80 thiamin pyrophosphokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447559.1"
                     /db_xref="GeneID:2889187"
                     /db_xref="GOA:Q6FQD5"
                     /db_xref="InterPro:IPR006282"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="InterPro:IPR016966"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD5"
                     /translation="MAETCIENPDYLVVNGIPSSKYKHEIELENCFEPQHENSALLIL
                     NQEIKMPKLFMKLWNRYMIKVCADGAANKLYQFCVNNNVNHNDYLPDYIVGDLDSIDE
                     NIAQFYKEKGVYVIKQTTQYSTDFKKSINLITCHFYATNFKDHLQSSNEDSNYGISLE
                     KGIHDIYATIKNVAELPKLNVLALGGIDGRFDQTIHSITQLYTLTNTDPYIRMFFLTE
                     NDLIFIIPPDGVLLRYDAEFRKACIGNCGLLPVGLPTEIIETIGLKWDVANWPTSIES
                     GRVSSSNRFSGHDKCYINVKDGMIINVEIKKDVVANYV"
     gene            complement(<685176..>686135)
                     /locus_tag="CAGL0I07139g"
                     /db_xref="GeneID:2889188"
     mRNA            complement(<685176..>686135)
                     /locus_tag="CAGL0I07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447560.1"
                     /db_xref="GeneID:2889188"
     CDS             complement(685176..686135)
                     /locus_tag="CAGL0I07139g"
                     /note="highly similar to uniprot|P53598 Saccharomyces
                     cerevisiae YOR142w LSC1 succinate-CoA ligase alpha
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447560.1"
                     /db_xref="GeneID:2889188"
                     /db_xref="GOA:Q6FQD4"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR005810"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017440"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD4"
                     /translation="MLRFTRGFSRKAGVYDQTIKNLLLPKDTKVMFQGFTGKQGTFHA
                     KISQEYGTNVVGGTNPKKAGQTHLGQPVFASVKDCVKETGATVSGIFVPPPIAGAAIQ
                     EAIEAEIPLAVCITEGIPQHDLLYISEMLKSQNKTRLVGPNCPGVINPANHVRVGIQP
                     TRIFKPGKIGIVSRSGTLTYEAVQQTTLSGLGQSLVVGIGGDAFPGTDFIDVLKLFLE
                     DPQTEGIIMLGEIGGKPEIEAAEFLQEYNFSKANPKPVASFIAGKVAGQMKGVRMGHS
                     GAIVEGSGTDAESKKEALRNVGVQVVESPGYLGQTLLEQFSKL"
     gene            <686948..>689461
                     /locus_tag="CAGL0I07161g"
                     /db_xref="GeneID:2889189"
     mRNA            <686948..>689461
                     /locus_tag="CAGL0I07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447561.1"
                     /db_xref="GeneID:2889189"
     CDS             686948..689461
                     /locus_tag="CAGL0I07161g"
                     /inference="similar to AA sequence:UniProtKB:Q12386"
                     /note="similar to uniprot|Q12386 Saccharomyces cerevisiae
                     YOR141c ARP8 Actin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447561.1"
                     /db_xref="GeneID:2889189"
                     /db_xref="GOA:Q6FQD3"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD3"
                     /translation="MSRESSVNSSMVEDEDSASDMDADLDEENARKHGRSDDGEDTGD
                     DNADDNADDNADDNGDADTSVDGASTRRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKR
                     RLGRLKAAEEFARKLKVVGIERVENLNLPQSGLFSPVPLINQKNYSSDYLRKDENAFA
                     VRERKQMRNSNANNSAHAKTSELGSGAQSASMASSASLDALVDTDTKLQSVEDIDFND
                     PRLTIVIHPGSDSIKIGLATDEEPVSIPNLVAVPRSQVVNPVDETPVNVLNIELDDQF
                     HELTNQLKYNFKERMKYYKRKMQSNAHEQVTSFNSNSKPEEVSDKNDQGKIDWIYNAD
                     KKYYGEDAQRCIGDEFILRRPFCKSGIFNLESNNYSSIQDLLGDVSELVDSALSSDKF
                     NITKSEYKHYKAVIVIPDLFKKSHLETFIRLLLNEMDFRSVALMQESLATCYGAGIST
                     PTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGNDVTNLLAILLQQSKFPYKNWNLS
                     TLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGIPSEKYDFKVFDEVILAPLGLF
                     YPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLNDWRSITQRDCEENMIYCDA
                     KDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAIVQSITNAAINVDISKIS
                     QFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFYKSLTKQLKDIQTSNK
                     SNTGDKSQEQEVAERSIALVKVELDKLVASLEIPNSGDHFFTVGVLPAPRNLDPSLLD
                     WKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY"
     gene            complement(<690080..>692395)
                     /locus_tag="CAGL0I07183g"
                     /db_xref="GeneID:2889190"
     mRNA            complement(<690080..>692395)
                     /locus_tag="CAGL0I07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447562.1"
                     /db_xref="GeneID:2889190"
     CDS             complement(690080..692395)
                     /locus_tag="CAGL0I07183g"
                     /note="some similarities with uniprot|P20134 Saccharomyces
                     cerevisiae YOR140w SFL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447562.1"
                     /db_xref="GeneID:2889190"
                     /db_xref="GOA:Q6FQD2"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD2"
                     /translation="MSEKDGGNTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSES
                     FSQNLAHYFKHTNITSFVRQLNIYGFHKISNDHFHNLKREKKQKSSTDNNTGVSNNNS
                     GDENIKVWEFKHSGGLFKKGDLENLKLIKRRSSSRTIPSLSLASSNTNTSTLETNDGA
                     EIDNVKVIASAVHNATEHLKKKDKVKKEGKKSSKKSTKLKNEPTVDISNTETTSAAIT
                     NESEQSSNKRATRVYKSVGTISNQDSKNPEKLTKKPKKNSNLKNKGKKSKSNSVDGQS
                     IDNIQPNENQPINIQVNTTEIPTDNTLHHYNETLYEQSIQLNHQIAQMRNTNMDMLAI
                     LELMSKLAEMNKEVLNINNSEKIPELMANHYRFFDAQLTSLKNNILDRINNTNIHKFG
                     MDSNDLRSASQTNIHLSHPIAQNMVYSSADQAIPKSVPYYLKQGQRTSPDNGTTTPAG
                     AQNYSKNQVVQHPQAANDYFSSVHVQTANPFEKFQTEKNGIINVTARRHMSVLVDPLT
                     PASMMSVPTTTQSSLSGPSLYNQQHAIIFPHDLNQAFNSRSEPTITPITGHHSNFTRA
                     SDSNLMNTKQTIVNSMKNRASYPSRRTESPLKYSSGMPIEEEQRWEYKITKDNGRNTD
                     IPQLPSNQCQIDSPVPVRSPYNKFVSPHSFYAGGRNISPPMNGNVDMLAQRPSTEVVS
                     LTSSDNKIDNAVVIKRSSTANPILRGSSSEKENKESSNKLIGSTVTEKTSRTKRNSSG
                     VYSLLNGTIKEEKANETFIDTDSHVDKKIKL"
     gene            <694434..>696245
                     /locus_tag="CAGL0I07205g"
                     /db_xref="GeneID:2889191"
     mRNA            <694434..>696245
                     /locus_tag="CAGL0I07205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447563.1"
                     /db_xref="GeneID:2889191"
     CDS             694434..696245
                     /locus_tag="CAGL0I07205g"
                     /inference="similar to AA sequence:UniProtKB:Q12242"
                     /note="similar to uniprot|Q12242 Saccharomyces cerevisiae
                     YOR138c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447563.1"
                     /db_xref="GeneID:2889191"
                     /db_xref="GOA:Q6FQD1"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD1"
                     /translation="MDFEGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIFNTPNE
                     IDNDAMAGQQMGSVPVGTQGIFDDSAFKIQENNPPQSQSYSEQQLVQENLPDNTFRSD
                     SDTNSDSDSSSSLEQSQYTSIDDLIPQQFKNTMDYPTVVIPAPAVPNHIYYCALFALF
                     ISIHLPHYFVKADHDDMPLLFSPDWFNDIDREPEDEPLLVLRDQLHKLIAVQNSNDHS
                     ARAFVTSKMFDVDLQSVIQSNEPMLTNPNYFHLYQILPSFIKTIANLSYTEKNLFISS
                     AIQGGEEASSSKESLLSLFHFLPEEYESNLYKMFNVLLYPDDDHDIGEDEDEVSENSL
                     KELAPVMTIIFNEAENIDENAPVTNGVEVPLKFYPQLYTKKCKDQLISHVLSKRKDGR
                     KELKQILKDIGNLKSYQGKDILSFINSSLDYLTKDKDDSGIAEELHKLKDELTAKKTE
                     KMNSYKQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAVVSPFFYFVRNRKD
                     EWYEVRFNPFNTAEDKISVGKCDGPGEVIQHVKNSTTVPNSTPLMFVYSKDSYMADDT
                     EMQELLSQNKTLLDFFKQDQIYLQNFENARGEGDIRI"
     gene            complement(<696605..>697711)
                     /locus_tag="CAGL0I07227g"
                     /db_xref="GeneID:2889192"
     mRNA            complement(<696605..>697711)
                     /locus_tag="CAGL0I07227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447564.1"
                     /db_xref="GeneID:2889192"
     CDS             complement(696605..697711)
                     /locus_tag="CAGL0I07227g"
                     /note="highly similar to uniprot|P28241 Saccharomyces
                     cerevisiae YOR136w IDH2 isocitrate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447564.1"
                     /db_xref="GeneID:2889192"
                     /db_xref="GOA:Q6FQD0"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:Q6FQD0"
                     /translation="MLGIRSFRLNARRFLATAQPSIGRFTGKPNPSTGKFTVSFIEGD
                     GIGPEISSSVKRIFQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPL
                     ATPIGKGHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIE
                     HLVSPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVA
                     KELAAEYPDIQLETELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSL
                     GLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEK
                     AVLGTIAGGSEYRTGDLGGSASTTSFTDAIIKKL"
     gene            complement(<698635..>699771)
                     /locus_tag="CAGL0I07249g"
                     /db_xref="GeneID:2889193"
     mRNA            complement(<698635..>699771)
                     /locus_tag="CAGL0I07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447565.1"
                     /db_xref="GeneID:2889193"
     CDS             complement(698635..699771)
                     /locus_tag="CAGL0I07249g"
                     /note="some similarities with uniprot|P17121 Saccharomyces
                     cerevisiae YDR389w SAC7 or uniprot|Q12128 Saccharomyces
                     cerevisiae YOR134w BAG7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447565.1"
                     /db_xref="GeneID:2889193"
                     /db_xref="GOA:Q6FQC9"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC9"
                     /translation="MFWNKKTPVLDHYQFKGSVFGVSLDESLNTANSQVKFVDDSEKT
                     GRIPVIVAKCGHYLKNNALETPGIFRVAGNSKRIRELQNVFSEGPDYGRSFNEWDQYS
                     VHDVASLLKRYLTNMKNNEALIPSDTTDVFERVLLQHPDVVQYLKGSYSSVVDLQSNN
                     SSTESAVVSATADTADTADTADTPNTAGSVNRINEPIDSINSIAIQYKDIVVTRLEQD
                     RKYMFMYLLDLLGMFAAHSGVNLMTPCNLAAIFQPAILGQERIVDSTKADRLVVEFMI
                     QYSDKLLELLHLDNEVSRAVDPISPLSQSPLRMHNMHHTYYYRGSMTPPRHTTGSAGT
                     CATSDMTPAREVPRGAIGDVLDTADRTGRRSSLPWLYKLRHKQL"
     gene            complement(<701045..>702652)
                     /locus_tag="CAGL0I07271g"
                     /db_xref="GeneID:2889194"
     mRNA            complement(<701045..>702652)
                     /locus_tag="CAGL0I07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447566.1"
                     /db_xref="GeneID:2889194"
     CDS             complement(701045..702652)
                     /locus_tag="CAGL0I07271g"
                     /inference="similar to AA sequence:UniProtKB:P32913"
                     /note="similar to uniprot|P32913 Saccharomyces cerevisiae
                     YOR132w VPS17 Vacuolar protein sorting-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447566.1"
                     /db_xref="GeneID:2889194"
                     /db_xref="GOA:Q6FQC8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC8"
                     /translation="MASAVPYDPEDEVDDILHNNPFEEPSNTNNHVDDIYTNDSHTTI
                     ETTKPDNAINDDEATQPKQMESEETKKKNAEKQQEILKKLIPERFEQKDKYNVVIKVI
                     GLERVGSLSNKKENPTIIFEVNTNLPTFRKKNHKNVRKSLDEFRNLFKYLNATLSESF
                     IPSLPAPFTNYGINTKEDYKKTVNNFQVWFFRLCANPLIIRNEELAFFIESDFDTYYP
                     VNQYKSPVSGLKRKTMKQFAPPYDEYTELAEFRPLVKSIYSICDSIQERLLKASRARK
                     LMVQDENLFGKCFEQIDDKNVLYKKYGRVMTAVGDIDSIIASMDMATFYDGLTWIVRD
                     TYVVKEALTNRHFLMRELLNAQANTKNRQEQVRKTRTKRDSNPIKVEETTRNMKLAHQ
                     YEADVSQKLNRVTQNMLIERNEWLSWYDKWLKSCIRSYVLKRIEYERKKLALLERVRI
                     DVRKADPRGGLSRLGRENVSDRTEVSQSLEGDSWAGERRIRNDNDLKKLLNTEFDETL
                     ERAEQKTNGETTLDARNAASLLGVTTF"
     gene            complement(<703325..>708640)
                     /locus_tag="CAGL0I07293g"
                     /db_xref="GeneID:2889214"
     mRNA            complement(<703325..>708640)
                     /locus_tag="CAGL0I07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447567.2"
                     /db_xref="GeneID:2889214"
     CDS             complement(703325..708640)
                     /locus_tag="CAGL0I07293g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447567.2"
                     /db_xref="GeneID:2889214"
                     /db_xref="GOA:Q6FQC7"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC7"
                     /translation="MIWLLTQTTAAIIALIQLASSATIDKNTYLDNLPSEDITVNSNA
                     FLALIHANTYTFNGGINNNGYLFMGNVNSGQSGLKTTLSSGSVSNQGTFVLDNRNETN
                     GASLSWSGSSFTNTGTMYFWGAGSPQNSYDFNPSGNFENKGTMVFHQDSKNTDSYANF
                     QGSNVNNDGTICLTNTKSLLKKSIVGNGCITIGENAMMVLQSTSSGTMGSQTLYMTSS
                     SSIIFAESDAKTDNIIVRGFGNGNILTFRTSVDPFRGKWSYDGNSGVLTVKLWPSISH
                     AFHIGKGYDKSKFKQKQITNNVTPTLVNNAVYYDGPVPDTSKPDVCAICPNNPPWIPV
                     INEETNNAAWTGTFLSTKDVHYNFYTDGNQLKESIIYDVVTPIRTELATSYEAWTGTT
                     TNTRTTILETTKGPDGFDTIKETIIIQTPIEKRTTTKFEGWTGSVTNTRSTDFSTFTG
                     SDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYV
                     QTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLE
                     AWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTD
                     FSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETI
                     EAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNT
                     ATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVT
                     NTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGS
                     DGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQ
                     TPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEA
                     WTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDF
                     STFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIE
                     AIYYVQTPIHNTATTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTA
                     TTVLEAWTGSVTNTRSTDFSTFTGSDGSETIEAIYYVQTPIHNTATTVLEAWTGSVTN
                     TRSTDFSTFTGSDGSETIEAIYYVQTPIFVSSSDIHRSPSHSIDSSSTVQASIVSSAM
                     SLNSTNSDKYDDTLRETTIYSTFYSMSMTIEEKIEYFISTDENGNKVQGIHTEMSGYM
                     VDSQPVYASYNSSKSESVTSLSSTQVPTSSVIDSITSSSIIENFIESASTSTYQSDDW
                     SVTQIVSYYIVTNSNGTLQQGINTVYFRERVDSLPIFLNSSVSLTSGTLTSSIDVPSD
                     PNIISESTGTTIPEKETTLFSSNYNPESHVDKSSSKIFTRYQNSSSSNIQSSERKLST
                     GEDTQIYSRKTVTETDYSLIASTTTTCPLSNTGSSMQSKIYSSSHIEKQSLADTTSSI
                     TSKKKEEIITKTSTKQWSSPSALKPSNVLEDISILPQVQKSSITSTKSKTVVVSRPSQ
                     SIDNEARSSKSDSTKISISTKSLTMDNKSNNAQLDVTTSKTSLSSHTVLKLTPSDVYN
                     DSDSKTSSATKIASSFVTPPTISHIESTLITKTPNRIDSVASSSTQTTKQILQQINIT
                     KETSSIVSMSQSVYLQTANSAGSRLTKTATFVKFILGITVLITIL"
     gene            <710334..>710987
                     /locus_tag="CAGL0I07315g"
                     /db_xref="GeneID:2889215"
     mRNA            <710334..>710987
                     /locus_tag="CAGL0I07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447568.1"
                     /db_xref="GeneID:2889215"
     CDS             710334..710987
                     /locus_tag="CAGL0I07315g"
                     /inference="similar to AA sequence:UniProtKB:Q12486"
                     /note="similar to uniprot|Q12486 Saccharomyces cerevisiae
                     YOR131c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447568.1"
                     /db_xref="GeneID:2889215"
                     /db_xref="GOA:Q6FQC6"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC6"
                     /translation="MVTTKLRTFSKLPKVAAVIFDMDGTLCLPQPWMFPAMREAIGLK
                     DASQDILDFISMMDDPVQQKIAEEGLAKVEEKAMLEMIPQPGLVETMKYLTQQGIAKN
                     ICTRNVGTPVHYFIDKFIPKDYAKFDHIIMRDFRPTKPYPDPLLHIAKQIDSNPQHII
                     MVGDSYDDMKSGRLAGCLTVLLKNKINAKLVEEQSSLIDVTISELNELIEIIEEINN"
     gene            complement(711112..711183)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0I07337r"
                     /db_xref="GeneID:2889216"
     tRNA            complement(711112..711183)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0I07337r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2889216"
     gene            complement(<711707..>712096)
                     /locus_tag="CAGL0I07359g"
                     /db_xref="GeneID:2889217"
     mRNA            complement(<711707..>712096)
                     /locus_tag="CAGL0I07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447569.1"
                     /db_xref="GeneID:2889217"
     CDS             complement(711707..712096)
                     /locus_tag="CAGL0I07359g"
                     /note="some similarities with uniprot|P13902 Saccharomyces
                     cerevisiae YOL108c INO4 basic helix-loop-helix
                     transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447569.1"
                     /db_xref="GeneID:2889217"
                     /db_xref="GOA:Q6FQC5"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC5"
                     /translation="MKEENISGTETDASNTQSDTSGKLKKSTKRVSKKVKSNKLSEHE
                     VRKNHVVSEQKRREIIRMMYDDLVQIVPDLSQKENRSELAIYIKTANYLRWLYEKNQE
                     LRMRIQEKHGDDKEIPQELIWNLKGNT"
     gene            <713018..>714037
                     /locus_tag="CAGL0I07381g"
                     /db_xref="GeneID:2889218"
     mRNA            <713018..>714037
                     /locus_tag="CAGL0I07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447570.1"
                     /db_xref="GeneID:2889218"
     CDS             713018..714037
                     /locus_tag="CAGL0I07381g"
                     /inference="similar to AA sequence:UniProtKB:Q12239"
                     /note="similar to uniprot|Q12239 Saccharomyces cerevisiae
                     YOL107w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447570.1"
                     /db_xref="GeneID:2889218"
                     /db_xref="GOA:Q6FQC4"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC4"
                     /translation="MKHSNKFFEVDIPESSLSPRSLPKATKIITSLYLLLTLLLFVLR
                     RIYYVRHEDQEFDSVIVPFLELVPDKVVQYPTAIILSNLIDIKWWKIITNLLNLVLGG
                     SFIEKNWGSSKEIVIFILVLGSITNLVVLSATYVLAQVFTSIRLDLPIDGNYTVLVGF
                     PIIYRQLLPETTIINIKYPSFISKNFRFKLLPIFVICFMTMVQLVWFHHFAELISIWL
                     TFFTTWIYLRFYQRLPTLGNSNTTNEIIVGDASDTFQLIYFFPDIIKPALRPIFNFSY
                     YLFCEKLRLIKPFETDEIDKGNQVAENRGAKRIDQAIDDIEAGDRRRELALKMLNQRM
                     EEPNR"
     gene            714367..714439
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0I07403r"
                     /db_xref="GeneID:2889219"
     tRNA            714367..714439
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0I07403r"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:2889219"
     gene            complement(<714551..>715390)
                     /locus_tag="CAGL0I07425g"
                     /db_xref="GeneID:2889220"
     mRNA            complement(<714551..>715390)
                     /locus_tag="CAGL0I07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447571.1"
                     /db_xref="GeneID:2889220"
     CDS             complement(714551..715390)
                     /locus_tag="CAGL0I07425g"
                     /note="weakly similar to uniprot|Q12366 Saccharomyces
                     cerevisiae YOL104c NDJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447571.1"
                     /db_xref="GeneID:2889220"
                     /db_xref="GOA:Q6FQC3"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC3"
                     /translation="MSQLAKLDNVAVVRHVLNYAVLRIDVGSTMGWGLYRDCWAGETS
                     GYVSYFLRDDDEDVTLVGATDLAGGYDFNVVPLVLCGVKGVDEKIEKFVQFFTAVAAK
                     YKAMYSAVYGNWLKLLESYCYFSSSLVWHNWSKWCQSNGSSKLDKDTSTYLYDKLIAN
                     YLILGESNQYSIDQFTTVLKNRMLRIYNSTRKRTFGKKKIENYNPYLNYGIWFDLSNG
                     IVLFINCELAATIELNEMKLHSSFGACIDELPIDDLVRKLLVFCNMSLVECLMRETSG
                     PFS"
     gene            <716374..>718086
                     /locus_tag="CAGL0I07447g"
                     /db_xref="GeneID:2889221"
     mRNA            <716374..>718086
                     /locus_tag="CAGL0I07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447572.1"
                     /db_xref="GeneID:2889221"
     CDS             716374..718086
                     /locus_tag="CAGL0I07447g"
                     /note="highly similar to uniprot|P30606 Saccharomyces
                     cerevisiae YOL103w ITR2 myo-inositol permease minor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447572.1"
                     /db_xref="GeneID:2889221"
                     /db_xref="GOA:Q6FQC2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC2"
                     /translation="MAGEKVELSSMDSAIEIRHVNQHAKEISSENKSESYDDNKEFEG
                     SNRVVIKPVNDEDDVSVMINFNQGVSHFIIMLTFVASLSGFLFGYDTGYISSALISIG
                     TDLDNKELTYGEKEITTAATSLGALIFALVAGFSVDIFGRKPCLMFSNIMFLIGAILQ
                     VTAHKFWQMTAGRFIMGFGVGIGSLIAPLYISEIAPKMIRGRLTVINSLWLTGGQLIA
                     YGCGAGLNHVHNGWRILVGLSLIPTVLQFVFFIFLPDTPRYYVMKGDYEKAKSVLKRS
                     YNGVSDELIDRKIEELLALNQSIPGKNHVERTWNAVKELHTKPANFRALIIACGLQGI
                     QQFTGWNSLVYFSGTIFESVGFKNSSAVSIIVSGTNFIFTLVAFFCIDKIGRRNILII
                     GIPGMTVAHVMSAIAFHFIGIKFVGNTAIVEHSGFSSWGIVIIVFIIMFAAFYALGIG
                     TVPWQQSELFPQNVRGVGTAFATATNWAGSLVIASTFLTMLQNITPTGTFGFFAGLCV
                     VSFFFCYFCYPELSGLELEEVQTILQDGFNVQASKELAKKRKRQIAVLKKAKHQPTEE
                     IIEE"
     gene            complement(<718481..>719173)
                     /locus_tag="CAGL0I07469g"
                     /db_xref="GeneID:2888972"
     mRNA            complement(<718481..>719173)
                     /locus_tag="CAGL0I07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447573.1"
                     /db_xref="GeneID:2888972"
     CDS             complement(718481..719173)
                     /locus_tag="CAGL0I07469g"
                     /inference="similar to AA sequence:UniProtKB:Q12272"
                     /note="similar to uniprot|Q12272 Saccharomyces cerevisiae
                     YOL102c TPT1 tRNA 2 -phosphotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447573.1"
                     /db_xref="GeneID:2888972"
                     /db_xref="GOA:Q6FQC1"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC1"
                     /translation="MSSKRDIQISKALSYLLRHGAVKENLPFDVNGYIEVERVLNHQR
                     LKSHKCTLEDLHRVVDTNDKKRFNIKLSDDGQTELICAVQGHSIDRIKPDEEVLEVID
                     TAEKLPKNIIHGTSVRNAIQILKSGSIKRMNRNHIHLSIGITEKDKEVISGMRKSSRV
                     HIYILSEPKILEHLKLYRSMNSVILTPDDINKSLFLLVKIRAASGSDESKDERELINL
                     LDENGIKHEYFN"
     gene            complement(<719539..>720444)
                     /locus_tag="CAGL0I07491g"
                     /db_xref="GeneID:2888973"
     mRNA            complement(<719539..>720444)
                     /locus_tag="CAGL0I07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447574.1"
                     /db_xref="GeneID:2888973"
     CDS             complement(719539..720444)
                     /locus_tag="CAGL0I07491g"
                     /inference="similar to AA sequence:UniProtKB:Q03419"
                     /note="similar to uniprot|Q03419 Saccharomyces cerevisiae
                     YDR492w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447574.1"
                     /db_xref="GeneID:2888973"
                     /db_xref="GOA:Q6FQC0"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:Q6FQC0"
                     /translation="MEKKTVQSKIVTLEKLPVWYRRYGNSRIKTGYFYYTNATYLGCL
                     QKLVKFNNDSISIYMNLVCGLISGVMLLFYTDVRLIPSHPSTTMTDYIIINLFLMATT
                     TYFATMTLGQLLKGHSEYQGKLWNQAKQLALVLLLTCSIVTLLYYAFFDHVFLFKLFV
                     IWTCLLMSITSIVIINDQYKRVQKLSCVVIFGVLSISLPIAVSIIKFGLFDSYKKQRI
                     PFQVLTWEIVLYSLSAMLQLTRLPELTLSTLGDSFWIVDYLGNSDQVSQLVTIFAIIV
                     HFNTIIFAYEVVHASIHVPPMISFK"
     gene            <722045..>725275
                     /locus_tag="CAGL0I07513g"
                     /db_xref="GeneID:2888974"
     mRNA            <722045..>725275
                     /locus_tag="CAGL0I07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447575.1"
                     /db_xref="GeneID:2888974"
     CDS             722045..725275
                     /locus_tag="CAGL0I07513g"
                     /inference="similar to AA sequence:UniProtKB:Q12236"
                     /note="similar to uniprot|Q12236 Saccharomyces cerevisiae
                     YOL100w PKH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447575.1"
                     /db_xref="GeneID:2888974"
                     /db_xref="GOA:Q6FQB9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB9"
                     /translation="MTYSDEHASNSRPLLPTDEFALNRQLAKKRTEHEHGPGEIEDYE
                     FNNSLRSSSNKNVADLLYERKNFHPQVQKALTDTDNFIAMYSHHDDNNGEEQDDQLSL
                     GSEDNTEPQVIEEEDEELADDSSSTDNLSYATAGLELDPVLKKRQEEWARRGAAQIVK
                     ESVNPKTGEREKKIIRKGIKDFKFGEMVGDGAYSTVMLATAKDSGKKYAVKVLNKEYL
                     IKQKKVKYVNIEKNALQRLNNSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYG
                     SLSEDCTRYYSAQIIDGIKYLHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPK
                     NEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSYVDARCDIWAFGCMVFQMIAGKPPF
                     KATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYKDIS
                     FEDGSVWTAPAPEIQPYKINAKSMQPVPELKDAPNKRTIINIPKRQLQKAHTNSSSTP
                     NLPTIERPETPQRLESDVDVPKRTTDERTAQILENARKTVNNRKLQLSKRQASGAASA
                     ASIALSRKTSQASSISTTRKRSTPTTPVNDSTSRFADSQAGSRSHSTISTKEASPASF
                     SNSPSAPIMHQQPEASNYSPISTIIESPRLDHGTHSENVSSDPNSKDYWQQYLDSNEH
                     IIKKEEIGLTIVNTDVLEKRVHKTNSVLADPQSSVPIRSTLLSQVARSGGSTTGFRFE
                     GGYLPEQKYYKKLNIEVPNIDEDHKSPAGIITPLMSENVEAVANNEAADDGNNTEDNK
                     ISGKFKKLFHNNKLANLGEFRNLERYKYFKREVIITNSGRMIILVKMRNKFDQHYYSQ
                     LYSINLAQHGCKIKELHFPITTDSQIDNVSYIVIETPYNSFVLICSKGDTKTWLSALI
                     KASTVESHSQVKKSNRVKSESISRTSLPQPRFHKTSSSSSVLSPKQNMPVSPRSVSTN
                     EIETSDPSHSMHKSGRLFDTFVNSRERKQKSHSSQVPINSKLINGLPTSIGNASAAVF
                     GLGINSGSNSTQHNLPQPPEPKAHKKTITANNSRLLSRSEKILRNK"
     gene            complement(<725369..>728434)
                     /locus_tag="CAGL0I07535g"
                     /db_xref="GeneID:2888975"
     mRNA            complement(<725369..>728434)
                     /locus_tag="CAGL0I07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447576.1"
                     /db_xref="GeneID:2888975"
     CDS             complement(725369..728434)
                     /locus_tag="CAGL0I07535g"
                     /inference="similar to AA sequence:UniProtKB:Q12496"
                     /note="similar to uniprot|Q12496 Saccharomyces cerevisiae
                     YOL098c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447576.1"
                     /db_xref="GeneID:2888975"
                     /db_xref="GOA:Q6FQB8"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB8"
                     /translation="MTFQKLVNFQLDYAPQFNVAKYISPRTKLQLVHINHKASPLVEG
                     YFAVATECPNDSGVPHTLEHLIFMGSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVYT
                     LTSAGWQGFKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQDFSDKGVVYSEMEGIESQ
                     SWFLTSLEKQRLMFPEGSGYRSETGGLTKNLRTLTNDEIKEFHKKMYSPQNLCLIVSG
                     NVPEDELLEIASRWDETLPTYSDASISRPFVDTPDSQIPEKRTQIARSVIEFPEADES
                     QGEILLSWIGEKYDSYERDLAVSMLLEYYTESSISPFNKEMIEIEDPYANSVDYYTDD
                     YLRTIINLNLHGVPTEKLDITVKKAIELMTTHKFDLERMKQVIENSKWDYVLRCEKTP
                     SDTLSQAVISDFLYGKTDGSSLVETLKNLNDYDRIINNWTVQDWEKLRDEIFVENKPV
                     VVIGKPSAKMNEVLEKEKENLLHSREQQFGETGRKELKQKIDNAKKTNDVDIPNTILD
                     MFAIENPAASVDFIKTEGKKHETTREFPLPFHVESFPTDFVEMHCLLNSMYVKDTELL
                     PYYQVFHELFSLPMKSSDGSILSYEQVISQLKDETLETKVTLGLSGACPDLIDIMIKC
                     RAKDYAKAVEWFNHVLFDMIFDESRIKVLLENYLDSIVELKRDGPMMLESITNRNLYS
                     ERSLKKSIDPLYAESILEDVLEDIEKGNFESNILPRLETMRSQLRTHFTKFRILVLGD
                     VSKIVSSGGLYEPWNGLLKNMEKDNAEFGDHKIPPAPRPLHFVSDICSKPSGQVFIIT
                     TPASESSFMNVVTKVPFDLDYHHPDYPKVCLASEYLQCVEGPFWKGIRGAGLAYGAYM
                     LKLPEINSWGFSIYRGADIIGCYKAGKEIVTSYANGKTKFENRLISGALSSIINSLAS
                     MEDNYFNAGLMDYVDNELYNRGPHFKDIFLERLGQVSAAQLEEMMSKYLVNIFQPQHS
                     TIFLSCHPSKLESTQEYFENEGFNVNVEELEEDVDDSDYESDDSDVSMK"
     gene            <729792..>730430
                     /locus_tag="CAGL0I07557g"
                     /db_xref="GeneID:2888976"
     mRNA            <729792..>730430
                     /locus_tag="CAGL0I07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447577.1"
                     /db_xref="GeneID:2888976"
     CDS             729792..730430
                     /locus_tag="CAGL0I07557g"
                     /inference="similar to AA sequence:UniProtKB:Q99258"
                     /note="similar to uniprot|Q99258 Saccharomyces cerevisiae
                     YDR487c RIB3 3 4-dihydroxy-2-butanone 4-phosphate
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447577.1"
                     /db_xref="GeneID:2888976"
                     /db_xref="GOA:Q6FQB7"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB7"
                     /translation="MVQFMEIKDAIEHFKQNKFVIVMDDEDRENEGDLICAAANVTPE
                     HIAFLVRHSSGYVCTPMSNKIADRLDLPLMRDNLKCESADDDRHGTAYTITVDVSEGT
                     TTGISAHDRALTCAKLADPSAKPKDFLKPGHICPLRAKDGGVITRQGHTEAAVDLCRL
                     SGLPEVGVICELVNDRDGSMMRLNDCAEFGKKFDIPIITIQSLIKYIKENNL"
     gene            complement(<730934..>732211)
                     /locus_tag="CAGL0I07579g"
                     /db_xref="GeneID:2888977"
     mRNA            complement(<730934..>732211)
                     /locus_tag="CAGL0I07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447578.1"
                     /db_xref="GeneID:2888977"
     CDS             complement(730934..732211)
                     /locus_tag="CAGL0I07579g"
                     /note="highly similar to uniprot|Q12109 Saccharomyces
                     cerevisiae YOL097c WRS1 tryptophan--tRNA ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447578.1"
                     /db_xref="GeneID:2888977"
                     /db_xref="GOA:Q6FQB6"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB6"
                     /translation="MSEVDKVTKEVENLKTADKDQVVTPWDVEGAVDESGVAQAIDYD
                     KLIKQFGTKAITQETLDRFEKVTGQKPHHFLRKGLFFSERDFNKILDLYEQGKPFFLY
                     TGRGPSSGSMHMGHLVPFMFTKWLQDVFDCALVIELTDDEKFLFKPKLTIDDVKGFAR
                     ENARDIIAVGFNPENTFIFSDLEYMGGAFYENVVRVSRQITGSTAKAVFGFTDSDCIG
                     KFHFASIQIATAFPSSFPDVLGLPPKTPCLIPCAIDQDPYFRVCRDVADKLKYSKPAL
                     IHSRFFPALQGSTTKMSASDDTSAIFMTDTPKQIQKKINKYAFSGGQVSIELHREKGG
                     DPDVDVAYQYMSFFEDNEEFLKETAEKYRSGELLSGEMKKYCIERLQKVVKEFQDRRA
                     NVSDEVLDKFMKPHKLVWGQKERLVAPKPKEKK"
     gene            complement(<732591..>733490)
                     /locus_tag="CAGL0I07601g"
                     /db_xref="GeneID:2888978"
     mRNA            complement(<732591..>733490)
                     /locus_tag="CAGL0I07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447579.1"
                     /db_xref="GeneID:2888978"
     CDS             complement(732591..733490)
                     /locus_tag="CAGL0I07601g"
                     /inference="similar to AA sequence:UniProtKB:P27680"
                     /note="similar to uniprot|P27680 Saccharomyces cerevisiae
                     YOL096c COQ3 enzyme of ubiquinone biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447579.1"
                     /db_xref="GeneID:2888978"
                     /db_xref="GOA:Q6FQB5"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB5"
                     /translation="MMNRFTSRISRLQLGRVAKRLKSTEASQDEIHHFQELAPTWWDP
                     HGPQRILHLMNNARLDFIQRTLRSCVKVDNPDIFIPGFDHTSFLPRYVSNNIERELTE
                     EINDQLVHKQYSVLDIGCGGGILGESMARLPFVKRVTGIDLTPEVIEVAKQHSLQDPA
                     ILDKLDYKLMPLEKVQEKFDIVTCFEMLEHVDYPSEILKHAWNRLHQGGILYLSTINR
                     DPISWFTTIFMGEDVLKIVPKGTHHLNKYINSREVKNWFKKNHAHRHEILDCKGTMYL
                     PLKGWVEHDCQDIGNYFMAIRKL"
     gene            complement(<733766..>735901)
                     /locus_tag="CAGL0I07623g"
                     /db_xref="GeneID:2888979"
     mRNA            complement(<733766..>735901)
                     /locus_tag="CAGL0I07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447580.1"
                     /db_xref="GeneID:2888979"
     CDS             complement(733766..735901)
                     /locus_tag="CAGL0I07623g"
                     /inference="similar to AA sequence:UniProtKB:Q12039"
                     /note="similar to uniprot|Q12039 Saccharomyces cerevisiae
                     YOL095c HMI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447580.1"
                     /db_xref="GeneID:2888979"
                     /db_xref="GOA:Q6FQB4"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB4"
                     /translation="MRKGKLTSSQKSVLEAKYEPNSTLKVVAGPGSGKTTTLLHKVHH
                     LIDSQNIHPDEILILSLTNKAVDNIFGKLTSVFYELTDSDDAQHIEQVADKIGCYTIH
                     GLANKIVTEREGTVSIIEENGWRGLSQLVSKDYWNKTRSPGKKTKRLEKLLSEYKKQN
                     KSSDDTIDKLIQIMDSCKVLTNEDLIIRASKILTEPTFDSAEFSFIRDLNQRYKVILI
                     DEFQDLYPQLLPLLQTISKNKQLIIFGDVHQSIYEFLGANSTVVEALDHLHSNTITVH
                     LNDNFRCSPEIMKAARKVINKEHVAVELETISDIIVKEPSKVDPIIESIDNVDAQLRY
                     IETEISKLVCSSAKLSDIAILTRSNAEIDTIIDYFKNSAIPFEKLTSQPEWMSDVRIQ
                     YIIDFMRTILLTSDDNNSNNNNYRPNERNCTPNWKSDFNTIVTLSGVKGIGYATIQQL
                     YQSALSNEQPLWEYLKSLDAGDIPIAGHIKQQIQRYVGLLRELHRSSFVSSCNEPIEL
                     LEMLVNIISDIEYQPLINISKKDLDIVMKHLQDLLLALNEAKDSKPSDCSLLEWFLTH
                     YIEQVTSAHHEKLLAGNKDDIGTIKLSTIHAAKGLEFPIVLISNLSQNQYPIDTNALY
                     VAMTRARNLLYLINVNHKEIKNIDRFSHSILEQRNFWKYYNRDLKRTNIITTKSYYTE
                     LSKKYNLLPSKRMLHSAPKTFLRAAKFLF"
     gene            complement(<736131..>737099)
                     /locus_tag="CAGL0I07645g"
                     /db_xref="GeneID:2889001"
     mRNA            complement(<736131..>737099)
                     /locus_tag="CAGL0I07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447581.1"
                     /db_xref="GeneID:2889001"
     CDS             complement(736131..737099)
                     /locus_tag="CAGL0I07645g"
                     /note="highly similar to uniprot|P40339 Saccharomyces
                     cerevisiae YOL094c RFC4 DNA replication factor C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447581.1"
                     /db_xref="GeneID:2889001"
                     /db_xref="GOA:Q6FQB3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB3"
                     /translation="MSKATLTLELPWVEKYRPHLLKDIVGNEETVERLQQIAADGNMP
                     HMIISGLPGIGKTTSIHCLAHEMLGESYSQAVLELNASDDRGIDVVRNQIKHFAQKKC
                     HLPPGKHKIIILDEADSMTAGAQQALRRTMELYSNSTRFAFACNQSNKIIEPLQSRCA
                     ILRYSKLSDEQVLKRLLEIIKAEDVQYTNDGLEAIIFTAEGDMRQAINNLQSTVAGHG
                     LVNGENVFKIVDSPHPLIVKKMLLAETLDESIDCLRQELWAKGYSAVDIVTTCFRVTK
                     NLFQLKESVRLEMIKEIGTTHMRILEGVSTYLQLASMLAKIHKLKA"
     gene            <737449..>738312
                     /locus_tag="CAGL0I07667g"
                     /db_xref="GeneID:2889002"
     mRNA            <737449..>738312
                     /locus_tag="CAGL0I07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447582.1"
                     /db_xref="GeneID:2889002"
     CDS             737449..738312
                     /locus_tag="CAGL0I07667g"
                     /inference="similar to AA sequence:UniProtKB:Q12400"
                     /note="similar to uniprot|Q12400 Saccharomyces cerevisiae
                     YOL093w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447582.1"
                     /db_xref="GeneID:2889002"
                     /db_xref="GOA:Q6FQB2"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR016653"
                     /db_xref="InterPro:IPR028564"
                     /translation="MSDTSDLVDGKWQRLPPVPEGMSKSQWKKQWRRQMYEAKKEEYA
                     EVRKEKRKRAKENRRKKIQEYIDRGEEVPAELKREPRVNRDQVASGINIILDCAFDDL
                     MNDKEIVSTSNQITRAYSANRRASQYANITVTSFNKRLKERFDKALDDCNYPQWQNFK
                     FVSDEKLITEGDKSKMVYLTADTEEQLDTLEPGMTYIVGGIVDKNRHKLLCYNKAKEL
                     GIPTRRLPIGEYIKIEGRKVLTTTHVIQLMLKYCESRDWKESFESVIPSRKLDPVKEK
                     EQQQQQQQQQQ"
     gene            <738928..>739857
                     /locus_tag="CAGL0I07689g"
                     /db_xref="GeneID:2889003"
     mRNA            <738928..>739857
                     /locus_tag="CAGL0I07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447583.1"
                     /db_xref="GeneID:2889003"
     CDS             738928..739857
                     /locus_tag="CAGL0I07689g"
                     /inference="similar to AA sequence:UniProtKB:Q12010"
                     /note="similar to uniprot|Q12010 Saccharomyces cerevisiae
                     YOL092w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447583.1"
                     /db_xref="GeneID:2889003"
                     /db_xref="GOA:Q6FQB1"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB1"
                     /translation="MVSFVPVVWDSQAVSGIAGSVSIACWVVVFVPQIYENFYRKSAD
                     GLSLLFVVLWLAGDVFNLVGAMMQHLLLTMVILAAYYTAADVILLIQCLWYDNEEKLD
                     PIHFSPANPINENVLQDVFNEHQPLLTSGEPTRGSEAENNSRSQAIEALLEADEQKTK
                     RSNLFNDFTIVALVILGGIVSWYVSYCANPPEPIVGEPDVEMNMLAQSFGYLSAVLYL
                     GSRVPQILLNFKRKSCEGISFLFFLFACLGNTTFIISVLAISTDYRYLLVNASWLIGS
                     SGTLVMDFIIFIQFFAYGTSKPIELPRDEERLA"
     gene            <740473..>742197
                     /locus_tag="CAGL0I07711g"
                     /db_xref="GeneID:2889004"
     mRNA            <740473..>742197
                     /locus_tag="CAGL0I07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447584.1"
                     /db_xref="GeneID:2889004"
     CDS             740473..742197
                     /locus_tag="CAGL0I07711g"
                     /note="weakly similar to uniprot|Q02455 Saccharomyces
                     cerevisiae YKR095w MLP1 or uniprot|Q12411 Saccharomyces
                     cerevisiae YOL091w SPO21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447584.1"
                     /db_xref="GeneID:2889004"
                     /db_xref="GOA:Q6FQB0"
                     /db_xref="UniProtKB/TrEMBL:Q6FQB0"
                     /translation="MESIIENDTIEQDSLDSIELRVPQLEDYSIHTYENSSDGTTSYS
                     DGSELSSSSSKVSFRDKVRQIFKKTPKTDANEEHDEQSNSSFSFFRVHRKKKCPEENE
                     LESSNDSEKLDNLQPNDTIDGYSNRENIMMQNGSKSPNNDHSVEANDSTGLLLAKSID
                     NIEDYSDYENDADIFDSNDQGKPEISPLTPAEFNNDLGKYKGVYDFSEFFYEVWQLIT
                     NDGITLESIGNQKPKDYLLESIRQLMTENNKLKVGMEEFEEELLQKNTELQKAKKTYK
                     DKLKKSEDKYKTIIKKYIAELKIMTDDKNNTACKELIDFDSMNQALKQRIAILESESN
                     DLDTRNKALTEKLEKMTEKVGEVSRQLITMQEANERFKESLDDSTTKIERASFEIDRS
                     CTAINHLKQKYEYQKKKTLTLLKRDKTQRKMAEFFETYMRESLSFVGYLLEAFKGKFN
                     ETDYNELQNYYLDISKITELKGDLRDAENVDSRIHSLEEMIFNFYSVAAKAQFVEPIL
                     VRQDTAERSVTFLTGQLESLKKELQETKKIIKQMKKASSNSSHYVNKSQRRLTNKTHT
                     EILADLPI"
     gene            <742610..>745483
                     /locus_tag="CAGL0I07733g"
                     /db_xref="GeneID:2889005"
     mRNA            <742610..>745483
                     /locus_tag="CAGL0I07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447585.1"
                     /db_xref="GeneID:2889005"
     CDS             742610..745483
                     /locus_tag="CAGL0I07733g"
                     /note="highly similar to uniprot|P25847 Saccharomyces
                     cerevisiae YOL090w MSH2 DNA mismatch repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447585.1"
                     /db_xref="GeneID:2889005"
                     /db_xref="GOA:Q6FQA9"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR011184"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA9"
                     /translation="MASNRPELKFSDISEERGFYKRYVKLPEKPSGTVRIVDKGDYYT
                     AVGDDAVFIAENVYHTMSVLKDCHVDPAVAKQFNEPTKYVTMSLQIVASLLKLCLLDV
                     GNKVEIYDRSWKLIKSASPGNIEQVSDLLNLNIDASIVIASLKIQQNPKDAHVILGLT
                     FIDTSNYKIGMMDIIDNEAYSNLESFLIQLGIRECLVPDLSQNGSTNPELKKITNVID
                     RCGSVVTIVPNSEFSNKDVEVDLAKLLGNDLTLTLPQNVSQLALGACNALLNYLQLLS
                     EQEMLGKYELIQHSLESIMKLDSSAIKALNLFPQNNATFFTPMQSGTVGSNGGTKVAS
                     LFQLLNNCKTNSGVRLLNEWLKQPLTDFSGIQVRHNLVEFLIDQLELRQILQTEYLPG
                     VPDIRRLVKKLNKNGTLEDVLKVYQFSLKVPDIINIIESFLEDDITTTDIKELVRKTW
                     CDPLKEFMEPLKKFDEMVQTTVDLDAYEENNEFMIRVEFNEELAKVREQLTAMRDEIN
                     AIHLEAAEDLGFDPNKKLKLENHHIHGWCMRLTRNDAKALRNHKQYIELSTVKAGIFF
                     STRKMKEIAQETVVLQKDYERLQSSLVKEIVSITLTYTPIFEKLSLVIAHLDVLCSFA
                     HASSYAPIPYVRPTMHPLSSDRRTKLMNSRHPVLEVQDDVTFIANDVDMAKDVSEFQI
                     ITGPNMGGKSTYIRQVGVITLMAQIGCFVPCDNAEISIVDAILCRVGAGDSQLKGVST
                     FMVEMLETASILKNATSNSLIIVDELGRGTSTYDGFGLAWAIAEHIAKEIRCFALFAT
                     HFHELTNLSEQLPNVKNMHVIAHIDESEKALNSNDITLLYKVEPGISDRSFGIHVAEV
                     VQFPKKIVSMAKRKANELEELKNTSNDLKRAKLNPQEIAEGNLKLKCMLKEWKQSVEN
                     KGLLDVEKLSEEETQLAIESLLKKLCDADHSDDRYFSYLKELL"
     gene            complement(<745585..>748746)
                     /locus_tag="CAGL0I07755g"
                     /db_xref="GeneID:2889006"
     mRNA            complement(<745585..>748746)
                     /locus_tag="CAGL0I07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447586.1"
                     /db_xref="GeneID:2889006"
     CDS             complement(745585..748746)
                     /locus_tag="CAGL0I07755g"
                     /inference="similar to AA sequence:UniProtKB:Q12180"
                     /note="similar to uniprot|Q12180 Saccharomyces cerevisiae
                     YOL089c HAL9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447586.1"
                     /db_xref="GeneID:2889006"
                     /db_xref="GOA:Q6FQA8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA8"
                     /translation="MSEPNQGTPMAIQHVPGQTPMPQSQTGQQQMSPPMLDPFWQRNL
                     PEQYIQVSGTRYPSIDASVQPNVNGSKNNNGNTAASTPASYGAQQIQGMAHTNGHLDA
                     AIPMSNMIPVQMGGYQVMDRSMMEPMSGSSVAYANTSANANGTPLPPQPVSANYMNNI
                     SQMPGQLHKEKRRAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDCIFITEPTKKK
                     RKSSSEGTKVNKSPKPAAKTNSTKHKVKKQSDGDNEPVHQNTVENIAKRMEILDRKMS
                     TVIDNIARFEWLLDKMVQKQNEKVDDTTNQAKPRRRIYTTSLLTHQKLLWMKRKICKN
                     MTDEQFAEPLNSILSNGLKWYVAQIKQYTDFSSPCVYGVEFKVYDLPSELHTRRIMEN
                     FNAYLTSVTGVFDSSECYKVTNKYYENKGENMTFTEHLLLNVSICSGALATRMLTSAD
                     SQFLRKDRHNPSIAELKEIENNCFLNCMFYYHKISTVCSGPKTLLPLLLLTKYLQANY
                     NTELANTILSTAVRFTIDMSMNKKITYKNLSLAEQIRKRSMWWHFFATDKLFSFTLSR
                     PPMLLEEDMDMLTDQNYLEVIKTNILPKIFKTKEECEQVSDIHEALSIIINYCEYIPF
                     FTSYYVTKLLRIESSLYSTCFSVRNTLDNTFDGLLSKALEIFESLKTWKDNLHPSMRL
                     ESYRQYISLLYSQSSDENPALAFELACTHVLACHLRYLYLVVILSMFIVSLLRDNQEL
                     FPVSHHEIPKIYKKFSEQYILSSVKLVEIFQGVNFVIHTYNDLIYPFLTGIYVVLMHV
                     VDELDKPKNLEVPSLIELLIKGHSSIMGENFKNLGCYNMKWNVSLYIYTYLLKYIIKY
                     FNENHPLAVEHKFSYEHYDEILEKLEANTISVKKTTVERLKKNLKRNGVFQEVDEAEK
                     TEEENNEKDHIIELFNDLNSHTVKILESDSLLKNSKERISSVATSQDASIFPADSAGF
                     QIIYPIYKDSNKNLNESVHDDNDKKDNNEKNISSSITDADVENFRNLLPLEDFLYDRD
                     FKFIKPFQSYLSRHSVSNKDQSL"
     gene            complement(<749478..>750200)
                     /locus_tag="CAGL0I07777g"
                     /db_xref="GeneID:2889007"
     mRNA            complement(<749478..>750200)
                     /locus_tag="CAGL0I07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447587.1"
                     /db_xref="GeneID:2889007"
     CDS             complement(749478..750200)
                     /locus_tag="CAGL0I07777g"
                     /inference="similar to AA sequence:UniProtKB:Q99316"
                     /note="similar to uniprot|Q99316 Saccharomyces cerevisiae
                     YOL088c MPD2 protein disulfide isomerase-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447587.1"
                     /db_xref="GeneID:2889007"
                     /db_xref="GOA:Q6FQA7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA7"
                     /translation="MRFSLILAVLAVAFAEIIPIESIDQFYDLANKDGTYTVVKYYTE
                     WCSHCKKLKSVYKELDEQLSSESNLNAPIQFVEVDCDTYGSTICKRLPGYPIVEVVKP
                     PTLDANTTVTDTPTLFERVKRAIFGENTWTISDDRIVRFEGSRSVNPLQGFITMVVNK
                     DVMKRQLMDIIEGRPIEAQDKVLNAIKEYYNELEHNNLVHERARLERILKTNDDGQLD
                     IVKGQLELINLLETTNEIVDEL"
     gene            complement(<750496..>751143)
                     /locus_tag="CAGL0I07799g"
                     /db_xref="GeneID:2889008"
     mRNA            complement(<750496..>751143)
                     /locus_tag="CAGL0I07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447588.1"
                     /db_xref="GeneID:2889008"
     CDS             complement(750496..751143)
                     /locus_tag="CAGL0I07799g"
                     /note="highly similar to uniprot|P20434 Saccharomyces
                     cerevisiae YBR154c RPB5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447588.1"
                     /db_xref="GeneID:2889008"
                     /db_xref="GOA:Q6FQA6"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /translation="MDQENDRSISRLWRTFRTVKEMVRDRGYFIAQEELDLTLEDFKV
                     KYCDSMGRAQRKMMSFQANPTEESMTKFPDMGTLWVEFCDEPSVGVKTMKTFVIHIQE
                     KQFQTGIFIYQNNITPSAMKLVPSIPPATIETFHEAALVVNITHHDLVPKHIRLNEEE
                     KAELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETAGRYASYRICM"
     gene            complement(<751754..>755143)
                     /locus_tag="CAGL0I07821g"
                     /db_xref="GeneID:2889009"
     mRNA            complement(<751754..>755143)
                     /locus_tag="CAGL0I07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447589.1"
                     /db_xref="GeneID:2889009"
     CDS             complement(751754..755143)
                     /locus_tag="CAGL0I07821g"
                     /inference="similar to AA sequence:UniProtKB:Q99247"
                     /note="similar to uniprot|Q99247 Saccharomyces cerevisiae
                     YOL087c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447589.1"
                     /db_xref="GeneID:2889009"
                     /db_xref="GOA:Q6FQA5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA5"
                     /translation="MKLTVSYGLIPPNEGCGVNSHILPITKVMHPVFNDKPYFLTCGR
                     DGSVVLHRGPRYEQHEGMRMQVHSDWVSDIIEVGKNRFVTVSHDFSIVLLVLNDDLDS
                     WQMQIVGDHDDYIKCVVPLHHEQEKAHLLMLNLDMQATRQLSMSDDEDQDEALLKQNQ
                     DQTQEQDQEQKQKLEQEQAQEQEQGRDKSGAGEQDSVASFFHFATGSLDKTIKIWQLD
                     NLSNTATLLHTFDNSQDDDMGSIYAMAALNRNDISHLFDGDQLKEKVLDGTGFTENEV
                     SDTDSNSDHSMDLDMPFDLVVGDCNGNLIFYSSEHYQEYTRLKNAHMSNIKVLKVIDN
                     SSKLISTCSDGVIQLWDLDATAKSEDNVPVNIGCWKWNATIWCITGTSHDELYFGDSK
                     GKIVKLDLTNYNDSSKDITMDVIFDKEHHKAELSENDIKVQSSKRQKGILDLICLPSK
                     CLFFSFCTDSNMNIYNMITEELKVKKGGFALTRSSLLTNRRHVITENTKNEIQRWDIL
                     NCTLLDTFTPEEGTFDEVVMKYTSKEILSHWCTVSVKVGMLFVKINDRFTNTEIYGSA
                     LENYELMNKISLNQDERYNLGKIVVNSLFFEFISYELDKDKIWRKKLVSRKKEHPSVK
                     EAGSNSESQVPPVEKSRDKWKKSAFNKFLGSSSNSNSNNGEPLDLVTENENSESEAYD
                     TPPLSPSQGLNDKTLDEVIQPTAHKNFGGRTLSSGSLLGRKFKSFRSGSTKNNSNTNN
                     LSESCAETPIENGERDQSLVPSHNVSGTTTKDGTPDLINWNHPFKGDSSKQNAPSHSN
                     IAARLQATESSRSNSVAAADSFIGTPLSLSSREEFMSDLMDEIHESYQKTHNANTSSI
                     KLLARKPPDSKIRRDLSCPIVKIERGCLLLVHNWKEGACGGRVVFSTYIPIPRSEEEQ
                     EEGLKKIQTEEEDDNAAIDEDKLKKYDYVDNDDGNVLSRRELFELLETNLPYWLAKIL
                     LTESKKTEGQPKLSFTIIPWTPGQLNSNNETLETDDDGNTQSQTESSTQSHSMHNMLK
                     FGKSKSNDHALTATDLPKISELNMKLMAPGMIKVKKIKLYVVDRFESKTPEMKAKQNP
                     NDWLELLCKGQVLDNDMTLSTVRSLFWKSQGDIVLQYRRKL"
     gene            <755409..>755738
                     /locus_tag="CAGL0I07837g"
                     /db_xref="GeneID:9488012"
     mRNA            <755409..>755738
                     /locus_tag="CAGL0I07837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999515.1"
                     /db_xref="GeneID:9488012"
     CDS             755409..755738
                     /locus_tag="CAGL0I07837g"
                     /inference="similar to AA sequence:UniProtKB:Q3E835"
                     /note="similar to uniprot|Q3E835 Saccharomyces cerevisiae
                     YOL086W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999561.1"
                     /db_xref="GeneID:9488012"
                     /db_xref="GOA:B4UN18"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR029003"
                     /db_xref="UniProtKB/TrEMBL:B4UN18"
                     /translation="MAGGYKLQSYKATKLQSYKGTSEAMDESQLKGKLWYCVDRLLAR
                     EERRFSQKFVSALVELVYVQLVEVGETLESYAQHGGRDVVSMADLRLLLRRSPELLAM
                     CDPEGSQ"
     gene            complement(<756345..>757403)
                     /locus_tag="CAGL0I07843g"
                     /db_xref="GeneID:2889230"
     mRNA            complement(<756345..>757403)
                     /locus_tag="CAGL0I07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447590.1"
                     /db_xref="GeneID:2889230"
     CDS             complement(756345..757403)
                     /locus_tag="CAGL0I07843g"
                     /note="highly similar to uniprot|P00330 Saccharomyces
                     cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
                     uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447590.1"
                     /db_xref="GeneID:2889230"
                     /db_xref="GOA:Q6FQA4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA4"
                     /translation="MATLHAVPETQKGVIFYENNGKLEYKDIPVPKPKANEILINVKY
                     SGVCHTDLHAWHGDWPLATKLPLVGGHEGAGVVVGMGENVKGWKIGDYAGIKWLNGSC
                     MACEYCEKSNESNCPEADLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAG
                     ITVYKALKSANLNAGEWVAISGAAGGLGSLAVQYAKAMGYRILGIDGGDEKKALFHEL
                     GGEIFVDFTKSKNVEQDILVATNGGAHGVINVSVSEAAIESSTRYVRSNGTVVLVGLP
                     ANAKCSSDVFNHVVKSISIVGSYVGNRADTREALDFFSRGLVKSPIKIAGLSELPEIY
                     EKMEKGQIVGRYVVDTSK"
     gene            <758727..>761651
                     /locus_tag="CAGL0I07865g"
                     /db_xref="GeneID:2889231"
     mRNA            <758727..>761651
                     /locus_tag="CAGL0I07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447591.1"
                     /db_xref="GeneID:2889231"
     CDS             758727..761651
                     /locus_tag="CAGL0I07865g"
                     /inference="similar to AA sequence:UniProtKB:Q12252"
                     /note="similar to uniprot|Q12252 Saccharomyces cerevisiae
                     YOL084w PHM7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447591.1"
                     /db_xref="GeneID:2889231"
                     /db_xref="GOA:Q6FQA3"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA3"
                     /translation="MAADTSSSTSAFVTTLIFNGVVAVIFLLLFWYLKPKNKRVYEPR
                     TLTDIQTISEEERIDTLEYDDENSWLGFLLSRPHSFLIQHCSIDGYLFLRYIGIFAGL
                     SFISCFILFPILLPVNITNGNHLEGFEVMSFANVRNKNRFYAHVFLSWIIFGLFTYVI
                     YRELYFYISLRHSLQTTPLYDGLLSSRTVVVTELSDTYNQEGEFDRLFPNAAHIIFAR
                     NLKELQDMVKERDETAQNYEKTLNKLINKCVKKQNSEKKREKLYKDGKPKDDLSTYVP
                     HNKRPKKWIKHWPLPTFLGGEKVDLLTYSTKQIGDLNDKIKDKQQDWQKSDHLNSVFL
                     IFDTQLEAQRCFQSVPDILGFTNYGKCLIGCTPDDLNWDNLNLTKKARYMKRLTANSI
                     LTAMIIFWAIPVAVVGCISNVNFLVEKIHFLHFLNNVPNVIMGIITGLVPSLALSILM
                     SLVAPFIKKIGEMSGDITRQETDQYCQKWYFAFQVLNTFIVTTLASSASSTVTAIIDE
                     PGSAMTLLANNLPKASNFFITYFLLQGLTMPTGQLLQVANLILSKFMGRILDTTPRQK
                     WNRYNTLSKPSMGVVYPTVEILVCIMISYIIIAPILLVFSTMTFLFLYFAYLYNLNFV
                     MGFSFDLKGRNYPRALFQVFVGIYLSQVCLLGLFIMAKAWGPLVLECFWIVVTALAHI
                     YMKWRFLPLIDAIPLSAILNARGSKKHRYPQKDQGLKEVKGIGEDMKKLFEDDNHNGV
                     LRPATKGDLRRADLLPEDELESDSEGCGDDISTLGDMEESLPKNDRKQSNVTDGSKYA
                     STFVGSDEDFKKLHYADVKDMKKQQQSGPEVNPEGAVVGNADVGKIFSDPMAMTDDPN
                     AFPDNILPSQGKFKRLANFFEPSKSYPFCKVRNRLPHSLNTTIQYNLDYAETAYTDPS
                     VNSTSPIVWICRDPMGVSQRQIDEAHMDNVPITDEFTEYDEKGRAQFTFNPPDFIRKA
                     KK"
     gene            <762373..>763521
                     /locus_tag="CAGL0I07887g"
                     /db_xref="GeneID:2889232"
     mRNA            <762373..>763521
                     /locus_tag="CAGL0I07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447592.1"
                     /db_xref="GeneID:2889232"
     CDS             762373..763521
                     /locus_tag="CAGL0I07887g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447592.1"
                     /db_xref="GeneID:2889232"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA2"
                     /translation="MGITIKTVNGDQVNEIKFDDCSYALKVFPLLTVLKYKIKDLYKE
                     ADVVCYYDGQSKLIQNERELSFPDGSTLIITFKRQVATNYVSTDDLDAQEYEIVSEKE
                     DNAQKSVNVPVVVLDAIRKQVDKMDTFLKKVASEQHVNEEKYCKMELPKLIDAEEAND
                     VCDPKEKALEISHCFEVYKRYKTLYYETKGQQINFSFEDYLDYILKNTDHQPIKVCSQ
                     AFVHLSQDYDTVTIDLVTTPGEFPTNHQLSVSTSNSNLFTINLSGFFPNTGGTKKFRY
                     FPVTEDIKSKPLSVAISDKTTGRITMKGKSEGNSLPKLIRLSTVVDKIESSIDLDSIQ
                     EQTSKLYDEILKYETANKETSIISEDESAIKTESANWEEYDFLSDSSV"
     gene            <764170..>773280
                     /locus_tag="CAGL0I07909g"
                     /db_xref="GeneID:2889233"
     mRNA            <764170..>773280
                     /locus_tag="CAGL0I07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447593.1"
                     /db_xref="GeneID:2889233"
     CDS             764170..773280
                     /locus_tag="CAGL0I07909g"
                     /inference="similar to AA sequence:UniProtKB:P19158"
                     /note="similar to uniprot|P19158 Saccharomyces cerevisiae
                     YOL081w IRA2 GTPase-activating protein for RAS proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447593.1"
                     /db_xref="GeneID:2889233"
                     /db_xref="GOA:Q6FQA1"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:Q6FQA1"
                     /translation="MSSDSQPRPYMVGSMVNYLFFSRLLPLLPIESTATSHVEVEAEP
                     FFISIRGVLMKIAIFKDLNIVIENALNLLESILDDEDIISGKIKPDAIQSSLVVVRLL
                     SDIVEFYWQYNEQKSNDKDDMNTNIDIFEIKSFATPDFDPMARKKSNFDWQKKQQNMS
                     SFFVGYSTSKTCYHQKPPKKLDGDVISRLIYTCARLTFNTQTLEVLKNIEKHSPEDVH
                     QPNTLDHYDAYLKTNNYPEYCSNMDNTINHILKFIAAANPKEYVKFVETNVQNLLQEN
                     ALEAEKYIIEYLDLFSYAFITKDFLPTYLKKVSSVLHSLKNPAYRCLLLFFASESLLY
                     WIMLRPRDFMGIYSVVEGHHPGSTHLEVNKTTSVIANELFEEIYTMFNVSSILSSTQS
                     INILNPIRYMERSVSPIPTESNEYRTKSHRNSFLERENRGLKSSSPDPLEVHTPAPQF
                     GDVFQDVPTPMSRTSPEITLNASDLIKNYPATARNMTSSTASNSSSNSKNFNPFVDFD
                     TIKIQPENTKPEIPHLDNVLDLYTIHDQSIALPHTSVLRFLTTLVMIDLDAFTELNST
                     PSKYLTDIDKLTKGTATSRTSYSKFDSSKQKEKNGSMKQLSNSWKKLTNLQLSKKKTV
                     KFLKALIKNLNGLQYVCDNALLDTIGSLLCLMNMNSALSLVEPNLPSVLFSRRFLVVL
                     GKNLDVGENWDGKLNTSMIECLQKYPKVHGRFLLSYFSSAIRFDYMSFLNHLNLEDAL
                     NSFDLRKLNFYTEGFRIFFHLPNTESLLKAVTEQTSDFIKILFSNIADILLAANAYFG
                     DKVSDIVNSILDGTILDEYGTRKHFTGSTSSDVSSVRSFSPLQRGFTPGISPSFSEIE
                     NSGHLYASAESASPRISDSDSSQTSLENSSQTESQLSHLVAPRPHHIPPTSSNLRTSV
                     LSSAAVREKSYASSGRNASNEPTANIAAALMTVTTSTPSITSNAMKSAYQKSKRRYSD
                     EAARRFFRLNMSNVSENALMDSNSEPNPEAKYIMISIFSIFKTLTKYFIVPHDQNSKS
                     SWVSKDFRNIIKPIFVAFISEDDNLQSKAKYFMDVLIEFVTKFSDSTEPLTMQGYHLI
                     CSYTIILFAVGLFDMKLDTKKRESLLDIVVQFMRVRSHLGITAEKTNQINIIKDIECA
                     TFPMILGIVGRGLFVSLYCSKPSVQKILKAAFSEFLELLQFHDKYAEQHEKNWIDNVK
                     FIQAVSGDTHSTSGSVAFQRRVRRSILNHIKYPDSILLDSFKMIYRKWYSLSLYTDYS
                     HEDLNDFRSFAGIIATLSGVLFVGNNSDRENYSYLESMKAELIKDLDYFIAMQCKWLN
                     DTDLLTRENSKDILSLELHPLSFRFLFKNLRSRLQEIYDLDLSECEQELNFVLLEQII
                     IILRTILNREDEEKSMLLFSSEIVDFIDELCCQVEKIPHTSPKYFKGIIQMSKMFRAM
                     KSAEGTLALMNHYQLKNKWLKIVTDWFKLTISKNYDFENLSKPHREMDLKTRDLDILH
                     IDTAIESSSAIAYLTENLPLETPASTSSEELKKSQALVFGHNFNILFKGLEKTKDPER
                     FPASLKHKMNVFTENLILSLTNLSNRNVEASLQFTLPMGFSKNKNIRLAFLKVFINIV
                     KNSESSQTQSQKVRLEAMDKLLKFAISHPKLSLVAAAICPANDLDAYAADLVDGFNTR
                     NAAHLAVSQLIDAEIEQSTRSTDILRRNSVATRALSMLARLKGNKYLIKTLQPTLLDL
                     IRNQEVFEVEKSKPPGENYERDVALFKKYMNKILDSITDSLSYMPPELFYICQGIYQN
                     VKEKFPDYALVAVGSCMFLRFICPALVSPESENLVNTISIKEKKSFISLAKVIQNIAN
                     GSENYVKWESLKDECQFFDECKKKIFDFLAEVCRTDRELKIKIRTDPTPLQFDFGFLH
                     NFLYQNGLAIRKFLLSKDNNTENFEFLKNTILLVDSLLGELGPPRLQYSSGLPDFVRE
                     NATTYPQLYEFMSRYAFKNAHTLQSATNFVQESMSAQGIPTLTVLFGNFSSSDLEAEI
                     LAYKFLKIYSRIWSAKHYLILDCTNFHKPRADSKKFTTMLCTLVPDIFVRNCIGFYYF
                     NVNEEFIDMFSIYFREENPYLIPEIPHYFINSSTDDKLVKTLGIGNEGLDIIEDVRIS
                     LHDISLYNEEKKRFTPVLLKMGNRYFQVLHETPRHYKIDEINSLVSIKFNDVYDISQI
                     SAVHVSSSTGIMKEFTVIFIDGKKLVFSSTKYLEIVKMFSHAQSRLENEYNIASATNN
                     NIRHGGEILSLEKEAESLSENKKIVCHILLVSLVGLFDDDNLVKNFSYNLLAAAEQSF
                     HLDLGTHFHMSPEIYVPDDTTTFLCVISESLSQNSPELTRYLWDYILDGLETCLLPHN
                     MIPQTICALSYWTHNLYEFVFLGHPEEGPEAISRIFRSLIRLTIAEPDFITIYVQQIW
                     CLLIIDGRLSDILVEEVINHALERDSENRDWSKTIHLLTALPTVEISSCIIDRLLFKI
                     RGFLPSLRIEALTQSWSELTILVKVSVHLFFETPLLAQMFLPEVLFIISLLIDVGPVE
                     LRNSLHGLLMNVCYSLSMNLALGENERCHLDEITRIFSTEKSKFMFGFSQEKGSLLQS
                     FTTTSVSSKFNILECFITNMMALMDYGATIESGQWKSRYKKYLMSFVFNGDSFLSARA
                     IMIVGIVGRNNASLTLCRNLLGETIKVSSIPVVNEETTFLLIAHIFCFSKIVDGLHPS
                     SPIIKKMFWFATIFLESKHPILFESGLLLMSMCLRKLYVYRFDDSLEMGPVIPQLMED
                     RKFADRFLCEIDETYGVSWNITNFTSIIISFVIRGFSIPFIRSNALSFLSMQFKHNYY
                     EHLIDNTSEQFYPYMFLMYLLFGTEQFIEILEDSDYEEKIVYLDQHIRIPMSLLEWLG
                     KDNEASQATLFQCAALFSSTVTDEPFKLRFSLILEWLLNENPLCVFKFYALIRQELKR
                     ISSFERVSDCGPVIFEIVRLLVLHPEFDRLDEFYDSSVKTLKERGLAALTSNENIEQD
                     TKTLITSLFESPETIFKRKKLTTQIVAVMISSTY"
     gene            complement(<773528..>774319)
                     /locus_tag="CAGL0I07931g"
                     /db_xref="GeneID:2889234"
     mRNA            complement(<773528..>774319)
                     /locus_tag="CAGL0I07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447594.1"
                     /db_xref="GeneID:2889234"
     CDS             complement(773528..774319)
                     /locus_tag="CAGL0I07931g"
                     /inference="similar to AA sequence:UniProtKB:Q08237"
                     /note="similar to uniprot|Q08237 Saccharomyces cerevisiae
                     YOL080c REX4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447594.1"
                     /db_xref="GeneID:2889234"
                     /db_xref="GOA:Q6FQA0"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /translation="MRLSSNWSKLQDGVTKKAGKKRIDKKPHIIKKVGQDKKPKSKIM
                     GMIYQMNKEIDQQKENKKVGKKFEFTETITEIDTVETTTETKKDANKIGKYIAMDCEF
                     VGVGPEGKDSALARVSLVNFHGNVVLDIFVKPRETVTDWRTWVSGITPDHMKNAVSFK
                     QAQQQLSDILKDKILVGHAVKHDLEALMLSHPKSKVIDTARHLPFRQKYAKGKSPSLK
                     KLAKEILNMDIQSGQHSSVEDARATMLIYKSAKQDFDKEHRKKFH"
     gene            <774721..>778428
                     /locus_tag="CAGL0I07953g"
                     /db_xref="GeneID:2889235"
     mRNA            <774721..>778428
                     /locus_tag="CAGL0I07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447595.1"
                     /db_xref="GeneID:2889235"
     CDS             774721..778428
                     /locus_tag="CAGL0I07953g"
                     /inference="similar to AA sequence:UniProtKB:Q08236"
                     /note="similar to uniprot|Q08236 Saccharomyces cerevisiae
                     YOL078w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447595.1"
                     /db_xref="GeneID:2889235"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008828"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ99"
                     /translation="MDTVASINNLRAQFFRICPEKDQMSRIIKPYIPQTEKDAIVKYS
                     TQDYDKVDPKISDVYTNPDGTSLLTEMESPPISKNFMDSYATIAKARLKKHNEEAYFR
                     GNRTFNQGDLNNRVIETKDDGYNTDELKNENLTQVDGTLIEKSHNDFIANNTLKNNSI
                     STSILNDDLSDNVVFENTSAKKKDARKSGLPFVRIFKNKKDSNAIPSKQNNTSSNSKN
                     RKKSSSNSNAGKTDSGYSSVSNKSSRSDLRSKKSSQNIGNHRQTHTRRKSKFSMNFDF
                     DENLEEEEEDEDEDEEGADLHSKFFRLDSNSSSQQSLSQNNEYTGSRAGSVLNNNGSK
                     LIHGIQNSNNNNNNNNHNVTVNGGKYINDKFSNQNNKSKLHAGHSFVQKTTALDSGKS
                     VSSMHGSLVNGAVQGLDGAAVNSVSANELKSVHSADDAISDLDSFIEAQNLEEMDFDA
                     AGSDINKIVSNDSQRETHISDENGTSRLSLADDMNSISDASSYGKSLLGSDYSADELI
                     KQDASTLDSASLMAATDMQTHTIPSNSIPMSIDKFGLYEGVDDSTINNVFGKAVQNLK
                     TESSTEKKNVVPQMFFSSPSTANKAEFGTSANSTGKINTTPKSTQYRSRSNSYDQARY
                     NRYDSRKIRKGSQSSVDRNKSNSSQSNGQSHKIELNDSLVIERRTDLSSAIPAVSQLS
                     TLFKMQKQNAGNPLSALQYFSFVSGSKVAKTDVMQLEVYIQNSKKYKRDPFTVQIRKN
                     STVFEVIGFILYSYANDFKPPNFESDGLTVDKIGNPNNFSLSIVDEDGEPFEDNFGKL
                     DRKSEIQTVSDNEVVLCEVDGNEKELNESMTPVPYDTCGDIVDGSKSAAVSRSSSVGK
                     SEKINQRSFYKPIVQDQDDLENTQGSKIVPITVYLYPNLNPKFNYTTINVNVTSKIND
                     ILVRYCKMKNLDPNEYLLKVVDKMSTYDLNDTVLKLDGNYSVELISKKEAREKRLEKL
                     KADTSMPVLPTIQSSDMTPLTIDRGGKSFLKGKNEDKTSEVKATKSKKSSSKYKLSLA
                     KQTSSSSNQSANGLGIGNGNMHTIGGSNALTSGANSLFKSKNSSRSSLHGPLQFYNIN
                     RSQTNIDVKAGPSKPLSVDDSTTNNSANNFQDLFSGAYHRYKVWRRQQMSFINKHERT
                     LALDGDYIYIVPPEGRMHWHENVKTKSLHISQVILVKKSKSAPENFKIYVKKSHDDIK
                     RYYFEAASAQECTEIVTRLQNLMNAYKMNLK"
     gene            <778758..>778949
                     /locus_tag="CAGL0I07969g"
                     /db_xref="GeneID:9488013"
     mRNA            <778758..>778949
                     /locus_tag="CAGL0I07969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999516.1"
                     /db_xref="GeneID:9488013"
     CDS             778758..778949
                     /locus_tag="CAGL0I07969g"
                     /note="highly similar to uniprot|P81451 Saccharomyces
                     cerevisiae YOL077wa ATP19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999562.1"
                     /db_xref="GeneID:9488013"
                     /db_xref="GOA:B4UN19"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:B4UN19"
                     /translation="MGSAYQILGRSFQPHQLAIGTLSLVALVAMPNPFAAKKAKEVEI
                     QASSKEEEKFIKEYLEKHK"
     gene            complement(<779426..>780310)
                     /locus_tag="CAGL0I07975g"
                     /db_xref="GeneID:2889236"
     mRNA            complement(<779426..>780310)
                     /locus_tag="CAGL0I07975g"
                     /product="ribosome biogenesis protein BRX1"
                     /transcript_id="XM_447596.1"
                     /db_xref="GeneID:2889236"
     CDS             complement(779426..780310)
                     /locus_tag="CAGL0I07975g"
                     /note="highly similar to uniprot|Q08235 Saccharomyces
                     cerevisiae YOL077c BRX1"
                     /codon_start=1
                     /product="ribosome biogenesis protein BRX1"
                     /protein_id="XP_447596.1"
                     /db_xref="GeneID:2889236"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="InterPro:IPR026532"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ98"
                     /translation="MSSIFKALSGKSKKEASKTDGGNGKLYMNKQRTLLISSRGVNYR
                     HRHLIQDLHSLLPHTRKEPKLDTKKDLQQLNEIAELYNCNNIMFFEARKHQDLYLWMS
                     KPPNGPTIKFYVQNLHTMDELNFTGNCLKGSRPILSFDNRFDTTPHYQLIKEMMIHNF
                     GVPPTSRKRKPFIDHVMSFSIVDDKIWVRTYEISHSARNKSEYEEGEEDNDISLVEIG
                     PRFVMTVILVLEGAFGGPKIYENKQYVSPNAVRAQMKQQAANEAKSRADAAVERKIKK
                     REAVLAADPLSNEVLFKD"
     gene            <780687..>783041
                     /locus_tag="CAGL0I07997g"
                     /db_xref="GeneID:2889237"
     mRNA            <780687..>783041
                     /locus_tag="CAGL0I07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447597.1"
                     /db_xref="GeneID:2889237"
     CDS             780687..783041
                     /locus_tag="CAGL0I07997g"
                     /inference="similar to AA sequence:UniProtKB:Q12387"
                     /note="similar to uniprot|Q12387 Saccharomyces cerevisiae
                     YOL076w DEC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447597.1"
                     /db_xref="GeneID:2889237"
                     /db_xref="InterPro:IPR019183"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ97"
                     /translation="MSDKIEEEVLELIRRSNFKQCYDYVGKLRKQYPNSAFLLALELY
                     VKYRHTPQKFDRTLLDTIQTSETHALSFLYKFYVELLCYDKALGVYEIAATKYPSYET
                     SYMWFSKAVEVNDYKAMARASLQMAKYNSNSNDTKLECRDYLIWHAISVVALFRWKRS
                     SVSETESKVLPQLCYKNMLSLKPFKSVQELIIFCEVCETLFDNKSKEIVDQILPKLDY
                     TADLYLKNFFVRNIDSLEPQERYNSCIKILANYDDFSVIECLLRAGMDLNIDKNTVLD
                     KLKSMIGDSRNFRVANLKADVIFNGRVQEHALKFYIDKFYNKPCCHIDLNNYSDFIDF
                     KQLRQFFMDIDSEDLFYEYNKLMLFKDCSVEQSISIFKKHQNEIIVKSKTNISKNSEF
                     IMNIIRANVIEKKEMEISDVLFGITILENYQSQDLYNFETRLWLVVFYLYLGIVPLAY
                     SHFKELNVKNVQVDSVEYVMYSRFSTMFPNKQHDYLKNIFDCPTNIYENSLKRLPALL
                     RVSFERKAYSKILGMIEFYRKLEVSTNRWMRSIEKSKLTRLNNEKRNSGMTELLVLWE
                     SLQHINEPGLSDNRDKSLFHPYLDLRSCPAVLRQLHIDETWLYANISQEFMIEAVSSR
                     AIEPIVKEMLSNYDIIEKVSASETMTVTERQSFELIHDVYANDGSNVLSILDKIDLAE
                     TKSIGWLQIHSYLQQLTVLKTLDNMKKLKDKVVKQQIKSKLSYVRGNCDEIFDVMIRD
                     IKKGAGQLKSGGYKDIVDSLGFNDLDEKILVDSINTVRKVTRNL"
     gene            complement(<783133..>786990)
                     /locus_tag="CAGL0I08019g"
                     /db_xref="GeneID:2889238"
     mRNA            complement(<783133..>786990)
                     /locus_tag="CAGL0I08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447598.1"
                     /db_xref="GeneID:2889238"
     CDS             complement(783133..786990)
                     /locus_tag="CAGL0I08019g"
                     /note="highly similar to uniprot|Q08234 Saccharomyces
                     cerevisiae YOL075c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447598.1"
                     /db_xref="GeneID:2889238"
                     /db_xref="GOA:Q6FQ96"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ96"
                     /translation="MEQQDLVENKLSFSKIPRVGLHVRDLSITASKTDSVLVHPLSLD
                     LPSGSVMAIMGGSGSGKTTLLNVLASKISSGLTHSGEISYILEADKNNVDDSSSEASF
                     DLNATYKENVTLAYVPQQDVLCSRLTCRETLMYAADLKLDASKVEKTLIVNQLIDELG
                     LKDCADTLVGDNSHRGLSGGEKRRLSMGTQMVSNPSVMFLDEPTTGLDAYSAYLVVKT
                     LKKLAKEDGRTFILSIHQPRSDILFLFDYVCILSKGNVVFCNQMNELIPYFKSISYDV
                     PDLVNPADYFIDLSSVDGRTEDSLAITSERLEMLVSHWRKYEEKTLSYKPINHKYEIQ
                     LKSMTGRLPFWKQVSVLTRRNYKLNFNDTNTLIATFAEPVVMGAIVGWIYFKPDTSNI
                     GGLRTLISCLYASVILQSYLYLLFDTYRLCEQDIALFDRERAEGAVSGIAFIVARKLA
                     LFITDDILMTILYTSITYFMFGLEKNASKFFFQYAVNLLAQLICSALAMVSVAVSRDF
                     AKASLVGNLSFTLFSMSCGFFVNAKLMPVYVRWTKYIAFTWYGFGSLLSNTFSDSYCN
                     GGEGFECQGNQVVRQYGFPLHWRTLPMWILFCWFVGFFMLSIIILTWNKVDITLQNEV
                     NKKKHKKSDIKDDASNLTEESDIKDTDDSISTNQRDDMTNKLAHITVVAQDVDLEVKY
                     TKLYNRKNHKIFEYENKKILQNVSAVFKPGMINAIMGPSGSGKSSFLNLISGRLESSL
                     LVKFNTAGTIKLNDTPISQDMFKHLCSYVSQDDDHLLAMLTVRETFDFAAALRLKHLS
                     KDDKRSRTDSLIAILGLKHCENTIIGNEFIKGISGGEKRRVSMGIQLLSDRPILLLDE
                     PTSGLDSFTSSTILEILENLCSEHNKTVILTIHQPRSELFMKFGNILLLAKSGRTAFN
                     GSPEEMIKHFDLMGYKCPSFTNIADFFLDLISVNTQNEQNEIHSKTRVENILSTWRAE
                     RLRLSAEKSIVTEEEHTLETFEDEYGQYFSKPAGLKLAYMVNLRRQYTTTIRNFDSLM
                     ARIAQVPGLGGIFALYFAPLKHNYTSISNRLGLAQESTSLYFVGMLANLAVYPPERDY
                     FYEEFKDGVYGVAPFYLAYMTLELPLTTIAAIVYSALTVFGCGMPRTAGNFFANVYCA
                     LMIVSCGEALGIMTNTLFKRPGFVVNCISVILSIGTQLSGLMSLHMSRVLKGINYINP
                     VWYTSIIVINFAFPDNLNFTCKDGPQNADGSCVLKTGRDVLDAYGLHRNTKNFLGVVI
                     CVTFCYRLLAYLMLKAKLEWLKW"
     gene            complement(<787552..>787953)
                     /locus_tag="CAGL0I08041g"
                     /db_xref="GeneID:2889239"
     mRNA            complement(<787552..>787953)
                     /locus_tag="CAGL0I08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447599.1"
                     /db_xref="GeneID:2889239"
     CDS             complement(787552..787953)
                     /locus_tag="CAGL0I08041g"
                     /inference="similar to AA sequence:UniProtKB:Q02260"
                     /note="similar to uniprot|Q02260 Saccharomyces cerevisiae
                     YGR074w SMD1 snRNA-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447599.1"
                     /db_xref="GeneID:2889239"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ95"
                     /translation="MPLKLTNFLRKLQNQYVTLELQNGSTVYGMVISVSPHSNVNLRD
                     ATLDRYYNSDSVYSEVTPQPISTSHLKNINVKECFIRQVILPDSLDLDSILVNANEVN
                     GLTRSGKLADLGGNRKRRRRSSSNMTKRLRG"
     gene            <788285..>789688
                     /locus_tag="CAGL0I08063g"
                     /db_xref="GeneID:2889289"
     mRNA            <788285..>789688
                     /locus_tag="CAGL0I08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447600.1"
                     /db_xref="GeneID:2889289"
     CDS             788285..789688
                     /locus_tag="CAGL0I08063g"
                     /inference="similar to AA sequence:UniProtKB:Q08231"
                     /note="similar to uniprot|Q08231 Saccharomyces cerevisiae
                     YOL072w THP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447600.1"
                     /db_xref="GeneID:2889289"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ94"
                     /translation="MVNGYSLLDLVRDIGNGHLGVLSINIEKNGVRIAALQNDLQGQD
                     DKMIDRLVDGSKIIMPGQDPTRRWTRLNIMVVSFLKFCRDVDPWSLWTSSDLIFEHYS
                     NLNNALLDDSYPVDALTELFLSETEYVTKLAIKLDANNLDLGTKQSLFLSYISSIISK
                     LFNSIKPPRDGANSTIPNKQLILLNIINKLNNIYFRINSPQLCSNIFKNFKPKSMFES
                     FKRYPIHEQIEFRYLLGRYYVINFRMTNAFVQLDTAFRMLCQYMEQCPHTATREILQR
                     NLKRILKYLIPVGITIGKKPHFQAVRGIDLDLAKSYIELSRNVNSGNFKQVNIWLASN
                     EDELKSQNLLLPLLQKLPILVFRNLFRKVVIEYVLSAQNNKISYDLLMRALQVSIGSD
                     QLALPPMFKVIHRPEDVENILVTLINLGFLRGNCFPALRLCVVKKTTDINDIFPEMTE
                     RIVKMFPLNNEDNWFDI"
     gene            <790086..>790547
                     /locus_tag="CAGL0I08085g"
                     /db_xref="GeneID:2889290"
     mRNA            <790086..>790547
                     /locus_tag="CAGL0I08085g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447601.1"
                     /db_xref="GeneID:2889290"
     CDS             790086..790547
                     /locus_tag="CAGL0I08085g"
                     /inference="similar to AA sequence:UniProtKB:Q08230"
                     /note="similar to uniprot|Q08230 Saccharomyces cerevisiae
                     YOL071w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447601.1"
                     /db_xref="GeneID:2889290"
                     /db_xref="GOA:Q6FQ93"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /translation="MLRITYKLPIALRQQAFVARKLVPTIKANYSTNSDDDVVSRIKV
                     HPIKRINESIDKKRARLIYQSRKRGILETDLLLSGFAAKHLRSMTNEELDEYDALLNE
                     LDWDIYYWVTKNYKTSPVPERWKNSEILKKLQDFSENKEKKILRMPDLENY"
     gene            complement(<790779..>792341)
                     /locus_tag="CAGL0I08107g"
                     /db_xref="GeneID:2889291"
     mRNA            complement(<790779..>792341)
                     /locus_tag="CAGL0I08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447602.1"
                     /db_xref="GeneID:2889291"
     CDS             complement(790779..792341)
                     /locus_tag="CAGL0I08107g"
                     /inference="similar to AA sequence:UniProtKB:Q08229"
                     /note="similar to uniprot|Q08229 Saccharomyces cerevisiae
                     YOL070c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447602.1"
                     /db_xref="GeneID:2889291"
                     /db_xref="GOA:Q6FQ92"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ92"
                     /translation="MEEYSSPSKLSVNTQRLSAMIDSLGSPNAEEPLPAENNTTSSHL
                     SHHTTSSPAPQSEDTFTSSLKKSTFQMPRSPATDNLNNRASVLSNYSGVVDHAIEVSY
                     VVRNSPSKSIKNRDETGKEDTEENGNNSELQTKVPESTTDGEVVIQSVQNAKPVGRFG
                     SFNRSVSSKIIPSDKDSNSKKAESIHLATTSKKPLHSSIGSGNLASESGTSSYSYDQT
                     LKNLDQQLQIPDVDDESSITSSANMPSLATNKYTKSQEDIEVPHLRTETTAFNPTIPP
                     RSKDRPRSRIFGTEENQSEAISPPQRPINHNYSRSDAAKSESYYSAISYNSQEDLHEK
                     SQNAGSDELPMDDSYLSRPLPITPHNNREIYRDDTIKAFSGRPELPSKNSFVDNSNEY
                     EDILDEDEAEEFQYAPVHQENSQKNTPIQKVNQPNKLKSKKKNKKKNTREDIQSFDIE
                     TLNQLVNVTKGTLIGSEFSNLGMRTEEKKALERLVDSLSRLTADMVLDPERYEEGLKR
                     LDKATRALEGFY"
     misc_feature    792727..792837
                     /note="Centromere Cen0I"
     gene            <793917..>795065
                     /locus_tag="CAGL0I08151g"
                     /db_xref="GeneID:2889293"
     mRNA            <793917..>795065
                     /locus_tag="CAGL0I08151g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447603.1"
                     /db_xref="GeneID:2889293"
     CDS             793917..795065
                     /locus_tag="CAGL0I08151g"
                     /note="highly similar to KLLA0D01243g Kluyveromyces lactis
                     and DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
                     Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447603.1"
                     /db_xref="GeneID:2889293"
                     /db_xref="GOA:Q6FQ91"
                     /db_xref="InterPro:IPR003829"
                     /db_xref="InterPro:IPR008778"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR012093"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ91"
                     /translation="MTKIEGQSQEKKVKRSSGSAFKLTIVSLFIALACIYYKFSAVTE
                     VHDIKLGARNDQDSMASQNRDYDQLKDNNDGINDDRIYRSILTHFIAGEQEEGVGARV
                     RRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQETITYVTDGMIAHEDITGSKG
                     VLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLPSDMKNIDPRYRNLRGNE
                     TPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKTGTEFVQDIPEDFNVF
                     IYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIAGRILDQEVIQHGP
                     FVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEALKLYRE"
     gene            795438..795519
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I08173r"
                     /db_xref="GeneID:2889294"
     tRNA            795438..795519
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I08173r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2889294"
     gene            <798163..>799509
                     /locus_tag="CAGL0I08195g"
                     /db_xref="GeneID:2889295"
     mRNA            <798163..>799509
                     /locus_tag="CAGL0I08195g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447604.1"
                     /db_xref="GeneID:2889295"
     CDS             798163..799509
                     /locus_tag="CAGL0I08195g"
                     /inference="similar to AA sequence:UniProtKB:P10823"
                     /note="similar to uniprot|P10823 Saccharomyces cerevisiae
                     YER020w GPA2 guanine nucleotide-binding regulatory
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447604.1"
                     /db_xref="GeneID:2889295"
                     /db_xref="GOA:Q6FQ90"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ90"
                     /translation="MGICGSKPDKAGDTKPGTSKARVRSDNRNSGGASNGKSTTAGQK
                     DGQDMEGGQSGNSMSNEGDKKTTLEEELQNTRGLPVDEQSSSQSGSNNQKAIKVLLLG
                     AGESGKSTILQQLKILHQNGFTKQELIDYTPLIYDNIIEIGKDIISARRKFNVDIDDP
                     TLTEEDLDKISNYTSTRKNTDEDSSEGENSITVKPSEQANTTSIVSKDEFPKEFYPIL
                     SKLWNMKSTQELIMSEKSSQFYMMDSTKYFLDNLDRICNTPNYIPTEQDVLRSRQKTS
                     GIFDTVVNMDNNFQMHIYDVGGQRSERKKWIHCFDNVTLVIFCVSLSEYDQFLMEDKS
                     QNRFQESLVLFDNIVNSRWFARTSVVLFLNKIDLFAEKIQRVPLEHYFPDYMGGKDIN
                     KAAKYILWRFVQLNRANLNIYPHVTQATDTSNIKLVFAAIKETILENLLKDSGVLQ"
     gene            <800170..>801552
                     /locus_tag="CAGL0I08217g"
                     /db_xref="GeneID:2889296"
     mRNA            <800170..>801552
                     /locus_tag="CAGL0I08217g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447605.1"
                     /db_xref="GeneID:2889296"
     CDS             800170..801552
                     /locus_tag="CAGL0I08217g"
                     /note="highly similar to uniprot|P47154 Saccharomyces
                     cerevisiae YJR117w STE24 zinc metallo-protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447605.1"
                     /db_xref="GeneID:2889296"
                     /db_xref="GOA:Q6FQ89"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ89"
                     /translation="MTVFELFASLVDSPSIPWKSIITGFCISQFAFETYLTYRQYKVL
                     QKNQLPPVLVNEIDKETFEKSQEYSKAKAKFSVFTDLFSLVQNLAFIKYDFLPRLWHI
                     GVKVSARILPAKYAAVSTIAQSLWFLAVLSNLSTIIGLPISYYKHFVLEEKFGFNKLT
                     VKLWITDMIKSTVLSAAFGIPILFVFLKIFEKFQTNFLWYICLFVFVVQILAITIIPV
                     FIMPLFNKFTPLEDGELKTSIENLAAKVGFPLDKIFVIDGSKRSSHSNAYFTGLPFTN
                     KRIVLFDTLINESSVEEITAVLAHEIGHWQKNHIVNMLFISQVHIFAIFSLFTSVYRN
                     VSFYKTFGFNVGFNEILNAAGSSTTVYTPDFPIIIGFMLFNDLLTPMECGMNFVMSLI
                     SRLHEYQADAYAKALGYTQNLGRALINLQIKNLSTMDVDPLYSSYHYSHPTLAERLTA
                     IDFVNEKKKE"
     gene            <802072..>803610
                     /locus_tag="CAGL0I08239g"
                     /db_xref="GeneID:2889297"
     mRNA            <802072..>803610
                     /locus_tag="CAGL0I08239g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447606.1"
                     /db_xref="GeneID:2889297"
     CDS             802072..803610
                     /locus_tag="CAGL0I08239g"
                     /note="highly similar to uniprot|P40016 Saccharomyces
                     cerevisiae YER021w SUN2 26S proteasome regulatory subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447606.1"
                     /db_xref="GeneID:2889297"
                     /db_xref="GOA:Q6FQ88"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ88"
                     /translation="MTTDLMDVDTPLENEMNGSKNEDVRYAEEKTMSEIIDTLKVIAK
                     TTASLDHRYIWRALKELSKIRKNYLNQETLAILVSVLYPDHSEYKVDLLKYINEKHKS
                     EVPHADEIRAKYPAAFYEITSDGKSLAVSAEINAFIHLLTQLYLLDNQKIIELISFNN
                     KVVLPKILKYYNQRSLDLINSKLWFYIVMAHEQQDINGGYVDLRNEMMKALKTASLKH
                     DNETRAMLITLILRFFLASGEIDAASDFINKVDPLTSDVSSPLEARFFFYQSKINTIQ
                     LDYSTANEYIVAAIRKAPHTKNSLGFLQQANKLSCVIQLLMGDIPELSFFHQNGMETS
                     LKPYYHIAEAVKLGDLKKFTSTITKYKQQLIKDDNYQICVRLRSNVIKTGIRIISLTY
                     KKISLKDICLKLHLESEQTAEYMVSRAIRDGVIEAKINHEKGYIETSEVNNTYITEDP
                     QTVFDERIRFVNQLHDECVVAMRYPQDKKKGLNNQNHDDEYLEGDLLDDLSDFSDIDD
                     MGFL"
     gene            <803992..>806022
                     /locus_tag="CAGL0I08261g"
                     /db_xref="GeneID:2889298"
     mRNA            <803992..>806022
                     /locus_tag="CAGL0I08261g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447607.1"
                     /db_xref="GeneID:2889298"
     CDS             803992..806022
                     /locus_tag="CAGL0I08261g"
                     /inference="similar to AA sequence:UniProtKB:P32569"
                     /note="similar to uniprot|P32569 Saccharomyces cerevisiae
                     YER022w SRB4 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447607.1"
                     /db_xref="GeneID:2889298"
                     /db_xref="GOA:Q6FQ87"
                     /db_xref="InterPro:IPR019313"
                     /translation="MTQLTENTDELHSIRLAIDPNLITLPIGSKSTSPHSNSTSDGNP
                     ESHNTENEEVDNKAGSLPPEQFSNNSAKLIVNPYEKYGRMSLGQLIPLISQQRGPNFK
                     FADINEDILKQELAIENDNGKQESKDDTKAEDGIDTMDIDQNDNSEANTNDIGYNEWS
                     NEPKEDTGILDNTQDTNINGEMESQLTQEEFNKIRKVMLEHINMAMNESSLAMEFVSL
                     LLSPVRESTAVSSMSPFLKKTVNPGSLNSEKVKMPAVSRRDKLSLSILSRGWKLRALN
                     EARAILKKNFTEISSSLKQEHHYWSSIAYNISNKDVLFKIRDKQTTKRSLGLKYGYED
                     SGSTFRNDRGTAILRGTDEANGLELIPLTLGRTSTVGSVYKGGKFLRVRIFTKIESEG
                     DYILSGESSLDKLFKNHSENSDSKNDDVRLQISKLKFFIFEQELMHQLKKECAYLISY
                     GVTVENEHKIVIELPNEKFEIEYLSLDDDSVVNHEQDAPKANDRRANLMLVTLRMLLI
                     VIYKKNLRQKMVSNTRKHIASTEKDILLIRPLLGKMRHSNHKKLIRKILKECVLEVVP
                     DTELQERSIQSLDKEDFETFDLQDAHIVKLTKDINAFRNVLDVGKTEFTIDMKQSGKL
                     SLILESPNYCNAQVSIKYDNQTSNTHFNTVSTEFKEVEEFLHFLISTYVNPE"
     gene            <806428..>807279
                     /locus_tag="CAGL0I08283g"
                     /db_xref="GeneID:2889401"
     mRNA            <806428..>807279
                     /locus_tag="CAGL0I08283g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447608.1"
                     /db_xref="GeneID:2889401"
     CDS             806428..807279
                     /locus_tag="CAGL0I08283g"
                     /note="highly similar to uniprot|P32263 Saccharomyces
                     cerevisiae YER023w PRO3 delta 1-pyrroline-5-carboxylate
                     reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447608.1"
                     /db_xref="GeneID:2889401"
                     /db_xref="GOA:Q6FQ86"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ86"
                     /translation="MTYTLTILGCGVMGQAVLSAIYKAPKATSVIKALYPSKIITCNH
                     DEPSAQQVTDLISTFETSPNGIEVVSTYGKNVEAVKQSDVIILGTKPFLAEQVLNGVK
                     DVTSGKLIISLAAGWTIGQLQAYTPSVSRVMTNTPAKYGYGCAVVSHSPQVTEDQKSL
                     VSELISHVGKYVELPEKNMDAATALVGSGPAFVLLVLESLMESGIKMGIPLKESTECA
                     LKVLEGTAKMVEESGVHPSVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAARV
                     AAELGKK"
     gene            <808566..>811421
                     /locus_tag="CAGL0I08305g"
                     /db_xref="GeneID:2889402"
     mRNA            <808566..>811421
                     /locus_tag="CAGL0I08305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447609.1"
                     /db_xref="GeneID:2889402"
     CDS             808566..811421
                     /locus_tag="CAGL0I08305g"
                     /inference="similar to AA sequence:UniProtKB:P40017"
                     /note="similar to uniprot|P40017 Saccharomyces cerevisiae
                     YER024w YAT2 carnitine O-acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447609.1"
                     /db_xref="GeneID:2889402"
                     /db_xref="GOA:Q6FQ85"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ85"
                     /translation="MSEEGTFAHEESLPRLPLPDLESSFEQLKASLEPLYYADGYYQH
                     PLDPEQIESLSSSLTRFATSDAARKLQAKLKEFEEKNSCYLDKLHLDINNQTSAKEIA
                     DDVLPRNPFLILADDAVPDISQAERSAVLVHSALRFISALKNNKLPPDVNTKNGKYLS
                     MEPYLNLFGTTRCPIFEEGEVENFDLDKPYTASDLDGSDESSDEFDDDYEFEAGEGTN
                     DFGDNNRRRNSFIGAGDDDDGLEPKKLIEEANKEVEEEEQKAEHQRRPTTASTTTTIN
                     STQSAGDKEEEDERLGQEVFKRHGITVKRHHDSKHILVISKGQYYTVDVLDEENKILY
                     NATALTSIFHHILDDAEKSYSFRKSTALGSLTSHSFKNWKYARKRLQKRYPNELHLID
                     SALFVLVLDESAGNTADVAADEAELKPGSIQATSNTCKRLFYGTSIIDNGGHQIGSCV
                     SRWYDKLQLVVTADVKAAVIWDSFTCDGSVVLRFTSEAYTESILRLARAVNAGDPRFS
                     LWPSVVDSVCDKEIAKTAGDIKSGEISPDLLVNKIDWSFSNILNTHVHLSETKLADLI
                     SKHNIVRSSVPLGRRSAQKLGINPDSMIQVALQVAFYSLYGKMVYGFEPISTRCFKNS
                     RSSFINIQNKELLELCQLFISTSMDGLGKLDKFIQSCQKHTETVRLTKQGKGFEKHFN
                     ALKYLYKFHDLYGIELSEEDKQMAASVFESEAIAPFSAPELIIANCGNSATTTFGITP
                     AVPHGFGIGYIIKDDQCDLTVTSQFRQGSRLLFMLNWVLNEIRSFWRMARATSQTKSG
                     VKISPMVDRLYEMDNALNSKNRTSSNLNMNTAYGLFDLDAHVDSRSVSKSPSLKNLPA
                     KFAEMTPFNPLVTAHSSLALSVPTEKEKHDTGHQILQFQPKIIGDEGDDDDIALPSVE
                     DMNLSAADAAKRRNVIDSKFEIDFDRSRVGRKIVTFD"
     gene            <812123..>813679
                     /locus_tag="CAGL0I08327g"
                     /db_xref="GeneID:2889403"
     mRNA            <812123..>813679
                     /locus_tag="CAGL0I08327g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447610.1"
                     /db_xref="GeneID:2889403"
     CDS             812123..813679
                     /locus_tag="CAGL0I08327g"
                     /note="highly similar to uniprot|P32481 Saccharomyces
                     cerevisiae YER025w GCD11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447610.1"
                     /db_xref="GeneID:2889403"
                     /db_xref="GOA:Q6FQ84"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ84"
                     /translation="MSDLQDQEPTIIINGDLPPVEEEEVYEQEEQEEVVEEKPKKKVA
                     FTGLEDGESEEEKRKREFEEGGGLPEQPENPDFTKLNPLSAEIINRQATINIGTIGHV
                     AHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPEPDCYRSFKSD
                     KEINPKCQRPGCPGRYKLVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAGNESCP
                     QPQTSEHLAAIEIMKLKHVIILQNKVDLMREESALEHEKSILKFIRGTIADGAPIVPI
                     SAQLKYNIDAVNEFIVKTIPVPPRDFMLSPRLIVIRSFDVNKPGAEIDDLKGGVAGGS
                     ILNGVFKLGDEIEIRPGIVTKDDKGKIQCKPIFSNIVSLFAEQNDLKFAVPGGLIGVG
                     TKVDPTLCRADRLVGQVVGAKGHLPSIYTDIEINYFLLRRLLGVKTEKQAKVRKLVAN
                     EVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIDKHWRLIGWATI
                     KKGTTLEPVV"
     gene            complement(<813998..>816001)
                     /locus_tag="CAGL0I08349g"
                     /db_xref="GeneID:2889404"
     mRNA            complement(<813998..>816001)
                     /locus_tag="CAGL0I08349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447611.1"
                     /db_xref="GeneID:2889404"
     CDS             complement(813998..816001)
                     /locus_tag="CAGL0I08349g"
                     /inference="similar to AA sequence:UniProtKB:P23293"
                     /note="similar to uniprot|P23293 Saccharomyces cerevisiae
                     YPR161c SGV1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447611.1"
                     /db_xref="GeneID:2889404"
                     /db_xref="GOA:Q6FQ83"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MSQENSNVPALKRTESKYKIGRVKSLPTVQIDEKTGDSYIELAP
                     RSEGKIYGCTTFQGNYKEEEKLGQGTFGEVYKGLHLQTQRKVAMKRIIVNQENDLFPI
                     TAQREITILKRLNHKNIIKLLEMVYDFPPESNNKDYAQFNQNNSANPPAVPKKFFYMI
                     LPYMVADLSGILHNPRIELKMADIKNMMKQILEGVNFIHCSKFMHRDIKTANLLIDHN
                     GVLKLADFGLARQYYGSPPNIKFPGSAGSGAKYTSVVVTRWYRAPELVLGDKYYTTAV
                     DIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLMGTPDERTWELAKYLPGAELTKTE
                     YKSTIDERFGKHLTPTGLSFLKGLLALDPYKRLTAMSAMKHPFFQEEPLAADRLTLPC
                     EESHEADIKRYKEELHEAMSQKGPSAPPGHIKEATPSPAKFEKKSGIKREQPYQSNQK
                     NDQYPIKRQKFNQNPSVPHPQPKANRYGGSSLPSGPKYGRYEGNNHSGSLRNRITPSN
                     MGTHSNPRAENMGSKPYQSEGRYSSNEDRKNGYNRGYSSSVNSRYNNRAAFNETEDQS
                     ITTTTLNRYRHKGYHDNNQSQTRLQGHSSLPGKPTSKYNSTQTNIPYRRTEIPNPNEY
                     NASKLGSQDTKKNDYPKHSETQKQQNNEEKKIHSEQKDIADLY"
     gene            complement(<816581..>818200)
                     /locus_tag="CAGL0I08371g"
                     /db_xref="GeneID:2889405"
     mRNA            complement(<816581..>818200)
                     /locus_tag="CAGL0I08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447612.1"
                     /db_xref="GeneID:2889405"
     CDS             complement(816581..818200)
                     /locus_tag="CAGL0I08371g"
                     /inference="similar to AA sequence:UniProtKB:P54791"
                     /note="similar to uniprot|P54791 Saccharomyces cerevisiae
                     YPR162c ORC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447612.1"
                     /db_xref="GeneID:2889405"
                     /db_xref="GOA:Q6FQ82"
                     /db_xref="InterPro:IPR016527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ82"
                     /translation="MNDDMTIEDGLSAAVKTVKLIPIKRGIDNYEAVETDDLTSILKK
                     SRKHESISKEESDHEFKKLKKHLLKQLNFNLPVDDNVVLPFLEEAEQEIDRMAKQAII
                     QKESHSAIIVGQREGFKTFLLEHIVSKISKDFSKQFITIKLNGLIHTELTAINSIATQ
                     LEEQLSNIENVDGAKQKMTSIVDISQGSLTEVFEKILHLLDVASMSRQIDDSAKSDQS
                     KVTVLFLFDEIDAFAGPVRQTLLYNLFDMVEHARVPVCIFGCTTKLNILEFLEKRVRS
                     RFSQRIVYMPQIGSREQLLQNIKYLLQIHSGTDLKYKEQWNEAVEAALENESTGLYEL
                     VKVNDENYRSIPMLRNSLLPMIGTSSNLDQLMHNLNSGEASLRYTQSLLKNNLRDRTL
                     SLSDLELAILISACRVAVKTKDESVNFNLTYAEYESIVKVLNAKIPTMVPKDTEERKN
                     TIVFDSAIKQWPKRDIKNVWESLLSLGFLAEKSDVGLRESAMAVFYASNYQLQGNALP
                     YDLRVYQMQITLHELRRTIPRSSMYYQWTQL"
     gene            complement(<819029..>820321)
                     /locus_tag="CAGL0I08393g"
                     /db_xref="GeneID:2888917"
     mRNA            complement(<819029..>820321)
                     /locus_tag="CAGL0I08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447613.1"
                     /db_xref="GeneID:2888917"
     CDS             complement(819029..820321)
                     /locus_tag="CAGL0I08393g"
                     /inference="similar to AA sequence:UniProtKB:P34167"
                     /note="similar to uniprot|P34167 Saccharomyces cerevisiae
                     YPR163c TIF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447613.1"
                     /db_xref="GeneID:2888917"
                     /db_xref="GOA:Q6FQ81"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ81"
                     /translation="MVPPKKTVKMDLNSFLNDDTFGSSWAEDEVDLNKINIPIENTSA
                     NTIPLEDIAAAKKAGAMGGMGMGGGRSRLDPALGGGAKSFEREEYPVPNAPPYRAIIN
                     NIPWDISPEGVQAWVEDGLGKEGAVEEVSLPKSIKDPTRLKGIAFITLKEREDLVKAL
                     TFNSTKLNERTVYVSVAAPRREGFRSGGDDFDWGSARGSGFQASREEPNLDWGAARGS
                     GFQPSRESRPRREDPDLDWGSARGSGFQASRESRPRREEPDLDWGSARGSGFQGSRDR
                     EDRPKREEPNLDWSAARGSGFQASRQREDRPKREEPNLDWGAARGSGFQASRQREDRP
                     KKEEPSLDWGAARGAQFNKATQQGTKKNAAPAKAPEETPKIQKSAFDVLRDEDDEDDE
                     TESTTAQQNSGDVEKLTEETKQLNVTEDDGDWEVVGKK"
     gene            <820773..>824699
                     /locus_tag="CAGL0I08415g"
                     /db_xref="GeneID:2888918"
     mRNA            <820773..>824699
                     /locus_tag="CAGL0I08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447614.1"
                     /db_xref="GeneID:2888918"
     CDS             820773..824699
                     /locus_tag="CAGL0I08415g"
                     /note="some similarities with uniprot|Q06211 Saccharomyces
                     cerevisiae YPR164w KIM3 drug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447614.1"
                     /db_xref="GeneID:2888918"
                     /db_xref="GOA:Q6FQ80"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ80"
                     /translation="MAERFAGLLRGVDLLRGTDDRSRCVFGTRFEVYKNRIHGYKHTD
                     SRNSKRVPCTLESARRGFVPRRLLTMRVGVNNDEVFRWLDDQGGVPRVAPLEYQTLLV
                     GGSAFKLLGQTKPLEFEGQVYDVGTVRTSLYGDLLLVSAKNTGVVCLCYISEKLNDIF
                     LVDRFEGNCSVSWSFACSKTTNSFAIYDKASGECHVFTVDDSLELQLTGELSLGEPGE
                     VTILKATFLDNNSVSRPQLLLVISRLSLVSYVLIDYDANNMLEDCNYHELPYLSGDVI
                     QDIIPLSRSKCLMYTINSFFLINADQIMSGDLNFPRISKRLLKGTIDWFNAPQLLEYL
                     IAHDQEYYGEFSDAIIIGTAIGNIIALLVSDNGNIEYHTLTRFKGIKALCSADQSLIS
                     DHKFKLLVLSFGKSISLTLSLKDIFNFEHYENLPSNLTSNLCDKKTVTSDSENNFDMV
                     LIDPIHSIKESCPEIWLTSPHSVSKLSIENPTRKFRFLGYLEENHQFSTLFPIEIHNT
                     YDKHSSNGIYHTDILALSSYEGYTRVVSINSNGNTNLEDDTIFIPNEKIETLELHKVN
                     ESVIQVGRKGIYCRAITSHPSSTVSYEPFGNDSIDQVCFIGNQLFVALRDSKEIWWSS
                     ATDDLLLVNNMTKINLVTSDNEIMNFEHITKICAILDTSSNDDIALLVLSLESLKIFK
                     TSTNTAICVDTKLLNEFPSDMVTLGSTVVLFYETRIYAYKLDNYKLRDCKYTSIDNLI
                     GGFKFKKVDNNRLLLYGSKKLYLLDIQNDLTIEEIEVFENLKNDIILDCYFDIKTKKM
                     YSLLYNGIQVSVEGISTYYPKNYTIRHTRNPNKQFLFLSKLNRMLIVNFDIGEWELLK
                     LRNNKTLTLDKCYLTDKHNNLVQSVYELPGSNPNTRILLNYGSSVSIIELRPKKGKID
                     IGIISSTDIPDIHKHAQIMSSDVVMLYRPGSYSNSERHKHMFILLSGCSHGHLSIDEW
                     FAFDTLHSIDEFIVKDDELYFKTDNGEHIFKVVNNAALKEAIVMKLNIPFECKVEQLL
                     NFSDRIGVVCSSDLRGIAKSQILFFESNRTDFIGKSRKIMSRTRNVSSHDFLETNVGS
                     DDDECIIGYEAWDVNYLDPDNGSDSMDADGRINSSGSSSDDMSIDSDDDISINIDMTV
                     NDQVLRFGPSVGIQQDLDEDGIGSTILSSADATHNNHPVGNNELSNLLDVHHITRGRQ
                     FFESVVSRSHDTPLSILQNYRLLNPQVISESDTKDKDQHKEETSEPIYTINFDQSVIR
                     AKSHNDKLYVILFDQSVLVFTSELDANKSDEYLTTETYTSTNCMGA"
     gene            <825046..>829038
                     /locus_tag="CAGL0I08437g"
                     /db_xref="GeneID:2888919"
     mRNA            <825046..>829038
                     /locus_tag="CAGL0I08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447615.1"
                     /db_xref="GeneID:2888919"
     CDS             825046..829038
                     /locus_tag="CAGL0I08437g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447615.1"
                     /db_xref="GeneID:2888919"
                     /db_xref="GOA:Q6FQ79"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ79"
                     /translation="MTNSTSEDDLNRLNSLLTHRWIDFNPKSTQINGYYEDSCHAGLH
                     KVDKPPLRPLYDQVGVIPKLDQVLDCKKFLINKNDNDLDDFLSDLELLEKAPLIKNKI
                     NVSTLIPTPTVSTRDPESLDDPDFESLLEDSEQDPRADAPENTDATEDINTKLENAKM
                     ELELGFAMRTEGHLFLGNKSFQNILTLEIDDYAFIDTSRSNFPSLLLVIEKGTNILYT
                     IALFKDIKKSFVLQYCYLTSVNPRHLRGKPLKLFTDLNNHTFAVVGPHSFCKIFRFKN
                     YLQFEYLTTIKFCDVVDIFFKQIGTDATNCITEIILINKKGKILLIQYDYKLDKIIKR
                     QTSYIGIQDKNDIIRSVFSLSKEVLFLLGKENQYVAHKSNILNTEPAEIKQFKPFHNK
                     EIKLFELPCLISEIKEICPTIRYTHSVLYYTSSSNDMGIMFSDSSDILEAIFIKLSLS
                     VEAENAPFIPMCCFPSELQDEVILRAFLYKGFIDIPIRLSDEMIKTLEEPSISFSIVS
                     LPWEIHEYWEPQICLGTSVVSSWPINHSSIFVEYRDRFRTLNLFGSNLMARRSLNIDY
                     LAKFDTILLYYWDDMGDSVSSLIFSENERKDDSCMLVASNKKETLCQLLTANDHDIDV
                     TFLDDIIPCASTTCRAILFFHDLVLQISAFSVYVNNLSSEGGTTTRKVFTSDHQIVKF
                     TMLDGTCLSYCSNDTLYVSESIVDVLDEKDEFYETALLKALICLDTDAPKIDSERGSS
                     SHNSSQTNDNHSNCIVTISNRTNLYSVKNRDYFKDNTYLIDIDLVSLNDFNDNTMILL
                     ICTTVSRMLVFDWRKVVDFLRVKECKSEKLHGIYEEAVLYNWKVTGISSSSIGDGKVT
                     VVANSGIYLLDLLSIVHDVNKANTAKKLALKFGKDVINQRNSWKLTLKQTIGDKQLFF
                     YDKSIYMCNMKDYEKPEGIEIPAKKFQFDLYQSKQVYDAIFDKVSNSILAIVDGGLLV
                     LKDIYETKVVHEIGTDVHAAPSSNFNRLQFLFGDGRNYIREDGYGSLRFAGGNDVGTS
                     DFDASDVAYALRSERFDAYQIFDTNPSSPLGLLCVWNGIICLTRLVPGKPDYILSVLD
                     TYDLYSEEVWFHFSSLKNKFVATYSNQCDSPAVPFEIVGDRLVRKHLSDVSKSNVFCD
                     TGILGEYGIQEVDGALYVLGGGSPANWAPFLCSKECRPIVLNNDTVVVKWDARTLRFL
                     EITREQATAPTDRMSEARERMQEYLREASNEDEWFDLEEMLNVGDPHNDISLSASLLP
                     HRIEIDEDIVSLQYDQFTDRILVYTTYKIWVITRDPRMDLPRPHSISIRNYLPSDNAQ
                     TKFIARRIEQ"
     gene            <829562..>830194
                     /locus_tag="CAGL0I08459g"
                     /db_xref="GeneID:2888920"
     mRNA            <829562..>830194
                     /locus_tag="CAGL0I08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447616.1"
                     /db_xref="GeneID:2888920"
     CDS             829562..830194
                     /locus_tag="CAGL0I08459g"
                     /note="highly similar to uniprot|P06780 Saccharomyces
                     cerevisiae YPR165w RHO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447616.1"
                     /db_xref="GeneID:2888920"
                     /db_xref="GOA:Q6FQ78"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ78"
                     /translation="MSQQVGASIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQE
                     KWIAEVLHFCQGVPIILVGCKVDLRNDPQTLEQLRAEGLQPVATADGQNVADQIGATG
                     YYECSAKTGYGVREVFEAATRASLMGKQKNTGKKNKKNSGEKKKRKCVLL"
     gene            complement(<830943..>831287)
                     /locus_tag="CAGL0I08481g"
                     /db_xref="GeneID:2888921"
     mRNA            complement(<830943..>831287)
                     /locus_tag="CAGL0I08481g"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="XM_447617.1"
                     /db_xref="GeneID:2888921"
     CDS             complement(830943..831287)
                     /locus_tag="CAGL0I08481g"
                     /note="highly similar to uniprot|P10663 Saccharomyces
                     cerevisiae YPR166c MRP2"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="XP_447617.1"
                     /db_xref="GeneID:2888921"
                     /db_xref="GOA:Q6FQ77"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ77"
                     /translation="MTFRFPVKTKLPPGFLNARVIRDNFKRQQFAEHEITAKALKYIA
                     RNTTLPPRARLEAQLQLSSMPNYTRLTQVKNRCIESGHARAVLSDFRLCRYQFRERAL
                     KGELPGVKKGVW"
     gene            complement(<831571..>832350)
                     /locus_tag="CAGL0I08503g"
                     /db_xref="GeneID:2888922"
     mRNA            complement(<831571..>832350)
                     /locus_tag="CAGL0I08503g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447618.1"
                     /db_xref="GeneID:2888922"
     CDS             complement(831571..832350)
                     /locus_tag="CAGL0I08503g"
                     /note="highly similar to uniprot|P18408 Saccharomyces
                     cerevisiae YPR167c MET16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447618.1"
                     /db_xref="GeneID:2888922"
                     /db_xref="GOA:Q6FQ76"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR004511"
                     /db_xref="InterPro:IPR011800"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ76"
                     /translation="MKVYNLNNGISVTEEQLAHWNQALSQLEPQEILKWSLATFPHLF
                     QTTAFGLTGLATIDMLSKLGADALVPLITIDTLHLFPQTVTLRENVEDKYYRPHGKTI
                     HVYKPIGCDTEQQFADKYGEFLWETDDDKYDYLVKVEPAARAYKDLQVTAVFTGRRKS
                     QGSARSELQFVEIEELTGIIKINPLANWTFDQVKQYIDDNAVPYNELLDLGYKSIGDY
                     HSTVPVKEGEDERSGRWKGKAKTECGIHETSRFAKFLKQDT"
     gene            <832983..>833582
                     /locus_tag="CAGL0I08525g"
                     /db_xref="GeneID:2888923"
     mRNA            <832983..>833582
                     /locus_tag="CAGL0I08525g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447619.1"
                     /db_xref="GeneID:2888923"
     CDS             832983..833582
                     /locus_tag="CAGL0I08525g"
                     /inference="similar to AA sequence:UniProtKB:Q06213"
                     /note="similar to uniprot|Q06213 Saccharomyces cerevisiae
                     YPR168w NUT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447619.1"
                     /db_xref="GeneID:2888923"
                     /db_xref="GOA:Q6FQ75"
                     /db_xref="InterPro:IPR019145"
                     /translation="MGSVKSSNPALEGLHEELGVMEEQIRSIIESFIELGVSVYDFPG
                     TPEASQGMVTNLKRNVDRIFKLNQTSNDPQSALKDVNVPLEVVQYIEDGRNPDIYTRE
                     FVEAIRRSNQYQRAKMHGMGMLRDSLAEKIKEQFPELKDDVENIVQRTNMKPTGQARV
                     NSGTTNMTTTAEQSNVVNATAGDVGTNANTTESVEQNGI"
     gene            complement(<833793..>834797)
                     /locus_tag="CAGL0I08547g"
                     /db_xref="GeneID:2888924"
     mRNA            complement(<833793..>834797)
                     /locus_tag="CAGL0I08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447620.1"
                     /db_xref="GeneID:2888924"
     CDS             complement(833793..834797)
                     /locus_tag="CAGL0I08547g"
                     /note="highly similar to uniprot|P40093 Saccharomyces
                     cerevisiae YER156c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447620.1"
                     /db_xref="GeneID:2888924"
                     /db_xref="GOA:Q6FQ74"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ74"
                     /translation="MDTKRQKLEMLQICTHSGPFHADESLAVYMLRLLPKFKDAKVVR
                     SRNPEDWEASDIVVDVGAKYDGVKFFDHHQREFFETFNGEYATKLSSAGLVYKHFGRE
                     IITAIVENKGASISSGDLDILYDKVYKQFIEALDANDNGIDKYENSKELTPKFKDNAI
                     SIPGVISGMNPSWNADTSAEAYDTNFQRASKFIGEIFVDLVEGYALSWIPAKSLVIEA
                     VNRRSEVDDSGKIIVLNQFCPWKEHLYEVEKAKGIEGQIEFVLFKDSSNTWRVSTVPV
                     SSTSFQFRKGLPEHLRGLRDQELSDKSGVPDCVFIHAAGFIGGAKTQDSVYKLAKMSL
                     "
     gene            <835234..>837567
                     /locus_tag="CAGL0I08569g"
                     /db_xref="GeneID:2888925"
     mRNA            <835234..>837567
                     /locus_tag="CAGL0I08569g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447621.1"
                     /db_xref="GeneID:2888925"
     CDS             835234..837567
                     /locus_tag="CAGL0I08569g"
                     /inference="similar to AA sequence:UniProtKB:P40094"
                     /note="similar to uniprot|P40094 Saccharomyces cerevisiae
                     YER157w SEC34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447621.1"
                     /db_xref="GeneID:2888925"
                     /db_xref="GOA:Q6FQ73"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ73"
                     /translation="MVRPRRPSLVEDIASQPGFESSSSQENSKFGALFADSYLLQKLE
                     ALSVELQKNKDNVEMPKYDLSSQPTSKSSVDDNDPYITYRKYIQQLDHSIEGFQKVVQ
                     KTEEVNGKLGDGLDQFVNISKRADGFVDETREIHEKRDKLEAQNRLVPEQLKYFEALD
                     PIIRRLNHATSPSIVRKESFKNMMVKIDNSLEYLHEHSDFKEAETYRIKFKQCLIRCC
                     DLIVHHLNSIVNRICTEITDGLQNNKEISETTREVLLYNKFASISEEYTSEIKCIIER
                     RHMSTYTRYRDELDSLLNECYNHYFQARKSLLDSIIKNKLNEIYKSEEHIQTRKFISA
                     EKDFFQQLAENEYHLFVKFFPGPESKERGNKWLIQLCDPFYDSVKAKLLRENDILTIR
                     DCILLFTQYYEFEEDYEEYENIFKDVYYDKLFEPVLQKLQSRLIFRAQKYIDEAIVKY
                     KPPKGAPMITNRKTSAKLESEEEMVGIYIDDLKNSEVISLPETDSEEDATDIILSTYY
                     IPIIRALALLSTIYEMINTVVFDDLAHHVVRDCLVSIGEAFNLLTSGDDVNLVEYSLS
                     YLRNLLFLRDQLQTFNIQYTVNETFLDFSAVGSLFRRSSSNLVREELPKPDMGRRNSQ
                     RILSAARNLIPKLVVNTVDSGSELVEALRFAIRSFTDRASKILTQDYMKISDIEIEDI
                     LGDNVKLRTSIDTNLPRVVQLIHDYISDDEIVENLLDALKEAIQIQYQNYYDELNNLV
                     ENGKVENGKVLEVMYPDTFSEYLATSIKKEVEILENK"
     gene            complement(<837766..>839319)
                     /locus_tag="CAGL0I08591g"
                     /db_xref="GeneID:2888926"
     mRNA            complement(<837766..>839319)
                     /locus_tag="CAGL0I08591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447622.1"
                     /db_xref="GeneID:2888926"
     CDS             complement(837766..839319)
                     /locus_tag="CAGL0I08591g"
                     /note="some similarities with uniprot|P40095 Saccharomyces
                     cerevisiae YER158c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447622.1"
                     /db_xref="GeneID:2888926"
                     /db_xref="GOA:Q6FQ72"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ72"
                     /translation="MSVQGVSLTRSNSYRRLLTQDQMDLRQSIMVGDIAVVVPERRSP
                     ERRSPERPERPERPERSERFERHEPRQRYERDREKVPSQNVRREPRITRSKTINVGSD
                     SVRKKALQNSQKQNMLNAPAHKKVPQNYYMQPHYQQQQQQMRQAYPAIQRSKSVTASN
                     IGKTYSDRGREHGREHEREHERERDRQHELSRRHSHVYRAPQVEDRRAVETPTVSAYQ
                     LQKQKMKHSFKFENGEVFTPRRELQAAKNPQEKINPYAYKDKSSASSIHSDLSDDEDE
                     FDLSVGSINFQKRPAVSPIKAKPKAKEPVVKEKKKFGSFFKSIWKSKSLSDAEQPPKK
                     LFIAEPKVEQKPATQPPEIKVSEPAPKKNPIDEIYDRLVVQWEKVTFIPPDELETIRS
                     ISSSDRSSLINFYLPNLSSTSLSSNGNSTSFASAVRKDMMSTMNKKLRFSNEVLLTDT
                     WAPEVYERSNDSFLDNFIEVGGSTSSGNDSSANTTTQKPEIKQEINEFKKNEMVVHEK
                     SAKYTHIYC"
     gene            complement(<840182..>841861)
                     /locus_tag="CAGL0I08613g"
                     /db_xref="GeneID:2888991"
     mRNA            complement(<840182..>841861)
                     /locus_tag="CAGL0I08613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447623.1"
                     /db_xref="GeneID:2888991"
     CDS             complement(840182..841861)
                     /locus_tag="CAGL0I08613g"
                     /note="weakly similar to uniprot|P33413 Saccharomyces
                     cerevisiae YHL016c DUR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447623.1"
                     /db_xref="GeneID:2888991"
                     /db_xref="GOA:Q6FQ71"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ71"
                     /translation="MGHLSIPAAHAIIWPTYGVLLITASMVAYWKRDSKTFLSANGTQ
                     KAIPLAFNFVASGLGCGVLSTYPQIANLDGLHGLLVYALAGGLPMFVFAFLGPLIRKK
                     TPSGFVLTEWVFHRFGLLCGWYLSACTILTVYLFLVSEVASLKYAIDTLTNINSLPVI
                     IIECVVTTIYTSIGGFHISFMTDSLQVSIVFILLVIVAAAMGSRIHIDRDLIGPSGLL
                     KGNKLGWQLVYILTVAIFTNDFFMSGFWLRTFASRSNKDLLIGCSLACFILVTFVTVV
                     GVTGFIAVWAGLLPARDQENSGAAFYLLLAQLPSWIIGFTLVFVAVLSTCTLDSLQSA
                     LVSTISNDVFRNKLHIMLVRGIVVAIMVPVVVVGLIAQDVLSIYLIVDLLSSSVVPVL
                     VVGLWGKLDEIWSAWEVIGGGCAGILGVWIFGTVYYHSAKEGGRLLLISNGLYADDWG
                     AFGAFVVAPGAGLVCSVIILAIRLSLMKLYKKNPEGRFHRTCNKLGQVTGITRLYHFV
                     NYWDSRLIDRSATEELPSDISLRSDEEDNKKSMESIRVHELSENNTNEHDS"
     gene            complement(<842809..>843228)
                     /locus_tag="CAGL0I08635g"
                     /db_xref="GeneID:2888992"
     mRNA            complement(<842809..>843228)
                     /locus_tag="CAGL0I08635g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447624.1"
                     /db_xref="GeneID:2888992"
     CDS             complement(842809..843228)
                     /locus_tag="CAGL0I08635g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447624.1"
                     /db_xref="GeneID:2888992"
                     /db_xref="GOA:Q6FQ70"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ70"
                     /translation="MDIKEITTGDSEVYGTVGTEVGASVGASAEVSAEAKDETTEVFE
                     KIKTHFPPAKVKKIMQSDEDIGKVSQATPVITGRSLEFFMALLVKKSGDMARQRGMKR
                     ITADVLRDTILEDERFDFLRESICAGYKGYKEDEEKE"
     gene            complement(843819..843891)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0I08657r"
                     /db_xref="GeneID:2888993"
     tRNA            complement(843819..843891)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0I08657r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2888993"
     gene            847826..847907
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I08679r"
                     /db_xref="GeneID:2888994"
     tRNA            847826..847907
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0I08679r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2888994"
     gene            <848204..>848947
                     /locus_tag="CAGL0I08701g"
                     /db_xref="GeneID:2888995"
     mRNA            <848204..>848947
                     /locus_tag="CAGL0I08701g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447625.1"
                     /db_xref="GeneID:2888995"
     CDS             848204..848947
                     /locus_tag="CAGL0I08701g"
                     /note="highly similar to uniprot|P53039 Saccharomyces
                     cerevisiae YGR172c YIP1 golgi membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447625.1"
                     /db_xref="GeneID:2888995"
                     /db_xref="GOA:Q6FQ69"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ69"
                     /translation="MSYFQGNDMNTSSGFYQPSSQFNFPQGSMSFQSGGNNSGDSNAM
                     GVAPDPLPAGLFNALSTKGYPHEPPLLEEIGINFDHIFKKTMYVLRPTMSSAMLSHEI
                     LNDSDLAGPVIFFMLFGLFLLMAGKVHFGYIYGVALFGTISLHTLSKQMATSSSQQQQ
                     PSSLHFFNTASILGYCFLPLCFLSFIGVFHSLDNRIGHLTGALFVIWSTWSSSGFLNN
                     LLQLQNARTLIAYPLLIFYSVFALMAIFV"
     gene            <849315..>851069
                     /locus_tag="CAGL0I08723g"
                     /db_xref="GeneID:2888996"
     mRNA            <849315..>851069
                     /locus_tag="CAGL0I08723g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447626.1"
                     /db_xref="GeneID:2888996"
     CDS             849315..851069
                     /locus_tag="CAGL0I08723g"
                     /inference="similar to AA sequence:UniProtKB:P22438"
                     /note="similar to uniprot|P22438 Saccharomyces cerevisiae
                     YGR171c MSM1 methionyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447626.1"
                     /db_xref="GeneID:2888996"
                     /db_xref="GOA:Q6FQ68"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ68"
                     /translation="MNGSILRTSRSLRPWLLPINTRLAHTTAVQSHVTTPIFYPNAKP
                     HLGHLYSSLLCDIYHRWQVLNGDSAALFTTGTDEHGLKIQLAAEKNNCESPKAFVDKL
                     YPEFVELDKTYDISYTRFIRTTDPDHIENVKLLWNLCLENGYIYKGKHEGWYSISDET
                     FYPSSKVIKDPNNPNKYINTESLNEVIHQSEENYYFKLSSFKEKLINHITEFPDFVHP
                     PSKRDQILRDLKNDPNITKDISISRPATRLQWGIEVPNDPSQKVYVWFDALCNYISSI
                     GGIEAVKQNKRALSNHILGNSDITVYQPTNVWKDTVHVIGKDIEKFHIIFWPSFLLAA
                     NLPLPKQIVVHSHWLCNGFKMSKSLGNVVEPMKISSHYGTDMVRWFLMENSKVEEDGD
                     FQEEKLFATTELFVSKWGNLINRCCGAKFNIERSVHKYARNSEEVLADFEKIYIDNDM
                     IIQARSLIQDVDQLILNAGKYYEKFQYNLLIKDIWKIINSTNSLFQYAEPWKKLGEQQ
                     DIIIFLCADISRVLAILTQPIIPQLSHKLLDHLKVDQERRTIDYANIGHDQSYAVEAN
                     IKNRPVPIARVLGLIGIE"
     gene            complement(<851234..>854935)
                     /locus_tag="CAGL0I08745g"
                     /db_xref="GeneID:2888997"
     mRNA            complement(<851234..>854935)
                     /locus_tag="CAGL0I08745g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447627.1"
                     /db_xref="GeneID:2888997"
     CDS             complement(851234..854935)
                     /locus_tag="CAGL0I08745g"
                     /inference="similar to AA sequence:UniProtKB:P53037"
                     /note="similar to uniprot|P53037 Saccharomyces cerevisiae
                     YGR170w PSD2 phosphatidylserine decarboxylase 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447627.1"
                     /db_xref="GeneID:2888997"
                     /db_xref="GOA:Q6FQ67"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ67"
                     /translation="MGIGKRKRRGEKEDRMRNGLFLEVHLVGTKKIELFQRFQCCPTC
                     FVTTNTFFVKRSSRLKNSNTRWNQIVKLKLPARPVSPYVDLVVYDCISSKHSHGVNDE
                     SDLNSGSEVENKRKRGYSSSSALTPYSRTNLSVSGESISDASIYGNSTAEGTRSNVTS
                     KNLPYLTIDNNKSSTTAHRHSRSFGNLSLQRLSIPSPSVSSSPSGYSPSGQKRNFTSD
                     SNNQGSLGTRNKSSYLYVGETRVSLTDIFKVKDTATGYNFFQPPQWFPLYDKKRQKSD
                     DFGKEQIIGEIQVGFRLKCNNRSHSIVQEFNEWNKYLHENKKSNLDLRNVYSSSAYLD
                     DENEDLLSMKDPDARDLCDEFIEENINLDEEQVVMDEDDDDELEDDVLAIPNELIEPL
                     GLLHLSSNNSDDSTSPDASGKNDSDPSNDAFDELENGYEDDVESFSDELKDIDYFPDE
                     PLISENLENSSILTIPTMVTALDEYEVVLPSSDEVMTLDDVIASRNSSPDTPTDGLSR
                     IKSGSPHIRSTGSFKDDRNEESENSSDLNSTILKMNRKKLFPMLKRKRTRANYSSFSN
                     YYETLLSRKFQLSKREHALGVMFVHFESIEGLPELKNKISKTYYAMDPFIIMTFGRRV
                     FKTSWRKHTLNPVFDERAAFEIYPNEKHYDIHLSVMDKDSFSYNDMIAKYELTLQEVM
                     QKQTPDHDWKVIEIPLKLTLRDSENFDSPVLRLGIRYVPYSHLKSYFWKRAVSLSTDR
                     ETFDLVQTLLFLQRLGSFSEFDVLEFFSYYKKLPWSGETLTQDELVNGLQQWTKSGDF
                     KNIWKCPSCFRSFRPSNNDMNSKLILENDLITHFALCSFKKCGKVLKPSYVSSQFASK
                     RWFSKLLIKLTYGKYAVGSNNANILVQDRDTGIVLEEKISAHVKVGMRIIYNGKGKES
                     KKFKTLLKTLSVRQGKKFDNPLSAKQIDSFIKFHDLDMSQCEPTEYRTFNEFFYRKLK
                     PGSRPPEGDTSEVMVSAADSRCTVYSTIQKSKEIWIKGSKFSLNRLTGGYRPEIFNDS
                     SCSIAIFRLAPQDYHRIHCPVDGVVGKPIFIKGEYYTVNPMAVRSELDVFGENVRVIV
                     PIETKEFGPLLYIAVGAMMVGSIILTCQEGDFKRRGDEMGYFKFGGSTVILVMQSKKL
                     IFDSDLVSNSLEGIETLVKVGMSIGHTPNIKEIKRRKVKPTDEKQIEKIKRSISVAEH
                     KAENAGNIPWQMQLLEKDIREGNLWGTDT"
     gene            <856085..>856357
                     /locus_tag="CAGL0I08767g"
                     /db_xref="GeneID:2888998"
     mRNA            <856085..>856357
                     /locus_tag="CAGL0I08767g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447628.1"
                     /db_xref="GeneID:2888998"
     CDS             856085..856357
                     /locus_tag="CAGL0I08767g"
                     /note="highly similar to uniprot|Q3E772 Saccharomyces
                     cerevisiae YGR169C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447628.1"
                     /db_xref="GeneID:2888998"
                     /db_xref="GOA:Q6FQ66"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ66"
                     /translation="MGKRFSESAAKKAAGQARKREQAYHKHQAELAAQEAEEAAKWEQ
                     GSRKENPKKLLEEQKKQEKLRAKKEREALLAEEEASLGKGGKGKKK"
     gene            <856941..>858176
                     /locus_tag="CAGL0I08789g"
                     /db_xref="GeneID:2888999"
     mRNA            <856941..>858176
                     /locus_tag="CAGL0I08789g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447629.1"
                     /db_xref="GeneID:2888999"
     CDS             856941..858176
                     /locus_tag="CAGL0I08789g"
                     /inference="similar to AA sequence:UniProtKB:P53294"
                     /note="similar to uniprot|P53294 Saccharomyces cerevisiae
                     YGR169c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447629.1"
                     /db_xref="GeneID:2888999"
                     /db_xref="GOA:Q6FQ65"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ65"
                     /translation="MSNIQYYYQSGLRKIYPYYHTRTAFVKGRWHNRTVLDVLVKEFR
                     AHSAEYYGHQIVNGKYKLIRDGQYLDNLSVLDTPIKNNDKLESTVHKHEPPVLQWCSN
                     EANIPGKKIAGIDIVYEDENLLVINKPCGIPIHPTGLYYGNTLTEILKVNGVHALPAY
                     RLDKVTSGLLILSKDTGTASMVQKKIRSHEMQKWYLARVEGAFPHVNEVPHIETLEIQ
                     RLDLPIEEQIIQDNSILTIEDSDVYTVEPKKQYPSGLSVPRSAKTIFYPIKYFPHKNE
                     SIVACRPITGRTHQIRIHLARLNHPIVNDTIYSQKITRYPERLNFIRSIANWSEAKLT
                     DEELSETFQIFIQESEHFKKKALAENKNCPVCSECGALTLSDPDPEDLSIDLHAWRYS
                     DAEKTLNFKTELPQWVVNE"
     gene            <858471..>859535
                     /locus_tag="CAGL0I08811g"
                     /db_xref="GeneID:2889000"
     mRNA            <858471..>859535
                     /locus_tag="CAGL0I08811g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447630.1"
                     /db_xref="GeneID:2889000"
     CDS             858471..859535
                     /locus_tag="CAGL0I08811g"
                     /note="some similarities with uniprot|P53293 Saccharomyces
                     cerevisiae YGR168c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447630.1"
                     /db_xref="GeneID:2889000"
                     /db_xref="GOA:Q6FQ64"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ64"
                     /translation="MSKGNLSFIIRVLLERQAGTVNGLKLVRRRVVVMVCSSLLLLIR
                     RIKNSGGMSKIDIRNWCLNTIAVLFATNASPYIKPILDNKKYDKLIDRITLIFSIMIS
                     RTVPEKLVSFSVANVIINGIRNFISAKKPDATASSLLNHAATSMLITLIYLLDDKKSR
                     LYKSIIFNDKNLFYDFAIIFSTISIHSFYMDVMNKLGSKKIDKDFLLELYERRKTYRK
                     YKANYSEISNNSKVIVDKFREKYEITFKRQRTKLEKILNSRLFQNFISTSQWCIFKVL
                     LMHIFRKESGRFRFNGTTKKFVATFISLLTLDFGKVMSVNTWILKLLTYYISIKYYHW
                     WQVTEEINKVVLSIASALIV"
     gene            complement(<859749..>860381)
                     /locus_tag="CAGL0I08833g"
                     /db_xref="GeneID:2889010"
     mRNA            complement(<859749..>860381)
                     /locus_tag="CAGL0I08833g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447631.1"
                     /db_xref="GeneID:2889010"
     CDS             complement(859749..860381)
                     /locus_tag="CAGL0I08833g"
                     /inference="similar to AA sequence:UniProtKB:P17891"
                     /note="similar to uniprot|P17891 Saccharomyces cerevisiae
                     YGR167w CLC1 clathrin light chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447631.1"
                     /db_xref="GeneID:2889010"
                     /db_xref="GOA:Q6FQ63"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ63"
                     /translation="MSEKFPPLENNDSDLVANLDNSTDFLKREAEVLGDEFKTEQDAE
                     LLDDGSLSDFNNDNAAKDNEDAAVQENLNTSESYDDFGDMQQSTTTAEDRSHVVQEWK
                     TKRDNEIREKDEAELEAKKKLQDEAIKYIDDFYDNYNKKKEQHISTTKKEAEEFLKER
                     DQFFSQDNTTWDRVLQLINVDDADVIGGRDRSKFKEILLKLKGKTGVPGA"
     gene            complement(<860709..>862229)
                     /locus_tag="CAGL0I08855g"
                     /db_xref="GeneID:2889011"
     mRNA            complement(<860709..>862229)
                     /locus_tag="CAGL0I08855g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447632.1"
                     /db_xref="GeneID:2889011"
     CDS             complement(860709..862229)
                     /locus_tag="CAGL0I08855g"
                     /inference="similar to AA sequence:UniProtKB:P32893"
                     /note="similar to uniprot|P32893 Saccharomyces cerevisiae
                     YGR166w KRE11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447632.1"
                     /db_xref="GeneID:2889011"
                     /db_xref="InterPro:IPR024662"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ62"
                     /translation="MECFIPTERGIVTGGVVDEVTLDKLRSSKQDRLFVIFDECLEIY
                     FYLKGKNLSINSISIWINEAIVLESSEQNIFTQIECHEGVLLRLEESTYARKIFRSSV
                     VMTNGYNNKVRLVVRYGEKSVIKRLNGISLQEEEEERDSSDDEMLTSFEPVYSLLPSD
                     DSELEKVSSTTVTKADYEGIGSEDQNQKDEIFELEYPIYSLINMRLRNTALEQISSII
                     SCLEFQTSKAAESLISKHYTSESFSMHFDRVSYNLVNRKAQTEIEPVSKFTMPFEVYL
                     RDSYSINYKLPLLQNSQIYPHHVRINLKYELVIGDKRFPVNTIWETDIALKRPVNPNL
                     IPNASSSTLAVNQSAKPFGVSPRLSATAVSTPSLLYNKLKNVKFSILNNNLKVDMGKK
                     FVLRLQIINTSPVPLDLVVYYNNQSPVIQNSSNITLDRQIQLYKKYKKITEGIILLSN
                     DYKIPIIDPHETYFVDLSFIAIMPGYYQSLAGLKLLDLKTNELIDIGTGASILVQE"
     gene            complement(<862629..>863663)
                     /locus_tag="CAGL0I08877g"
                     /db_xref="GeneID:2889012"
     mRNA            complement(<862629..>863663)
                     /locus_tag="CAGL0I08877g"
                     /product="mitochondrial 37S ribosomal protein MRPS35"
                     /transcript_id="XM_447633.1"
                     /db_xref="GeneID:2889012"
     CDS             complement(862629..863663)
                     /locus_tag="CAGL0I08877g"
                     /inference="similar to AA sequence:UniProtKB:P53292"
                     /note="similar to uniprot|P53292 Saccharomyces cerevisiae
                     YGR165w"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS35"
                     /protein_id="XP_447633.1"
                     /db_xref="GeneID:2889012"
                     /db_xref="GOA:Q6FQ61"
                     /db_xref="InterPro:IPR021036"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ61"
                     /translation="MFRPAASGKSSSLLQGNICCYQQVRNLSRRRLAYPFYPFKRLGR
                     QHPKKHDTNLKYAMRQFLGPKNYKGEYVMNTYFAVPNNHVPNYIKPDIERGQALRDPN
                     TGKRLTERYDGALVDAPHNKRLEDVSERRQLQPFPSNPHCKTNYMVSEELKAQIYNDI
                     ETNGLSTQQVSHNYGLKIPRVEAIVKLMKVEKKWEKLNRISPDLKVMSETLYKMFPLF
                     VPEVPANRENLSEIPVPQKALSSRFLTIAESQPFGPVDAAKVLELEPAVKTLEKLSTI
                     GEHSEGHIEKKEHKKKVVYGELKEGERSVLKFTHAKVGEVGHRYGRVLRDNKKDRKIG
                     FNELGQMVYI"
     gene            complement(<863906..>866701)
                     /locus_tag="CAGL0I08899g"
                     /db_xref="GeneID:2889013"
     mRNA            complement(<863906..>866701)
                     /locus_tag="CAGL0I08899g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447634.1"
                     /db_xref="GeneID:2889013"
     CDS             complement(863906..866701)
                     /locus_tag="CAGL0I08899g"
                     /inference="similar to AA sequence:UniProtKB:P41695"
                     /note="similar to uniprot|P41695 Saccharomyces cerevisiae
                     YGR188c BUB1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447634.1"
                     /db_xref="GeneID:2889013"
                     /db_xref="GOA:Q6FQ60"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ60"
                     /translation="MVFDSWAVAKPQATPNLEDVRKHYENLLYEDLENLDDPLQLYLE
                     YIKHLKHCQNEGQGISCSQVLQDVMERCLLYFLDLEIFKNDPRLLRVWISYMNMVYKE
                     FIDEKINILCYLYHKKIAVRLALFYEQLAECLASINKGEESVAILRLGKDNNAFPTQR
                     IIASYEQYALKYGTTNDNNNMYIQFMNTYRIPTFIINYDSSNLSPIPLRQIRKEDVTN
                     LDNKNDNTSKTLNEEQNDNDDLIPQSKPKIPIFHDSESPEKNSKSNKSQVLKVVEMKG
                     KKPQKIVCNFKLLFPDDSQEYCIEEILAKSSISRDILRKKQDRVKRNLDLSVTNSKAD
                     IKRRNILSDKITGLPSTQPPIPGLNTENKDVDTKYEVDSPVKTKIDVSTSILPLKEAP
                     MPGMTSKQYGAPSSPTVTMFSKNAMNEVYSMFNQNYEDFNGLGEKEDTTSKFSQYENF
                     TEGFTAKNLDDLTEAKPNIIRTDVGEISNSNVRSPIRAIPNKSKLPEFMTPIKETART
                     LLPRNKIKIYEDKPSSVIPSQSSPFISQPIPKESNSQGKEIPEYKQIINHPTSKKFRL
                     SLLTNIQPPLSTYSTFYSYNQNLKMSSHLKKMHKASKIENKRQILEFKKADELYCIVG
                     ELGQGGYATVYLAESDRGDIRALKVETPSSSWEYYILKQIENRLQGDKILDSVISAYS
                     LHFFLDESYLVLNFADQGTILDLVNYYGEKSSNSVDECLCIFLSLELIKIVLRLHDVG
                     IIHGDLKPDNCMIRFSDGLLGNYDKHGGNGWHKKGIYLIDFGRSFDMKLFDKNTKFIA
                     DWTTDMQDCPAMRKGDPWSFEADYYGLASIVYCMLFGKTIEIDNTNSGTYRIRGTIKR
                     YWNHDIWNPLFDILLNPSSTGSFSMKIETVVSRMEDYLSVMGNSQQLRSIIYDLQPEL
                     IKIMSKKMSLGKRKTSI"
     gene            867088..867159
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0I08921r"
                     /db_xref="GeneID:2889014"
     tRNA            867088..867159
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0I08921r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2889014"
     gene            <867666..>869474
                     /locus_tag="CAGL0I08943g"
                     /db_xref="GeneID:2889015"
     mRNA            <867666..>869474
                     /locus_tag="CAGL0I08943g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447635.1"
                     /db_xref="GeneID:2889015"
     CDS             867666..869474
                     /locus_tag="CAGL0I08943g"
                     /inference="similar to AA sequence:UniProtKB:P39684"
                     /note="similar to uniprot|P39684 Saccharomyces cerevisiae
                     YFR023w PES4 DNA-directed DNA polymerase epsilon
                     suppressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447635.1"
                     /db_xref="GeneID:2889015"
                     /db_xref="GOA:Q6FQ59"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ59"
                     /translation="MSTLMLADILKQVSLNNRKLPENNLPGIEKKPRRIVSDASSRSE
                     TLEIVDIRTENLGTNVQNNIALFVGNLAEEITSERLTEMFKVYKSFISAKVCTNADDN
                     RSLGHGYINFGNKEDAERATEDFNYNKIMGKEIRIMPSIRDSVYRKNFGTNIFFSNLP
                     LQKEKLTHRMFYDIFRKYGNVLSVKLDSSKNIGFVYFEDDTIARDVIKEFNNKEFLGN
                     IISCGLHFDKELRKKPNFDKQISKLDDDIIIEKEKEIFDSNKVEIKIDKDKVAIIQPN
                     GIFIKNLPLDTNNNEILAIFSEVGPIKSVFLSPLNESREYLWAFVTYKDKASVEKAIS
                     LFNGKAIGNRNVFVTHAYSKYNIPTPKPILFLSNLSPICDRKFLKQIMNQLSVKPEDI
                     KVHQSENPEHVTSTGTIQFKTQDDLDKAKKFLNNKLVSGSIIYATTRKSKKNQEQTNY
                     REFCQILPNSPFTYKNYGDYCSTNIHDPSTHDKMHFMHAKKLKNYEVQTNKLPYNGCQ
                     DKKATQLFKNGRGAIPAKELLLQQIKDKIDNLKYPFATRPENLKSLADYIFIVFWNRN
                     GQSLSQFLLLQNSSKEYAEMLKHQIETAASTLGFGR"
     gene            complement(<869942..>871255)
                     /locus_tag="CAGL0I08965g"
                     /db_xref="GeneID:2889016"
     mRNA            complement(<869942..>871255)
                     /locus_tag="CAGL0I08965g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447636.1"
                     /db_xref="GeneID:2889016"
     CDS             complement(869942..871255)
                     /locus_tag="CAGL0I08965g"
                     /note="highly similar to uniprot|P43603 Saccharomyces
                     cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
                     cerevisiae YHR016c YSC84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447636.1"
                     /db_xref="GeneID:2889016"
                     /db_xref="GOA:Q6FQ58"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="InterPro:IPR013315"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ58"
                     /translation="MGINNPIPRSLHSETKKAAKILASFVKPNQVFGADQVIPPHVLK
                     NAKGLAIITVLKAGFLFSGRAGSGVIVARLRDGSWSAPSAIGMAGAGAGGLVGVELTD
                     FVFILNTPDAVRSFSEFGTITLGGNISVSAGPLGRNAEAAASASAGGVSAVFAYSKSK
                     GLFAGVSLEGSVILERREANRKFYGNNCTTKMILSGRIRPPPSVDPLFRVLESRAFNY
                     RSSGDDYEDSDYDDDYYDDIPSSFTSDDTSRYSRSGAARRDRRNDDDRYDRIGSRGSR
                     RDKYRDDDDFDDDFDDPSGAKDYYANHRRGGASSARNQRSSYYDDDYDDDYRGDSRRH
                     GDSRRDVDDLSNRFSKSRISPGATNNGRSNSRPADEPPRRDASSGAPKAVALYSFAGE
                     EAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVELV"
     gene            complement(<871699..>873084)
                     /locus_tag="CAGL0I08987g"
                     /db_xref="GeneID:2889017"
     mRNA            complement(<871699..>873084)
                     /locus_tag="CAGL0I08987g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447637.1"
                     /db_xref="GeneID:2889017"
     CDS             complement(871699..873084)
                     /locus_tag="CAGL0I08987g"
                     /note="highly similar to uniprot|P04076 Saccharomyces
                     cerevisiae YHR018c ARLY"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447637.1"
                     /db_xref="GeneID:2889017"
                     /db_xref="GOA:Q6FQ57"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR009049"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="InterPro:IPR029419"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ57"
                     /translation="MSGQAKTKLWGGRFTGQTDPLMQLYNASLPYDYRMYKADLEGTK
                     VYTAGLTKLGLITESELAKIHSGLKDIENEWDEGKFVRHESDEDIHTANERRLGELIG
                     RDIAGKVHTGRSRNDQVVTDMRIYCREILNEKIFPAMKSLINVLVNRAEKEIDILMPG
                     YTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSPLGSGALAGHPYGIDRQF
                     LAEGLGFNGVIGNSLVAVSDRDFVVELMFWATLFMNHVSRFSEDLIIYSTAEFGFIKL
                     SDAYSTGSSLMPQKKNADSLELLRGKSGRVFGELSGFLMSLKGIPSTYDKDMQEDKEP
                     LFDCLTTVEHSILIADGVISTLTVNKEKMENALTMDMLATDLADYLVRKGVPFRETHS
                     ISGQCVALAEKENLSGIDKLSLEQFKNIDPRFEQDLYETFNFEMSVERRDAIGGTAKS
                     AVLAQLKSLKL"
     gene            complement(<873741..>874763)
                     /locus_tag="CAGL0I09009g"
                     /db_xref="GeneID:2889018"
     mRNA            complement(<873741..>874763)
                     /locus_tag="CAGL0I09009g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447638.1"
                     /db_xref="GeneID:2889018"
     CDS             complement(873741..874763)
                     /locus_tag="CAGL0I09009g"
                     /inference="similar to AA sequence:UniProtKB:P38635"
                     /note="similar to uniprot|P38635 Saccharomyces cerevisiae
                     YFR025c HIS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447638.1"
                     /db_xref="GeneID:2889018"
                     /db_xref="GOA:Q6FQ56"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ56"
                     /translation="MHSHHSHSGDYVAHGVDPLDDIVAQAVAMRFHTYCLTEHMPRVN
                     SKYLYPEERQEDMSPDPNIGELGLKVLKEKFLSYLEHSRSIRAKYSGGDCKTKFLVGC
                     ELECCDVEHIEYSKYLLRTYGDDLKFTVGSIHHIRGIPIDFDPHSWNEAFDSCDKNIV
                     KFLSSYFDMQHAMITELQPIIIGHFDLYKLLLPDEMFVHPATGDCSDDPQVDFVPITS
                     ISLVKTFPILREKIIRNLKAIDSYGGAIEINTAGFRKGLCEPYPGPEICELAKQYCGS
                     RFVLSDDAHAVSHVGTCYKQALDYITNTIKIEALYHLEETSDGSVKLVKEDMASVSEN
                     SFWKQF"
     gene            complement(875015..875087)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I09020r"
                     /db_xref="GeneID:2889019"
     tRNA            complement(875015..875087)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I09020r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2889019"
     gene            <875858..>876643
                     /locus_tag="CAGL0I09042g"
                     /db_xref="GeneID:2889020"
     mRNA            <875858..>876643
                     /locus_tag="CAGL0I09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447639.1"
                     /db_xref="GeneID:2889020"
     CDS             875858..876643
                     /locus_tag="CAGL0I09042g"
                     /inference="similar to AA sequence:UniProtKB:P43605"
                     /note="similar to uniprot|P43605 Saccharomyces cerevisiae
                     YFR027w ECO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447639.1"
                     /db_xref="GeneID:2889020"
                     /db_xref="GOA:Q6FQ55"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="InterPro:IPR028009"
                     /translation="MAVNHVRSKSSNGKRLVQSKLNINNETILKCPKCEMKYSPNSID
                     DVATHKKYHDLHINGRNWSQTWGIPIHDTTSSTIIATPSSSPFKTGKSVNNKNNERIV
                     MIQENKPAEVKAMLEIMDIVNQELNAPQDENNFWRKPNAEHQGKAIVYIKDKKVVGAI
                     TVEVLKQHKCRWMIYETRTLVEHVRPQFTLGISRIWVCRAQRGKGIAEKLLDAARISA
                     IPGQNVDKMKLAWSQPSDSGGKLAKKYNGVKHKSGHILIPCYL"
     gene            complement(<876825..>878417)
                     /locus_tag="CAGL0I09064g"
                     /db_xref="GeneID:2888963"
     mRNA            complement(<876825..>878417)
                     /locus_tag="CAGL0I09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447640.1"
                     /db_xref="GeneID:2888963"
     CDS             complement(876825..878417)
                     /locus_tag="CAGL0I09064g"
                     /note="highly similar to uniprot|Q00684 Saccharomyces
                     cerevisiae YFR028c CDC14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447640.1"
                     /db_xref="GeneID:2888963"
                     /db_xref="GOA:Q6FQ54"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ54"
                     /translation="MRRSIYLDNTIEFLRGRVYLGAYDYTPEATDEIVFFTIEDSIFY
                     NSFHLDFGPMNIGHLYRFAVIFHEILNDPENAQKAVVFYSSASTRQRANSACLLCCYM
                     ILVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLH
                     SFNLETYERYEHVENGDFNVLTPDFIAFASPQEDPKVLSSGTLTPKSHLNQPFRSVLN
                     FFANNNVHLVVRLNSHLYNKKHFEDVGIQHLDLIFEDGTCPDMSIVKNFVGAAETIIR
                     RGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLH
                     QNDFREWKYTMRLSTKPSEIIGGLYPLVSVEEYRLQKKRLKEGKRSSDITSNNRVNSN
                     DEVRDIEMTPARGSKYERQNDMKPTETAYKTAVPQHSPGQPRKGQNGTNTIEQISKNG
                     KSNSKTQHNNMVVDNNSDDDSMTSNYQNSSSQNRITRQTTESDEEGLLKQLLPKNRRV
                     ASGRRNVSAAGGVRKASGTVKR"
     gene            complement(<879007..>880863)
                     /locus_tag="CAGL0I09086g"
                     /db_xref="GeneID:2888964"
     mRNA            complement(<879007..>880863)
                     /locus_tag="CAGL0I09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447641.1"
                     /db_xref="GeneID:2888964"
     CDS             complement(879007..880863)
                     /locus_tag="CAGL0I09086g"
                     /inference="similar to AA sequence:UniProtKB:P53918"
                     /note="similar to uniprot|P53918 Saccharomyces cerevisiae
                     YNL125c ESBP6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447641.1"
                     /db_xref="GeneID:2888964"
                     /db_xref="GOA:Q6FQ53"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ53"
                     /translation="MGPEVEKDTQLRKAVTDGLWRVLTGDKSVGVGVKKSSTTPDLED
                     PREDVNQLDDEQLLDDQRNRILESRFDVADAFNMQETMEDVDEQQHKSEQVSQLASDT
                     SSNVESIMSMAQTTEGEQLERVPTIKKVFTNKSTGQIDLPPDGGYGWICCFCVFLVMF
                     STWGCNSGFGVFLGFYLNNDTYPHATKYDYALIAGFTVALGQGMSPFVMVIMRIIGMK
                     PTMLFGDALLLAGFILASFTKKIWQLYLTQGVLIGFGISFIFVPSTVVLPGWFLKRRA
                     VALGISLLGTGAGGVTYGLAANKMIQNTGNTRWALRILGISCSTTVVVATMLIRERKP
                     IKPIGLKNFKAIRKEFHTMFSVKILKRPIVLLIAVWFAFALFGYNLMIFTLSPYSIAK
                     GLSAHDASTLTAVLNGSQAIGRPLMGLAGDRFGRTNVTISLTTLLAIYLFAFWIPSHT
                     FVQLLFFSIMTGSCVGVANVMSTVLIADMAGPVDFLPAWACVNYLGAPLLLLPEVIAQ
                     ALTQPEHKSNPYLHTQIFAGCCFSFALLLACCVRSSAVWLKYNQKLIEVETKLKEYAN
                     DRQSSDEKSNTSINLSYSNEEKRLIELRDRYKELLKRTPRAYVKRIVHKMIV"
     gene            complement(<882180..>884075)
                     /locus_tag="CAGL0I09108g"
                     /db_xref="GeneID:2888965"
     mRNA            complement(<882180..>884075)
                     /locus_tag="CAGL0I09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447642.1"
                     /db_xref="GeneID:2888965"
     CDS             complement(882180..884075)
                     /locus_tag="CAGL0I09108g"
                     /inference="similar to AA sequence:UniProtKB:P53918"
                     /note="similar to uniprot|P53918 Saccharomyces cerevisiae
                     YNL125c ESBP6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447642.1"
                     /db_xref="GeneID:2888965"
                     /db_xref="GOA:Q6FQ52"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ52"
                     /translation="MVEEGSCASSVSVDSSYERSSLEVRSYTRDGRDADQYKLHNGNT
                     RTRTLSDSKEGVWRALTNDGTSIVDVLHVRDQSPHESEEKDLKQADEKAVDYDEEDDR
                     LLESRFDLADALRLVDTRQSMQDKENVQIRNRRYSGDDESIKSAYQSEDSIPIERVPT
                     IKKVFTNKSTGQLDLPPDGGYGWVCVFCVFLAMFSTWGCNSGFGVFLGFYLNNDTYPG
                     ATKYDYALIAGLTVALGQGASPFVMVMMRVIGMKPTMLFGNALLLAGFLLASFSTKIW
                     QLYLTQGVMSGASIAIVCVPATVVLPGWFLKRRAVAVGLSLLGTGLGGMVYGLAANKM
                     IQSRGNTHLALRVLAITCTVSNIVATVLIKERVPKKPVGIRSWKAIVQQFKVMFTIDL
                     VKKPFVLLIATWFSLALLGYIIMVFTMSPYAIARGMTAHNASALTAILNAAQSVGRPT
                     MGLAGDRFGRTNVTITMTTLLMVFVFGFWIPAHTFLQMIFFSICVGSCVGVANVMNTV
                     LIADMVGPEEFLPAWAFVCYIGSPLCLVAEVIAQALTVPEHKSNPYLHTQIFAGCCFT
                     AALLLALMLREYSVRLKYEGKRRELLREIKEDGALDALHQKEEYDALLSKTTSAYFKR
                     MTKKLII"
     gene            <885451..>887631
                     /locus_tag="CAGL0I09130g"
                     /db_xref="GeneID:2888966"
     mRNA            <885451..>887631
                     /locus_tag="CAGL0I09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447643.1"
                     /db_xref="GeneID:2888966"
     CDS             885451..887631
                     /locus_tag="CAGL0I09130g"
                     /inference="similar to AA sequence:UniProtKB:P43606"
                     /note="similar to uniprot|P43606 Saccharomyces cerevisiae
                     YFR029w PTR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447643.1"
                     /db_xref="GeneID:2888966"
                     /db_xref="GOA:Q6FQ51"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ51"
                     /translation="MEQIRSLQDRILYLPDNRDEDTGEVTYGIVSDAVTLSCACVVSA
                     KLCNQNLKACPVCEKVDIYVIGPCKPLRLLYQELQRIKRDSSKHILTEFKDIDQAATV
                     LHDNDNTTNDNNNDDDISHTNSNMNTNEIDSLLPPITKNLEFFSMMEDQPIADTSNNN
                     ISFPVISSNTGDQSLSDIPTASLLSDTKNSSSDDNNTQSLMHLFHTVAIRVNNKYQDN
                     DKTLSGAIGPTKDKLRYDVPFSSLKEEEDDFRALDNASNTRTVPISLENNSSNFSSTN
                     LANEGNNQYLQFSSLSASKANDSQTNLDHILSGNSAISVDEKRELYYAKCFPMYRKRF
                     QFNTHSKFNFIKSNTSSFINTAISPDCTKFALITDSKWEVYSMPTREDRHSNTPQLLF
                     CGKSNGQYGSNYKELKRSANKKLDHSNSHQSFCRLSNDLLVISGSNNQFRVYNLNGNG
                     EYIHSYKSSFPIRCIDIDPASQIIAYGITGKDRNTGAEQALIAFHQISKNKVTTETEF
                     SEPVTVTLPYRDPINSIQLSNDGKFISCSTALESRFLIISVERPKEPRLLMKSLRTID
                     SSMESEGITDTKLFPGNPNIMCVTSCAFNSPPIVINTRINNKKNGIRTVAQPSMIMRI
                     SELGSQIHKCEISPRNDSIAFLDKNGSVYVMSTPAMMDNEKRRVALVDIVANSHRVYE
                     SASFRFSPDGHQLFIIDRKGILYIEDFAAGQPQDLDVTKCKQID"
     gene            <887985..>888842
                     /locus_tag="CAGL0I09152g"
                     /db_xref="GeneID:2888967"
     mRNA            <887985..>888842
                     /locus_tag="CAGL0I09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447644.1"
                     /db_xref="GeneID:2888967"
     CDS             887985..888842
                     /locus_tag="CAGL0I09152g"
                     /inference="similar to AA sequence:UniProtKB:P38336"
                     /note="similar to uniprot|P38336 Saccharomyces cerevisiae
                     YBR257w POP4 involved in processing of tRNAs and rRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447644.1"
                     /db_xref="GeneID:2888967"
                     /db_xref="GOA:Q6FQ50"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ50"
                     /translation="MDKAQDFINNNLLTKCFNDPKNEIDEGRLLDTLMLLPTDGGSTS
                     RIKKIIEKRTRLHDTKVKNKVPNSEPIDYDKYKQANYKKINKRSKQSLKDFIIKSKLS
                     VNKAKQIAHEKNITKKADLFKYLETNDPELYKDLPKYEKFRPLFSELWISYIQELLNI
                     SYPCQSTEFKANGMQILTKLSMADYNGAALRVTKSKNHNTVGIEGIVVWDAQKNFIMI
                     TSGSLVDEIKIIPKKGTLFDFEIPLNDEQALQYSILGDRFKYRSVDRAGRKFKTRRCD
                     DLLFYVFDS"
     gene            complement(<888910..>889395)
                     /locus_tag="CAGL0I09174g"
                     /db_xref="GeneID:2888968"
     mRNA            complement(<888910..>889395)
                     /locus_tag="CAGL0I09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447645.1"
                     /db_xref="GeneID:2888968"
     CDS             complement(888910..889395)
                     /locus_tag="CAGL0I09174g"
                     /inference="similar to AA sequence:UniProtKB:P38337"
                     /note="similar to uniprot|P38337 Saccharomyces cerevisiae
                     YBR258c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447645.1"
                     /db_xref="GeneID:2888968"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ49"
                     /translation="MDRRTVKQDPARDLTERFKKEGHFDKLKQEILAKTIECGGDSKT
                     IQEALKLSVSDVVRQLVNEDEEIVFKNRGSTSAMLEGQLIKNNYAKIKDSEFGVDVEK
                     FVGEALSDPAIRDEIKRGLVDMTADEKKEEGTDKLNVDANGNNSEKTQEMADNNGEIA
                     T"
     gene            <889696..>891537
                     /locus_tag="CAGL0I09196g"
                     /db_xref="GeneID:2888969"
     mRNA            <889696..>891537
                     /locus_tag="CAGL0I09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447646.1"
                     /db_xref="GeneID:2888969"
     CDS             889696..891537
                     /locus_tag="CAGL0I09196g"
                     /note="weakly similar to uniprot|P38338 Saccharomyces
                     cerevisiae YBR259w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447646.1"
                     /db_xref="GeneID:2888969"
                     /db_xref="GOA:Q6FQ48"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ48"
                     /translation="MKIKQDNAILESSQLLELKTSIARLSESLINGTCIVITQDDIQA
                     ARTIDNIIEDSIIQGDEYLCRIARKQLKKLVEKWIKANFTKSKLRKNSINVFDRYNGV
                     CDLLYSTIRKLKPWKHLNMFLLPYYLMYSLAAVPMAHLIICKSIFKNCFETETLTVKG
                     VFVIKNILQYCDVTDSDRNTIIELGILRLEDILESEGEDQDYFTEYESTMQLGRLMSE
                     NVYKYYFKKGNALMVENFQKILDKSKFEHIKLQVLETLYNDSSKKDFILDTLAKYICS
                     DPLAENISVVLKRYITMSANYYRIDSHNLMSALKDKIKKEILKTYKNRDYEFYDAVQK
                     FCEKMIKMKNESNINLAPSSRAQRNFFASENDMLYWKNLFHRIAELLSDPKIFTERIL
                     MPKLVRQIAFDTLVDRMPFSKKYPAENLFLEVICEIEPHCRHFTNLISRAVDNANIFN
                     HCTETMLFLPLVFPESSRESLSISNMRNDVPCWPSMELANFWQEKVVQKQNEGKTLKP
                     CFSMHTFLIETPISMHDGRKLNLVCNMYVASIICLFNDTSELSVNEIVDTLKTWNYDL
                     DINRLTLTLKRMVQQQILIVLPNKKFSINYKPLLSKRQQKLGYIKIN"
     gene            complement(<891665..>893716)
                     /locus_tag="CAGL0I09218g"
                     /db_xref="GeneID:2888970"
     mRNA            complement(<891665..>893716)
                     /locus_tag="CAGL0I09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447647.1"
                     /db_xref="GeneID:2888970"
     CDS             complement(891665..893716)
                     /locus_tag="CAGL0I09218g"
                     /inference="similar to AA sequence:UniProtKB:P38339"
                     /note="similar to uniprot|P38339 Saccharomyces cerevisiae
                     YBR260c RGD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447647.1"
                     /db_xref="GeneID:2888970"
                     /db_xref="GOA:Q6FQ47"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ47"
                     /translation="MNGSRNTDSTISQPGSAQVKREENLDYLFESEDIKHVMNSDVAI
                     NALLTRLKQSLLICEEFTKFVRKKYIFEEEHTNELAKQYKHFFNTTPSSNSSLNRIMH
                     EVLSYDGKMSQVKSSYVKALQKMYDELTALLFTMTKLRKSCKENSRRLEKEVTDAIHS
                     AEKAQARYNSLCQDWDKLRMTDPSKTKLTLRGSKTNKEQEEELLRKIDAQDLEYKQKV
                     DHSTSLRNTFITKERPKIVRELKDMILEMDTALAIQLQKYTIWTENLILNTGITVSPL
                     DSSKSMKSLAASVSNERDLYQFLKKYNQSGKNSMLVNRNLIPVEYSKHPSMKKSQSSQ
                     RNFSGPKKPPKFAVDPSRNSIPKRILSTHNDTPFDSSPSTPSMTKSGTFTELGVSSVS
                     TAPTSSSSGNIKYQNTSRDQSLPSLPSNVMEKERIPSNSMNSQFSTLDPGPRAKIVPS
                     LSTTISMSGSETDRPISHIQTGSSMPPGVSKNFKSFGVPLEDLIEFENDMVPAIVRQS
                     IYVIDTYGLDLEGIYRKSANVLDVSKLKDEIDKDPANVSMILPPRNHSDSDIYLVGSL
                     LKTFFASLPDALLPRDITAEVKTCVAIEDPTTRKNYMHGLLYKLPDAQYWTLRALLFH
                     LKRVLEHEPTNRMNTKSLCIIWGPTIIAPNDEDRNDVNYQIKAMEVLLDVTDQAFEAE
                     E"
     gene            complement(<894150..>894842)
                     /locus_tag="CAGL0I09240g"
                     /db_xref="GeneID:2888971"
     mRNA            complement(<894150..>894842)
                     /locus_tag="CAGL0I09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447648.1"
                     /db_xref="GeneID:2888971"
     CDS             complement(894150..894842)
                     /locus_tag="CAGL0I09240g"
                     /note="highly similar to uniprot|P38340 Saccharomyces
                     cerevisiae YBR261c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447648.1"
                     /db_xref="GeneID:2888971"
                     /db_xref="GOA:Q6FQ46"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ46"
                     /translation="MEKPDELIDYGDAIDYWTSIPPTVDGVLGGYGEGTVVPVMDVLG
                     SNHFLRKLKSRMVVEPGYKRVGCDVGAGIGRVTKTMLHKHCDVVDLVEPVEPFVAQMH
                     QELEPLRQEGKIGEIYALGMQDFVPEKGKYWLIWCQWCVGHLPDEELVKFFRRCVEGL
                     QPNGTIIVKENNTPTDTDDFDDTDSSVTRSDTKFKQIFEQSGLKLIATDRQKGLPKEL
                     YPVRMYALKPVA"
     gene            complement(<895097..>895441)
                     /locus_tag="CAGL0I09262g"
                     /db_xref="GeneID:2889123"
     mRNA            complement(<895097..>895441)
                     /locus_tag="CAGL0I09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447649.1"
                     /db_xref="GeneID:2889123"
     CDS             complement(895097..895441)
                     /locus_tag="CAGL0I09262g"
                     /note="some similarities with KLLA0F02079g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447649.1"
                     /db_xref="GeneID:2889123"
                     /db_xref="GOA:Q6FQ45"
                     /translation="MSKIAKLGSFTLVSGVVATSCYYYFIDRDGYHYKRSVWKQVGDE
                     VQRVIDRKPSLVFSKEKYGDQFDYDYKVSGERVERVPVDHKQLVLRYNSETMKDLWNK
                     EVRALVDWVYSR"
     gene            <895749..>897206
                     /locus_tag="CAGL0I09284g"
                     /db_xref="GeneID:2889124"
     mRNA            <895749..>897206
                     /locus_tag="CAGL0I09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447650.1"
                     /db_xref="GeneID:2889124"
     CDS             895749..897206
                     /locus_tag="CAGL0I09284g"
                     /inference="similar to AA sequence:UniProtKB:P37292"
                     /note="similar to uniprot|P37292 Saccharomyces cerevisiae
                     YBR263w serine hydroxymethyltransferase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447650.1"
                     /db_xref="GeneID:2889124"
                     /db_xref="GOA:Q6FQ44"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /translation="MMLLRAARVPVLGRRFLSQQQLISKHVQEVDPEMFRILSDERSR
                     QKHSVTLIPSENFTSKAVMDLLGSEMQNKYSEGYPGERYYGGNQFIDKAESLCQARAL
                     DLYGLDPEKWGVNVQALSGAPANLYAYSAVMEVGDRLMGLDLPHGGHLSHGYQLPSGT
                     KISYISKYFNTMPYHVNTETGIIDYDTLAMTSKLFRPKVIVAGTSAYSRKLDYARFRK
                     IADGCGAYLLSDMAHISGLVAANVIDSPFEHSDIVTTTTHKSLRGPRGAMIFYRKGIK
                     KVNKKTGKETPFTFDKTINFSVFPGHQGGPHNHTISALAVALKQAKTPEFVEYQKQVV
                     SNAKAFGDELLKRGFELVSGGTDNHLLLLNLSNMGIDGARLEAILEKINIAANKNTIP
                     GDKSALFPSGLRVGTPAMTTRGFQEQDFKKVAEYIDNAVKLSIALKSQESADAKDVRS
                     KLNSFKQLCDQSEPVQKLAEEVSSWVGTFPVPGEL"
     gene            complement(<897357..>897977)
                     /locus_tag="CAGL0I09306g"
                     /db_xref="GeneID:2889125"
     mRNA            complement(<897357..>897977)
                     /locus_tag="CAGL0I09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447651.1"
                     /db_xref="GeneID:2889125"
     CDS             complement(897357..897977)
                     /locus_tag="CAGL0I09306g"
                     /inference="similar to AA sequence:UniProtKB:P38146"
                     /note="similar to uniprot|P38146 Saccharomyces cerevisiae
                     YBR264c GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447651.1"
                     /db_xref="GeneID:2889125"
                     /db_xref="GOA:Q6FQ43"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ43"
                     /translation="MSETLVYQKSLKVVLLGESAVGKSAIVTRFSTGKYLRNNATIGA
                     AYVTKDLEYIRDGDVYQVRLEIWDTAGQERYRSLTPMYYRNTDVAIVVFDVSNLRSLS
                     MAHKWIDELNTYVENKGRERINIVLVGNKMDLCSDEERSTLPQRVEEQFQAVSAKSGE
                     GIEELFDHIVKGIPSDQFTLKSAAVEQPDNVVNLNNKSVLQSTCNC"
     gene            <898504..>899595
                     /locus_tag="CAGL0I09328g"
                     /db_xref="GeneID:2889126"
     mRNA            <898504..>899595
                     /locus_tag="CAGL0I09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447652.1"
                     /db_xref="GeneID:2889126"
     CDS             898504..899595
                     /locus_tag="CAGL0I09328g"
                     /inference="similar to AA sequence:UniProtKB:P38342"
                     /note="similar to uniprot|P38342 Saccharomyces cerevisiae
                     YBR265w 3-ketosphinganine reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447652.1"
                     /db_xref="GeneID:2889126"
                     /db_xref="GOA:Q6FQ42"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /translation="MFCLEDQVVLIAGGSQGLGKQFGQKYWDESRHSKIILVSRSDVK
                     LRNAITDITGGRQEPVELVMPEVAASEPSASGSSAINLSKSSNHAGFESELRSNSNRS
                     SSSLKESTNVVTHLTTNAADSRIVYIACDLSDPDAVERMFVTLQHNNLLPTQVLACAG
                     GSIPKLFTDLTAKELEMGVKMNYMTTLFVIHKAAQMVPQAHLILFSSSTAFFPFIGYS
                     QYAPAKVSLKALTSILRHELPNTRISCVYPGNFYSEGYVLEEMSKPDITKSIEGSSYP
                     ISCEECCDKIVWWLNRGYDDVTTDSIGWFLMSLDMGLNKHNNNSAYWFVQWLIGVIAN
                     LLVVPFYMVLCSYQINKWHKQNKNKNTLL"
     gene            <899921..>901144
                     /locus_tag="CAGL0I09350g"
                     /db_xref="GeneID:2889127"
     mRNA            <899921..>901144
                     /locus_tag="CAGL0I09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447653.1"
                     /db_xref="GeneID:2889127"
     CDS             899921..901144
                     /locus_tag="CAGL0I09350g"
                     /inference="similar to AA sequence:UniProtKB:P38344"
                     /note="similar to uniprot|P38344 Saccharomyces cerevisiae
                     YBR267w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447653.1"
                     /db_xref="GeneID:2889127"
                     /db_xref="GOA:Q6FQ41"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ41"
                     /translation="MSMYTCNSCELVFETSAFQRQHMKTDWHRYNLKRKVASLPPVSE
                     DNFNSKVQVSQEQAAEEALKKGKNEQLTKKEIRRREKEALLEKKKKLLEIARQNMLAK
                     MQEQGLSQPEPTKQEPVEDVKPEPIVEEAKSEVVKEEEVKEEDLTEEELAERLMKQKL
                     ENRVEIPLNQCLFCTKKREFEDFEANLDHMFRTHGFYIPEQKYLVDKEGLVKYMSEKI
                     GLGNVCIVCNYQGRSLDAVRAHMLDKRHCRIPYESEDERLEISEFYDFSKTYERIDRA
                     NIVSADSASANDDEWEDVDENEDAEEEEGEPPKEYLYHDGVELHLPSGVKVGHRSLQR
                     YFKQDLRPEKELSEGQGTLVAAETRSFLPQFDRGTVRVQQRAWKTEVRDKKRDDKRAA
                     KFVNNQPHYRDQLLQ"
     gene            <901576..>901887
                     /locus_tag="CAGL0I09372g"
                     /db_xref="GeneID:2888927"
     mRNA            <901576..>901887
                     /locus_tag="CAGL0I09372g"
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /transcript_id="XM_447654.1"
                     /db_xref="GeneID:2888927"
     CDS             901576..901887
                     /locus_tag="CAGL0I09372g"
                     /inference="similar to AA sequence:UniProtKB:P36532"
                     /note="similar to uniprot|P36532 Saccharomyces cerevisiae
                     YBR268w MRPL37"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL37"
                     /protein_id="XP_447654.1"
                     /db_xref="GeneID:2888927"
                     /db_xref="GOA:Q6FQ40"
                     /db_xref="InterPro:IPR013870"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ40"
                     /translation="MLRLLFTKRLLSSSVVLRNEAKQIKSSCLAGTPLSLNVKKTGKD
                     PVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQ
                     L"
     gene            complement(<902099..>902500)
                     /locus_tag="CAGL0I09394g"
                     /db_xref="GeneID:2888928"
     mRNA            complement(<902099..>902500)
                     /locus_tag="CAGL0I09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447655.1"
                     /db_xref="GeneID:2888928"
     CDS             complement(902099..902500)
                     /locus_tag="CAGL0I09394g"
                     /inference="similar to AA sequence:UniProtKB:P38345"
                     /note="similar to uniprot|P38345 Saccharomyces cerevisiae
                     YBR269c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447655.1"
                     /db_xref="GeneID:2888928"
                     /db_xref="GOA:Q6FQ39"
                     /db_xref="InterPro:IPR012875"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ39"
                     /translation="MLRHNRHLFSAVARSSVLISRPVAIRCINTERIPSPPKLPREEQ
                     EEFERLQRIAHSQEAIDEYNRKIKGDHTKESLNNEMLTKNDIGSFSPEFSKTIPEFEG
                     DVNPKTGEIGGPKQDPLKHGDYSFNGRVTDF"
     gene            complement(<902881..>904578)
                     /locus_tag="CAGL0I09416g"
                     /db_xref="GeneID:2888929"
     mRNA            complement(<902881..>904578)
                     /locus_tag="CAGL0I09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447656.1"
                     /db_xref="GeneID:2888929"
     CDS             complement(902881..904578)
                     /locus_tag="CAGL0I09416g"
                     /inference="similar to AA sequence:UniProtKB:P38346"
                     /note="similar to uniprot|P38346 Saccharomyces cerevisiae
                     YBR270c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447656.1"
                     /db_xref="GeneID:2888929"
                     /db_xref="GOA:Q6FQ38"
                     /db_xref="InterPro:IPR013745"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ38"
                     /translation="MQDTQSDQKSNETKHLGSGRFSRYGIGGLSSTASFQSVRNRATS
                     SVSRDSQLSEPHSNVSRVYNVSSDIVPQALTHPDEESNAKGKLSGNTEIGSAPRWSQV
                     GFQSIFQGNSNSIKRRDSNDSFSEEIKFQKLRNAASVDTFDYRNDDSKITEEEPYQDS
                     LFSGHSGKSKEKRRISLFSNNRDNNNALLKAERKSGLFKTKSNKSSSSLNTQLLKSPD
                     STKTKSNPFRKIANKLLSTKNHRAIGNDDLEAAQNSFSKFLHSSYGKHRASSQFIHSA
                     AGGLMDSSRSVHSFSPSVANLPNDAPMSINISNDMVDSANVAMLHDLLKNLPSLEANY
                     KNFTTQELHILAGNVWGIYCGVIIELFKMQRVWQLPAKIEDINRILDFYITIKTESKA
                     AVSHKKFLTEIEEFLTTSLYIFENQIVFNYSNEETMNTALKRVGVIWQVFYQQVYFDV
                     ISVLLPIERITKKFSRYSSTNQDERKHSYLTIDYMLLKCFRDSVILPYYQNFIHSNDG
                     ARKSFQQYIFNEEEESGVTERDKLTLLQCFGILETIQGNDRSQIIIDELLEGVRMSI"
     gene            <904886..>906106
                     /locus_tag="CAGL0I09438g"
                     /db_xref="GeneID:2888930"
     mRNA            <904886..>906106
                     /locus_tag="CAGL0I09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447657.1"
                     /db_xref="GeneID:2888930"
     CDS             904886..906106
                     /locus_tag="CAGL0I09438g"
                     /inference="similar to AA sequence:UniProtKB:P38347"
                     /note="similar to uniprot|P38347 Saccharomyces cerevisiae
                     YBR271w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447657.1"
                     /db_xref="GeneID:2888930"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ37"
                     /translation="MFDPLDLYTAEPPTVDDSLVITDHSVAGTDCDKQFANDVEEDED
                     YIVDILDLPPCSLAPPQVILIVLILLRPREQLNFANNDDNKEDIPLELDNNDEPMLND
                     LVQWYTINWPHEKLNTKDKLLRNIPRTTSIVSHESLLKFYTSVLQYYSKAEATKDSNE
                     YVKRILKEVSLRIAENCGRTAQPAIQRKFRIKNLDKTIMLHEPSLTADNLGWKTWGSS
                     LILGEIVVSYLENLSSTFESNRKVRTLELGAGTGLVGIAWAAKWRDKFCNSKTEIYLT
                     DLPEIVDNLKDNVKINNLQDIATADVLDWTNPDTFTEKYGNERFDYIVIADPIYSPQH
                     PEWVVNMIVKFLEVNGICHLEIPLRERYSKERDYLWRLLEEHNLDVVHEIYSSGKDDW
                     GKVDYVYKMLKFKA"
     gene            complement(<906191..>907636)
                     /locus_tag="CAGL0I09460g"
                     /db_xref="GeneID:2888931"
     mRNA            complement(<906191..>907636)
                     /locus_tag="CAGL0I09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447658.1"
                     /db_xref="GeneID:2888931"
     CDS             complement(906191..907636)
                     /locus_tag="CAGL0I09460g"
                     /inference="similar to AA sequence:UniProtKB:P38348"
                     /note="similar to uniprot|P38348 Saccharomyces cerevisiae
                     YBR272c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447658.1"
                     /db_xref="GeneID:2888931"
                     /db_xref="GOA:Q6FQ36"
                     /translation="MEQVFLEINEKLPGLLTTGGSDATFAESSKLIERCNLALISFTG
                     TPTAVMDDTIKLMKSILASNESYNIDYDQLMDLMSQMVIKYPFDRILELFTVEELALA
                     LNSPIERLNIMTCVVVEYSEPSGLFASTTLIDILLQKYLDEDSSVNLVNSIEKVWKKT
                     AQDELIRRRILENNYNFLSEVKNNEPNSLVFTRLLELLKICFTYLKSTEFRNSLFLIS
                     KKMIMDAVKDNILVFISICEYFTSIFSIVQDQKSQNPSKIICVRNCENTIMLFGDLFQ
                     NRSEFPDIEQFALSYLFKMFKILSYFDDLIVFEKLDNGYIHIEDGNEYLTDFLSFISP
                     QYLYKKHLNIIKSKGHVRPSEISIIRNLCMSSDCFDIIKKNITAEDILAMPYLEQMIL
                     LEKMSQYDYSVKFLAQHLPKVMGSLISKDVKELLDRETFDFRLQVINNLIEWDVEQLH
                     IWYEPLTEAKAQCMGTFASKDVGTKIESSFS"
     gene            complement(<907969..>909258)
                     /locus_tag="CAGL0I09482g"
                     /db_xref="GeneID:2888932"
     mRNA            complement(<907969..>909258)
                     /locus_tag="CAGL0I09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447659.1"
                     /db_xref="GeneID:2888932"
     CDS             complement(907969..909258)
                     /locus_tag="CAGL0I09482g"
                     /inference="similar to AA sequence:UniProtKB:P38349"
                     /note="similar to uniprot|P38349 Saccharomyces cerevisiae
                     YBR273c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447659.1"
                     /db_xref="GeneID:2888932"
                     /db_xref="GOA:Q6FQ35"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ35"
                     /translation="MDALFGLNVEDAVARSLRERKTLVVYNKPQDGNEDWVSWLAEHS
                     DEYPRLMEKGVWLKLTSGSDQFQQFEQIFPNVIVPSLYLIRDGKIVLIIQKQDDNPSL
                     SHWKKLLIGLGLPLEQHSNEDRGLKKKDPQNIDGKTEKDKILEKSNQIQRKEYEKQLR
                     AAEEERLRILKLVRADKAERLARSQHGNATEEKELPLEVKDNIKDRQKFHTDTCVLMF
                     RLTDSKTITHTFDSKNTLNDVRKWVDSNRTDGSVPYSFHRNIPRVTFQDSDELKTLDE
                     LDLAPRSVLVLKALSSTTTHLNVSEEQGPGLISKMFTGLSSWWGNSDSTTPLEHSRIP
                     ENSFNDASTSQINASMVRENTHAEADTNSKLASPIIAPSVSRLKKEPSEMNLTSRSVS
                     PNIFKFVNNDDNEDDQQEKDTYNGNNVKLEKNRDQSD"
     gene            <909589..>911175
                     /locus_tag="CAGL0I09504g"
                     /db_xref="GeneID:2888933"
     mRNA            <909589..>911175
                     /locus_tag="CAGL0I09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447660.1"
                     /db_xref="GeneID:2888933"
     CDS             909589..911175
                     /locus_tag="CAGL0I09504g"
                     /inference="similar to AA sequence:UniProtKB:P38147"
                     /note="similar to uniprot|P38147 Saccharomyces cerevisiae
                     YBR274w CHK1 regulats inhibitory Cdk phosphorylation of
                     PDS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447660.1"
                     /db_xref="GeneID:2888933"
                     /db_xref="GOA:Q6FQ34"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ34"
                     /translation="MVFTQESLPVIKDVELGGTIGEGSFGCVRSARLKFDSSVVVAVK
                     FVHLPTCAESGLSQKDVSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDL
                     FDKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFG
                     LASQFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIP
                     WSIPAKEDDNYEWFVNNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVSLEKLRHHP
                     WLTSRSKLANSEGLCNNPDVLAKKLLGKLRVSLSNETYNKFTQDNTLFETGPMKFRAT
                     QPVEGDIAHLEHDSMRTLDDKLTEKAFTQVITDKTSETTSNWDNRINRWTQYMNKEQA
                     VYQFIDDDHPSQHINQTLRFSPNKLTKFFTVQDMDIVLPTLEDALIYSGIRIRDHLID
                     VYERLCKSMSDPKVFPLIINIKSTDRRGGILTGSVTIDEIEDKFRCINFEKRTGDPLE
                     WRRLFKRIAVLCRDIILIPN"
     gene            <911397..>912287
                     /locus_tag="CAGL0I09526g"
                     /db_xref="GeneID:2888934"
     mRNA            <911397..>912287
                     /locus_tag="CAGL0I09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447661.1"
                     /db_xref="GeneID:2888934"
     CDS             911397..912287
                     /locus_tag="CAGL0I09526g"
                     /note="weakly similar to uniprot|P52868 Saccharomyces
                     cerevisiae YGL128c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447661.1"
                     /db_xref="GeneID:2888934"
                     /db_xref="GOA:Q6FQ33"
                     /db_xref="InterPro:IPR001623"
                     /translation="MSDVVKTVIGQRLDLYKLLELNYKDYKGNDDAATTHSLKKQYRK
                     LSLRYHPDKNPGPEYIDRFHLLNLAITVLADPAKKAEYDQWVAQYLYPDNGLSEAEQT
                     RREALVQKLNASERKVREDNQGGNVADIGKIQNYGEKLRRMAHFGLGFGDWRNLDEHI
                     SRATTNTIEDSTTDKEVCTLRAVFDFQSIENISDPNNLRRYMNEVFPEYMYDIDEIRY
                     SSNNVYDGEEDIVVYIVLKDPIKTGRLYHQIKRNPPDAFVEIEPYISPKLFESFSKEI
                     PLNDHVKNLLRGVPEVIDLD"
     gene            <912614..>913912
                     /locus_tag="CAGL0I09548g"
                     /db_xref="GeneID:2888935"
     mRNA            <912614..>913912
                     /locus_tag="CAGL0I09548g"
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /transcript_id="XM_447662.1"
                     /db_xref="GeneID:2888935"
     CDS             912614..913912
                     /locus_tag="CAGL0I09548g"
                     /inference="similar to AA sequence:UniProtKB:Q01163"
                     /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
                     YGL129c RSM23"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /protein_id="XP_447662.1"
                     /db_xref="GeneID:2888935"
                     /db_xref="GOA:Q6FQ32"
                     /db_xref="InterPro:IPR017082"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ32"
                     /translation="MGAAVRAAAPARGKSQGFAKKTGTSSGFTRKKISPGSLYKNWTD
                     TVHTARLNSNAVNLNLPIMKSQDISENLNKVTYFADTTYKTLHHLGSFRKDQRNELFP
                     KPISLVRESTTKKLIDELKNGTSKKLIITGEPGVGKSVLLSQVHAYGLESNMLLINIS
                     YPESFLNGRNDFMFDESLKLYTQPMYTKELIRKILKANKPEVLEKIPLTKNYKFTGAN
                     SKDSGHTATIQLKEGQHTLSNLLSVKANPQNVGIQFQAVMEELLAQEKVPVLFTIDNF
                     SRFLTKAYTDYRNVKNQQIYSLQFQLGKTIMDIISGDSRFKNKRSAFVAAISGVDRTN
                     KTLPVGLGKLEEDPYVTRYHYEKKFADLLKRGRVEEFEVPKWSKEEIRTLINFYRDSG
                     IISGKELDSKTPEQYTDEKYFVSGNGNPRELLKSIALSYR"
     gene            complement(<914062..>915411)
                     /locus_tag="CAGL0I09570g"
                     /db_xref="GeneID:2888936"
     mRNA            complement(<914062..>915411)
                     /locus_tag="CAGL0I09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447663.1"
                     /db_xref="GeneID:2888936"
     CDS             complement(914062..915411)
                     /locus_tag="CAGL0I09570g"
                     /note="highly similar to uniprot|Q01159 Saccharomyces
                     cerevisiae YGL130w mRNA guanylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447663.1"
                     /db_xref="GeneID:2888936"
                     /db_xref="GOA:Q6FQ31"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /translation="MDARISPEIPGIIQPGNVTQDLKMLVCKLLNSPKPSKTFPGSQP
                     VSFQHSDIRDKLVAQDYYVCEKTDGLRVLMLVVVNPITGEQGCFMIDRENNYYLVNGF
                     HFPRLPQKKKEELLETSQNGTLIDGELVIQKNPMTKLQELRYLMFDCLAINGRSLVQS
                     PTSSRLAHLGKEFYKPYYDLRSIYPDKCATFPFKLSMKHMDFSYSLVKVANSLDKLPH
                     LSDGLIFTPVRTPYAVGGKDSLLLKWKPEQENSVDFKLILEIPMTEDNSVAKKDPRRW
                     YYNYDAKPTFALYVWQGGSDVNTKLQNFEQPFDKREMQVLEKTYKRFAELSISDEQWQ
                     ELKNLEEPLNGRIVECTKDPETGSWTMLRFRDDKLNGNHTSVVQKVLESISDSVTIDD
                     LAESVPEIKSAWDERKNGAYQHHSSSFSESRQQPKAEPVAEKKQTEPKYVDDDDWSD"
     gene            <916388..>917566
                     /locus_tag="CAGL0I09592g"
                     /db_xref="GeneID:2888937"
     mRNA            <916388..>917566
                     /locus_tag="CAGL0I09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447664.1"
                     /db_xref="GeneID:2888937"
     CDS             916388..917566
                     /locus_tag="CAGL0I09592g"
                     /note="highly similar to uniprot|P07258 Saccharomyces
                     cerevisiae YOR303w CPA1 arginine-specific
                     carbamoylphosphate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447664.1"
                     /db_xref="GeneID:2888937"
                     /db_xref="GOA:Q6FQ30"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /translation="MSQATFEIKNGPSFSGYSFGADKSISGEAVFTTSLVGYPESMTD
                     PSYRGQILVFTQPLIGNYGVPSMEARDEYNLLKHFESSHIQVAGIVVADYAAQYSHWT
                     AVESLGDWCKREGVAAITGVDTREIVQYLREQGSSQSRILVEGSDTPKFYDSMATHLV
                     AEVSTKETLYVPAKNPVANIAVIDCGVKVNIIRSLVARGANVTIFPHNARIQDVAGQF
                     DGVFLSNGPGNPETCHETIENLKELLANEDLQQLPIFGICLGHQLLALASGGKTHKLQ
                     YGNRAHNIPAMDLTTGQCHITSQNHGYAVDPQTLPQEEWKPYFINLNDQSNEGMIHTT
                     RPIFSTQFHPEAKGGPLDTMPLFDKFFNNIECYKTHLSQSSYRMVSQIPAIDKKEIMA
                     "
     gene            <917977..>921096
                     /locus_tag="CAGL0I09614g"
                     /db_xref="GeneID:2888938"
     mRNA            <917977..>921096
                     /locus_tag="CAGL0I09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447665.1"
                     /db_xref="GeneID:2888938"
     CDS             917977..921096
                     /locus_tag="CAGL0I09614g"
                     /note="highly similar to uniprot|Q08773 Saccharomyces
                     cerevisiae YOR304w ISW2 or uniprot|P38144 Saccharomyces
                     cerevisiae YBR245c ISW1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447665.1"
                     /db_xref="GeneID:2888938"
                     /db_xref="GOA:Q6FQ29"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ29"
                     /translation="MTSEVYTVADRPKEYWDKRKAKFILADDPKVAKQKDSGDTYNRF
                     KYLLGLTDLFRHFMSLKAKNDKNIQKLLKTLDAESSAKSGKADPGSRHHRKSEKEEDA
                     ELMAEEEAEVDEEDDLNFVTESPSYIQSGKLRDYQIQGLNWMISLHENKISGILADEM
                     GLGKTLQTISFLGYLRYVKKIEGPFLVIVPKSTLDNWRREFFKWTPNVSTTVLQGTKE
                     QRQDILQNIVLEARFDVLITSYEMVIREKGYLKRLAWEYIVIDEAHRIKNEQSALSQI
                     IRLFYSKNRLLITGTPLQNNLHELWALLNFLLPDVFGDSEVFDDWFQQNNSDQDQEVV
                     VQQLHAVLNPFLLRRIKADVEKSLLPKIETNVYVGMTDMQVQWYKSLLEKDIDAVNGA
                     VGKREGKTRLLNIVMQLRKCCNHPYLFEGAEPGPPYTTDEHLIFNAGKMIVLDKLLKR
                     LKEKGSRVLIFSQMSRLLDILEDYCYFRNYNYCRIDGSTSHEERIDAIDEYNKPNSEK
                     FVFLLTTRAGGLGINLVTADTVVLFDSDWNPQADLQAMDRAHRIGQKKQVHVYRFVTE
                     NAIEEKVLERAAQKLRLDQLVIQQGSGKKTANLGNSKDDLIEMIQYGAKNVFEKNGTT
                     ISVDADIDEILKKGEAKTHELNARYEALGLDDLQRFNGMENQSAYEWNGKTFEKKAKD
                     TVTEWINPSRRERRREQTTYSVDDYYKDIIGGGSKSNKGTPQPKLPKAPKVTHGQDYQ
                     FFPKEFYELQEKEQLSYKKKINFKVTSSDVSIETEEDDEEGEKQLTSKEKKALTDAKI
                     KEEQEKIDNAPDFTDEDELEKQRMLDTAFTNWNRRDLLSFISACAKFGRSNMNKIKYA
                     IDSKTPEEVEEYAKVFWERYTEINGYEKYINSIENGERKLAKLEFQEQLLNEKLDQYN
                     YPFYELSIQYPPNNARRTYNTMEDKFILMTVRKYGLRAERLYEKIKQDIMESDLFKFD
                     WFIRTRSIHELSKRVTTLLTLITREFDNPDARKKRSRPGTKEDMDGLDEGTENPDHME
                     KKPKLPSSA"
     gene            complement(<921232..>923436)
                     /locus_tag="CAGL0I09636g"
                     /db_xref="GeneID:2888939"
     mRNA            complement(<921232..>923436)
                     /locus_tag="CAGL0I09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447666.1"
                     /db_xref="GeneID:2888939"
     CDS             complement(921232..923436)
                     /locus_tag="CAGL0I09636g"
                     /note="some similarities with uniprot|Q02555 Saccharomyces
                     cerevisiae YMR239c double-stranded ribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447666.1"
                     /db_xref="GeneID:2888939"
                     /db_xref="GOA:Q6FQ28"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ28"
                     /translation="MVTRNSKSHRRRTTRAPNQTPQGRSKDGRRDRSSRARDRRSRTT
                     GQSTRSRRRDSNSSSQLKDNRRRKLPRNTRNKVHVADYSDISDNSDDDLQISGMTTLA
                     ESNNPSIAKYNEFYSYSTVIELEQAVTEMVNAYEKIIKMAPDIETYWKVLENKSDLPI
                     GIMPAFSRYQLKLASEVKTLQESKAYPFLSTILQYKQLYKPDSIEPIFEELIMEEDEE
                     VEDSFSDNEGNEENTNIEITESKSNQECTSPILNKNKTVNRIDQKDKNYSNNIHGDDL
                     PGYESNDSTSSNTDSDSNEYSVIDISSEEEDDHIQASSSKEHLPTTTDYQSRLDTNDN
                     HKSPQQSSNEVEEKEGDDDIIVLAENGNPISGLRINNPAAIQSNSTEMSLIAHPENEQ
                     NTKPQVTNGIISSQDIIFSSIIDKWPPPIPEIKNEAIKARVFIHQSALSGQSYLTEEE
                     KIKNSYERLEFLGDSVINSIMTTIIYKSFPNYDAGQMTRLRVLLVSNRRLEKWAYLYG
                     LQKHLLIRKSILNEMLNSGSKVYKIYADLFEAYVGGLVEDDPTGNMPKIRDWLSTLAE
                     EAIKTISDKNALPGTDNNINMNAKTQLEKLLAPVGLEAQYVITNRRSSKKSPFTVIEC
                     RVANGQVTGIGKGRNYKIAEQIAAGNILEKKWLLDKLLERFGSGQSNGSQSETTERKQ
                     NEIKDEAIGKFRPDIIRESSNLSNDRNPDGFAHQYFSSRKTSDDKKEKSYYI"
     gene            complement(<923833..>924090)
                     /locus_tag="CAGL0I09658g"
                     /db_xref="GeneID:2888940"
     mRNA            complement(<923833..>924090)
                     /locus_tag="CAGL0I09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447667.1"
                     /db_xref="GeneID:2888940"
     CDS             complement(923833..924090)
                     /locus_tag="CAGL0I09658g"
                     /inference="similar to AA sequence:UniProtKB:O14468"
                     /note="similar to uniprot|O14468 Saccharomyces cerevisiae
                     YOR304ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447667.1"
                     /db_xref="GeneID:2888940"
                     /db_xref="GOA:Q6FQ27"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ27"
                     /translation="MSNAASSDQINQIQTEEPLQNIPTNTTTNKTTESNAATNNVITM
                     FDIVSEIEGLLKNVQKQMTDNDAQFQKSITAIEDKLRTLQR"
     gene            <924324..>925085
                     /locus_tag="CAGL0I09680g"
                     /db_xref="GeneID:2888941"
     mRNA            <924324..>925085
                     /locus_tag="CAGL0I09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447668.1"
                     /db_xref="GeneID:2888941"
     CDS             924324..925085
                     /locus_tag="CAGL0I09680g"
                     /inference="similar to AA sequence:UniProtKB:Q08774"
                     /note="similar to uniprot|Q08774 Saccharomyces cerevisiae
                     YOR305w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447668.1"
                     /db_xref="GeneID:2888941"
                     /db_xref="GOA:Q6FQ26"
                     /db_xref="InterPro:IPR018828"
                     /translation="MIRHSCRALRFVRSFHDYNSDILKFVASNTLISDSAVYKGKLYE
                     LTVQRELYNKLRIGQLDVVGGAHDGGVDIKALWNLFPIFQCALDAGVIKEPSLPLKGT
                     RINDTLVKPLVNQYDIKNKIAPSIEVLVQCKAYVSKISPKEIRELAGTYLSLTAKNKA
                     SLSTIPIMCSPQLPTSSSLKLLEKLNIPFLYLRINTLRHGSLNDFELTNTGQLMGYLM
                     NPILKGYLEGSGFEEWMKFELYNNAMNHSQDKDFI"
     gene            complement(<925383..>926948)
                     /locus_tag="CAGL0I09702g"
                     /db_xref="GeneID:2888942"
     mRNA            complement(<925383..>926948)
                     /locus_tag="CAGL0I09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447669.1"
                     /db_xref="GeneID:2888942"
     CDS             complement(925383..926948)
                     /locus_tag="CAGL0I09702g"
                     /inference="similar to AA sequence:UniProtKB:Q08777"
                     /note="similar to uniprot|Q08777 Saccharomyces cerevisiae
                     YOR306c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447669.1"
                     /db_xref="GeneID:2888942"
                     /db_xref="GOA:Q6FQ25"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ25"
                     /translation="MCPAHDMESLEMDSLPSVLQGASSSDVGATNGVVYNHRDGYQYK
                     KGESSEIDDYLSRQLTAKMEEESDSESEDTDVPDSHNKMDDEKLLYQFDDIDDFPEGG
                     FKAWTNVLGCFLGLTACFGTLNATGVIEDHIQKYQLSDVKTSTIGWIFSLFLFINYSC
                     CIFSGTYFDRNGYRDPVILGTVLHVAGLIATANCTKVWHFILAFSIVCGFGNGILIAP
                     LVAVPAHYFCRRRGTAVACATIGGSIGGVIFPIIVRKFYALKSDTDPNFGYAWGMRTW
                     ALIDLFLLSLSLLLAKERLPHVVEPEKYQNESKFQRIMRVYIRQSCDLKGFLDMKYLF
                     CVSGTVLGEICLCSTITYFASYSTAHGLSESDAYMFIMVINALGIPGRWLPGYFSDWI
                     GRFNIAIITIFSLSIVILVGWLPFGNTLANMYVISALYGFFSGSILSLLPVCCGQISK
                     TEEFGKRYSTMYLGVAFGNLIFIPVTGAIIGNESLTGYRNFVIFCGVASILSALCFII
                     SRHFCVGFRFVKF"
     gene            complement(<928113..>929606)
                     /locus_tag="CAGL0I09724g"
                     /db_xref="GeneID:2888943"
     mRNA            complement(<928113..>929606)
                     /locus_tag="CAGL0I09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447670.1"
                     /db_xref="GeneID:2888943"
     CDS             complement(928113..929606)
                     /locus_tag="CAGL0I09724g"
                     /inference="similar to AA sequence:UniProtKB:Q08777"
                     /note="similar to uniprot|Q08777 Saccharomyces cerevisiae
                     YOR306c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447670.1"
                     /db_xref="GeneID:2888943"
                     /db_xref="GOA:Q6FQ24"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ24"
                     /translation="MAFDSDVISVDKKAKGSSSEGNYLTRERTHQKDNETDSESDSED
                     IATVVRSNDSSDVESNYEEKPLNYSDVDDFPEGGLRAWTTVIGCFCGLVACFGLLNAS
                     GVVEDHVQQYQLANENPSTIGWIFSVFLFINFSSCIFSGTYFDRNGFRNPVILGGILH
                     VAGLIATANCTKVWHFILAFSIVCGFGNGILIAPLVSVPAHYFNKRRGTALACATVGG
                     SVGGVIFPVILRKFFTMKSTSDPNYGFVWGLRAWGLIDLFLLVIAVLMAKERLPNVVL
                     TEEEKSVPTWKRVLKIYFMESFDAKAFLDMKYLFCVIGTVIGEFSLCATITYFASYST
                     AHGISESDAYMLIMVVNLVGILGRYIPGYLSDVIGRFNVAIITICGLGIVMLVGWLPF
                     GTNLKNMYVISALYGFFSGSIFSLLPVCCGQISKTEEFGRRYSTMYFVVAFGTLIAVP
                     VTGAIIGNESLQSYQHYVIFCGVTTLLCAVSFVISRYYCVGFKLVKF"
     gene            complement(<931000..>932391)
                     /locus_tag="CAGL0I09746g"
                     /db_xref="GeneID:2888944"
     mRNA            complement(<931000..>932391)
                     /locus_tag="CAGL0I09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447671.1"
                     /db_xref="GeneID:2888944"
     CDS             complement(931000..932391)
                     /locus_tag="CAGL0I09746g"
                     /inference="similar to AA sequence:UniProtKB:P22215"
                     /note="similar to uniprot|P22215 Saccharomyces cerevisiae
                     YOR307c secretory pathway protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447671.1"
                     /db_xref="GeneID:2888944"
                     /db_xref="GOA:Q6FQ23"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ23"
                     /translation="MIQTQHITTTKRRGSLHKNLFDPEVVNIPSPKSYNYAGKREYRG
                     SSARNGLLYTINPREQFLSSLIGEEQWEYLHESFTSGLAYIQQTLSSRSKLQIPLLCL
                     VWYVVSSISSNLCRTILKGFPHPVALTEIQFLFTAILCTSFISLINYYERPRRHHSGL
                     SHWVRMFPEGTFPEYLDGDFHNSIVNKFLKPSALAMQCCLPLGIFQFVGHISTHKATS
                     MIPVSLVHSMKALSPIVTVGYYRLVEQKQYTRATYTSLCAIVAGVICTCFSGKSKSNR
                     EPHYYQGLLFALLSMAIFVAQNIFAKGVLTHKSSKSAKSVRGARGANSKPDKGQLDKI
                     TILLYCSCIGFVLTLPVLLSSMLFSSAVTTTYHPFFKLVALLLLHNVAHFLQAMLAFQ
                     LIGLLSPVNYSVANIAKRIVVICVALLWESKHSPAGLLGVAVTMAGLYGYDRARSETP
                     GLRHPPQNKYTAT"
     gene            complement(<933082..>934608)
                     /locus_tag="CAGL0I09768g"
                     /db_xref="GeneID:2888945"
     mRNA            complement(<933082..>934608)
                     /locus_tag="CAGL0I09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447672.1"
                     /db_xref="GeneID:2888945"
     CDS             complement(933082..934608)
                     /locus_tag="CAGL0I09768g"
                     /inference="similar to AA sequence:UniProtKB:Q12420"
                     /note="similar to uniprot|Q12420 Saccharomyces cerevisiae
                     YOR308c component of U4/U6.U5 snRNP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447672.1"
                     /db_xref="GeneID:2888945"
                     /db_xref="GOA:Q6FQ22"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ22"
                     /translation="MAEEISLSLEETNALRIKLGLKPIPKTEDNKQSIQPSEYVHKSP
                     ETQSQVKNNNSGSKKYRFVDERLLNKLRNRIASVSHNPKSSTSTNDDWLTNINKGNTK
                     SEVKLPKVQINYDVDEVQDDLPIVQVANNLEELKSGQSITLTLKESSITEEDDIDTLQ
                     VDHKHDEEQNATNLKQRHDKKKPLRSITALEEQGTDIDKPGKLISVGALNRIDNDTEN
                     DINKESISIDTSNKVKVTFDSDDDQTESSDFKRPRIKKRKRKQDTTLSRKRMNRDHEV
                     ELSSIDFTLDTNINMEELDEDITITPIVKPAVMKSADEIAEEIRRAKIERERREEEIR
                     RLQGQNERTLTISETADFFDTLKDNILTEPETSELPSHTDETSQDKEEEHIVQENGTS
                     PSEEIATSEVHTAEPVQEEDKPDFYNGLASTLSFLKSHNVLPKERNSKSTGTKRKDST
                     RLEYRDDEGNLLTTKEAYKQLSQKFHGTKSNKQKAAKAKAKIRARNNDTSTDYTDFHV
                     "
     gene            complement(<935016..>936557)
                     /locus_tag="CAGL0I09790g"
                     /db_xref="GeneID:2888946"
     mRNA            complement(<935016..>936557)
                     /locus_tag="CAGL0I09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447673.1"
                     /db_xref="GeneID:2888946"
     CDS             complement(935016..936557)
                     /locus_tag="CAGL0I09790g"
                     /note="highly similar to uniprot|Q12499 Saccharomyces
                     cerevisiae YOR310c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447673.1"
                     /db_xref="GeneID:2888946"
                     /db_xref="GOA:Q6FQ21"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /translation="MSYVLTETSAGYALLKASDKKIYKSSSLIMDLDSSEKVLKEFKI
                     AAFSKFNSAANALEEASAIIEGKVSPQLEKLLDEIKKEKKATLIVSETKLANAINKLG
                     LNFNVVSDAVTLDIYRAVKEYLPDLLPGMSDSDLSKMSLGLAHSIGRHKLKFSADKVD
                     VMIIQAIALLDDLDKEVNTYSMRCKEWYGWHFPELAKIVTDSVAYARLILTMGVRSKA
                     AETDMSEILPEEIEERVKAAAEVSMGTEITDVDLINIRALADQIVEFAAYREQLSNYL
                     SSRMKAIAPNLTQLVGELVGARLIAHAGSLISLAKSPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQASGRNKGKIARVLAAKAAVALRYDALAEDRDDSGDIGLEVRA
                     KVENRLSQIEGRDLRTTPKVVREAKKVEMTEARAYNADADTAAAADSDDEDEETEEKA
                     DKKRKRDTEEEEEEEETESKKSKKEKKEKKEKKDKKEKKEKKEKKDKKEKKEKKEKKE
                     KKSKK"
     gene            complement(<937195..>938040)
                     /locus_tag="CAGL0I09812g"
                     /db_xref="GeneID:2889272"
     mRNA            complement(<937195..>938040)
                     /locus_tag="CAGL0I09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447674.1"
                     /db_xref="GeneID:2889272"
     CDS             complement(937195..938040)
                     /locus_tag="CAGL0I09812g"
                     /note="highly similar to uniprot|Q12382 Saccharomyces
                     cerevisiae YOR311c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447674.1"
                     /db_xref="GeneID:2889272"
                     /db_xref="GOA:Q6FQ20"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ20"
                     /translation="MSHSQSNSNSDSNIKNRKRTGSRVDPMYDAKNPKYKHAEDIHLP
                     VTEIHLKSHEWFGDFITKHEIPRKLFHSSIGFITLYYYTKGVDYRLVNPFLIVGFVTV
                     FVLDCIRLNWPFFNFLYCRVVGALMRKKEIHTYNGVLWYLLGLIYSFTFFSKDVILIS
                     LFLLSWSDTAASTIGRRYGYLTPKITKNKSLAGSLAAFVVGFLTCLSFYGFFVPHYNW
                     ANKSGEIMWTPETSRLGLYQISFLGGFVASLSEGVEIFNWDDNFTIPVLSSIFMNAVI
                     KFFRI"
     gene            complement(<938648..>939751)
                     /locus_tag="CAGL0I09834g"
                     /db_xref="GeneID:2889273"
     mRNA            complement(<938648..>939751)
                     /locus_tag="CAGL0I09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447675.1"
                     /db_xref="GeneID:2889273"
     CDS             complement(938648..939751)
                     /locus_tag="CAGL0I09834g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447675.1"
                     /db_xref="GeneID:2889273"
                     /db_xref="GOA:Q6FQ19"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ19"
                     /translation="MICSLCPAPPDDNINIDANGNNGNAERRKRRFSLRSKSHAVQQN
                     IVLPGNINPSNDNNATQNEVDAAAVLPDPVNAINNVTLKYKTVQHITAIPFINRFDEG
                     RLAGRFEECAERFLNSRVMINLAPITTKIDRLIDKLMTITESLIPCLRPDEEVEFPRP
                     PLDEDTERNRNGHNFIVASVVPEGQSIVAPKNVRKLGGRKACILIRTNANAKKDKIKI
                     RQLGRTEQTDKIISMITNSTVIPGVDNNQNLVRISNFDGGNVVIAEDESLRCFEVIYF
                     LINSTNEILMTFIDSQSLIYAAVIGRMTDITSVIEGKLYPLKKCIMNILNKPLDEPEA
                     IHPVITIPPVDGGNGNNEDIEGNIPQQPLRPIE"
     gene            <942327..>943151
                     /locus_tag="CAGL0I09856g"
                     /db_xref="GeneID:2889274"
     mRNA            <942327..>943151
                     /locus_tag="CAGL0I09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447676.1"
                     /db_xref="GeneID:2889274"
     CDS             942327..943151
                     /locus_tag="CAGL0I09856g"
                     /note="some similarities with uniprot|Q12507 Saccharomyces
                     cerevisiae YOR315w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447676.1"
                     /db_xref="GeneID:2889274"
                     /db_xref="GOA:Q6FQ18"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ18"
                     /translation="MEDICLTPNGKLVRASVCPETPNKKRKRLPDPCPGAHDHITPSK
                     SQRQRGRLTFQPLSPEYEDEDEEERHLQEEQFQLRMRRLRCNGSISPLSEPELDQELE
                     LELDLGLQGQGSVPLHKAHTQEINAKVQQGLTLPMHKKATVPQKQVQVKVQQQIQIHG
                     KKHTPRHKVMKPTRSILRIAHGSLNYVVSSSRGSVADATIYATEINATTTTEKMPMVT
                     QPWEKLTIPVNTAIKDKYRRMKAEYFHEETLDAQLLEVPDAAIIRGLAFSPSTSSD"
     gene            <943766..>945856
                     /locus_tag="CAGL0I09878g"
                     /db_xref="GeneID:2889275"
     mRNA            <943766..>945856
                     /locus_tag="CAGL0I09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447677.1"
                     /db_xref="GeneID:2889275"
     CDS             943766..945856
                     /locus_tag="CAGL0I09878g"
                     /note="highly similar to uniprot|P30624 Saccharomyces
                     cerevisiae YOR317w FAA1 or uniprot|P47912 Saccharomyces
                     cerevisiae YMR246w FAA4 or uniprot|P39002 Saccharomyces
                     cerevisiae YIL009w FAA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447677.1"
                     /db_xref="GeneID:2889275"
                     /db_xref="GOA:Q6FQ17"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ17"
                     /translation="MAVTVTVGEARPGETAPRRAAKVAEKALDRPPNMKCSTVYEFIL
                     ECCEKHGGKNAIGWRDIIDVHEETKTIEKFNKKSGQMEKVDKNWLYYELSGYHYNTFT
                     EVIEVMHSVGRGLVKLGMEPKSEDKLHIFAATSHKWMKMFLGAQSQGIPIVTAYDTLG
                     EKGLIHSLKQTSSAAIFTDNQLLGKLINPLKVAEKIRYVIYYDNISAEDKRQGGKLYR
                     EAQEAVDKIKEVRPDIKLVSFDELLELGQKAKGEIEPHPPTRDDISCIMYTSGSTGDP
                     KGVVLKHSNVVAGVGGATINVCDYVGDTDKLICFLPLAHIFEMAFELLSFHWGSCIGY
                     ANVKTLTSASVRNCKSDLEEFQPTIMVGVAAVWETVKKGILNQINELPRVTKGIFWAA
                     YHSKLKMQKMGIPGGDTIGNIIFKKVRKATGGHLRYLLNGGSPISVNAQEFISNLICP
                     MLIGYGLTETCASLCILNPGHFEYGVVGDLTGCVTVKLVDVEELGYFAKDNKGEIWVK
                     GENVLPEYYKNEEETKESLTEDGWFKTGDIGMWTDTGSLKIIDRKKNLVKTMNGEYIA
                     LEKLESVYRSNSYVQNICVYADQNKVKPVGIIVPNHTPLVKLAKELGIMKKQETDIEP
                     YLHNKKLQNAVFEDMIKTAKKQGLVGIELLQGAVFFDDEWTPQNGFVTSAQKLQRKKI
                     LKAVEKDVESVYAD"
     gene            <946987..>947622
                     /locus_tag="CAGL0I09900g"
                     /db_xref="GeneID:2889276"
     mRNA            <946987..>947622
                     /locus_tag="CAGL0I09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447678.1"
                     /db_xref="GeneID:2889276"
     CDS             946987..947622
                     /locus_tag="CAGL0I09900g"
                     /inference="similar to AA sequence:UniProtKB:Q99181"
                     /note="similar to uniprot|Q99181 Saccharomyces cerevisiae
                     YOR319w essential yeast splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447678.1"
                     /db_xref="GeneID:2889276"
                     /db_xref="GOA:Q6FQ16"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ16"
                     /translation="MSDPEATIYVGNIDTKVTKELLYELFTQVGQVKKVKYPKDKISQ
                     EYQGFAFIEFFSTADADYVLNVMNNNVKLYQKVLKIRRSNQAVQKDDANKKHELDASL
                     LPVAKVFVKDIADTVEVRHLTQLFSKFGPLAKTPEVFTVSNGEVRCAFIYFKFYDNAD
                     LAIQTLNGQFIMNKKASLEYAFKENGRKNLRYGTEADRILNKEARKNGILK"
     gene            complement(<947782..>949287)
                     /locus_tag="CAGL0I09922g"
                     /db_xref="GeneID:2889277"
     mRNA            complement(<947782..>949287)
                     /locus_tag="CAGL0I09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447679.1"
                     /db_xref="GeneID:2889277"
     CDS             complement(947782..949287)
                     /locus_tag="CAGL0I09922g"
                     /inference="similar to AA sequence:UniProtKB:Q12096"
                     /note="similar to uniprot|Q12096 Saccharomyces cerevisiae
                     YOR320c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447679.1"
                     /db_xref="GeneID:2889277"
                     /db_xref="GOA:Q6FQ15"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /translation="MRLVSRRRLKGLALVAFALIGITIFVRILMEFQLEREVSFYKKF
                     FRLKKDGLHGVYNPIDIKQIPKQTIDDLYRAKMETVSASKPIDWSKYAYVNYVTEPNY
                     LCNTLIMFHALIKKFGTKAKLELLISNELFKSEIQSRNEQVQRILKKIRELDSEQIVI
                     KEVQNIVKPTDQSPWNESLTKLLVFGLTEYERIIYLDNDAILQDKMDELFFLPNDITF
                     AAPLTYWFMSEKDLEKTYKEVQHDKMSINLNKYTKQLSNRIRNGKEIYNHLPALPQSL
                     YLNSDRVAKEILDSTSSASPLFDADSLKKVGKVKFASNLMVIKPSQETYDYIINDCLP
                     RIVNKKEKYDMDLINEELYNLRHVVSRQVTLFRKLRSAFKPSILVLPFGTYGILTGSI
                     RKPQEHMIMRNDILGYKNIDDEGNEIQKSIEEVVLNNKYIHFSDFPLGKPWAYSSFDQ
                     LKCRVDPASSKDVAADQKNCDVWNSIYESYFTQRMVCSKDDSPKASEIQAA"
     gene            complement(949786..949858)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I09944r"
                     /db_xref="GeneID:2889278"
     tRNA            complement(949786..949858)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I09944r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2889278"
     gene            complement(<950095..>951126)
                     /locus_tag="CAGL0I09966g"
                     /db_xref="GeneID:2889279"
     mRNA            complement(<950095..>951126)
                     /locus_tag="CAGL0I09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447680.1"
                     /db_xref="GeneID:2889279"
     CDS             complement(950095..951126)
                     /locus_tag="CAGL0I09966g"
                     /inference="similar to AA sequence:UniProtKB:Q08223"
                     /note="similar to uniprot|Q08223 Saccharomyces cerevisiae
                     YOL053w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447680.1"
                     /db_xref="GeneID:2889279"
                     /db_xref="GOA:Q6FQ14"
                     /translation="MTYISRTMLWQRYLGTRISSTILPVAVRRIHYGGGRLQDPRYVF
                     SKPPTNDPNQSKEGRDGKHFFTPSVNDGTENSTLHNNSRLSESEMSSIANAIAEQKRK
                     RLKRSIITIFSAFVTAVLGYTIGYKVWYLKEQSFIPLYPCSRVRKLSTRDLRRVSVKK
                     IEDISEVRVLERLSQHKMIQEEYGVPLRDSNGKAPHVSDFSVWCEDQDPCVTGLVFEP
                     DSNRQSSHSWYRIPYVFKWRITHRPISISSFIDDVLNWINVSTSDLFEVISPEKVYGS
                     FKYEYPIQGDNHSLHICFLGEMKLDENTTVIYKGKYHVDVKLERIDLLRTENKKLVRY
                     ILFKEEDEK"
     gene            complement(<951638..>952801)
                     /locus_tag="CAGL0I09988g"
                     /db_xref="GeneID:2889280"
     mRNA            complement(<951638..>952801)
                     /locus_tag="CAGL0I09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447681.1"
                     /db_xref="GeneID:2889280"
     CDS             complement(951638..952801)
                     /locus_tag="CAGL0I09988g"
                     /inference="similar to AA sequence:UniProtKB:Q12161"
                     /note="similar to uniprot|Q12161 Saccharomyces cerevisiae
                     YOL054w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447681.1"
                     /db_xref="GeneID:2889280"
                     /db_xref="GOA:Q6FQ13"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ13"
                     /translation="MSDPLHTLVLHRSEKTKNKILSKLLDTTICSICHDYMFVPMTTE
                     CGHSYCYTCLKTWFSSDTNRGGLSCPECRAIVNRIPIVNTALQSWLNNTLDILGVKKN
                     DDDRYKKLMSAQSAEVRTYQDDKKADDLFGNIFKSSAQAIADESDDGIIRCSNCLWEL
                     DVDEDTNECPNCSARIRNGIPRGNGTSESTREDLYNRDEYSEGEYEEIEDELRNTGVV
                     ISNGRIEPAHLPEGYEEDDFSYDDEDEDTPISGSRRQHAASRFSSANMRSRLSLHDDE
                     AEEEDDDDNDSGHSIAEQEEAGDYDNEERDSDLDSFIADDDEVLEEEPEEVQEIRSSA
                     EDDNHDSDFYEKQPDSFVSGDSLDDESSAEEHGTSPKRQKRFRIVLDESDDEE"
     gene            complement(<953159..>954190)
                     /locus_tag="CAGL0I10010g"
                     /db_xref="GeneID:2889281"
     mRNA            complement(<953159..>954190)
                     /locus_tag="CAGL0I10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447682.1"
                     /db_xref="GeneID:2889281"
     CDS             complement(953159..954190)
                     /locus_tag="CAGL0I10010g"
                     /inference="similar to AA sequence:UniProtKB:P53286"
                     /note="similar to uniprot|P53286 Saccharomyces cerevisiae
                     YGR142w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447682.1"
                     /db_xref="GeneID:2889281"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ12"
                     /translation="MLDIFNGPCMATLPSIYNNDAAFPHDIFSAMPIFSDMMVDAPHG
                     KRRCYKNYNKTGGNEHTQKHASRARSHKKQHSMNYKIEKLGNGNYELQLSKKIGHNVV
                     AKAINDQVSVLAEKYYVPSYSVVRDIFGRQYYVEEETDEEELRQKVMSQIDIGDIKRK
                     IARQQFNDYEFELNHRGDEVIMFSKSDKIEKEFNFGENLEDIRMKYCTINNKNTEAVL
                     CVELIASEGHNINNSVFAQPVNHANEVFPDPRSDLSHQSSEEENEEDEAYISTDDELN
                     TNTDGNTSDSSDVVSDAVSDSDSSAYYGESVTKVYSPILENVEDEEIDRYRKSFEHSP
                     SGYAIIEDL"
     gene            complement(954784..954857)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0I10032r"
                     /db_xref="GeneID:2889282"
     tRNA            complement(954784..954857)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0I10032r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2889282"
     gene            complement(<955545..>957776)
                     /locus_tag="CAGL0I10054g"
                     /db_xref="GeneID:2889283"
     mRNA            complement(<955545..>957776)
                     /locus_tag="CAGL0I10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447683.1"
                     /db_xref="GeneID:2889283"
     CDS             complement(955545..957776)
                     /locus_tag="CAGL0I10054g"
                     /inference="similar to AA sequence:UniProtKB:P33336"
                     /note="similar to uniprot|P33336 Saccharomyces cerevisiae
                     YGR143w SKN1 glucan synthase or uniprot|P32486
                     Saccharomyces cerevisiae YPR159w KRE6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447683.1"
                     /db_xref="GeneID:2889283"
                     /db_xref="InterPro:IPR005629"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ11"
                     /translation="MSYRDLTGNHPDDANRDAGSSALSSSSSSIANEHKQMANDKNLR
                     NPFVTTSEEDVHSTSSSQNLLPHDNNYELAHTPDLIAPEHHFTSSSGSNSNPASLNEK
                     MAADYKGYYSKHNKGSPSRFYSANSRKNSSSITPPLNIGNYSDLSSNDIRAPPAFDRY
                     PLVGSRLHLSNYRQNFIKNDSPPPPFKNEKLADGESSLIVPSSVMFLDDQDFSPFGGY
                     PASAFPLSMDEKEDDDFLHNPDPEEEARLDKHRFSEDLKHMNKKSFGGILGVLFLFLG
                     AIALFIILPVLTYSGAVDHHDNNIHPANSTNFTNHNAVPLSLYQYPQLSAIRTSLVDP
                     DTPQSALTRKAKDGSDWRLVFSDEFNAAGRTFYDGDDQFWTAPDIHYDATKDLEWYSP
                     DATTTRNGTLQLRMDAFKNHNLYYRSGMVQSWNKLCFTQGALEISANLPNYGKISGLW
                     PGLWTMGNLGRPGYLASTEGVWPYSYSSCDAGITPNQSSPDGLSYLPGQKLSACTCDG
                     EDHPNPGVGRGAPELDILEAEASTELRVGVASQSLQIAPFDIWYIPDYNFVEIYNFST
                     TTMNTYCGGPFQQAISAVTTLNASWYEFGEGSGKFQKFAIEYLNDKNKGYIRWFVGDN
                     PTFTMYSTALHPNGNIDWRYISQEPMSIIMNLGISPNWAYIDWQMIYFPVVMSIDYVR
                     LYQPENAVSLTCDPEDYPTYDYIESHKNAYYNANLTSWKMAGYTFPKNQLTGNCKSSN
                     FKH"
     gene            complement(958676..958748)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I10076r"
                     /db_xref="GeneID:2889284"
     tRNA            complement(958676..958748)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0I10076r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2889284"
     gene            complement(<959218..>964074)
                     /locus_tag="CAGL0I10098g"
                     /db_xref="GeneID:2889285"
     mRNA            complement(<959218..>964074)
                     /locus_tag="CAGL0I10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447684.1"
                     /db_xref="GeneID:2889285"
     CDS             complement(959218..964074)
                     /locus_tag="CAGL0I10098g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447684.1"
                     /db_xref="GeneID:2889285"
                     /db_xref="GOA:Q6FQ10"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ10"
                     /translation="MFSNVINFCFWLTLFLTVGTAKNPVDFPNLCQYPNLDGAVAGFD
                     TEIYNADPSILINFSLWPILQFPKEWHKTIGRAITTQTNFKLPASDTTLFGVSIPTQN
                     ILIEFRGYFIPPKSGTYTFALYLTDDGSAMFLGNDAAFPCGNITSWSNPTNDQVSVSD
                     YDPKKKTLTVYMVAGVAYPLRIAYYNREKGGSLTASFVDPDGLTHSDWNGYIWTLPSC
                     DNCKYSPPPMETTTTSSAYVLEKTTSTIFSIYTGVDGEPTPHTLVKVIVPTVTEYIVV
                     PSPTTITTTKNVDGQQLVEQDVISFFSTTNSIGKPITGSTTITIDDGRDKTTTYKDKD
                     GSIHTDIISHITKLDENGMPVVILTRYPAPAPAPGPGEGGSGSNPGTGEGGSGSNPGT
                     GEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSEGGSGEG
                     GSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGE
                     GGSGSEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSEGG
                     SGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTP
                     SPGEGGSGSEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSG
                     SNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNP
                     GTGEGGSGSNPGTGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIIS
                     HITTTDKDGKPTVILTQYQSPTPSPGEGGSGSEGGSGSNPGTGEGGSGSNPGTGEGGS
                     GSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSEGGSGEGGSGSN
                     PGTGEGGSGSNPGTGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDII
                     SHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSEGGSGSNPGTGEGGSGSNPGTGEGG
                     SGSNPGTGEGGSGSNPGTGEGGSGSNPGTGEGGSGSEGGSGEGGSGGSNPVDDGKDKT
                     TVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEV
                     VHITTYTDSDGHTITSTYTEMFKTLIDAEPQYVSETTQTITTTDAEGHTTTITTTYTI
                     DNNGNAVPIVPSSSSMSSSSSSSMSSSSSSSMSSSSSSIISSSISSAISTPSGQDYTI
                     TTTGSDGKIETDIVSHITTTVNGKPTTITTTVPCDVSTGKDRTTTVTHSNGVIETNVV
                     SHITTTVNGKPTTITTTVPCDVSAGKDRTTTVTHSNGVIETNVISHITTTDSNGKPTT
                     ITTTTTKLNNAHTTTLTNKDGSVDTKTVVGVTTTNQFGQPVITSITYTPKADSHSNSN
                     VGTVAGTKGAAGNNPSGTNKPQTKPTANAGSNGASPAANAGSNGASPAANAGSNGASP
                     AANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAANAGSNGASPAAN
                     AGSAVAPKASASNSAAVQQQSSASGRNPGASAAPTIQQINKNAASSMKQTKIGVTTVL
                     TILLFTLF"
     gene            complement(<970731..>983741)
                     /locus_tag="CAGL0I10147g"
                     /db_xref="GeneID:9488014"
     mRNA            complement(<970731..>983741)
                     /locus_tag="CAGL0I10147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999517.1"
                     /db_xref="GeneID:9488014"
     CDS             complement(970731..983741)
                     /locus_tag="CAGL0I10147g"
                     /note="some similarities with uniprot|P32768 Saccharomyces
                     cerevisiae YAR050W FLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999563.1"
                     /db_xref="GeneID:9488014"
                     /db_xref="GOA:B4UN20"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="UniProtKB/TrEMBL:B4UN20"
                     /translation="MYCIIRLCLLLLYMVRFAAAIVLAANPISITNVCQFPDNWARTA
                     GFQATTVRLGLTIASNTYKELLNYPGLFNFATQKATVTQPNFSISGFPFFTGLYGLTV
                     WPINLLVELQGYFVPPESGNYTFTLQGSDDAAILFFANPSTFACGSQNDWPQPREADI
                     TVTDTLVPSRTLYLVKGVAYPIRIAYYNGSGDGKLNVSFKDPSGTTHTDWKGYVWQYS
                     NTCSTCTYTKPPTQTTTYSSGWVLNPTTTGTSYSLYTGIDGIESNYTIYQVEVPTITP
                     SLSIPPITTVTISHSDYIEEDIVSFFSTTTTNGSPVTGSSISTRTVLIIPPPKTVTIT
                     QQGWVEEDELSFFSTVDANGHPVTGTKTRTISVSVSLPPAFTTTFTSDYEQIIEEISY
                     VPTVAADGKPTYATTTKTLSISHFPAPPPTTQIIDLGNQVTEYDVISYYTTLDANGKL
                     ITTSHVDKYSPPPVTTITIYENHEHVVDVYSYFITVNGEGQIITDSVIISASTSYDPA
                     PSPETKIIDLGNEVTEYDVISYYTTLDANGKIITTSTTTKYSPPPLTVTATTGEDYVE
                     SDWISFFITVDEKGEIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTN
                     YEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEI
                     VTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGV
                     ITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSITLFNATRDYIDA
                     EAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTV
                     TATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPPVETH
                     TVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISF
                     FITVDEKGEIVTSITLFNATRDYIDANAPHTSFGPAPPVETHTVVLENNMTNYEVVSF
                     WTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTL
                     FNATRDYIDAEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSST
                     RTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTS
                     FGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGE
                     DYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDAEAQHTSFGPAPPVETHTVVLEN
                     NMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDE
                     KGEIVTSSTLFNATRDYIDAEAQHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNE
                     FGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRD
                     YIDAEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAP
                     PLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPP
                     VETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESD
                     WISFFITVDEKGEIVTSITLFNATRDYIDAEAPHTSFGPAPPVETHTVVLENNMTNYE
                     VVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVT
                     SSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVIT
                     TSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYKLPEA
                     PHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTA
                     TTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTV
                     VLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFI
                     TVDEKGEIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWT
                     TTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFN
                     ATRDYIDAEAQHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRT
                     YSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDAEAQHTSFG
                     PAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDY
                     VESDWISFFITVDEKGEIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNM
                     TNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKG
                     EIVTSSTLFNATRDYIDANAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFG
                     GVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYI
                     DANAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPL
                     TVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPPVE
                     THTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWI
                     SFFITVDEKGEIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVV
                     SFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSS
                     TLFNATRDYIDAEAQHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTS
                     STRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPH
                     TSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATT
                     GEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPPVETHTVVL
                     ENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITV
                     DEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTT
                     NEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNAT
                     RDYIDAEAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYS
                     APPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPA
                     PPVETHTVVLENNMTNYEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVE
                     SDWISFFITVDEKGEIVTSSTLFNATRDYIDANAPHTSFGPAPPVETHTVVLENNMTN
                     YEVVSFWTTTNEFGGVITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEI
                     VTSSTLFNATRDYIDANAPHTSFGPAPPVETHTVVLENNMTNYEVVSFWTTTNEFGGV
                     ITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDA
                     EAQHTSFGPAPPVETHTVVLENNMTNYEVLSFWTTTNEFGGVITTSSTRTYSAPPLTV
                     TATTGEDYVESDWISFFITVDEKGEIVTSSTLFNATRDYIDAEAQHPTFGTPPLPVTS
                     TIEVTEGVTEYVVVSYYTTTNEYGGVITTSTTTTHSPPAISTIEIETIGYHEIDYISY
                     YITTDSDGNISTGSSIWKTRTALYSNEQAAPHTSAKPAPSPVTNKVNAEDDRTNYEVV
                     SFWTTTNEFGGLITTSSTRTYSAPPLTVTATTGEDYVESDWISFFITVDEKGEIVTSS
                     TLFNATRDYIDAEAQHPTFGTPPLPVTSTIEVTEGVTEYVVVSYYTTTNEYGGVITTS
                     TTTTHSPPTVSTIAIETDGSHGTEYISYFITTDSDGKISTGETRLNQGHQSSSKGKSS
                     DLASQTKEGISEKPEAVWTDISQSREHSLPTSVKSNEVGNEVGSGTISEETTQSTSRN
                     TGSHNSEYQISNSRTLLVPSKIAESLPLSSSRPVISSIDTGSSHSEVHGHASGSAIKN
                     SKDNEGISPSTVNGGSVPVSSNTNTHREGSAADVSSNNKPNYSSVPTNTIQSRSRTRV
                     TLSSTDTRASGGSNSTSASNLISELSDSHDLTGSASSITFLGIKKCIILLIIVVVSIA
                     "
     gene            <992434..>996555
                     /locus_tag="CAGL0I10200g"
                     /db_xref="GeneID:9488015"
     mRNA            <992434..>996555
                     /locus_tag="CAGL0I10200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999518.1"
                     /db_xref="GeneID:9488015"
     CDS             992434..996555
                     /locus_tag="CAGL0I10200g"
                     /note="some similarities with uniprot|P38894 Saccharomyces
                     cerevisiae YHR211W FLO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999564.1"
                     /db_xref="GeneID:9488015"
                     /db_xref="GOA:B4UN21"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="UniProtKB/TrEMBL:B4UN21"
                     /translation="MRQTTMLWSLLVFVLSMINLGLAKNPVDFTTVCQFPDNFSKKPG
                     FLATTARLGLWITGNSYKELLNYPGTFTLTTQQASTTTPNIQLRGTDLFTTIYGLTVY
                     PLYLLVELQGYFVPTQSGMYTFSLTGSDDAAIIFIGNPSTFPCDAFKTWPQATANDIT
                     VTDSINPSRTLYMVKGVAYPLRIAYYNGLGNGVLNAAFTDPSGTKRTDWNGYIWQYDQ
                     CSTCTYKPPPTVTTSITSGWVLSTTTTGTSYSPFTGIDGVESTSTIYQVVVPTITPSL
                     SIPPITTVTIHNPEYVEEDVISFFSTTDSDGKPITGSTTINATREDILPDPPHTSFGP
                     APPPVTHTVDLGNGVTDYEVVTYWTTTNEFGGIITTSSTVTYSPPPVTVTATTAPDYV
                     ESDWISFFITVDEKGDIVTGSTTINATREYIDGEAPHTSFGPAPPVETKTVDLGNEVT
                     EYLVISYWTTTNEFGGLITTSKVDTYSPPPVTVTATTAPDYVESDWISFFITVDEKGD
                     IVTGSTTINATREYIDGEAPHTSFGPAPPVETKTVDLGNEVTEYLVISYWTTTNEFGG
                     LITTSKVDTYSPPPVTVTATTAPDYVESDWISFFITVDEKGDIVTGSTTINATREYID
                     GEAPHTSFGPAPPVETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSKVDTYSPPPVT
                     VTATTAPDYVESDWISFFITVDEKGDIVTGSTTINATREYIDGEAPHTSFGPAPPVET
                     KTVDLGNEVTEYLVISYWTTTNEFGGLITTSKVDTYSPPPVTVTATTAPDYVESDWIS
                     FFITVDEKGDIVTGSTTINATREYIDGEAPHTSFGPAPPPVTHTVDLGNGVTDYEVVT
                     YWTTTNEFGGIITTSSTVTYSPPPVTVTATTAPDYVESDWISFFITVDEKGDIVTGST
                     TINATREYIDGEAPHTSFGPAPPVETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSK
                     VDTYSPPPVTVTATTAPDYVESDWISFFITVDEKGDIVTGSTTINATREYIDGEAPHT
                     SFGPAPPVETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSKVDTYSPPPVTVTATTA
                     PDYVESDWISFFITVDEKGDIVTGSTTINATREYIDGEAPHTSFGPAPPVETKTVDLG
                     NEVTEYLVISYWTTTNEFGGLITTSKVDTYSPPPVTVTATTAPDYVESDWISFFITVD
                     EKGDIVTGSTTINATREYIDGEAPHTSFGPAPPPVTHTVDLGNGVTDYEVVTYWTTTN
                     EFGGIITTSSTVTYSPPPVTVTATTAPDYVESDWISFFITVDEKGDIVTGSTTINATR
                     EYIDGEAPHTSFGPAPPVETKTVDLGNEVTEYLVISYWHDYERVWWSNHHQQG"
     gene            <1002627..>1006349
                     /locus_tag="CAGL0I10246g"
                     /db_xref="GeneID:9488016"
     mRNA            <1002627..>1006349
                     /locus_tag="CAGL0I10246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999519.1"
                     /db_xref="GeneID:9488016"
     CDS             1002627..1006349
                     /locus_tag="CAGL0I10246g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999565.1"
                     /db_xref="GeneID:9488016"
                     /db_xref="GOA:B4UN22"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:B4UN22"
                     /translation="MLIDCILKLFLLIGIALSKNPVELNNVCTFPNDYGRIPGFTVLV
                     GRLGLLISASDYKELLRYPGAFLIATQDTMTTSPNFELTGFPFFTGLYGLTVFPLDLL
                     VELRGYFVPPNSGQYTFTLSDSDDAAIIFLGNPSAFPCGDLQNWPKPSEEDITVTDHL
                     FPSRTLYLIEGVAYPMRIAYYNGIGAGRLNAAFIDPSGTRHTNWEGYIWQYDPCSTCT
                     YSEPPTATTTYSSGWVVNETTTGTSYSIYTGIDGVESTYTIFLVEVPTITPSLSIPPI
                     TTVTISRPDYIEVEVISFVSTTNKEGVPITGSTTINGTRDYLDADAPHNSLAPAPSPV
                     THTIDLGNGVTNYEVVSYRTTTNEYGGYITVTETVTFKAPPVTVVELKGDDYVESDWV
                     SFFITTDEKGDIITGSTTINGTRDYLDADAPHNSLAPAPSPVTHTIDLGNGVTNYEVV
                     SYRTTTNEYGGYITVTETVTFKAPPVTVVELKGDDYVESDWVSFFITTDEKGDIITGS
                     TTINGTRDYLDADAPHNSLAPAPSPVTHTIDLGNGVTNYEVVSYRTTTNEYGGYITVT
                     ETVTFKAPPVTVVELKGDDYVESDWVSFFITTDEKGDIITGSTTINGTRDYLDADAPH
                     NSLAPAPSPVTHTIDLGNGVTNYEVVSYRTTTNEYGGYITVTETVTFKAPPVTVVELK
                     GDDYVESDWVSFFITTDEKGDIITGSTTINGTRDYLDADAPHNSLAPAPSPVTHTIDL
                     GNGVTNYEVVSYRTTTNEYGGYITVTETVTFKAPPVTVVELKGDDYVESDWVSFFITT
                     DEKGDIITGSTTINGTRDYLDADAPHNSLAPPPSPVTNLIIDVYENVTEYEVVSYYIK
                     ANAYGQYLTLTETITFKAPPTTVVEVKGRDYDIRIYVSYFITVANNGVLITESTTLSE
                     VKECLGAEGISKLKSYSYNWAPKQLHFPNSTISSSSIDSCTNECDKMDENSSKVKNPN
                     AKLGHMSDALSITQEVYGEMLPNSSHISIETFPTSLISSRPNTIGESGASSSNLIMSD
                     KLIDSVTVNEIFRHSTISSTNFNSTTTTRDSLANVAIELISKLSPHKSDAFPATTPGN
                     EINSNSLQPSRDDSSSIGNSLMHSRDTIQLYNSNQSSKPELYASETLTTHSEPATSGL
                     ISAEPPRSSIIFSPSTINLYSRFNSTLGTVISKYSTMSVSPPMNASYSKQFNKTICSV
                     YYPDSQIINGCASGIINYWQCNFIFPILVLQLFFIL"
     gene            complement(<1006569..>1007909)
                     /locus_tag="CAGL0I10296g"
                     /db_xref="GeneID:2889210"
     mRNA            complement(<1006569..>1007909)
                     /locus_tag="CAGL0I10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447687.1"
                     /db_xref="GeneID:2889210"
     CDS             complement(1006569..1007909)
                     /locus_tag="CAGL0I10296g"
                     /inference="similar to AA sequence:UniProtKB:P53285"
                     /note="similar to uniprot|P53285 Saccharomyces cerevisiae
                     YGR141w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447687.1"
                     /db_xref="GeneID:2889210"
                     /db_xref="GOA:Q6FQ07"
                     /db_xref="InterPro:IPR009291"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ07"
                     /translation="MISSVYVTLINVYIKADRKEFDMDPIGKSDLWKRDISRNMYDKL
                     PSIKKSDGGSNSFKNGTIPDYVIDNCPLIHLYSDEKYWPSNFSEYVSHFKLLDDEGEA
                     ILDQLNSIKELKQSYVRYDEDGASYEVDSEDIFMTSIDDFDKDPGWMKGFKPKYGTGY
                     AAQAPALVFVVDKGNGWVDAFWFYFYPFNWGPFIMGYGPWGNHLGDWEHTLVRFYNGV
                     PKYIWMSAHGGGSAYTYEAIEKKKRLRRIEGRITNELIEKPLLFSARGTHANYPSVGQ
                     HSHDVPFFFMPLSDFTDRGPLWDPSLNYYGYTITTNGKLAPATNQTSEDLGTSWLYFQ
                     GHWGDKQIPFRDPRQKWCLVQWKYIGGPRGPLRKNLMRKGLCQRSKWWNFMGVCPVRK
                     MIKNGVGLDAERNDYLGDNCGILLYKVRPSIFRSILRLITWRGGLCFLMESFTG"
     gene            complement(<1008846..>1011566)
                     /locus_tag="CAGL0I10318g"
                     /db_xref="GeneID:2889211"
     mRNA            complement(<1008846..>1011566)
                     /locus_tag="CAGL0I10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447688.1"
                     /db_xref="GeneID:2889211"
     CDS             complement(1008846..1011566)
                     /locus_tag="CAGL0I10318g"
                     /inference="similar to AA sequence:UniProtKB:P32504"
                     /note="similar to uniprot|P32504 Saccharomyces cerevisiae
                     YGR140w kinetochore protein complex CBF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447688.1"
                     /db_xref="GeneID:2889211"
                     /db_xref="GOA:Q6FQ06"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ06"
                     /translation="MISKDNEIRKLMESVAPIKVHQYKSYYMKYIEWCEQKELLSFES
                     NSSIPYENVPLLPQLVHLFLLECVIKWPIVASDVNELQIYIESFRFLKKLCDIHSEVD
                     PNSEFDDYITDVLELHRRWDSLLKDESQSSQLNKMATLSINMWNSNTQELSDKYFKTS
                     MEKLRFLTDYHFYTLLNWPYKERSKLKLSHLKVHNVENDENSLNAYRLIIINDDGAVQ
                     GTVIPHDCPLICPITTLAAYLYLRFYGVKPIYRGDGFPELTKDFDLPLIRGKSLKDYP
                     REETLGNYYSSAFKYCSLEYKRRVYLHGSSDEKNGVKNIRYPDTSNPAYKEFLTDYPN
                     NEEMKFDRLFPAHIPLDYERIFNYSNYDGVQDGLTIPEITELPPNDLLVQVFPEIEKY
                     KRESYNILTTKSKEFLKVLEVLRNVLVINLPWIYRYFPDHEIFSDQTSIFQNSDFVSY
                     FNERIALISNNDSTIDINSIPPPLRNIPGYHTGLIENNIMLQYLVEPNFKAGVKSDSI
                     PSVHDSIYNIPVTGNEGQSSSVALAPPITNNSGWKKEAFKLVQFQTLSNFNPMIDTFK
                     KVFEKLDMKRSTREFIINKFETLTKYVNARLNSVTSEEITSYFDDILEKKNGLRYINK
                     ESNSVDKQISGRDVVDNLKRKKQKQKRRFKLLSVDDSSSGTDDANEDSVNDSSTESDS
                     STDDLHEEENAMQEQISSMIDELVTKKLSTLFDVKFEQMEMKLESLVKNTVSEKFNHY
                     IAQESKKRSYEGDFEIDNTKKIRKSIDDGIKEKFNDKVNTSSTGAEEEHFVFRMADTL
                     DSIDEIIQEWYTPDPKQGNMCVHSMNKKYKSKWRTGFEKIYRERKPIVDFFIYLVNME
                     KLSRSKALSICWELKSQNNFTVSELSAYLKSWKEKNNSTFVGLLNQIQHT"
     gene            <1013299..>1016337
                     /locus_tag="CAGL0I10340g"
                     /db_xref="GeneID:2889212"
     mRNA            <1013299..>1016337
                     /locus_tag="CAGL0I10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447689.1"
                     /db_xref="GeneID:2889212"
     CDS             1013299..1016337
                     /locus_tag="CAGL0I10340g"
                     /note="some similarities with uniprot|P39712 Saccharomyces
                     cerevisiae YAL063c FLO9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447689.1"
                     /db_xref="GeneID:2889212"
                     /db_xref="GOA:Q6FQ05"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ05"
                     /translation="MPLIGKYFHFLILCLLSLIGLVLAANPVPLTNVCYFPEEYPRQA
                     GFRAITAGLASTILQGSVDELLNYSGLSSLTTQQTTTTTPNFQLPTLPLPTNVYGLTV
                     VPLYLLVQLQGYFVPPVSGQYTFSLENTNDAAIIFFGNPSAFPCGDLSAWPQASADDI
                     TVTDGTFPSRTLFLKAGVAYPMRISYYNSLGSGNLAVSFTDPGGTKRTNWNGYIWRYN
                     SCSTCTYTPPPAGTTIYSSGWLLDSTTVTTSYSLYTGIDGVESTYTLYKVGVPTITPS
                     LEVPPLTTVTLSYNEYNEENVVSYYSTTTDDGSPIIASTTLTIRTIYSEAPEPITITI
                     EIQPGLTNYEIISYWTTTNADGQFITTSTSTTYSPPPVGTVSVYENHELVEDVYSYFI
                     TLDGSGNIITDSVLISATTIYDAAPEPSTNVIDLGEEVTGYEVISFYTTVDGDGKVVT
                     TSTSTTYSPPPVGTVSVYENHELVEDVYSYFITLDGSGNIITDSVLISATTIYDAAPE
                     PSTNVIDLGEEVTGYEVVTYWTMTNEAGDLITTSSTVTYSPPAITVVGTTGSNYVESD
                     WISFFITRDVEGQLVTGSTTLNGTREYIEAEVVETSLLSVPTAETRTIDSGNGVTEYE
                     VVTHWTTTNEAGDLITTSSTVTYSPPAITVVGTTGSNYVESDWISFFITRDVEGQLVT
                     GSTTLNGTREYIEAEVVETSLLSVPTAETRTIDSGNGVTEYEVVTHWTTTNEAGDLIT
                     TSSTVTYSPPAITVVGTTGSNYVESDWISFFITRDVEGQLITGSSIVDYSFFSALNRT
                     ISNAGSNSLSEEASSQTSISDLKPDIATITNLRATSSITMSSYVSSAKRWSNSSKEIK
                     ISTSSSATSNKELTKASSYYLKGTIVNTIANVPGALSSKNAISNSVGVHPPIKTDEAT
                     SATSSYGNSRMDTHSWVPSSKSSPTPSSVESSNISSVINQFENNTTLETRRKTNIESK
                     MSQSSSHDNELYGSFYGGSPHTREGNLSVALVIILVQFLL"
     gene            <1020373..>1025691
                     /locus_tag="CAGL0I10362g"
                     /db_xref="GeneID:2889213"
     mRNA            <1020373..>1025691
                     /locus_tag="CAGL0I10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447690.2"
                     /db_xref="GeneID:2889213"
     CDS             1020373..1025691
                     /locus_tag="CAGL0I10362g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447690.2"
                     /db_xref="GeneID:2889213"
                     /db_xref="GOA:Q6FQ04"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ04"
                     /translation="MWIMKFLTVLLVFILNLDITNGQLKDESDNNKAFLGVPYAVGNP
                     ITVSNVCSFPKNWHRTAGFRALTARLGIGIQSDSYKELLNYPGTFQLTTQQSSTTKPN
                     FQISGLVGNIYGLTIVPSYLLVELTGYFVPPVSGEYTFSLEGSDDAAIIFIANPSTFK
                     CGHVEDWPTAYDNDVTVTESIHATRTIYMIEGVAYPIRIAYYNGLSLGKLQASFTDPE
                     GVKRVDWNGYIWRYDSCDTCSYVPPPTVVTTETSSWVLNPTTTGTSYSTALGIDGLPT
                     TYTIYQVVVPTITKSLEIPPPITQTDTHPDYLEEEVVSYYSTTNAEGSPITGTTTSTI
                     RTILIIPPPITITVTKEGWEEEQEISYFSTTDANGHGITGTITKTVRLRVDVPTPFTT
                     TYTSNHEQVEAEVSYIPTVDADGKPTYVTTTKVIAISHLPPPPGYTVTVDVGNEVTHY
                     EVVSYFTTEDENGQFYTGTSTVTFTPPSPTTITITKEGVEETDYVSYFITTDAEHNII
                     TSSSVSKILDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGL
                     DKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTV
                     HTDIISHITTTDAEGNPTIILTTYPSPTDSIGNPIALSNVCSFPESRSRTAGFRVLTA
                     GLGIWITSDSYKELLNYSGSSQLITQQSSTTQPNFEIGGLVGNIYGLTIVPSYLLVEL
                     TGYFVPPVSGEYTFSLEGSDDAAIIFIANPSTFKCGNIEDWPTPNEADISVTDTIHTS
                     RTLYMVEGVAYPIRIAYYNGLSIGKLQASFTDPRGVRRVDWNGYIWRYDSCDTCSYVP
                     PPTVVTTETSSWVLNPTTTGTSYSTALGIDGLPTTYTIYQVVVPTITKSLEIPPPITQ
                     TDTHPDYLEEEVVSYYSTTNAEGSPITGTTTSTIRTILIIPPPITITVTKEGWEEEQE
                     ISYFSTTDANGHGITGSTTRTITFHVDLPTPFTTTYTSNHEQVEAEVSYIPTVDEDGK
                     PTYVTTTKVIAISHLPPPPGYTVTVDVGNEVTHYEVVSYFTTEDENGQFYTGTSTVTF
                     TPPSPTTITITKEGVEETDYVSYFITTDAEHNIITSSSVSKILDDGLDKTTVVTDEDG
                     TVHTDIISHITTTDAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTT
                     DAEGNPTIILTTYPSPTDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTY
                     PSPTDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYPSPTDNVDISTSL
                     PQPSTTSYTEDGVVIVEVVYVTIYTASNGDVMLTTITELSKEMIDAGPIWVSPTTSTV
                     TTVDSNGNTLTITTSYLIDNNGNTGPIPNSVISSSVQPSDDGLDKTTVVTDEDGTVHT
                     DIISHITTTDAEGNPTIILTTYPSPTDNVDISTSLPQPSTTSYTEDGVVIVEVVYVTI
                     YTASNGDVMLTTITELSKEMIDAGPIWVSPTTSTVTTVDSNGNTLTITTSYLIDNNGN
                     TGPIPNSVISSSVQPSDDGLDKTTVVTDEDGTVHTDIISHITTTDAEGNPTIILTTYP
                     STAEDGKDRPTVISSSDSTMPPHKLSSSSRADSDIKPSPTSNSIYIPEISRSVGNNLQ
                     PSSSATLSIGIPEDNFSSSVIVGSDSFGSSDQSVLEGQSIGTDDFASIKTIDISVLET
                     SLPTNETTSRHTSIIEGSVKGAAPSVKNNFTITVLPLIVVLALCVV"
     gene            <1027883..>1029775
                     /locus_tag="CAGL0I10384g"
                     /db_xref="GeneID:2889240"
     mRNA            <1027883..>1029775
                     /locus_tag="CAGL0I10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447691.1"
                     /db_xref="GeneID:2889240"
     CDS             1027883..1029775
                     /locus_tag="CAGL0I10384g"
                     /note="highly similar to uniprot|P53283 Saccharomyces
                     cerevisiae YGR138c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447691.1"
                     /db_xref="GeneID:2889240"
                     /db_xref="GOA:Q6FQ03"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ03"
                     /translation="MVDQESLVSFSSETSQSINSDIDIESQQQPRQYIPSNEKDGNKE
                     RLHLTRTETVKSLQEMGMTQDAPIPDVNAPQTTTKNAIFPEEYTMETPTGLVPVATLQ
                     SLGRTSTAISKSRTRQIERSVSRRSQNIAASSNSSNKEELEDEEEVSSDMSNQQPELD
                     PEIEFVTFVTGDPTNPHNWPLWIRWAYTVILSCLVICVAYGSACITGGLFTVQEQYHV
                     GLEAAILSCSLMVIGFSLGPLIWSPVSDLYGRRLAYFISMGLYTIFNIPCALSPNLGG
                     LLVCRFLCGVFSSSGLCLVGGSIADMFPSETRGRAIAFFAFAPYTGPIIGPLVNGFVS
                     VCTRRMDLIFWINMAFAGVMWIIVAFIPETYAPVILKWRAAKLRKETGNPKIMTEQEA
                     QGVSVNEMMKACLIRPLYFAVTEPVLDLTCFYVCLIYSLLYAFFFAFPVVFGELYGYK
                     DNLIGLMFIPILIGATMALATTFYCENEYLKLVKKRKPTPEDRLFGAMIGAPFAAAAL
                     WILGATSYKHIIWVGPASSGLAFGYGMVLIYYSLNNYIIDCYVQYASSALATKVFLRS
                     AGGAAFPLFTNQMYHKLGLQWASWLLAFISTAMILLPFGFYYYGKTLRHKLSKKDYSI
                     DTIEGY"
     gene            complement(<1030282..>1031055)
                     /locus_tag="CAGL0I10406g"
                     /db_xref="GeneID:2889241"
     mRNA            complement(<1030282..>1031055)
                     /locus_tag="CAGL0I10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447692.1"
                     /db_xref="GeneID:2889241"
     CDS             complement(1030282..1031055)
                     /locus_tag="CAGL0I10406g"
                     /note="highly similar to uniprot|P23638 Saccharomyces
                     cerevisiae YGR135w proteasome subunit Y13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447692.1"
                     /db_xref="GeneID:2889241"
                     /db_xref="GOA:Q6FQ02"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ02"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGI
                     VLAAERKVTSTLLEQDTSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTY
                     NEEIPVEMLVRKLSDIKQGYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGW
                     KAISVGANTSAAQTLLQMDYKDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKK
                     KGETEEFEQKIFKPAEIKQLLIKTGISKKSDEDEDVEMS"
     gene            complement(<1031462..>1034953)
                     /locus_tag="CAGL0I10428g"
                     /db_xref="GeneID:2889242"
     mRNA            complement(<1031462..>1034953)
                     /locus_tag="CAGL0I10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447693.1"
                     /db_xref="GeneID:2889242"
     CDS             complement(1031462..1034953)
                     /locus_tag="CAGL0I10428g"
                     /inference="similar to AA sequence:UniProtKB:P53280"
                     /note="similar to uniprot|P53280 Saccharomyces cerevisiae
                     YGR134w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447693.1"
                     /db_xref="GeneID:2889242"
                     /db_xref="GOA:Q6FQ01"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ01"
                     /translation="MGKKKKSKNSQVPKTEDNDAEIVEAEKNPPTNDLGLLLRELVNR
                     SQGERLPKVPDVLRRLFYTYFSEMDPSYILEKQSYRAHKFDVIPFEYLEKIYRDEDLS
                     TTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFFKNTGLDSAIEHNDSDDTLFHSPA
                     YEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTCPNNNIKHR
                     FLLSEEFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMTLHLYDRVTEYNQSYL
                     RYEITDDENALCQFDESLLDVLLEFERYVTTDDIEAILLQSGRINKVKDISSAIERGD
                     YKWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSMLRHSILFEFLGL
                     SQRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKA
                     RNYDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNT
                     QDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQ
                     NDSEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCSG
                     SLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSE
                     DMDEKADNESDGVRPAPIFRRCNCVFEDDKIMDESTIDHQSLITDMELENNAISTKDE
                     NDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFAS
                     YFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLANGDVNKSKLTVDE
                     IYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHYIFE
                     LVMGYRVGFSDGDANGDNNKKSSTGKCGFSRLGTVALSSIEKQMLLQEFFLNATVSLS
                     AKSFESNGTEIDNYDDNADEDNEYISSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTV
                     ELQTLLVNWISLIPEAKELFFFLKQEAHEFDIQDSLEPINESELQTSGNINEPAATDS
                     IPLDDTINTSLTSSTKNSNATDALSTFLETVEETSVQPPQIGRKVIYKGTKILPLPEQ
                     ERPIPFHLLFERAEHLI"
     gene            complement(<1035489..>1035977)
                     /locus_tag="CAGL0I10450g"
                     /db_xref="GeneID:2889243"
     mRNA            complement(<1035489..>1035977)
                     /locus_tag="CAGL0I10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447694.1"
                     /db_xref="GeneID:2889243"
     CDS             complement(1035489..1035977)
                     /locus_tag="CAGL0I10450g"
                     /inference="similar to AA sequence:UniProtKB:P29340"
                     /note="similar to uniprot|P29340 Saccharomyces cerevisiae
                     YGR133w ubiquitin-conjugating enzyme - peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447694.1"
                     /db_xref="GeneID:2889243"
                     /db_xref="GOA:Q6FQ00"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6FQ00"
                     /translation="MARISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGP
                     AETPYYPYEFKLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILK
                     PEGWSPIWDILHVVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEID
                     SP"
     gene            <1036324..>1037190
                     /locus_tag="CAGL0I10472g"
                     /db_xref="GeneID:2889244"
     mRNA            <1036324..>1037190
                     /locus_tag="CAGL0I10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447695.1"
                     /db_xref="GeneID:2889244"
     CDS             1036324..1037190
                     /locus_tag="CAGL0I10472g"
                     /note="highly similar to uniprot|P40961 Saccharomyces
                     cerevisiae YGR132c prohibitin antiproliferative protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447695.1"
                     /db_xref="GeneID:2889244"
                     /db_xref="GOA:Q6FPZ9"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ9"
                     /translation="MSQQANNFVRLITKVAIPVGIAVSGLQYSMYDVQGGSRGVIFDR
                     LQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPKSIATNTGTKDLQMVSLTLRVLHRPD
                     VMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREIVSQKIRQELSNR
                     ANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERARFLVEKAEQERQASVIRAE
                     GEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANSNNITYLPSNHAGGDKDDKG
                     SPNTLLLNLGRS"
     gene            complement(<1037855..>1038373)
                     /locus_tag="CAGL0I10494g"
                     /db_xref="GeneID:2889245"
     mRNA            complement(<1037855..>1038373)
                     /locus_tag="CAGL0I10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447696.1"
                     /db_xref="GeneID:2889245"
     CDS             complement(1037855..1038373)
                     /locus_tag="CAGL0I10494g"
                     /note="highly similar to uniprot|Q12207 Saccharomyces
                     cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
                     cerevisiae YGR131w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447696.1"
                     /db_xref="GeneID:2889245"
                     /db_xref="GOA:Q6FPZ8"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ8"
                     /translation="MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFA
                     AAYGIATDSLYGIFANFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKR
                     YLERETKIVQGSGTRCRQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLRRKH
                     HTEVGVPSISQV"
     gene            <1039201..>1041642
                     /locus_tag="CAGL0I10516g"
                     /db_xref="GeneID:2889246"
     mRNA            <1039201..>1041642
                     /locus_tag="CAGL0I10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447697.1"
                     /db_xref="GeneID:2889246"
     CDS             1039201..1041642
                     /locus_tag="CAGL0I10516g"
                     /inference="similar to AA sequence:UniProtKB:P53278"
                     /note="similar to uniprot|P53278 Saccharomyces cerevisiae
                     YGR130c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447697.1"
                     /db_xref="GeneID:2889246"
                     /db_xref="GOA:Q6FPZ7"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ7"
                     /translation="MSFKSDDPIGRLLQEGSQEKKKSILTRSVEDTGFVSPFRRGLTS
                     ASAAASVSASASASRHRRFSNDSSDSDSDSRDAHNAASGGRSDSSRSDSSSDSDNEQK
                     IAVNPFTNKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVY
                     LTENEFRQQTILKELELKEGKLQYLKDSQKIIDLTIRQPDSDEEQQDEQDEQDDTEVE
                     DNVDAENQQAHTKDNDTITDKEDMASQDAPEKEMSPREDSLPHPDAAETKIMQHKDID
                     APKLQERKPTPDVDVAAEQAEEVAETDGDVDAKEVDAEAGAEADAEAKAADAVMDSEA
                     EPESQEKMAPSVKDTSSALASEDLESYMTVETPQPYDKVPRIPYTEQPESGKKFSSFF
                     KRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIAKTEEYGYMSKPIYDKVVYDET
                     NHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSEN
                     NLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDKHAVVQDEITQLNDRKKE
                     VREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAK
                     KEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENANEQTELSKITKELE
                     EERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENEL
                     NNVKKQKESLETEKLVEEHNRNENIKKEVLDKQRKQAEAQHAAQTKSIATNAANDMQD
                     NSLYEFKTEEEIMYV"
     gene            complement(<1042601..>1043203)
                     /locus_tag="CAGL0I10538g"
                     /db_xref="GeneID:2889247"
     mRNA            complement(<1042601..>1043203)
                     /locus_tag="CAGL0I10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447698.1"
                     /db_xref="GeneID:2889247"
     CDS             complement(1042601..1043203)
                     /locus_tag="CAGL0I10538g"
                     /inference="similar to AA sequence:UniProtKB:P53277"
                     /note="similar to uniprot|P53277 Saccharomyces cerevisiae
                     YGR129w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447698.1"
                     /db_xref="GeneID:2889247"
                     /db_xref="GOA:Q6FPZ6"
                     /translation="MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVY
                     SMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQH
                     LAKNTYDKELQNLPRPEFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETAKQ
                     RYDSNRKIANDKEHTSLSGSINAKNLQFNKSLDDDHEAEK"
     gene            <1043862..>1045898
                     /locus_tag="CAGL0I10560g"
                     /db_xref="GeneID:2889248"
     mRNA            <1043862..>1045898
                     /locus_tag="CAGL0I10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447699.1"
                     /db_xref="GeneID:2889248"
     CDS             1043862..1045898
                     /locus_tag="CAGL0I10560g"
                     /inference="similar to AA sequence:UniProtKB:P53276"
                     /note="similar to uniprot|P53276 Saccharomyces cerevisiae
                     YGR128c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447699.1"
                     /db_xref="GeneID:2889248"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ5"
                     /translation="MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLL
                     GISGSSISKYVITPTPRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDT
                     APTSTNTVEETKHYEIWCYALSANNKTHTLNCLIREVDNNNTSITENNPQFNAKFKEQ
                     IINIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLL
                     ISDLKDQKVALQLYEVSTEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEV
                     YSIPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSE
                     REVSHMKTFQILKTAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDS
                     LGKSFLRRNNQIQGQLKNLFPEPKYELPSINFPEILGKLKNANSAEKFDETFFNLLNI
                     KEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLT
                     KVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIK
                     KLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQL
                     SSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAASKLAENSQTPYIVEYIDI"
     gene            complement(<1046028..>1046987)
                     /locus_tag="CAGL0I10582g"
                     /db_xref="GeneID:2889249"
     mRNA            complement(<1046028..>1046987)
                     /locus_tag="CAGL0I10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447700.1"
                     /db_xref="GeneID:2889249"
     CDS             complement(1046028..1046987)
                     /locus_tag="CAGL0I10582g"
                     /inference="similar to AA sequence:UniProtKB:P53275"
                     /note="similar to uniprot|P53275 Saccharomyces cerevisiae
                     YGR127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447700.1"
                     /db_xref="GeneID:2889249"
                     /db_xref="GOA:Q6FPZ4"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ4"
                     /translation="MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPY
                     DLARIGAGQSNDTFGTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLN
                     DRQGNFEDWDTYAKFCKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK
                     GYLVISNNIHDKLHLQSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFK
                     LASTNLILDKITEEFDLVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIV
                     LLVDKSKTKATFIERIIYSSDQDISLYSTSNPKEELRYEYDIE"
     gene            complement(<1047516..>1048151)
                     /locus_tag="CAGL0I10604g"
                     /db_xref="GeneID:2889391"
     mRNA            complement(<1047516..>1048151)
                     /locus_tag="CAGL0I10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447701.1"
                     /db_xref="GeneID:2889391"
     CDS             complement(1047516..1048151)
                     /locus_tag="CAGL0I10604g"
                     /inference="similar to AA sequence:UniProtKB:P53274"
                     /note="similar to uniprot|P53274 Saccharomyces cerevisiae
                     YGR126w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447701.1"
                     /db_xref="GeneID:2889391"
                     /db_xref="GOA:Q6FPZ3"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ3"
                     /translation="MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTKNENLSR
                     KATNASQGTYMDDATSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQ
                     RKAIPDYNAPLTTTGTNQFPEEYRLETDTGLVKMKTLETLKRKSTQVSRNSDLSSKDK
                     SISKSQSNKSEVSDIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD"
     gene            complement(<1048818..>1052030)
                     /locus_tag="CAGL0I10626g"
                     /db_xref="GeneID:2889392"
     mRNA            complement(<1048818..>1052030)
                     /locus_tag="CAGL0I10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447702.1"
                     /db_xref="GeneID:2889392"
     CDS             complement(1048818..1052030)
                     /locus_tag="CAGL0I10626g"
                     /inference="similar to AA sequence:UniProtKB:P53273"
                     /note="similar to uniprot|P53273 Saccharomyces cerevisiae
                     YGR125w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447702.1"
                     /db_xref="GeneID:2889392"
                     /db_xref="GOA:Q6FPZ2"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ2"
                     /translation="MKSPQQRRKNSILSISESISVSLGLQYPEGNRDGSIDRLNESNS
                     LNVNARPNTKNVGIPNNDTNTFLGRSYVSGILGSSLPQGGERNTLPVSNKFGSRAIHE
                     QNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDNDLITDN
                     KTPVSINLKRATDPELEQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQESTYQS
                     ITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMIIFPITEP
                     IFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP
                     GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLII
                     TGLEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSF
                     YIITLILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVK
                     QIPTMLALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYL
                     VYTNSVLFIRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLV
                     EAMIDPFGKVTTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGE
                     FDGTVAKSTVYRDFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDND
                     VSKHRIKFLILDFKNINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVF
                     NQVGLLQDIELFNDLNSALEWCENEFLYQYKELREKARNKLQRRSKNINAAIGNQLRR
                     YDQTNKNQGPTSSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDP
                     LLKVLLFALKLYRPNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFL
                     VDAGILKVIYNLPAGSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDE
                     KSMEIMKMDNIVLYTELVLLILAIRDTRFKELLGYTLVSA"
     gene            complement(<1053030..>1054754)
                     /locus_tag="CAGL0I10648g"
                     /db_xref="GeneID:2889393"
     mRNA            complement(<1053030..>1054754)
                     /locus_tag="CAGL0I10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447703.1"
                     /db_xref="GeneID:2889393"
     CDS             complement(1053030..1054754)
                     /locus_tag="CAGL0I10648g"
                     /note="highly similar to uniprot|P49090 Saccharomyces
                     cerevisiae YGR124w asparagine synthetase or uniprot|P49089
                     Saccharomyces cerevisiae YPR145w ASN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447703.1"
                     /db_xref="GeneID:2889393"
                     /db_xref="GOA:Q6FPZ1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ1"
                     /translation="MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTI
                     MVHERLAIVGLDSGAQPITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPII
                     PAYLEHDIDAPKYLDGMFAWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFAS
                     ELKCLTDDCDEITAFPPGHVYDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEK
                     AVRKRLMAEVPYGVLLSGGLDSSLIASIAARETEKANEENDAADNDASASKQLAGIDN
                     QGHLHTAGWSRLHSFAIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIY
                     HLETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSATEFHI
                     ESVKRVKNLHLADCLRANKSTMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQSAGRI
                     EKYILRKAFDTSDEPDVKPYLPEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDTMF
                     SNPKIEWGEDIPTTKEAYWYRLKFDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAK
                     IHEQHVTA"
     gene            <1056629..>1058296
                     /locus_tag="CAGL0I10670g"
                     /db_xref="GeneID:2889394"
     mRNA            <1056629..>1058296
                     /locus_tag="CAGL0I10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447704.1"
                     /db_xref="GeneID:2889394"
     CDS             1056629..1058296
                     /locus_tag="CAGL0I10670g"
                     /inference="similar to AA sequence:UniProtKB:Q06512"
                     /note="similar to uniprot|Q06512 Saccharomyces cerevisiae
                     YPR144c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447704.1"
                     /db_xref="GeneID:2889394"
                     /db_xref="GOA:Q6FPZ0"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR027193"
                     /db_xref="UniProtKB/TrEMBL:Q6FPZ0"
                     /translation="MLTIEETKKITKKITASDDRKDYNSIVKLVQSLKFEESVDLEDE
                     KTEASLRFLVVALFQIFKKLFSKNELSLHVKKPEILEFNKWCRKIYESFKNNLLKIIS
                     KVEFECSLTLDCLDVYMQLLEQESIHFASSKDATYFPNKSFRKLIKALFDSNLKEFEL
                     DPKTGESQSPLITEFTEKYFKEFVDVQFYFLSEFLDLQESKELHASSHIAAKWLAIVN
                     HDRYLTNGDVELEIFVSNPPQAIESESKFKSNLEKNWLLLLNSELSISQYKTILLILH
                     RRVVPYLQNPTKLMDFLTDSYNLQSSKTINADAVPILALNGLFELIKSSGLEYPNFYG
                     KLYQLLTPDLMHVKYRSRFFRLMDIFLSSTHLSAHLVASFIKKLARLSISAPPGAIVT
                     VLPFIYNLLKRHPSCMIMIHDPAFVSNPFHTPDQRKALAELQTNFKDPFDAAAVDPEQ
                     THAMESSLWELKTLMDHYHPNVATLAKIFSQQFKKMHYNMEDFLDWSYDTLLEAEASR
                     RLKVLPTLEFEEFPSLLQNPGTNNTDEDNLENDAFLPGSGYLSGIAW"
     gene            complement(1058429..1058502)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0I10703r"
                     /db_xref="GeneID:2889396"
     tRNA            complement(1058429..1058502)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0I10703r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2889396"
     gene            complement(<1058860..>1060071)
                     /locus_tag="CAGL0I10725g"
                     /db_xref="GeneID:2889397"
     mRNA            complement(<1058860..>1060071)
                     /locus_tag="CAGL0I10725g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447706.1"
                     /db_xref="GeneID:2889397"
     CDS             complement(1058860..1060071)
                     /locus_tag="CAGL0I10725g"
                     /note="weakly similar to uniprot|P53272 Saccharomyces
                     cerevisiae YGR122w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447706.1"
                     /db_xref="GeneID:2889397"
                     /db_xref="GOA:Q6FPY8"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY8"
                     /translation="MSKTTATSNQYICYNTGFSTPNIELNVARQDVIELITSASAPDN
                     VLAKLFSYIQLLLRFKATKGIDHELTITTLNIAIAYEKMVLESMTVAYTAGRTDLWTT
                     ASDYLKRAIGILLFLKSTDWLHGDEELYQYLLRYTNEMGVLQQLSVVLVAITKLRSNL
                     YKDSILDLDHSNDLTQNILSSNNITLYSRMCISALETMVAILGKHSSNTLPITIINSY
                     NVDFIKVLIYLLVSLEQYEANNVGHAMGFLKLSRKYLTRSIMKTTDLQSSLDSIMVFD
                     GHKKNLKAASLGKLKNVFKKEKTVDFNSTLKSLKVTFNKDNSNDPLRPLLLNVLNDLI
                     LPLFLLLSYRYEKTNQLYSFQEPIEDEDMLIRDLPKAIIMNLKSISWKISDQNELIED
                     TALSIGHDEYF"
     gene            <1063046..>1064482
                     /locus_tag="CAGL0I10747g"
                     /db_xref="GeneID:2889398"
     mRNA            <1063046..>1064482
                     /locus_tag="CAGL0I10747g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447707.1"
                     /db_xref="GeneID:2889398"
     CDS             1063046..1064482
                     /locus_tag="CAGL0I10747g"
                     /note="highly similar to uniprot|P53390 Saccharomyces
                     cerevisiae YPR138c MEP3 or uniprot|P40260 Saccharomyces
                     cerevisiae YGR121c MEP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447707.1"
                     /db_xref="GeneID:2889398"
                     /db_xref="GOA:Q6FPY7"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY7"
                     /translation="MARGDGYVWTETYDPATVAFIILGAALVFFMVPGLGFLYSGLAR
                     RKSALALIWAVLMATLVGMLQWYFWGYSLAFSKTAPNNKFIGNLDSFGFRNVYGKTSE
                     DSTYPEIAFASFQMMFLCVTVSIIAGATAERGKLLPHMVFLFIFATLVYCPITYWIWA
                     PGGWCYKWGVLDWAGGGPVEIVSAVAGFVYSYFLGRRRENLLINFRPHNVSMVTLGTS
                     ILWFGWLLFNAATSLTPNLRSAYAFMNTNISAVTGGMTWCLLDYRSEKKWSTVGLCSG
                     IICGLVAATPSSGCITLYGSLIQGIISGVVCNFATKIKYYLKVDDAMDLLAEHGVAGI
                     VGLIFNALFAADWVIGMDGATKHRGGWITHNYRQMYKQIAYIGAVAGYTAVVTALICI
                     VIDNIPGLRLRASEEAEALGMDEDQIGEFAYDYVEVRRDYYLWGVDNDNNSADNTDGN
                     ADDQSVTGSSTAATNEGHDIEKVPAGPQ"
     gene            complement(<1065199..>1065957)
                     /locus_tag="CAGL0I10769g"
                     /db_xref="GeneID:2889399"
     mRNA            complement(<1065199..>1065957)
                     /locus_tag="CAGL0I10769g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447708.1"
                     /db_xref="GeneID:2889399"
     CDS             complement(1065199..1065957)
                     /locus_tag="CAGL0I10769g"
                     /note="some similarities with uniprot|P11746 Saccharomyces
                     cerevisiae YMR043w transcription factor of the MADS box
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447708.1"
                     /db_xref="GeneID:2889399"
                     /db_xref="GOA:Q6FPY6"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY6"
                     /translation="MSDKEDINGNNMEDKVDDIDDDGSMTGSVSGSNSVLNEMSAEPK
                     SNNGTSFENTSTPKDRRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
                     LIVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDEDGEEDDEEEQDEDHGDTQN
                     GNPDLGSNSQTDLPHHLRQNAVHNQMLDNQQQLQNQNLLQQPQHSNQTLDHQALPQNH
                     NPYPNIAMGDMGQQYMKGQDHQDPTYQQYFQDTS"
     gene            complement(<1066916..>1067896)
                     /locus_tag="CAGL0I10791g"
                     /db_xref="GeneID:2889400"
     mRNA            complement(<1066916..>1067896)
                     /locus_tag="CAGL0I10791g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447709.1"
                     /db_xref="GeneID:2889400"
     CDS             complement(1066916..1067896)
                     /locus_tag="CAGL0I10791g"
                     /note="highly similar to uniprot|P05150 Saccharomyces
                     cerevisiae YJL088w ARG3 ornithine carbamoyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447709.1"
                     /db_xref="GeneID:2889400"
                     /db_xref="GOA:Q6FPY5"
                     /db_xref="InterPro:IPR002292"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY5"
                     /translation="MNSNSKIRHLVSIKDLSDEEFEILVNRAEHFKKIFKSGNTEEFQ
                     EQHLKLLGRTIAMIFTKRSTRTRISTEGASTFFGAQPMFLGKEDIQLGVNESFYDTAK
                     VVSSMVSCIFARVNKHEDIQLLCQHSSVPIINSLCDTYHPLQAICDMLTIKEHLDYTK
                     NKLKITWIGDSNNVINDMAIACLKLGMDVSIATPPGIEMDPEIMNAAKKICAKNGTQI
                     EVTHDSKHASVGAHVLVTDTFVSMGEEFAKEAKLKQFQGFQVSQEHASVAAPNFKFMH
                     CLPRHHEEVTDDIFYGDHSIVFDEAENRLYAAMAAIDVFVVHKGDFNACK"
     gene            complement(<1069404..>1070108)
                     /locus_tag="CAGL0I10813g"
                     /db_xref="GeneID:2889349"
     mRNA            complement(<1069404..>1070108)
                     /locus_tag="CAGL0I10813g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447710.1"
                     /db_xref="GeneID:2889349"
     CDS             complement(1069404..1070108)
                     /locus_tag="CAGL0I10813g"
                     /note="weakly similar to uniprot|P38290 Saccharomyces
                     cerevisiae YBR165w Ubiquitin-conjugating enzyme suppressor
                     1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447710.1"
                     /db_xref="GeneID:2889349"
                     /db_xref="GOA:Q6FPY4"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY4"
                     /translation="MRIATRRLLREWKHYNRTVRQDEALFYMKPHDSNMFVWHVVLRD
                     FKQTGHELYILLYLHQPENDNSIIVMKCLTPNNKLPINRNVSLTHLQNLLLLEHGFVK
                     LIDHIWGMFFRTTDTLMNNNTQINSRLCYSWNRIVCKDFVRVFPELCGLLQEGDYDLV
                     RSYRHKLNAIQSQNSSNCSTTKPMDDSFYFGFNKGIPPSNGLTHNFLACDSRPSHKHG
                     GEIIEEMQSSLKRRRC"
     gene            <1071206..>1071757
                     /locus_tag="CAGL0I10835g"
                     /db_xref="GeneID:2889350"
     mRNA            <1071206..>1071757
                     /locus_tag="CAGL0I10835g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447711.1"
                     /db_xref="GeneID:2889350"
     CDS             1071206..1071757
                     /locus_tag="CAGL0I10835g"
                     /note="highly similar to uniprot|P38116 Saccharomyces
                     cerevisiae YBR164c ADP-ribosylation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447711.1"
                     /db_xref="GeneID:2889350"
                     /db_xref="GOA:Q6FPY3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY3"
                     /translation="MGNFFSSMFDRLWGINKELRILILGLDGAGKTTILYRLQIGEVV
                     TTKPTIGFNVETLTYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMS
                     TASKELHLMLQEEELQDAALLVFANKQDQPGALTASEVSKELNLVELKDRSWSIVASS
                     AIKGEGITEGLDWLIDVIKDEQL"
     gene            1072621..1072692
                     /locus_tag="CAGL0I10857r"
                     /db_xref="GeneID:2889351"
     tRNA            1072621..1072692
                     /locus_tag="CAGL0I10857r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT)"
                     /db_xref="GeneID:2889351"
     gene            <1073671..>1074762
                     /locus_tag="CAGL0I10879g"
                     /db_xref="GeneID:2889352"
     mRNA            <1073671..>1074762
                     /locus_tag="CAGL0I10879g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447712.1"
                     /db_xref="GeneID:2889352"
     CDS             1073671..1074762
                     /locus_tag="CAGL0I10879g"
                     /inference="similar to AA sequence:UniProtKB:Q02969"
                     /note="similar to uniprot|Q02969 Saccharomyces cerevisiae
                     YPL112c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447712.1"
                     /db_xref="GeneID:2889352"
                     /db_xref="GOA:Q6FPY2"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY2"
                     /translation="MSFTEEWVDERPISHKKLVDEFYDFEYKSEDKQQSIAPIVRALD
                     IIKVIIESLAGKDKSAKVLKYTLDVINLFVQRTRENIVRWDPQVLTYYKKVLKDLKWW
                     MMLRHPITIAKIWVVAMSRNFEIKASYLSQQLSTYRYILRFGSSPFQVLNIWKKLAQT
                     YKEGLTASCIHKLWFNEDSIREVINLHNTVCDELVLLYKLKVWDHKDFYNWLEKQEAI
                     SWEADILFSLKNKLIELQEMKQKRYEMLIDLRARRQALELSKSLHRSRENMSPIHNQL
                     LHEFDNSDDWRRTELEISSQLEEYRHGISMIYLDIMRLSCDLIANTTDVLNMRVPRGT
                     YAVFSLGSGLSGLMKLWHTTRMDLEMKNK"
     gene            <1075178..>1077628
                     /locus_tag="CAGL0I10901g"
                     /db_xref="GeneID:2889353"
     mRNA            <1075178..>1077628
                     /locus_tag="CAGL0I10901g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447713.1"
                     /db_xref="GeneID:2889353"
     CDS             1075178..1077628
                     /locus_tag="CAGL0I10901g"
                     /inference="similar to AA sequence:UniProtKB:Q08581"
                     /note="similar to uniprot|Q08581 Saccharomyces cerevisiae
                     YOR195w involved in control of spindle dynamics"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447713.1"
                     /db_xref="GeneID:2889353"
                     /db_xref="GOA:Q6FPY1"
                     /db_xref="InterPro:IPR024312"
                     /db_xref="UniProtKB/TrEMBL:Q6FPY1"
                     /translation="MEGSEIKTPVKTIEADPTLPHVSADCNAEEISAPNSHLKVHPHG
                     LSSKKKIATFQLRTPTDDNSSDPKDGNKLQFENNSNDNEVENIQNNRNDESILENMDV
                     NTIMKRKRSHNNEDKTVTLTNKYSDENINISDDMKENHPLTLSNKESLPTERNANQEQ
                     SNKRPRVDGLQAAPELDTVRSNQLNDDDQNVQIEMLENNSSPLKNEGDISNINKNDTA
                     DILNSIKNEIDNFDSTYSSPSTPAKKDDDGKNIAMDTIFNTTESIHKLSPIFPKSQRS
                     HDTVNSEYNTDIDKAHSVSLEILRRNEELANEVHKTNTDLNDCLMKLENLSYEFQKHK
                     EQSLVDQERLTEKTEELEDSLEKLTVLREELSTNVANLEKQLHEKQDEIKMLNQNQSI
                     LQHNFDKKLEDEQKAREEYIIIQNEKDKAIEDLRNCKGKVEELESEIITLKTQINENE
                     DWNSKLLQEKTNLEAQVKNIEEKDLLKSEQITELEKKLQDAISSQKNTNTELSLKVEE
                     LLKTNSSLEKDAITWKYKLESREIELKTTLEGKEKELANATSTLSKYESQIRELRSEL
                     TDVEMKYSTLKKSFEDVDDDAKIRSAEVTELNYKIDDLREKVENLESSLQEKDDYINK
                     LKEELQSKKDEHSKTLLELESVHLKNNNIEKEHLAELEGLHESLSHLEEELKSKTICV
                     NDMKDEISKLEDEKKEYLSSVSKQNTTSINTEGIMNLQNLQREIDQLRDKLNNSEQEK
                     NKQLQQLSDDLYVQYSSKHEQKVKMLKKNYEATYKKNLEELKMQNKSYIQEIKQLTSQ
                     LDYERKEKQELLKLLEQK"
     gene            complement(<1077815..>1078981)
                     /locus_tag="CAGL0I10923g"
                     /db_xref="GeneID:2889354"
     mRNA            complement(<1077815..>1078981)
                     /locus_tag="CAGL0I10923g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447714.1"
                     /db_xref="GeneID:2889354"
     CDS             complement(1077815..1078981)
                     /locus_tag="CAGL0I10923g"
                     /note="highly similar to uniprot|P32875 Saccharomyces
                     cerevisiae YOR196c lipoic acid synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447714.1"
                     /db_xref="GeneID:2889354"
                     /db_xref="GOA:Q6FPY0"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /translation="MRLTTVQRRFLVSTKAKVSGASISSTANTGSASAGAPNGQTRRR
                     RRITEFKDALNLGPSFEDFVSGRAAGFTVVDPLEQMRQDREEYKKLPKWLKVPIPKGV
                     NYHKLKKDVKELKLSTVCEEARCPNIGECWGGKDKSKATATIMLLGDTCTRGCRFCSV
                     KTNRNPAKPDPTEPENTAEAISRWGLGYVVLTTVDRDDLPDGGAHHLAETVIKIKQKA
                     PKTLVEALTGDFLGNLEMVDVMAKSGLDVYAHNLETVEALTPHVRDRRAGYRQSLNVL
                     KRAKETVPSLITKTSVMLGLGETDDQIIQTMQDLRAINCDVITFGQYMRPTKRHMKVV
                     EYVRPEKFDYWKDKAKEMGFLYCASGPLVRSSYKAGEAFIENVLNKRKQDNKRI"
     gene            <1079542..>1080720
                     /locus_tag="CAGL0I10945g"
                     /db_xref="GeneID:2889355"
     mRNA            <1079542..>1080720
                     /locus_tag="CAGL0I10945g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447715.1"
                     /db_xref="GeneID:2889355"
     CDS             1079542..1080720
                     /locus_tag="CAGL0I10945g"
                     /inference="similar to AA sequence:UniProtKB:Q08601"
                     /note="similar to uniprot|Q08601 Saccharomyces cerevisiae
                     YOR197w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447715.1"
                     /db_xref="GeneID:2889355"
                     /db_xref="GOA:Q6FPX9"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /translation="MYPGSGNYSYNNRPSMPPPGFNGDGQGYRQEYGNQYGGGYQQQQ
                     YQDQYQGENRGQYQGQYQDQPEYGRPPSGMVRPPSSIQQGNGQQFQYSQMTGRRKALL
                     IGINYIGSKNALRGCINDAHNIFNYLTTYCGYRPEDIVMLTDDQREMVKIPLKENIIR
                     AMQWLVKDAQPNDALFFHYSGHGGQTKDLDGDEEDGMDDVIYPVDFESVGPLIDDTMH
                     DIMVKSLPQGARLTALFDSCHSGTVLDLPYTYSTKGVIKEPNMWKDVGSDGIQAAMAY
                     ATGNRSALFSSIGNMVSSVTKKQNVDRERVRQIKFSPADVIMLSGSKDNQTSADTFAD
                     GQNIGAMSHAFISVMTRQPQQSYLSLLQNLRNELAGKYSQKPQLSASHPIDVNLQFIM
                     "
     gene            complement(<1081047..>1082474)
                     /locus_tag="CAGL0I10967g"
                     /db_xref="GeneID:2889356"
     mRNA            complement(<1081047..>1082474)
                     /locus_tag="CAGL0I10967g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447716.1"
                     /db_xref="GeneID:2889356"
     CDS             complement(1081047..1082474)
                     /locus_tag="CAGL0I10967g"
                     /note="highly similar to uniprot|P38934 Saccharomyces
                     cerevisiae YOR198c maintenance of normal ploidy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447716.1"
                     /db_xref="GeneID:2889356"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX8"
                     /translation="MSSQQQQQRIKRPDVSVRDKKLETLNVQLKKIDEELNQLRKQID
                     QNQVNDKTQNERKKLQEKTKEIIKTQADLKARRNAIHDSIKQLDSQIKRRTGEIQDRI
                     GKKSKYTTTAEAKQRINQIEDQISTGDMSLVEEKMLVKELNSLNKLIKDLVAIDPIKK
                     AIDTDKDKIVKLKEELSGMNSRELSAQFDENQKRLNELQSSTQTVFDKRQTLYNKRTA
                     LYKKRDEVYSQIRKIRADFDNEFKAFKNKLEKQRLKREEEEKLSKVLEEKDAKLGKLQ
                     EKLTHARIPAFTYEIEAIENTLVILDPTFEKPKKNVLQELENGAAEPVMSNAPVNNDG
                     LVLVEKKDDSYNRVAPSKSKKHKKKSQSAKEPSSQNLFTKVDGKITLEPTLIATLAEL
                     DVTVPITQDDVATSVEQLKKKLEEFKSNQDEQTEKNIKAVEEQMKKLELAYEEKENEV
                     KRELEEKRQKEKEEEESKKENEDND"
     gene            complement(<1083728..>1084882)
                     /locus_tag="CAGL0I10989g"
                     /db_xref="GeneID:2889357"
     mRNA            complement(<1083728..>1084882)
                     /locus_tag="CAGL0I10989g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447717.1"
                     /db_xref="GeneID:2889357"
     CDS             complement(1083728..1084882)
                     /locus_tag="CAGL0I10989g"
                     /inference="similar to AA sequence:UniProtKB:P25270"
                     /note="similar to uniprot|P25270 Saccharomyces cerevisiae
                     YOR201c rRNA guanosine-2 -O--methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447717.1"
                     /db_xref="GeneID:2889357"
                     /db_xref="GOA:Q6FPX7"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX7"
                     /translation="MSIRPAVKDGSPLKRRSVDRNIPVYKTSKAWERDGLDKDTWFRK
                     KYAHVHADQKKRQKAGSLGKREAHEQRLDGICHSYRDNKNAHRQKFKNLYTNVTKFAI
                     NPLSEYLYGVNPILAALESDRRGYFTRLLHHDTNDKDSNKLTILRLCKEKGIKIDTAD
                     KHQLNLITKSAVHNNMVLECKPLSIPEINSLQNVNIDTASFNVLQTDGITQWSKSEKF
                     HNNERKKYPVGIYLDEVTDPHNMGAIIRSAFFLGADFVALSRKNCAAIGPVVAKTSSG
                     AVDYLPMFYVDKPLKFFELSQAEGWTVVSSSHGHSKKDVAKTLDLGDLHNMSHSMPIL
                     LVMGNEYSGIRTNLKQRSDFLVAIPQMTNNSTVDSLNVSVATGILLSKLV"
CONTIG      join(CR380955.2:1..1100349)
//
DBGET integrated database retrieval system