GenomeNet

Database: RefSeq
Entry: NC_006033
LinkDB: NC_006033
Original site: NC_006033 
LOCUS       NC_006033            1195132 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome J complete sequence.
ACCESSION   NC_006033
VERSION     NC_006033.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1195132)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1195132)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380956.
            On Aug 5, 2010 this sequence version replaced NC_006033.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1195132
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="J"
     gene            complement(10142..10213)
                     /gene="tRNA-Glu (CTC)"
                     /locus_tag="CAGL0J00143r"
                     /db_xref="GeneID:2889891"
     tRNA            complement(10142..10213)
                     /gene="tRNA-Glu (CTC)"
                     /locus_tag="CAGL0J00143r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2889891"
     gene            <12254..>12577
                     /locus_tag="CAGL0J00165g"
                     /db_xref="GeneID:2889892"
     mRNA            <12254..>12577
                     /locus_tag="CAGL0J00165g"
                     /product="40S ribosomal protein S25"
                     /transcript_id="XM_447719.1"
                     /db_xref="GeneID:2889892"
     CDS             12254..12577
                     /locus_tag="CAGL0J00165g"
                     /note="highly similar to uniprot|P07282 Saccharomyces
                     cerevisiae YLR333c RPS31B and highly similar to
                     uniprot|P07282 Saccharomyces cerevisiae YGR027c RPS31A"
                     /codon_start=1
                     /product="40S ribosomal protein S25"
                     /protein_id="XP_447719.1"
                     /db_xref="GeneID:2889892"
                     /db_xref="GOA:Q6FPX5"
                     /db_xref="InterPro:IPR004977"
                     /translation="MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQ
                     EKFDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLEREGIIKPISKHSKQAIYT
                     RASAE"
     gene            complement(<12843..>13682)
                     /locus_tag="CAGL0J00187g"
                     /db_xref="GeneID:2889890"
     mRNA            complement(<12843..>13682)
                     /locus_tag="CAGL0J00187g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447720.1"
                     /db_xref="GeneID:2889890"
     CDS             complement(12843..13682)
                     /locus_tag="CAGL0J00187g"
                     /inference="similar to AA sequence:UniProtKB:P53217"
                     /note="similar to uniprot|P53217 Saccharomyces cerevisiae
                     YGR026w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447720.1"
                     /db_xref="GeneID:2889890"
                     /db_xref="GOA:Q6FPX4"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX4"
                     /translation="MAKKIKIIKKRDRKRVDPLAKQKLAWTTGHSLVVVCGILFSIAY
                     FFQILLFFKYRNWKWLFLRENKNYTFIKGTRWYHTILRHTPLLLYKTSLIGVFVSYGV
                     TLLQNWKGVDPSWNDLLASQNFQSIMIAALWFVSGGKSFYKLVPFMVLSYLHLINMKN
                     EFNGVDNHKEFSKKYKFQLNIVAYSELVVMLRLLIDALVMRTGTSGYMFVIYLGIYWL
                     RLNYSAYAQASVVQIIKLVDHKIPKQAQPLWTGFKKFLSLKISECIERNRQIEKEDAI
                     IAT"
     gene            <14366..>15079
                     /locus_tag="CAGL0J00209g"
                     /db_xref="GeneID:2889888"
     mRNA            <14366..>15079
                     /locus_tag="CAGL0J00209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447721.1"
                     /db_xref="GeneID:2889888"
     CDS             14366..15079
                     /locus_tag="CAGL0J00209g"
                     /note="highly similar to uniprot|P53215 Saccharomyces
                     cerevisiae YGR024c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447721.1"
                     /db_xref="GeneID:2889888"
                     /db_xref="GOA:Q6FPX3"
                     /db_xref="InterPro:IPR007537"
                     /db_xref="InterPro:IPR024956"
                     /db_xref="InterPro:IPR025845"
                     /translation="MAKSKYEYVKQFESHDTLLPQCYIVVRIDGKKFHEFSKYYDFKK
                     PNDERALKLMNACAKNVVLQYRHEMILAYGESDEYSFVLKKDTELYKRRRDKLSTLIV
                     SLFTSNYVALWSKFFPGTNLHPKHLPFFDSRCVIYPNLETIRDYVTWRYVDTHINNLY
                     NTAFWQLIQKCGMNPQEAEKRLSGTVSSEKNEILFKECGINYNNEPEMYKKGSLITNK
                     GEILHINVIDSLDSLFEGY"
     gene            complement(15352..15423)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0J00231r"
                     /db_xref="GeneID:2889889"
     tRNA            complement(15352..15423)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0J00231r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2889889"
     gene            complement(<15883..>17376)
                     /locus_tag="CAGL0J00253g"
                     /db_xref="GeneID:2889887"
     mRNA            complement(<15883..>17376)
                     /locus_tag="CAGL0J00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447722.1"
                     /db_xref="GeneID:2889887"
     CDS             complement(15883..17376)
                     /locus_tag="CAGL0J00253g"
                     /inference="similar to AA sequence:UniProtKB:P53214"
                     /note="similar to uniprot|P53214 Saccharomyces cerevisiae
                     YGR023w MTL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447722.1"
                     /db_xref="GeneID:2889887"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX2"
                     /translation="MFVVLLLLSFAFAQIEPPAGGVGINNNNNNNNNNGTDLSSSNII
                     PSSDPYSFTPDESTQLQVPSSTSSVVPVEPSSFTNSFSTLISQSPSTFSSTFSSTFSS
                     IIPSSFSSLPSSSRSSQYTPSSTISSISSSSSLSSSSSYFSSSISVRSSYSSSSRSSS
                     SIISSSSRSTIAPSSSSSSFFSSAITSSSSSVYSSFSSFSSSYSSSSSSISPSSTLST
                     FSSSSSILPSSTTSSSTTSISSSISSTTITTSSTPSSSSSINTSNVIITSVIEGKTIL
                     SNSYTTITYSPESTAHKSPQNKSGNHGLSSKNKKIVIGCVVGIGVPLLIAILVLLYIF
                     CIMPTRTDFIDSDGKVITAYKRNIFVTIWYSLLGKNLDDARNFSSESPMGSDDNSSDF
                     IITNDKDVANTYEVPDIDTTQASANEEDDLINNIRGRNFKAHRHSTSLTSNIYTESSV
                     DEFTTPSQGRQYDHLSIVNSIASENIIPEDFDDGYYHRGGNLNVTNY"
     gene            complement(<19390..>20301)
                     /locus_tag="CAGL0J00275g"
                     /db_xref="GeneID:2889913"
     mRNA            complement(<19390..>20301)
                     /locus_tag="CAGL0J00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447723.1"
                     /db_xref="GeneID:2889913"
     CDS             complement(19390..20301)
                     /locus_tag="CAGL0J00275g"
                     /note="highly similar to uniprot|Q05636 Saccharomyces
                     cerevisiae YDR280w RRP45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447723.1"
                     /db_xref="GeneID:2889913"
                     /db_xref="GOA:Q6FPX1"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX1"
                     /translation="MAKDIEISTSEATFIVEALRQKQRLDGRRLDQFRDVQIEFGKEY
                     GDVTVRMGKTLVQCRISCQITEPYEDRPFEGLFVISTEISPMAGPQFENGNSTGEDEV
                     LCARIIEKAVRRSGALDVEGLCIVAGSKCWAVRADVHYLNCDGGFIDASCIAVMAALS
                     HFRKPDISVHGEDVVVYPVDEREPVPLGILHIPICVTFSFFNPQDTEENIKGDSNAEI
                     SIIDATTKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALQLMQCCHKAYEITEQLT
                     DMILKEVKHDLAKRDKYSSILSSENAR"
     gene            <21048..>22742
                     /locus_tag="CAGL0J00297g"
                     /db_xref="GeneID:2889914"
     mRNA            <21048..>22742
                     /locus_tag="CAGL0J00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447724.1"
                     /db_xref="GeneID:2889914"
     CDS             21048..22742
                     /locus_tag="CAGL0J00297g"
                     /inference="similar to AA sequence:UniProtKB:P38775"
                     /note="similar to uniprot|P38775 Saccharomyces cerevisiae
                     YHR045w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447724.1"
                     /db_xref="GeneID:2889914"
                     /db_xref="GOA:Q6FPX0"
                     /db_xref="UniProtKB/TrEMBL:Q6FPX0"
                     /translation="MFDIGFLIKLSITVLAFVLGTNWLLSSFVLDFMRDWTQVALNQQ
                     SNVSSVRKEKESAHYRNFLIPLGFPLTTGLSLSLGYKSRNGNVCDIWNAVMEVGEGQN
                     TIQLYNENGQLEKFSLSRLNGLVKKILQLEGIEKCRRIGITVPINTIQGFVLTIAGMV
                     RSVTHSAPIQMLSSVPRSKIDGLDIIVIPTWKSYTRLNGSENWYSKILILEKEPMIEN
                     IPANVIFWDDLVNGSLTDSEFDYTCPEDMSDDKKDLMYVTSPQNQTNRFSQMNLVSTV
                     ASCIKGFPVDHSLSEKDNLLVGAQQSKPLESLSVWPKLFAVLLHGGSVSFLKVTDTNL
                     NNLDGVTLASLSRQEIEILHREILSNNTSIFDRIKKKWAETLFSEGIFTQFAKKKISS
                     IKNMRCIYVVNELLNADIISSLDSSKIESYDTATVGNVLSSKLLGDIRSEFGCRVVQE
                     LVCPYMLMGIISGTNYYDYRVFPENVDKLLACFGTLETNLEAKMVEVISKKKLDVTKR
                     QGMLCIRGYSIGKPLDEERLNHALQLSDTVGGADGWMPLIGVFGLFGTDGCLYIYK"
     gene            complement(<22849..>23733)
                     /locus_tag="CAGL0J00319g"
                     /db_xref="GeneID:2889912"
     mRNA            complement(<22849..>23733)
                     /locus_tag="CAGL0J00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447725.1"
                     /db_xref="GeneID:2889912"
     CDS             complement(22849..23733)
                     /locus_tag="CAGL0J00319g"
                     /note="highly similar to uniprot|P38710 Saccharomyces
                     cerevisiae YHR046c and highly similar to uniprot|Q05533
                     Saccharomyces cerevisiae YDR287w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447725.1"
                     /db_xref="GeneID:2889912"
                     /db_xref="GOA:Q6FPW9"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW9"
                     /translation="MDLLSIEKFLCDLSVNQVGPIIKKKSGTQHVYDLKTGERAVDIV
                     TAIDKQVEKLIWDSLKEQYPDFKFVGEESYVKGVTTITDDPTFIVDPIDGTTNFVHDF
                     PFSCTSLGLTINKEPVVGVIYNPHLDLLISASKGNGIRINREPFDHKAKLESMGPLYL
                     NKSVVALQPGSAREGNNFKTKMKTYESLLSCDEGFVHGFRNLGSTAMTLAYIATGNLD
                     SYWDGGCYSWDVCAGWCILKEAGGIIVGANPGEWDIPIDNRSYLAVRGTTEEGGKELQ
                     KKYVDDFWKCVKGKLSYD"
     gene            complement(<24103..>26676)
                     /locus_tag="CAGL0J00341g"
                     /db_xref="GeneID:2889911"
     mRNA            complement(<24103..>26676)
                     /locus_tag="CAGL0J00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447726.1"
                     /db_xref="GeneID:2889911"
     CDS             complement(24103..26676)
                     /locus_tag="CAGL0J00341g"
                     /note="highly similar to uniprot|P37898 Saccharomyces
                     cerevisiae YHR047c AAP1 alanine/arginine aminopeptidase or
                     uniprot|P32454 Saccharomyces cerevisiae YKL157w APE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447726.1"
                     /db_xref="GeneID:2889911"
                     /db_xref="GOA:Q6FPW8"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW8"
                     /translation="MDREILPSNVTPLHYDLVLEPSFETFKFDGSVTIDLQVNDSTVD
                     SISLNTLEIDIKAVTLDGSITPSEIKVDEAAQVTEFVFEKGTLSEKKSVKLEIKFIGI
                     LNDQMAGFYRAKYEDKQTGETKYMATTQMEATDARRAFPCFDEPNLKSTFDVTLISDK
                     HLTQLSNMDVKSETIEGEKKITKFNTTPKMSTYLIAFIVAELKYVESKEFRIPVRIYS
                     TPGDEHLGEFAASLTARTLKFFESTFDIEYPLPKMDMVAVHEFSAGAMENWGLVTYRV
                     VDLLLDKENSTLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSC
                     NEFQPQWNVWQQYVADSLQRALSLDSLRSSHPIEVPVKNADEINQIFDAISYSKGSSL
                     LRMISKWLGEDIFIKGVAEYLNKFKYGNAKTEDLWDSLSEASGKDVTKVMNIWTKQIG
                     YPIVTVNEEGEKISFTQHRFLSTGDVKPEEDETLYPVFLAIKTKDGIDNNINLDEREK
                     TIELKDNEFFKINGNQAGVYVTCYSDERWAKLSKQAEFLSVEDRTGLVADVKSLASSG
                     YTSTTNFLNLISNWSNEESFVVWTQMINSISALESAWVFEDESIKTGLKNYVTKLSIE
                     KAHKLGWEFSNEDSYSTQKLKVLLFDVACSNDDEKAQSAAIDMFNKYISGDKKAIPAL
                     IKPSVFNTVASKGGEESYQKLYNIYKNPMATDEKLAALRALGKFKEDKLITKTLSYLL
                     DGTVLSQDFYIPMQGLRTHKEGILAMWEFLKQNWTEIIKKLQPGSPVLGGVLTVSVSS
                     LASVEKIDDVKQFFSDKPTKGFDQTLAQALDTATSKSKWVARDGEVVRKYLEDNGYFI
                     N"
     gene            <27627..>29123
                     /locus_tag="CAGL0J00363g"
                     /db_xref="GeneID:2889909"
     mRNA            <27627..>29123
                     /locus_tag="CAGL0J00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447727.1"
                     /db_xref="GeneID:2889909"
     CDS             27627..29123
                     /locus_tag="CAGL0J00363g"
                     /note="highly similar to uniprot|P38776 Saccharomyces
                     cerevisiae YHR048w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447727.1"
                     /db_xref="GeneID:2889909"
                     /db_xref="GOA:Q6FPW7"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW7"
                     /translation="MSESISMKDSDSCNQIDAESKSALSANEQTEFEVSFSEDGDPDP
                     ENIARHLPLVRKYYISSLITLTSTVITIISSCWSLASPNIMKHFHISHEVSTLGITLY
                     IFGLGFGPLFLSPISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFG
                     SVFLSVAGGAISDIFSKKQIGIPMAIYTTAAFLGPSLGPIISGALYHANYKWTFVTLL
                     IASGVCLTLIVISVPETYAPVLLIKKAQRLREETGDDRYYAPLEITRKETSIFKSVVL
                     SAKRPFGLLLRDPMMGVLCFYTGLVLAIVYLYFVAFPYVFETLYHFTVMEVGCSYIGL
                     MVGMLLASPTSYIFQKRYDAKVERNGGVRTPEMRFEPLYYGAFCTPIGLMIFAWTCYS
                     HVHWIGPQIGSAIFGVGVYFVFVGVFGYTVDAYRKYAASGMACNSFVRSVMSGVFPLF
                     GLQMYKGMGVNWAGFLIAMVTVLMIPVPFLFDRYGPYLRSKSPYAWDD"
     gene            <29762..>30487
                     /locus_tag="CAGL0J00385g"
                     /db_xref="GeneID:2889910"
     mRNA            <29762..>30487
                     /locus_tag="CAGL0J00385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447728.1"
                     /db_xref="GeneID:2889910"
     CDS             29762..30487
                     /locus_tag="CAGL0J00385g"
                     /note="highly similar to uniprot|P38777 Saccharomyces
                     cerevisiae YHR049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447728.1"
                     /db_xref="GeneID:2889910"
                     /db_xref="GOA:Q6FPW6"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW6"
                     /translation="MTASAAPRLLFLHGFLQNGKVFSEKSSGIRKLLKKADIQCDYID
                     APVMLEKKDLPFEMDDEKWAATLEADVNRAWFYHSEISKELDLTEAINTVANHIKENG
                     PYDGIVGFSQGAALSTIITNKISELVPSHPEFKVSLVISGYSFTEPDPENPGQLRITE
                     KYRESFKPNPESQTKMLFVYGASDMAVPSERSKYLYNLYKESFGEDAEGTKLHAFEHP
                     GGHMVPNKKDIIRPIVEQITSSL"
     gene            <31269..>32894
                     /locus_tag="CAGL0J00407g"
                     /db_xref="GeneID:2889954"
     mRNA            <31269..>32894
                     /locus_tag="CAGL0J00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447729.1"
                     /db_xref="GeneID:2889954"
     CDS             31269..32894
                     /locus_tag="CAGL0J00407g"
                     /inference="similar to AA sequence:UniProtKB:P38778"
                     /note="similar to uniprot|P38778 Saccharomyces cerevisiae
                     YHR050w SMF2 or uniprot|P38925 Saccharomyces cerevisiae
                     YOL122c SMF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447729.1"
                     /db_xref="GeneID:2889954"
                     /db_xref="GOA:Q6FPW5"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW5"
                     /translation="MPVARESSRNSLSQMFLREESEELPMIATSSRMQNLIRIGKKYA
                     RFIGPGLMVSVSYMDPGNYSTAVAAGSAHKYKLLFSMFVSNLMAGFLQCLCARLGAVT
                     GLDLAQNCKKHLPYGLNITLYILAEIAIIATDLAEVVGTAISLNILLGIPLPIGVVLT
                     VIDVLIVLMAYKPNGDLKLIRYFELFVSFLVICTVICFAIELFYVKLGPASDIFKGFL
                     PSKAVIEGDGLYLSLAILGATAMPHSLYLGSGVVQPRLRDYDIKHGYYSPDELDIDNN
                     HQDYKPSLESVQETLHYTVAELLVSLFTIALFVNCAILIVSGATLFETPQDADIADLF
                     SIYELLSNTLSKSAGTIFALALLFSGQSAGIVCTLSGQIVSEGFLNWTIAPALRRSLT
                     RAVAITPCLILVMVSGRSGLSNSLYASQVVLSVLLPFVSAPLLYFTSNKNIMRIEMID
                     RKLPATSIFSTPGNVEQNKKKYGKVRLDEDEEEVIPLQDMETETETDQSQHQDQNIEY
                     KDMSNSTFVNILAVTVWLLISGLNLYMLKNLDK"
     gene            <34645..>35103
                     /locus_tag="CAGL0J00429g"
                     /db_xref="GeneID:2889953"
     mRNA            <34645..>35103
                     /locus_tag="CAGL0J00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447730.1"
                     /db_xref="GeneID:2889953"
     CDS             34645..35103
                     /locus_tag="CAGL0J00429g"
                     /note="highly similar to uniprot|P00427 Saccharomyces
                     cerevisiae YHR051w COX6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447730.1"
                     /db_xref="GeneID:2889953"
                     /db_xref="GOA:Q6FPW4"
                     /db_xref="InterPro:IPR003204"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW4"
                     /translation="MLSRTLLRAPVFKRTLLTSATRATPLSLRVATWSPQITSIRKYS
                     DHHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVN
                     DLPTAVRVFEALKYKVENEDQYKAYLDELKEVREELGVPLKEDLFPSSSQ"
     gene            complement(<36171..>37169)
                     /locus_tag="CAGL0J00451g"
                     /db_xref="GeneID:2889895"
     mRNA            complement(<36171..>37169)
                     /locus_tag="CAGL0J00451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447731.1"
                     /db_xref="GeneID:2889895"
     CDS             complement(36171..37169)
                     /locus_tag="CAGL0J00451g"
                     /note="highly similar to uniprot|P00359 Saccharomyces
                     cerevisiae YGR192c TDH3 glyceraldehyde-3-phosphate
                     dehydrogenase 3 or uniprot|P00358 Saccharomyces cerevisiae
                     YJR009c TDH2 or uniprot|P00360 Saccharomyces cerevisiae
                     YJL052w TDH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447731.1"
                     /db_xref="GeneID:2889895"
                     /db_xref="GOA:Q6FPW3"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /translation="MVRVAINGFGRIGRIVLRIAMKRDGIDVVAINDPFITNDYAAYM
                     FKYDSTHGRYDGEVTHDDKDLIIDGKAIKCYQERDPADLPWGDNDIDIVIEATGVFTA
                     KDLAEKHITAGAKKVVITGPSATAPMFVKGVNDDKYTSDVTVISNASCTTNCLAPLAK
                     VLQDNFGIEEALMSTVHSQTATQKTVDGPSKKDWRGGRTASANIIPSSTGAAKAVTKV
                     LPELEGKLTGMAFRVPTVDVSVVDLTVRFAKDVTYDEIKAAIKKASEGEMKGILAYTE
                     DAVVSTDFLGDTHSSIFDASAGIQLSPRFVKLVSWYDNEYGFSARVVDMVELVSKA"
     gene            <39305..>40402
                     /locus_tag="CAGL0J00473g"
                     /db_xref="GeneID:2889876"
     mRNA            <39305..>40402
                     /locus_tag="CAGL0J00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447732.1"
                     /db_xref="GeneID:2889876"
     CDS             39305..40402
                     /locus_tag="CAGL0J00473g"
                     /inference="similar to AA sequence:UniProtKB:P38779"
                     /note="similar to uniprot|P38779 Saccharomyces cerevisiae
                     YHR052w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447732.1"
                     /db_xref="GeneID:2889876"
                     /db_xref="GOA:Q6FPW2"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="InterPro:IPR028365"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW2"
                     /translation="MAKKGVKKQVKNKEEGLSRERIGRALGSLKKYLEAQEGGEKTQL
                     LEDESLGDLQLLFTNAESFTGSKKSFKLKLVDVKHSLYAKWKAASATEIKDFKVLLIL
                     KDSDVSKVTQDELYDQLNESGIEIDEIICGKDLKTTYKAYEARNAFISQFSLVIADDS
                     VVTALPKLLGGKAYSKVETTPIPIRCNLKGQFSLNALTNQIKKIYLHKLPVRAPRGNM
                     LNVHLGRVNWFTDEEIIDNIESVADALIKDAKIRNIMLKTTTSPSLPIYRNDNVIDEM
                     VKENTVDDEKAEDVKTVKIGEVDVELSNFDRALMEVANPEEYETMFSKQISKAKRARE
                     EEPEVEEKTPVKKGKNDSKQVKGKKSPKSKK"
     gene            complement(<40807..>42804)
                     /locus_tag="CAGL0J00495g"
                     /db_xref="GeneID:2889877"
     mRNA            complement(<40807..>42804)
                     /locus_tag="CAGL0J00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447733.1"
                     /db_xref="GeneID:2889877"
     CDS             complement(40807..42804)
                     /locus_tag="CAGL0J00495g"
                     /inference="similar to AA sequence:UniProtKB:P38767"
                     /note="similar to uniprot|P38767 Saccharomyces cerevisiae
                     YHR032w ERC1 ethionine resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447733.1"
                     /db_xref="GeneID:2889877"
                     /db_xref="GOA:Q6FPW1"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW1"
                     /translation="MPNQFKYTTDERRSSVIYSTSVGKGGLYVPQDYIPPEATERVID
                     EEMERGDSSDEPLTYQSLSVNRNSNAGSNKRRSDEYQSLIEANNARTLQREHNARQSI
                     TNADGYGAISNYRKNSINKELLEEERDLLIDNHLLDTSKSRRHSQSVGINAAQDFFLG
                     QGYNENTNSVHPDLFIEGEEEVEEEEEEEEIINTWEDAIESGKEISTSFHREIQVISV
                     NAFPLVFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANITCLAAIQGLCTCLDT
                     LCSQAYGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMIPEKELCSLAA
                     SYLKITAIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYILVWDKNIGI
                     GYLGAPTSVAISYWAMALGLLAYTVLTKHPANPMKCWNGVIKPNQLFRNWKKMFNLAL
                     PGIIMVEAEFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISVSTSTRVAN
                     FIGASLYKSCIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSLVVSTLP
                     ILAFMQLFDAFNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAFVFNTGVGGL
                     WYGITCALVMMSICQGYAVFHCDWKQIIEAAKVRNSESCRP"
     gene            <44256..>46373
                     /locus_tag="CAGL0J00517g"
                     /db_xref="GeneID:2889875"
     mRNA            <44256..>46373
                     /locus_tag="CAGL0J00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447734.1"
                     /db_xref="GeneID:2889875"
     CDS             44256..46373
                     /locus_tag="CAGL0J00517g"
                     /inference="similar to AA sequence:UniProtKB:P38766"
                     /note="similar to uniprot|P38766 Saccharomyces cerevisiae
                     YHR031c RRM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447734.1"
                     /db_xref="GeneID:2889875"
                     /db_xref="GOA:Q6FPW0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:Q6FPW0"
                     /translation="MRRQAKKDPKQKSINSFFFKAAKSKSLIVNSSSRSQAHSTLPSS
                     QGSSRSDGTSFGSGRVMKQRSTLTKSNLFTFQGSFNDEDCNPQNEFRKLMNPQEINNF
                     KTPSLSRMPSFTRSNSSMSLSPVKRTTTVLSSDDEFREVTTFQSQDAKRQLSFTSSVD
                     TSAMRQHNNLINTNNDLANFSGLKFRKLKAPNQNSNKKSTSSPYGKPLISLTKEQQTV
                     VDYVVKKNMNVFYTGSAGTGKSVILRTIIDKLSSMYGKESIAITASTGLAANTIGGST
                     LHKWSSCGIGNKSVDHLVRQIRRYHDQYAIWRHTKVLIIDEISMLDGHYLDKLEAVAK
                     QLRNNDRPFGGIQLVLTGDFFQLPPVSKKDDDKNVVFCFDSKMWKKCIQKTILLTKVF
                     RQQDNELVDILNAIRYGELQNDMIKRIKSLGRDVYYPDGISPTELFPTRREVDISNSR
                     QLEALPGEAKIYESVDVAPPSYQNMLDNSVMAEKKLTLKEDAQVMMLKNKPESELFNG
                     TLGRVLFFSTEKLIRRMKELYGSSPLDEDLITDMRLVSRVIARPDIASSERFMKEVNM
                     RPMERFHKLQTMINDAVTTSIKEQVFPYVKWSLNHGRYNYELMLPERFPVDIPGDKLG
                     LERNQLPLMLCWALSIHKAQGQTIQRLRVDLKNIFESGQVYVALSRAISMDSLQVLNF
                     NPKKISIDPKVKEFYRQLEILDT"
     gene            <47095..>48561
                     /locus_tag="CAGL0J00539g"
                     /db_xref="GeneID:2889880"
     mRNA            <47095..>48561
                     /locus_tag="CAGL0J00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447735.1"
                     /db_xref="GeneID:2889880"
     CDS             47095..48561
                     /locus_tag="CAGL0J00539g"
                     /note="highly similar to uniprot|Q00772 Saccharomyces
                     cerevisiae YHR030c SLT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447735.1"
                     /db_xref="GeneID:2889880"
                     /db_xref="GOA:Q6FPV9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV9"
                     /translation="MDVERQTFKVFNQDFTIDKRFELIKEIGHGAYGIVCSARFTEAS
                     EETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGL
                     YLYEELMECDMHQIIKSGQALTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVN
                     ADCQLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTG
                     CILAEFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKI
                     PFSELFPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPADEPECNEKFEF
                     SFESVNEMEDLKRMVVDEVQSFREFVRQPLMDDKSQEDEQQQGSPENYQQTSPTNISP
                     QRLHNNGSHDLLQEPEFLTQTPNQNSTIPDQLQESFVGIHSDNLPEHDTDFPPRPQEN
                     ILASPMGLPSASDRNSMNNDSFLDLERELEFGLDRRYL"
     gene            <48915..>49796
                     /locus_tag="CAGL0J00561g"
                     /db_xref="GeneID:2889878"
     mRNA            <48915..>49796
                     /locus_tag="CAGL0J00561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447736.1"
                     /db_xref="GeneID:2889878"
     CDS             48915..49796
                     /locus_tag="CAGL0J00561g"
                     /inference="similar to AA sequence:UniProtKB:P38765"
                     /note="similar to uniprot|P38765 Saccharomyces cerevisiae
                     YHR029c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447736.1"
                     /db_xref="GeneID:2889878"
                     /db_xref="GOA:Q6FPV8"
                     /db_xref="InterPro:IPR003719"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV8"
                     /translation="MLQVPFKQVNVFSGEPFKGNPVAVINCLDLDESNYLTDEEMQSI
                     ANWTNLSETTFIYKSQNPQADYKVRIFTPVSELPFAGHPTVGTCKAYLDIVGKPISGN
                     YIVHQECAAGLVPIEIKDGIVSFSAPRVAPTELSDEVIAEYTKIVGHPYTHRPQMIDS
                     GPQWVVYLVEDADTCYNINPNFQNLKLLNLDNDHSGVIIAGPRSDNEWEMRAFVPVLS
                     VPEDPVCGSGAAAFIGHLQQRFQYKETTNVKITQGGRLNRNGLIVGQINLDNEKPVYK
                     IGGVPVTVVDGTITVRV"
     gene            <50462..>52915
                     /locus_tag="CAGL0J00583g"
                     /db_xref="GeneID:2889879"
     mRNA            <50462..>52915
                     /locus_tag="CAGL0J00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447737.1"
                     /db_xref="GeneID:2889879"
     CDS             50462..52915
                     /locus_tag="CAGL0J00583g"
                     /inference="similar to AA sequence:UniProtKB:P18962"
                     /note="similar to uniprot|P18962 Saccharomyces cerevisiae
                     YHR028c DAP2 dipeptidyl aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447737.1"
                     /db_xref="GeneID:2889879"
                     /db_xref="GOA:Q6FPV7"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR002471"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV7"
                     /translation="MEEQPERIRDDAFYWKKRFVVDRMLKFAVLLVLLVWGSVLLLKM
                     VTPLKEDHKRHQLPSNTTVDGKLLINFDNIRNGTFKPTRHNLQWIKSTKKGSDDDMGL
                     YATKIDDKFVIKSVLDEDYEDVLLKEKTFEYDGKNYTADDIIASPDLSKLLVRSSTVK
                     NWRHSNFGTYFLYDAKKAEFDQLAENVALAVWSPNSVDVAYVQNNDIYVYSTKTDETI
                     IVTDDGNENVFNGIPDWVYEEEVFSNDRALWWSPNGDYLAFLKTDETNVGEFSIPYYA
                     QKEDDVYPEVKTIKYPKSGTPNPVVDLWVHRFNDDSTYPLNISSHHESDSTLITEVTW
                     ISESSLVTKFSDRSSDVRLVLHFNADTKHAKVARKEPADDGWWEITHNTLRIAKDENM
                     GIIEDGYVDVANIDGYNHLVYFSPADSKYPQVLTSGEWEVIDGTLAFNSKTGNLFFIG
                     TREGKSTERHLLYVNINKPKEVHQVTDDSKRGVYTASFSSKTRFALLSYDGPDVPYQK
                     IIELDTDKRDEHIHGNSIGKTLYYLEENKKIRDNLKDYARPRKTYQELNLGKDKDGNN
                     IIVNSYEILPVNFDSKLKNEYPVFFFAYGGPNSQQCIERFSIGLDEVIATELNAIVVV
                     VDGRGTGLKGRPFRAVVRDNLGNYEAEDQIRAAKLYKSKPFVNSDKISLWGWSYGGYL
                     TLKTLEKDAGENFKFGISVAPVTDWKLYDSVYIERYMHTPQENPEGYEKSKVSDVEAL
                     GKARRFLIMHGTGDDNVHFQHTLKLLDRLNLKAIENYDVHVFPDSDHAIKYHNANDMI
                     YNRIVSWTRKAFNGEFDPK"
     gene            <53432..>56383
                     /locus_tag="CAGL0J00605g"
                     /db_xref="GeneID:2889882"
     mRNA            <53432..>56383
                     /locus_tag="CAGL0J00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447738.1"
                     /db_xref="GeneID:2889882"
     CDS             53432..56383
                     /locus_tag="CAGL0J00605g"
                     /note="highly similar to uniprot|P38764 Saccharomyces
                     cerevisiae YHR027c RPN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447738.1"
                     /db_xref="GeneID:2889882"
                     /db_xref="GOA:Q6FPV6"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016643"
                     /translation="MSTDKKKEEVPKPETEDLTVKDETKNKDKKKANEEEELSEEDQK
                     LKGDLEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDLCKA
                     YDKWSDKDQKSSLADMLSVLAMTYSDTHQHDSLRFRLLSDTSNIASWGHEYVRHLALE
                     IGEVYNEQVEKEAEDNSTSTESSPQPPHMNFEFSKDVILQLSLEIVPYFMKHNGEEDA
                     VDLLLEIEAIEKLPQFVDENTYKRVCQYMIACVQLLPPPEDISFLQTAYSIYLSELQL
                     PEALSLAIRLGNEDMIRSVFDATSDPIVHQQLAYILAAQRVPFEHPELQEIIGNTKLS
                     EHFLYLAKELNLLTPKIPEDIYKSHLDSSKSVFSSAGLDSAQQNLAASFVNAFLNLGY
                     CNDKMITDNDNWVYKTKGDGMTSAVASIGSIYQWNIDGLQQLDKYLYVDEPEVKAGGL
                     LGIGIASAGVHHDVEPALLLLQEYINHSDTKISTAAILGIGIAFAGSKNDEVLGLLLP
                     VVSNTENSLELAAIAALALSHVFVGTCNGDITTAVMDNFLERTPLELKSEWARFLALS
                     LGLLYLGQGEHVDDVLETINAIEHPMTSAIEVLISSCAYTATGDVLLVQDLLHRLTPK
                     AVKSSDEDEDEDNEELSQEDMNGISAFLGKKENEIAEEPQGNEGADNEMEVDSHQDET
                     TTGENNVKKEENEEEKTEKSEKTENDEEEEDEEESKDEGANDELAYAVIGIALITMGE
                     EIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGLVSVADPQMKVFDTLTRFSHDPDLDVS
                     MNSIFAMGLCGVGTNNARLAQLLRQLASYYSREQDALFITRLAQGLVHLGKGTMTMDI
                     FNDAHVLNKVTLASLLTVLVGLISPSFILKHHQLFYMLNSGVRPKFIITLNEEGEQIK
                     VNVRIGQAVETVGQAGKPKTITGWITQSTPVLLGHGERAELENDEYISYTNNIEGVVI
                     LKKNPNFQEEE"
     gene            complement(<56779..>57414)
                     /locus_tag="CAGL0J00627g"
                     /db_xref="GeneID:2889881"
     mRNA            complement(<56779..>57414)
                     /locus_tag="CAGL0J00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447739.1"
                     /db_xref="GeneID:2889881"
     CDS             complement(56779..57414)
                     /locus_tag="CAGL0J00627g"
                     /note="highly similar to uniprot|P23968 Saccharomyces
                     cerevisiae YHR026w PPA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447739.1"
                     /db_xref="GeneID:2889881"
                     /db_xref="GOA:Q6FPV5"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV5"
                     /translation="MAVVADKPLVGKINYSRYFYYLVLFVVVVYALRKMLTGHGSDID
                     IGRFLSKTSPYMWANLGIASCIGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISI
                     IFCEVVAIYGLIMAIVFSSKLTVSSKDSLYSKSNLYTGYSLFWAGLTVGVSNLICGVS
                     VGITGATAAVADAADSSLFVKILVIEIFGSILGLLGLIVGLLMAGKAADFQ"
     gene            complement(<58040..>59113)
                     /locus_tag="CAGL0J00649g"
                     /db_xref="GeneID:2889884"
     mRNA            complement(<58040..>59113)
                     /locus_tag="CAGL0J00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447740.1"
                     /db_xref="GeneID:2889884"
     CDS             complement(58040..59113)
                     /locus_tag="CAGL0J00649g"
                     /note="highly similar to uniprot|P17423 Saccharomyces
                     cerevisiae YHR025w THR1 homoserine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447740.1"
                     /db_xref="GeneID:2889884"
                     /db_xref="GOA:Q6FPV4"
                     /db_xref="InterPro:IPR000870"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV4"
                     /translation="MVRHFKIKVPASSANIGPGYDVLGVGLNLFLELDVEIDALNAQE
                     TNDDKNNCKLSYTEDSEGYDSVPLESDANLITRTALYVLRCNDIRKFPSGTKINVHNP
                     IPLGRGLGSSGAAVVAGVVLGNEVGQLGFSKQRMLDYCLMIERHPDNITAAMMGGFCG
                     SFLRDLTTQEMERREIPLSEVLPEPSGGEDTGLVPPLPPSDIGRHVKYQWNPAIKCIA
                     IIPQFELSTADSRGVLPKAYTTQDLVFNLQRLAVLTTALTLDPPDAKLIYPAMQDRVH
                     QPYRKTLIPGLTEILNSVTPTAYPGLLGICLSGAGPTILALATENFEDIAAEIINGFH
                     KKNVKCTWKLLEPAYEGVTVEQL"
     gene            <59501..>60946
                     /locus_tag="CAGL0J00671g"
                     /db_xref="GeneID:2889885"
     mRNA            <59501..>60946
                     /locus_tag="CAGL0J00671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447741.1"
                     /db_xref="GeneID:2889885"
     CDS             59501..60946
                     /locus_tag="CAGL0J00671g"
                     /note="highly similar to uniprot|P11914 Saccharomyces
                     cerevisiae YHR024c MAS2 processing peptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447741.1"
                     /db_xref="GeneID:2889885"
                     /db_xref="GOA:Q6FPV3"
                     /db_xref="InterPro:IPR001431"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV3"
                     /translation="MLRNSLRVAQRRGYFQVSRLKNGLRVATSDTPGHFSALGMYVSS
                     GSRYETGSLKGCTHIVDRLAFKSTKNIDARSMMETLELLGGNYQCTSSRESMMYQASV
                     FNRDVEKMLNLLAETIRFPKITEEELQEQKFTAQYEIDNIWTKPDLILPELLHNTAYS
                     GETLGSPLICPREILPSITKKSLLNYREKFYNPENTVAAFVGQPHEKSIELAEKYLGD
                     WTTTGEPLDKTAAHYTGGETCIPSAPVFGTMPELMHIQIGFEGLPIDHPDIYALATLQ
                     TLLGGGGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVSFNHAYSDSGIFGISLSCIPQ
                     AAPQAAEVIAQQFYNCFANGALRLTDAEVSRAKNQLKSSLLMNLESKLVELEDMGRQV
                     LMHGKKIPVSEMVSKIESLTTKDISRVAEMVFTGKAHNKGNGTGRATIVMQGDRAAFG
                     DVQEVLGHYGLGSSSFSTDQSKSSTTKLKWF"
     gene            complement(<61246..>66900)
                     /locus_tag="CAGL0J00693g"
                     /db_xref="GeneID:2889886"
     mRNA            complement(<61246..>66900)
                     /locus_tag="CAGL0J00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447742.1"
                     /db_xref="GeneID:2889886"
     CDS             complement(61246..66900)
                     /locus_tag="CAGL0J00693g"
                     /inference="similar to AA sequence:UniProtKB:P08964"
                     /note="similar to uniprot|P08964 Saccharomyces cerevisiae
                     YHR023w MYO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447742.1"
                     /db_xref="GeneID:2889886"
                     /db_xref="GOA:Q6FPV2"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR027401"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV2"
                     /translation="MNQDMRVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKD
                     NDGETATFKISEIFPVNPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLF
                     LVAINPYKEISNLYSNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVT
                     GESGAGKTENTKKILQYLASITSDSFEVSNNFEMKILQSNPVLESFGNAQTVRNNNSS
                     RFGKFIKIEFDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLES
                     IYKLSSNDFAHYQILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVI
                     LHCGNIEFVSEKSEQASFKSDISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNA
                     NQARFIINSLCRTLYEHLFGYIVDTINMSLNHGSMTANYIGLLDIAGFEIFEHNSFEQ
                     LCINYTNEKLQQFFNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGI
                     LPLLDEETILPKSEDSSFYSKLISTWQQNSTKFKRSKLDMCFVLKHYAGDVEYHVNGW
                     LAKNKDPLNENLVNILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGK
                     GRTNLKTALSRHREQQSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNG
                     VLEGIRIAREGYPNRILFKEFYERYRILSEHLDKSSDAINYKQSSQILISELHLDPTT
                     YKVGTSKLFFKAGTLAELESKKESILFEITVRFNSIIRGWSQRKRTKGEIQKMRASEM
                     IGNVFRKYNEKMQDPWFNMYMKIKPLLASSQNIVDSRKYTEKIKVLEQKLTAVETEKK
                     IHTAKHNDLLNELNDVKNLLDVEKEKLKRNEQLLSKSNEQQREIETMIKEIREDKSTL
                     LSEKEAAISKIQELELVRQKLEEKNNEKDASIAELTRKLSSLESEKGDITRQISMDTE
                     VLKKLENEKMEKERVIEKLSHDIKERDHIIDELKQKEHISNKDLDIKLQTLEKNCNVA
                     LTKLKSLLNENAELREEVGKNKKLHANTIQQVSSKEKEIERLKARFASNQGEINEILK
                     QRDSLMAENDKLSKELSEMKMALRKANENYAQMKNQIEEMAKQEHINRENSPMESRSD
                     ISLLKKQLEDEKSLNKYLNQKLLGDRVVQRSLHLDDLSNADKDVLLKKYYEIKTALHE
                     QSTSLEEAIEENKNLISRLRFTETRLASSSFESQTVKAQLKKLKHFLENKGMQADIDQ
                     LLSDIKPSDVNVEQILLEVQHLKMQLNAEQKAHKEAEAAITALHSKFELIQKVDSTSD
                     IYKIKYEASEEHVRALENKLRSLPFKDRTNLPSGEIFTNKDSISKYEEELRFYKIENF
                     KLQDKLSEFENICGSLKHEIKQGSVKEVLLEEQVERLQKDLESTERQKEMLTSNLRQQ
                     RQQYEDCLSDLNANETQLREYNHALKQAEDDIKGMATVIEKLKSSNKQKDKTIWDRET
                     EKNDLDMQLQETLLELKRVQDMNQLLQTDVHHFKERLNTSSDVSRYTNEIERLKEALD
                     ESSKYSGEFKKEISTLKYKLETLKNDSEAKIEHLLKQSEHYETIVGQLGEERDENQEI
                     IKDLNQKLIDMESNLKKLNDDYEALSQQRDTLLQESDRLRSELGNSTEQFNATVKHNV
                     DVNDKLRNLEETLRLQTEQNERNEQLVKSIQMDLESYKMKYDEEKQKNIDLVEEAETL
                     KSVTVRLEETIKDLDQRLSDTSEKEAWLRKIHEVETLLNDERDMKIEEMKKSKALERT
                     INELEARNASQVEVIETANGDRTKFEETVMKYNEQMHQLEKYISQQEIDMKKVVRENM
                     EYQEKMNEMERELMLWKQRYHVASGGTNNFSQRNEEEVMVQT"
     gene            <70057..>70941
                     /locus_tag="CAGL0J00715g"
                     /db_xref="GeneID:2889883"
     mRNA            <70057..>70941
                     /locus_tag="CAGL0J00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447743.1"
                     /db_xref="GeneID:2889883"
     CDS             70057..70941
                     /locus_tag="CAGL0J00715g"
                     /note="some similarities with uniprot|P01119 Saccharomyces
                     cerevisiae YOR101w RAS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447743.1"
                     /db_xref="GeneID:2889883"
                     /db_xref="GOA:Q6FPV1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV1"
                     /translation="MEILLYDVSDNPTPRCLDNTARITVMGEHGSGKTTLITRWLRNM
                     FIQVDQGDYDIYTTHVARQNIHQYDHEINAALSKTKSEMLAKNPSDENITPAMTRASS
                     YKNRHPLKVQILDAEPVEIGEYSDLRNMQIEQSDAFILCFDCADSNAVDELRGYKRKI
                     DSIRGNALIMLCCTKVDLSAERVFGIEETQDILEKLNISPSDYYEVSSKHAIGTERLL
                     YRTLAHIEDCKTSERIDMVKNSIATSEEEKSSTDSVSTETLKEDEKKTRGRLLHPRAI
                     RKLSHNDSPAQQQCCCIM"
     gene            <72900..>73831
                     /locus_tag="CAGL0J00737g"
                     /db_xref="GeneID:2889865"
     mRNA            join(<72900..72902,73586..>73831)
                     /locus_tag="CAGL0J00737g"
                     /product="40S ribosomal protein S27"
                     /transcript_id="XM_447744.1"
                     /db_xref="GeneID:2889865"
     CDS             join(72900..72902,73586..73831)
                     /locus_tag="CAGL0J00737g"
                     /note="highly similar to uniprot|P38711 Saccharomyces
                     cerevisiae YHR021c RPS27B or uniprot|P35997 Saccharomyces
                     cerevisiae YKL156w RPS27"
                     /codon_start=1
                     /product="40S ribosomal protein S27"
                     /protein_id="XP_447744.1"
                     /db_xref="GeneID:2889865"
                     /db_xref="GOA:Q6FPV0"
                     /db_xref="InterPro:IPR000592"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR023407"
                     /db_xref="UniProtKB/TrEMBL:Q6FPV0"
                     /translation="MVLVQDLLHPTAASEARKHKLKTLVQAPRSYFLDVKCPGCLNIT
                     TVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
     gene            <74694..>79826
                     /locus_tag="CAGL0J00759g"
                     /db_xref="GeneID:2889866"
     mRNA            <74694..>79826
                     /locus_tag="CAGL0J00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447745.1"
                     /db_xref="GeneID:2889866"
     CDS             74694..79826
                     /locus_tag="CAGL0J00759g"
                     /inference="similar to AA sequence:UniProtKB:P47054"
                     /note="similar to uniprot|P47054 Saccharomyces cerevisiae
                     YJL039c NUP192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447745.1"
                     /db_xref="GeneID:2889866"
                     /db_xref="GOA:Q6FPU9"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021827"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU9"
                     /translation="MKWSVSQFSDLYASIDAKAISSELFTQLLPDLKELLKYPPKNTE
                     SRNKLEKLQDYKTDDGSIFKLNQDFIISIISLSDELNLDELEAVNLVLENSPGSQIYA
                     SEVVNNGKISFFLRRQYILQIVSYICNAEDVMSPYYKKFFNAETNTTILSKVLENFDI
                     ISKHLSDIKQEVNRNQILDNMNPLITQGIHFKRDFFSKEYDLLSQVLYGLSKRSLINT
                     QISSVDLIIEHSLKMETNDFFVVYFLPTLLNLFSNLNTFSDVDIFGLHKKYTNELITK
                     QEQVYKKPMKVLIMFIFLTFLIGWCKEDPQNRVTKLNFKSDIDDPMTIAVELGAIEQL
                     LIVIADLSRIDESTAVQYYDFRALLERHLPRFIPLQLVDENVIQKYNQMSSLTERSDS
                     TKINGPHESFSRNTYRPPSMISPNNYSKDNRFTNGLGSTSISMDRLNEGRVFFSTSDM
                     NKEISKFRENISEMFEMFLEENIHHFIQTFISDCAFLLTKLKDAEEDSLLSGEDLDLD
                     DIATKADLERFFVSVFYFYSKRPHYVAAFWEDKESAAYGFVEWASKCNDNLMKSCFYL
                     MLGGLSSGKENALNVYYYLGDSNPTSWKRIADTIGSYSSKILNLGKAIQAKEQENEGE
                     LNTTLLALEEGLNEETIVFLSSLLTLISSVADQMEPDEKLMFSHLFVDVIFELTKCET
                     PLVGACFNTISTLVPILESDRASIWHKLDSTLFKGVALSDTSQYISAFSSILTTYSDV
                     LGFLALIRNLLQIESFDCNKEFLVFGHLQYPNQLGRPYRKSGIWPYLEFVMNEVFVNS
                     DKITDSFKRHELQERVLEIILTCLNSFDYSVLLNSISVGANLDNLVHGENFASYVQDN
                     AAPAMFNFLFQENVYTKLYSIASVGIDNSSLLKPHSQLQTLLRLSLSVIERTLDYEKT
                     YTEELLTIIKKYQSGEFYRPKYYGLHGLVSFTQTVFFNLDFVTCLGLYIGLDNDSIPI
                     ISINILRKLALLFNSTEPDPILGNKLFTLFDSIDESARIKDAFIDQLDCPIENSDNLM
                     LKVEILEFLKDSLDIESSKPSVAHLLLGFQYDNTLTFGPNLSTFIQSGHSLFHSVIRL
                     LISALNELSSYKIDFAPMRLAALSLQLLELMCKSQLTSDLVIEHITNNEIIKKIMDVD
                     PQTSNHTLWNGLNLESTTQSTKARFIQGSSAGAYLMFLRYRTSMIQFLNVVIHTISLK
                     GTISRVAPYTSYLISNSIYSARIFSLLRPLHQNIILKEKIVPENLQLLKDLPVDLDKV
                     QLRKSCTGNIYDFDEISSVLELHSKTYSVSQLNSKEFMDKILSEFEEVKQLITLFLVR
                     KESFSQQLAILHNWVQLVQIIVSDGNLGERKRSTFILEVFDMVTPKISVYVDIDVKFA
                     EELVSLMVFLFHIYNQSNASSSGKYFLDSKLHNLFQVCIRGISSPLSSLKLRSDFYVI
                     ANNYLLRVLKNSGMAYAIVKDLRLNNERLVEVICNDAIYGEGAIKITGLLLLDSLVQL
                     GNHHQENFIVMTLMRSTKLFHIIRSLKATDSLLNASTENVNVENFLYELTAFKATAYF
                     LIRIAETREGAVALIESKVFDILAELNFLKIDPDLGLELVFDETSNNTSSLLRVNITF
                     DEPLILGKEATSVSIFELIIPIFQLMLAIVISSGRFNDAVRLATTSLLKQYQKLIIGT
                     FKRDTLYKSGKKQASDELKYKHHQEFIKLVVLICTITKYEDK"
     gene            complement(<79993..>82593)
                     /locus_tag="CAGL0J00781g"
                     /db_xref="GeneID:2889867"
     mRNA            complement(<79993..>82593)
                     /locus_tag="CAGL0J00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447746.1"
                     /db_xref="GeneID:2889867"
     CDS             complement(79993..82593)
                     /locus_tag="CAGL0J00781g"
                     /inference="similar to AA sequence:UniProtKB:P14907"
                     /note="similar to uniprot|P14907 Saccharomyces cerevisiae
                     YJL041w NSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447746.1"
                     /db_xref="GeneID:2889867"
                     /db_xref="GOA:Q6FPU8"
                     /db_xref="InterPro:IPR007758"
                     /db_xref="InterPro:IPR026010"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU8"
                     /translation="MSAFGNSGGGSFSFGNNSSSAFGAAANAGSNNTGGSSAFSFGAN
                     QNASTPFGGAATNNSANNGGANNTASPFGMNANQNKPLFGGATAGQSSSPFGAASNNT
                     GATPGQTNNTSASQGLFGSNSNNVSQKPAFGFGASNTQATPSFGGFGSAQNGSSNNTT
                     GASAFGAATSNTQNTTPAATNTGSAIGSTPAFGFNSANNNNNNAQNNKPAFSFGSTQP
                     QSNNTLGTAAGTNSNPGSSGKPAFSFGASNTTSTTGTAGAVGNTSNTPVPPSGSTPKP
                     AFGTSASTTPAPGAGSFSFGSSIGTDANKTDAAKPSLFGGLNKPADAASKPTLSFGST
                     APSSNTTNDKPASDAKPAFSFGNSSTTNNGPSLFSQAKPADEEKKTTPALNFGSASQS
                     GEKTEEKKPAFSFGAAATGSTTQSKPSLSFGSTTKEENKSSSTPAFSFGSKPANDDKK
                     DTPETSNKPEASKPSFSLNLSAGTSEKKDENSTKPFSFGTKTAEKDETKTDKPAFSFG
                     KTTTDTNESKPALSFGGKNENSDKKSTLTFGSQSEKKEDSGAKPAFSFGSKSDKKDEP
                     PKPAFSLGTKTDKTEISESKPGFSFGAKTDKPSTTTDVNKTETPKAGFSLKSDSKADD
                     KSKNFSFGTSKDGKNTSETDKTESAKSNLGTEASSQQKLESKPVEVKPVSLDNKTLDD
                     LVTKWTNQLSSASKHFDQYSKRITDWDRILVDGGKQISQLYTEAVNAEQAQNKIDQSL
                     QYIERQQEELETFLDNYESRTEALLSDILPSNSGVPGNNNDQKRLQAYKTAESLDENL
                     NALSANLSSLIDEVNDVSNTFNNVTSINLNNKDESAQLIKLLNVHLDALKSLDNNALL
                     LENKIDSIQK"
     gene            complement(<83483..>87427)
                     /locus_tag="CAGL0J00803g"
                     /db_xref="GeneID:2889868"
     mRNA            complement(<83483..>87427)
                     /locus_tag="CAGL0J00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447747.1"
                     /db_xref="GeneID:2889868"
     CDS             complement(83483..87427)
                     /locus_tag="CAGL0J00803g"
                     /inference="similar to AA sequence:UniProtKB:P43638"
                     /note="similar to uniprot|P43638 Saccharomyces cerevisiae
                     YJL042w MHP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447747.1"
                     /db_xref="GeneID:2889868"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU7"
                     /translation="MGGLHSAWSRMQVRKTMDRRKSATDVDVAWLIRNSSHRKGVVYS
                     EGDEASEVCKLPMREVKEEGVPLRRTKSASSAPAPTFSESAANASNASVEGGRRGSVS
                     KGKIGFFKSLFSHHRHEVPKPVESAPQSPELSPMQSVQSNGSSPTRRLSQPRTISNES
                     SYAVSAENSKRLDDFIAHCKETLSERQRGIDERQRHASIGRPQSFMTPAQSAPRRLDS
                     RGRPIPPHPSKSAFPPILKRGNCDERKLNVESTVSLSSVDGPAPETPSSATHKFGAFL
                     KKVTSYGSQPSLNPNGTFDSIDRTVSNISDSSHRTTQDRYGTVPGLENCKQLKHVAFA
                     TTTYFNDPPQQICSKNPRKGEVEVKPNGSVIIHRLTPEERKKIMETSSAGIVVGGSGQ
                     LKVLNPIEQQSSDDEDSQKRNIAIAAEEAAAEARGNNKKEEDIEVSKLASHLTIDKPM
                     VSRRPRENPIRTSSSSSLLSILSDEENKNGTDQSPKGSESDSGTDEEEIYPPPNLKIP
                     HDVVYTRCCHLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISP
                     VLCVSLDGVSLTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNF
                     VALDLTMVPTIKTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATK
                     EGGIEEFVLAGACMSYTQFKNFIELACTNTDRLGLAYNKLTMEQCKVLAEWIVTSNIR
                     GLDLGFNDLKGKTSVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLR
                     LLSVLCYSENLKFLDLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVL
                     AESLPLCSKLHHLSLLGSKLNLASAKALTEAVNKSNTLMTLDLEYNTVPESIKERMSL
                     YTMRNIQNELDNVQKTKRKAGLSLPSVPQEEMAANEKQISTLQEELSSLLTDKFEDSL
                     EYDKLVVEFIEKITKVRTKIEKVVSDLFDLRVKNELSCEGKETLINLCLIDSSFEQGI
                     HLLKQRHNKLQKHTVAAPTSIHDEKTNLTSNKAMNKLLNNPMFSDPFANDSMSKLSNN
                     DSDQSLERTQRDRTILSSSAFGNTGHSALLPFGTATVEESNKAADDTVEFRESENSYK
                     TIVRGPSTDPIGTKYDILNKELEHLQKNKANKPAEKLYTLDSGVSINSDELTRAAESL
                     ESEKIKDFLLKNDVATIVNVIDELHEKGYHLHDIFRKQEVDDHKKEEILKTLQEDQSH
                     NKSNNPFLESTGNGASAEAKKAIPKYMEEKAIDEAYDQVLDNIARIRSKTHE"
     gene            <87530..>88843
                     /locus_tag="CAGL0J00825g"
                     /db_xref="GeneID:2889869"
     mRNA            <87530..>88843
                     /locus_tag="CAGL0J00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447748.1"
                     /db_xref="GeneID:2889869"
     CDS             87530..88843
                     /locus_tag="CAGL0J00825g"
                     /inference="similar to AA sequence:UniProtKB:P32806"
                     /note="similar to uniprot|P32806 Saccharomyces cerevisiae
                     YJL044c GYP6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447748.1"
                     /db_xref="GeneID:2889869"
                     /db_xref="GOA:Q6FPU6"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU6"
                     /translation="MGKSYWYKQRSRMDWFSQRAVDLGYDHGGVVARGVWLGEFYEGM
                     SRSDERCAGRGSRSWLWTHLAGEELPELEMPGAEYRHEESRSVSGSGSGSGSGGRAGH
                     THATYGGHGGLGKGNVRVLTPVRATAHPLAGAEKGDLSERLNTSMEIVDLDLKRLLIH
                     PMFSEPQHVKNMKLLLYNYLLDSIEYKQGFHEIMGMIYMQIYDNDENSETKLRTVLKL
                     FTTLMAPLNKVFYEEDNLLNWEQKIFRPMLMGLSPKVFSIIYSGHGKHHNNNLIWIIR
                     WTRLLFIREIASKVDILELWDHLLTVPAAQFPLFMAAFISVMLLSIYDQVVEFSRDKT
                     LDHDDLIEILLLRYKEMNPHIDVVKYCQVAMEATEQFNAGELDKLFGTATKFLEWKYR
                     DSPQILAMHQQSRDMKLGRPDIPPDPNRLRMEEKLKQRVLQRLHR"
     gene            complement(<89492..>91624)
                     /locus_tag="CAGL0J00847g"
                     /db_xref="GeneID:2889870"
     mRNA            complement(<89492..>91624)
                     /locus_tag="CAGL0J00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447749.1"
                     /db_xref="GeneID:2889870"
     CDS             complement(89492..91624)
                     /locus_tag="CAGL0J00847g"
                     /inference="similar to AA sequence:UniProtKB:Q00711"
                     /note="similar to uniprot|Q00711 Saccharomyces cerevisiae
                     YKL148c SDH1 or uniprot|P47052 Saccharomyces cerevisiae
                     YJL045w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447749.1"
                     /db_xref="GeneID:2889870"
                     /db_xref="GOA:Q6FPU5"
                     /db_xref="InterPro:IPR003952"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR011281"
                     /db_xref="InterPro:IPR014006"
                     /db_xref="InterPro:IPR015939"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU5"
                     /translation="METDFSENQSETTKCEAAQCCPLYAALVPYPSLPAGSRARARAR
                     VLCGSETYIRDMLRYVVGLGGETIHRSGEQEISKNPNTSTHKKMLRTGLRLRQLSTSC
                     VRRHAAPAGLGAGKYNVIDHEYDCLVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRS
                     HTVAAQGGINAALGNMHKDNWKWHMYDTVKGSDWLGDQDAIHYMTREAPKSIIELEHY
                     GMPFSRTEEGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHDCH
                     FFIEFFAMDLLTHNGEVVGIIAYNQEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTC
                     TGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERY
                     APTAKDLASRDVVSRAMTMEIREGRGVGKHKDHIFLQLSHLPPAVLKERLPGISETAA
                     IFAGVDVTKQPIPVLPTVHYNMGGIPTKWTGECLTIDENGEDKVIPGLMACGEAACVS
                     VHGANRLGANSLLDLVVFGRAVANTVADTLQPGTPHKPLPADLGKESLASLDAIRNAS
                     GDKTTAQIRLNMQKTMQKDVSVFRMQETLDEGVKNITAVDKTFKDVHVTDKSMIWNSD
                     LVETMELRNLLTCATQTAVSAAERKESRGAHAREDYPSRDDENWRKHTLSWQQHTGDP
                     VSIKYRKVIATTLDEAECPPVPPAVRSY"
     gene            complement(<92049..>92699)
                     /locus_tag="CAGL0J00869g"
                     /db_xref="GeneID:2889871"
     mRNA            complement(<92049..>92699)
                     /locus_tag="CAGL0J00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447750.1"
                     /db_xref="GeneID:2889871"
     CDS             complement(92049..92699)
                     /locus_tag="CAGL0J00869g"
                     /note="highly similar to uniprot|P35718 Saccharomyces
                     cerevisiae YKL144c RPC25 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447750.1"
                     /db_xref="GeneID:2889871"
                     /db_xref="GOA:Q6FPU4"
                     /db_xref="InterPro:IPR004519"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU4"
                     /translation="MFILTKLKDLVRIPPDQFHRDAVSAITHELNVKYSNKVVPHVGL
                     SVSVYDLLEVDEGQLRPGDGASYINVTFRCVVFKPFAGEILTGWIKRCDGEGIQVSMM
                     GLFDDIFIPKKMLFEGSYYSPEDGAWVWPMDEETKLYLDVNEMIRFRVEEEVFVDVKP
                     PSPKELELERERELQLQEQQEHQQHQQQESKLEKPPAYALLGSCQTDGMGLVSWWD"
     gene            <92958..>94358
                     /locus_tag="CAGL0J00891g"
                     /db_xref="GeneID:2889872"
     mRNA            <92958..>94358
                     /locus_tag="CAGL0J00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447751.1"
                     /db_xref="GeneID:2889872"
     CDS             92958..94358
                     /locus_tag="CAGL0J00891g"
                     /inference="similar to AA sequence:UniProtKB:P34078"
                     /note="similar to uniprot|P34078 Saccharomyces cerevisiae
                     YKL143w LTV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447751.1"
                     /db_xref="GeneID:2889872"
                     /db_xref="GOA:Q6FPU3"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU3"
                     /translation="MSKKFTSKNSQKFAVVHRPHDDPNYYDADATEHVLVPVDPKGKQ
                     AVKQRPQRQRKPVNEHVGEARIYGIGFDDSKYDYTQHLKPIGQDPNAVFIAKTPAQAP
                     AKKKNIEDLFVEDTYKGEAPTRPDSVFKFGMAKPEYLKHQQDVPDDIRGFKPDMNPAL
                     REVLEALEDEAYVVNEDIVVEDPKKKKGKKKVEVADDLEEEDDDIFAELLQGGEVGSD
                     GEFQDEFDEWDMDNLDEYEETHYQDEMKQFDNIDNLEDLQGIDYQADVMRFQKQQKKK
                     FEEFESDNEFDSDAEGDDLSRGGNVSEDEEEEEDGDVLGDLPTINKKTTGKKKRKERK
                     KKGAMSDISGFSMSSSAIARTETMTILDDKYDNIIASYENYEEEQLDDEYENAKPFNM
                     EEERADFESMLDDFLDNYELDAGGRKIVKKDAERDRIKQAADEVSKGKLSLRRNRERQ
                     KKEVEKVTSSLNSLRF"
     gene            <94620..>95756
                     /locus_tag="CAGL0J00913g"
                     /db_xref="GeneID:2889873"
     mRNA            <94620..>95756
                     /locus_tag="CAGL0J00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447752.1"
                     /db_xref="GeneID:2889873"
     CDS             94620..95756
                     /locus_tag="CAGL0J00913g"
                     /note="some similarities with uniprot|Q07913 Saccharomyces
                     cerevisiae YLR007w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447752.1"
                     /db_xref="GeneID:2889873"
                     /db_xref="GOA:Q6FPU2"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:Q6FPU2"
                     /translation="MSFKLIKSHLLHLKAIARSKKSNGVEVATQMSEGTPNNDVGDDL
                     AGEVRIGLSESEKEKHLLQYLLNCRGVCHENVLLKVMLLMENEQGDLEQGLSVFEWQA
                     KLQERVARINLKLQPLKYQVKKAIYGSGRAIVSEKVRSQLELNSANSFGKVNFPNSSQ
                     YYVYIDTSPFGEMKHATTFTDKELEYIKAFIKVLADRGSVIHEVDDVSGVDSKIVEQI
                     DEIRQKAYGNKRRHDSDVESGPENAENNEPVQSSSVSRWTHYASYTADIAALTDTTDL
                     QPLETQELLDKLCRLRWLYKTGKGKYGLDLRLLVEMNDYLSDNYSMSSCERCKDIVAQ
                     GVQCSTRDCNSVWHVDCYEHDILHENRICRSCGESILDRGVYVT"
     gene            complement(<95878..>96339)
                     /locus_tag="CAGL0J00935g"
                     /db_xref="GeneID:2889874"
     mRNA            complement(<95878..>96339)
                     /locus_tag="CAGL0J00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447753.1"
                     /db_xref="GeneID:2889874"
     CDS             complement(95878..96339)
                     /locus_tag="CAGL0J00935g"
                     /note="highly similar to uniprot|Q07914 Saccharomyces
                     cerevisiae YLR008c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447753.1"
                     /db_xref="GeneID:2889874"
                     /db_xref="GOA:Q6FPU1"
                     /db_xref="InterPro:IPR001623"
                     /translation="MDGTGISDGSSVTGDAAAGFPAGATQAPGSKQGMDLYFDNALQY
                     MGEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQILN
                     LKENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGIVRK"
     gene            <96608..>97201
                     /locus_tag="CAGL0J00957g"
                     /db_xref="GeneID:2889845"
     mRNA            <96608..>97201
                     /locus_tag="CAGL0J00957g"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_447754.1"
                     /db_xref="GeneID:2889845"
     CDS             96608..97201
                     /locus_tag="CAGL0J00957g"
                     /note="highly similar to uniprot|Q07915 Saccharomyces
                     cerevisiae YLR009w"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_447754.1"
                     /db_xref="GeneID:2889845"
                     /db_xref="GOA:Q6FPU0"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="InterPro:IPR024546"
                     /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRR
                     NPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQK
                     RERAFYKNRMKGNSERDFLRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEES
                     EEEEDMEVDSEEEEEEKLQKQKILLKNKKRNAKKLAF"
     gene            complement(97960..98041)
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0J00979r"
                     /db_xref="GeneID:2889846"
     tRNA            complement(97960..98041)
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0J00979r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2889846"
     gene            <98637..>99929
                     /locus_tag="CAGL0J01001g"
                     /db_xref="GeneID:2889847"
     mRNA            <98637..>99929
                     /locus_tag="CAGL0J01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447755.1"
                     /db_xref="GeneID:2889847"
     CDS             98637..99929
                     /locus_tag="CAGL0J01001g"
                     /inference="similar to AA sequence:UniProtKB:P47057"
                     /note="similar to uniprot|P47057 Saccharomyces cerevisiae
                     YJL036w SNX4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447755.1"
                     /db_xref="GeneID:2889847"
                     /db_xref="GOA:Q6FPT9"
                     /db_xref="InterPro:IPR001683"
                     /translation="MDSASADASVTGSGNAKGSSAERVNGGGKFYKLEILVSDPQKRA
                     GEAGLGPYVSYQISTRTDNPSYHGNQKASFDDIIVVHRRYNDVVLLHDILQNDHPTCI
                     IPPLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRRVSQHPILSTSKVLEIFLVGNEW
                     DTYRKNIAGTLQNAQKEDVTDAVMNAFKKVHNQNEEFTEIRDRSDKLDNSVNRINKVF
                     HRVVKKNEAIIEDYSKLGLTLQELQELVSSDNDKLADSLKVFIEGVTQFSYGLQDLNM
                     FIDYEYLIDLKDLSHYIGSMKQTMRLKDQKQIDYEELSDYLTKSIKEKNNLISGYGGG
                     NFLTSKLEELAGYNQEASRRDKINKLESTISSLTTELETAKKVADTFEQETLKEVKKF
                     EEIKNDELKISLNNLADENIKFYERMLETWEKVDQSLR"
     gene            complement(<100059..>100838)
                     /locus_tag="CAGL0J01023g"
                     /db_xref="GeneID:2889848"
     mRNA            complement(<100059..>100838)
                     /locus_tag="CAGL0J01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447756.1"
                     /db_xref="GeneID:2889848"
     CDS             complement(100059..100838)
                     /locus_tag="CAGL0J01023g"
                     /inference="similar to AA sequence:UniProtKB:P47058"
                     /note="similar to uniprot|P47058 Saccharomyces cerevisiae
                     YJL035c TAD2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447756.1"
                     /db_xref="GeneID:2889848"
                     /db_xref="GOA:Q6FPT8"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT8"
                     /translation="MDKYLKHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLN
                     DTNDSLSGTAHAEFVAMRMLRDAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALK
                     QMGIHKIVFGCGNDRFGGNGTVLSIHSDKSTTVAGSTEYDRTILVPGIRRREAIMLLR
                     YFYVRENDRAPKPRTKAERNLDKNTFPPMQWCNYLTRDDFTTIFGEPLISKYDNNEDL
                     AGETINWDMIDNSHDSIINELQQESQNFELFLQNKKHKHST"
     gene            <101282..>103579
                     /locus_tag="CAGL0J01045g"
                     /db_xref="GeneID:2889849"
     mRNA            <101282..>103579
                     /locus_tag="CAGL0J01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447757.1"
                     /db_xref="GeneID:2889849"
     CDS             101282..103579
                     /locus_tag="CAGL0J01045g"
                     /note="highly similar to uniprot|P20448 Saccharomyces
                     cerevisiae YJL033w HCA4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447757.1"
                     /db_xref="GeneID:2889849"
                     /db_xref="GOA:Q6FPT7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAKKHRYTTVQRKQERQKEEEYIKELEQRIQDYDVKNNKAVFFK
                     DLPISKSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAFLVPVLEK
                     LYRERWTEFDGLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNFELERI
                     AKINILIGTPGRILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGNLPPD
                     RQTLLFSATQSQSISDLARLSLTDYKKIGTIDSSEDGPATPKTLQQSYIIADLADKLD
                     VLYSFIKSHLKTKMIVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDK
                     FFRAQQVCLFATDVVARGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSLII
                     LTPQEEAFLTRMAAKKIEPGKLTIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYV
                     KSIYIQKDKEVFKFDELPTEEFANSLGLPGAPRIKIKGMKAIEQAKKLKNTSRSLLSL
                     SKANDDGEINDKKDKQVRTKYDKMFERKNQTILSEHYLNITKSQAQEDEDEDFITVKR
                     KDHELKEEDLPQLTVPTSRRAQKKALSKKASLSTKGNATKMVFDDEGQAHPVYELEGE
                     EEFHKKGDAEEQKKEFLSKEAEIMADRDVSDKIIQKEKKQEKKRKRLEAMRREMEAAY
                     ADEYSDEDEEGGNVAYLGTGNLSDDMEEYSSDEESRKTKKSKTVDYRFDKKNKTISED
                     TDIMEIQEPETIEDLESLTARLIEG"
     gene            complement(<103764..>104904)
                     /locus_tag="CAGL0J01067g"
                     /db_xref="GeneID:2889850"
     mRNA            complement(join(<103764..104714,104902..>104904))
                     /locus_tag="CAGL0J01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447758.2"
                     /db_xref="GeneID:2889850"
     CDS             complement(join(103764..104714,104902..104904))
                     /locus_tag="CAGL0J01067g"
                     /inference="similar to AA sequence:UniProtKB:Q00618"
                     /note="similar to uniprot|Q00618 Saccharomyces cerevisiae
                     YJL031c BET4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447758.2"
                     /db_xref="GeneID:2889850"
                     /db_xref="GOA:Q6FPT6"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT6"
                     /translation="MELLKQKRVQDQLKIEKYRQLTDTVLGLKDKREFTIESLKLTTN
                     LLELNPEFNAVWNYRRDIIVDLGEKLEPKFWEDELMFVMAQLKRFPKVYWIWNHRLWT
                     LQNYPGASVKIWGRELVIVNKLLDADARNYHGWHYRRIVVSHMQKMTGNDMNKEELEY
                     ATTMIKSNISNFSAWHQRVQLIQKMLEKNEIEDKTLFIEKEIDFVTNAMFTDAEDQAV
                     WFYIKWFIRSDLVLKVLTKERYLEMLKTFWENITMINEDELEFSGKENTWCLKLLLVI
                     QQIQKSEGIDIEDHTKIYLEKLLTVDPLRKNRYKHLLKLEC"
     gene            <105079..>105666
                     /locus_tag="CAGL0J01089g"
                     /db_xref="GeneID:2889851"
     mRNA            <105079..>105666
                     /locus_tag="CAGL0J01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447759.1"
                     /db_xref="GeneID:2889851"
     CDS             105079..105666
                     /locus_tag="CAGL0J01089g"
                     /note="highly similar to uniprot|P40958 Saccharomyces
                     cerevisiae YJL030w MAD2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447759.1"
                     /db_xref="GeneID:2889851"
                     /db_xref="GOA:Q6FPT5"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT5"
                     /translation="MDRNLSLKGSTRSITEFFEYCINSILFQRGVYPPEDFSTVRKYE
                     LSLLRTHDDELKDYLRKILSQVHRWLLGGKCNKLVLCIVDKDDGEVVERWQFDVTHFS
                     KEQETAAEVTDEETRNQMRTLIKQITASVTFLPELVKEGGYTFTVLAYTDADAKVPLE
                     WGDSDSKEVKDGEIVQFRSFETNDHRVGAQVSYKI"
     gene            complement(<105760..>108195)
                     /locus_tag="CAGL0J01111g"
                     /db_xref="GeneID:2889852"
     mRNA            complement(<105760..>108195)
                     /locus_tag="CAGL0J01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447760.1"
                     /db_xref="GeneID:2889852"
     CDS             complement(105760..108195)
                     /locus_tag="CAGL0J01111g"
                     /inference="similar to AA sequence:UniProtKB:P47061"
                     /note="similar to uniprot|P47061 Saccharomyces cerevisiae
                     YJL029c VPS53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447760.1"
                     /db_xref="GeneID:2889852"
                     /db_xref="GOA:Q6FPT4"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT4"
                     /translation="MLGDSLDYDPTEDITGMLMSRDSLESLDELISVTRSYKLELSKE
                     IKQLELEDSGEAATESDALALLQTLIEEYEVTKETSMRTQQSIMDVTQGISRLDNAKQ
                     NLSQTMSFFQNLKILTDCYIQCKQLLDSGSFRDMVSPYRIMYSLAGTTFAPYKSVQEI
                     NKLLTSVNRLKSEVFDRIKQKFQQLLSQQEIPPQEDTQQHNELRDGACELLDSDQSAK
                     STLIDWFISKLLYEMNEIFQVDDEAGSLENLARRYIYFKRVLNNFHSNLEQFFLPSWD
                     LPMHLTETFMETTRKDLNILLKREFQDKSPTIDLFMNALQETLEFENYINVRFSKKLN
                     DKPKLSTCFQPYLSVWVSHQDKLMDKKLLSYMSDPKFPENSTDSFIVPSSADLFRNYR
                     AILTQSLELVQESENTAVLTALATFFTKWLGLYANKILEPLILPDNVEVEDKRECAKY
                     TVLVINTAGYCSTTIEQLEERLLEFTSASEQINGIFMQTKSKYDDLAAKGINFLLNRL
                     ITVEISFVWREFKNVDWSNVMVEDYSRYMQTLKTLLKVTRSQPNTEGNVTILEYILKT
                     FNRDIYKWNFLDKVINLVFSEFLGCILKLLQPTPPYASATTKPRLNPRAVVNIGEQLM
                     LDLDLLSNILNSIPENMSGDGESTNNSSMKRTKKRIESDMDKLMKLVKLLIAPVDSPE
                     TYAETYNEITGGNDNSVVWAFILSLKAVPWDLEQWRALRAAYKTKLDERKEEGKPIDH
                     SMLIMEWDSRPMMHFQANICRIQDPEWSKLVRNELRIHPPARTIQRPVTPQPQEPRRG
                     IRELVSNSKLFER"
     gene            complement(108526..108598)
                     /gene="tRNA-Met (CAT)"
                     /locus_tag="CAGL0J01133r"
                     /db_xref="GeneID:2889853"
     tRNA            complement(108526..108598)
                     /gene="tRNA-Met (CAT)"
                     /locus_tag="CAGL0J01133r"
                     /product="tRNA-Met"
                     /db_xref="GeneID:2889853"
     gene            <109127..>109924
                     /locus_tag="CAGL0J01155g"
                     /db_xref="GeneID:2889854"
     mRNA            <109127..>109924
                     /locus_tag="CAGL0J01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447761.1"
                     /db_xref="GeneID:2889854"
     CDS             109127..109924
                     /locus_tag="CAGL0J01155g"
                     /inference="similar to AA sequence:UniProtKB:Q07897"
                     /note="similar to uniprot|Q07897 Saccharomyces cerevisiae
                     YLR003c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447761.1"
                     /db_xref="GeneID:2889854"
                     /db_xref="GOA:Q6FPT3"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT3"
                     /translation="MSFKKQDAEGTGVLMGWDGSSVEMGEKRSNEEELSKRQKKLKHG
                     KLAQKRREQAAYEEEKLRKLPMQGAEAISEHFATVIRAQNPDLSAIELDEMYLKKSEF
                     LGTEAFDGVRNLHEFPGFMARFSRAPRAIVLSMSNIRVADVYRSLGGSSQCVKLFAKN
                     KLHEDVATVESVLGADKDKKDKKDKKDKDSKKKIKYFVATPTRLEKLLESTELFFEGK
                     DKLDIILDASYLDSKKNSLLDSENTKVLCKVLRTMLDKKSSVKVLLY"
     gene            <111185..>112624
                     /locus_tag="CAGL0J01177g"
                     /db_xref="GeneID:2889855"
     mRNA            <111185..>112624
                     /locus_tag="CAGL0J01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447762.1"
                     /db_xref="GeneID:2889855"
     CDS             111185..112624
                     /locus_tag="CAGL0J01177g"
                     /note="some similarities with uniprot|P14164 Saccharomyces
                     cerevisiae YKL112w ABF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447762.1"
                     /db_xref="GeneID:2889855"
                     /db_xref="GOA:Q6FPT2"
                     /db_xref="InterPro:IPR006774"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT2"
                     /translation="MDDGMISEGVKDVYEYSHPIINNALAVSASEQQGKEVRRFATLA
                     DWYDVINDYEFQSRCPIILKNSHRNKHFTFACHLKNCPFKILLSYSSAGMHHGHAQDD
                     MYRSKDEDVDALNDGAHDHKLEYHDVDDPQVTAAIAAAVAAVGKDSSDPHNAATAAAT
                     AAAAATNGGEDHKNLVQDTQPSAHSQAQAQASVRPNSNAPETIRGPFVVTKIIPYHDH
                     PVQDNLSLDKFVLTKIPRILQNELNFDDVLETLVAEGASDGDVAKFRVSEYVEHSGLL
                     DIIKARYDLMDSDITKKFLSQIARRVTTYKARFVLRKKKYGIIKSDRHHPRANPAPAA
                     SGNRPPRISRTRRKRSLEDDETEIAQEALKNSMMDDVDHQRHIDDDDEEHARKLARLG
                     EDTDLHSGIHDDGDHSSTQNAAMHEINPLASIDEVTDDKLPREVAEQLRLLSSHFKDV
                     ENQNLQDEEGKKNSAEISDENIQPELRGQ"
     gene            <113385..>115256
                     /locus_tag="CAGL0J01199g"
                     /db_xref="GeneID:2889832"
     mRNA            <113385..>115256
                     /locus_tag="CAGL0J01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447763.1"
                     /db_xref="GeneID:2889832"
     CDS             113385..115256
                     /locus_tag="CAGL0J01199g"
                     /inference="similar to AA sequence:UniProtKB:Q03153"
                     /note="similar to uniprot|Q03153 Saccharomyces cerevisiae
                     YMR098c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447763.1"
                     /db_xref="GeneID:2889832"
                     /db_xref="GOA:Q6FPT1"
                     /db_xref="InterPro:IPR025210"
                     /db_xref="InterPro:IPR025656"
                     /translation="MQSLLQLKHYPLLTSYLEVLSTQKLHYMLRIRSIARPIVRRPWA
                     NAARVTGISGTRIQVPFPSSVRWYSDREPQTEPVVKDEESEHVPWYMRLEDDSLKSLN
                     EDISKQHEVRLPDDCPDSLHILVKHLQKQLALRDILVFDLKNQRLADPENYRLKMCDY
                     VIICTAMSTKHCERSYVEINKLLKNEYGVSGYVEGQVNPNDEKKRLKRLARKNNLGRT
                     NIRRNALNSTEESSWYMIDCHVDSIFLNILTENRRYEMNLEELYAPLNEKHLYEKSEH
                     SMHINTNNRSQAFDSLEEEDNVLLALRKLAQQKRQYSTESPARSLRNELVKENFDSSK
                     KLLADNPELREQLVKVAISTIEQIRDSTGASINTEKWYKFVSHNVPLVIQDTTFWDSY
                     LKFLLLLNDCNSQTYSYKRLIPDYLVTKRSMGEELTADDITTFLSVISERVNPQNYWD
                     LVKANTQVVEALRLFDEEVIFTDAILSKVIKTLTTNSNEHKLHSFYEVIKFLVWKYEK
                     EIPINTLETILKTLINFGEYDYLLRLWTTKIGYNVGSKDTRPWKVFLKAITETQDVEL
                     IRLIIEKGCLLDISRGKVDVDPQLAVLLKTAFKTVDPENLIYNDQQRLLIPSSATRQ"
     gene            <115478..>116533
                     /locus_tag="CAGL0J01221g"
                     /db_xref="GeneID:2889833"
     mRNA            <115478..>116533
                     /locus_tag="CAGL0J01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447764.1"
                     /db_xref="GeneID:2889833"
     CDS             115478..116533
                     /locus_tag="CAGL0J01221g"
                     /inference="similar to AA sequence:UniProtKB:Q03151"
                     /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
                     YMR097c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447764.1"
                     /db_xref="GeneID:2889833"
                     /db_xref="GOA:Q6FPT0"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPT0"
                     /translation="MSYRCYSSLSFVPRHVLPRFNIPKSDFKGHQVKAIKKFKKLSPG
                     LNMLIELRDIRAPLSTRNVIFDNILRSNRSLERLVVYTKKDMTSGNANGKQYFKKLSQ
                     WHAQLNEKFIILDGRDTSDAKQLLKILQWENHKVESRGMRLPLGYRAFIAGMPNVGKS
                     TLVNTLRRVTNPSSSGTKFKKVARTGSEAGVTRSTSEVIRLMPTTNNSSPIYLIDSPG
                     VGLPGRLTNQNRMLTLSMCGAVKTSLIEPVIQADYLLYLMNLQNPLPGAEWYPKYKSE
                     PTNDIYEVLRRLAKNKESFDENVVATNWVNKWRLDSKNLLFDVETLLPADAFSYRDYV
                     DKQLEELGELTFLRERQ"
     gene            complement(<116608..>118011)
                     /locus_tag="CAGL0J01243g"
                     /db_xref="GeneID:2889834"
     mRNA            complement(<116608..>118011)
                     /locus_tag="CAGL0J01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447765.1"
                     /db_xref="GeneID:2889834"
     CDS             complement(116608..118011)
                     /locus_tag="CAGL0J01243g"
                     /inference="similar to AA sequence:UniProtKB:P35203"
                     /note="similar to uniprot|P35203 Saccharomyces cerevisiae
                     YMR094w CTF13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447765.1"
                     /db_xref="GeneID:2889834"
                     /db_xref="GOA:Q6FPS9"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS9"
                     /translation="MVEERFNTLRFLDQPYEVRKLVYYHLDGQYTNANPPALDALYHG
                     AIEIPNVRDYGGSKKVKKYYRQLVKKLYPLFEQYLQNFQYSPAMIESWLEYSLWLRYD
                     AIVLDSLRLNHLYDGELVGPLDWIEIDGDLRLAVINKLYMLQVWYSYGEYKRWVIRNN
                     ITDYGDMELGYLRLNLEMQRDGQIPNIIQKLRKKEQLNLISEINFTTNIDTVTNGNAN
                     GNVKRGTNLKRARSDSPDVYLEDPMVKERYQIPNDPALTETIVNLEEMKQVSSLSVRG
                     KNLYESLINVHGARDNPGRTISYISRRRVMRIAMNQVLNPSETGLADLTKWVNLRVIS
                     INDCGFIDLNKLILPSKAISLSLSNIRELRWWEFEMDSAIQAQFQQNKLLPYRPLFDL
                     CEAGIHYTLDKKSISLVELKKFQTTIWKKLQALNWIKINNVAMISNKFIVIPKTLYES
                     KRTVIFSTTVHSNIVVI"
     gene            complement(<118375..>119928)
                     /locus_tag="CAGL0J01265g"
                     /db_xref="GeneID:2889835"
     mRNA            complement(<118375..>119928)
                     /locus_tag="CAGL0J01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447766.1"
                     /db_xref="GeneID:2889835"
     CDS             complement(118375..119928)
                     /locus_tag="CAGL0J01265g"
                     /note="highly similar to uniprot|Q04305 Saccharomyces
                     cerevisiae YMR093w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447766.1"
                     /db_xref="GeneID:2889835"
                     /db_xref="GOA:Q6FPS8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS8"
                     /translation="MSSSHPRIVTSRAAVLPQQTTAEQRYWRQYAATQLVKEHNSVTH
                     VAFNPQKPHDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDAT
                     GLVSVYDSYNPRTLLVSVAASQHPTHVTKFHDHDLKTLVSASDDRVTRVWDISHAYEP
                     QLELTGAADYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLVHDQPVENVV
                     AISPTQLVSCGGPNFKVWDLTSNKKIFERANFNKTVTCLDYVNLPSDSGLASNSALLA
                     SSLDGHVKVFDPLDNFQVKFGWKFSSAVLSCAVSPSDAQGSRHLVAGLTSGLLAIRTK
                     KKEKRNSHLAVDDYTAGSTGPKKSNNFQRMMRGSQYQGDLEHIIHDDKVKQQRRLRTF
                     ERYINQFKWAEALDCAFVPGMAKELTLTILQELRKRGKIRVALQNRDESSLEPLLNWC
                     LKGIEDVRSVNVVVDWVTVVLEMYGQVAQESPVLNEMVVALRNKVREEVHKAEEAQRI
                     EGMLQLLTN"
     gene            <120215..>122047
                     /locus_tag="CAGL0J01287g"
                     /db_xref="GeneID:2889836"
     mRNA            <120215..>122047
                     /locus_tag="CAGL0J01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447767.1"
                     /db_xref="GeneID:2889836"
     CDS             120215..122047
                     /locus_tag="CAGL0J01287g"
                     /inference="similar to AA sequence:UniProtKB:P46680"
                     /note="similar to uniprot|P46680 Saccharomyces cerevisiae
                     YMR092c AIP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447767.1"
                     /db_xref="GeneID:2889836"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS7"
                     /translation="MLVLEGSIVPVPQGTRNFSARLAYDERSDSVAYGSGKSAYVTGV
                     GAGAGGSEGGAGGNDVVQFTGHGANVSVVRFAPVGAYMCSGDESGKVIVWSWNRDGDG
                     GVECVVKAEFQVLAGPVTDISWDFEGKRLCVVGEGRDKFGVFISWDTGNSLGEVTAHS
                     SRVNAVHIKQSRPMRCITVGDDGTVVFYQGPPFKFVSSDRTHHDKGKFVRDVEFSKGA
                     GEFAVTVGSDRKIACFDGKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKV
                     RVWDVRESKCLHSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTLNFLKIGEDKPVR
                     TMHGHNKSITALAVNPLVTGSYDGRIMQWVPEKICDSKMQTGHTNLVVSIGSKESGYS
                     SVAWDDTLRVNNEVKYKFESQPKCASMDPAGKIAVVTTEDKLLVLDSSTGEKLVETAL
                     DVPASAVHLSGDLVAIGSEQTNTVSVYNSGDLSLLYKLPDPLRATPSCISIAPSHKLL
                     AVGDVMGKIILYDLETKTVKTSRWAFHTSKINAISWRPEEEDLVATGSLDTHIIVYSV
                     SKPMRTVKVLNAHKDGVNAVQWKDRDHIVSAGADACIHTWKFTQ"
     gene            <122339..>123667
                     /locus_tag="CAGL0J01309g"
                     /db_xref="GeneID:2889837"
     mRNA            <122339..>123667
                     /locus_tag="CAGL0J01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447768.1"
                     /db_xref="GeneID:2889837"
     CDS             122339..123667
                     /locus_tag="CAGL0J01309g"
                     /inference="similar to AA sequence:UniProtKB:P32832"
                     /note="similar to uniprot|P32832 Saccharomyces cerevisiae
                     YMR091c NPL6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447768.1"
                     /db_xref="GeneID:2889837"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS6"
                     /translation="MSDSETKLRSRSGSQKPDYKIDTEGLEIRDDDDNDVDYHEHDAE
                     HDGEDGSGRKKRSREDDDEDEDVSLEDDDEDEDEDDEDDGGKSEAREGPHKRARAKRA
                     RSATPMGGAGSTRKSEISYPIDEEGHLLPVYKYEYETLEDPEGEKKITADGDLLDGRE
                     FTIRSFAIAENNAQKFMLSTEVARTMGYRDSYMFFQYHPSVYKFVLGQNQKNHLIDQN
                     IIPYSYRSRKITIVAAKSIYKEFGAKVIKSGKSPHDDYYVTVFPVRGQKPKPTASDLK
                     RQEKQKSATATPTELPKKQSPLLSNPTFLEYRNSVANTFTGNSKLNSTNWLYQHAAAC
                     SRFNSDLYYDRVRVLLIEQQGLRDPYTNTLHIPQNVQSTKVLDWYKEVDEEQEPNEDA
                     ITCETIIKSSNIARPKTNLCDVAPEIYEGVVDEETKKAILAQQEYERQLY"
     gene            complement(<123787..>124473)
                     /locus_tag="CAGL0J01331g"
                     /db_xref="GeneID:2889838"
     mRNA            complement(<123787..>124473)
                     /locus_tag="CAGL0J01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447769.1"
                     /db_xref="GeneID:2889838"
     CDS             complement(123787..124473)
                     /locus_tag="CAGL0J01331g"
                     /note="highly similar to uniprot|Q04304 Saccharomyces
                     cerevisiae YMR090w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447769.1"
                     /db_xref="GeneID:2889838"
                     /db_xref="GOA:Q6FPS5"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS5"
                     /translation="MGPLRVAIVGANGKIGHLLTAKLKNSKASFATPVAIVRNEEQVK
                     HFQDEMGVDASLASIESATVPELQKAFTGCDAVVFTAGAGGKGVERIFTVDLEGCAKV
                     VEACEKSGISRFVIVSAIKAEDRDFWWGLEGLRNYYIAKKAADQYVRNSKLDWTILQP
                     GFLDTNSGTGKLVPQDQLESKKDDNYRIQREDVAEFIVQSLLHPAETKLKTISLANGD
                     VPIADFIKSL"
     gene            <124994..>127477
                     /locus_tag="CAGL0J01353g"
                     /db_xref="GeneID:2889839"
     mRNA            <124994..>127477
                     /locus_tag="CAGL0J01353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447770.1"
                     /db_xref="GeneID:2889839"
     CDS             124994..127477
                     /locus_tag="CAGL0J01353g"
                     /inference="similar to AA sequence:UniProtKB:P40341"
                     /note="similar to uniprot|P40341 Saccharomyces cerevisiae
                     YMR089c YTA12 or uniprot|P39925 Saccharomyces cerevisiae
                     YER017c AFG3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447770.1"
                     /db_xref="GeneID:2889839"
                     /db_xref="GOA:Q6FPS4"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS4"
                     /translation="MLEWGGCFLLGYLNVNRVVTAMIRTRIGAVARVRVPVFRARFHC
                     GPVWRNSADDDLKRVQERINEYMRKNQRAGAGADAGTNAGTDAGAGAGAGMDMERFRK
                     EIDRELKRMEQTIQKQTPEAPREEYKDTKDAKESSQESKEPQEAKEKAKGTKQEAREG
                     SSNGGNPPPPPLNDPSGNANNIGLFQLGLLFFLLSFLLDLVNDTEGQKEITWQDFRER
                     YLAKGYVQRLEVVNKSYVKVILNDMGKNQPENYGQEVVYFNLGSVENFEHKLEKAQNE
                     MDIDQDFRVPVQYVQQGNWARAVFQMLPTVLMLVGIIWLTRKSMQSAGNTRGGIFGIS
                     RSKAKKFNTETDVKVKFKDVAGCDEAKEEIMEFVSFLRNPQRYEKMGAKIPRGAILSG
                     PPGTGKTLLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFI
                     DEIDAIGKARQKGNFSGANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNAL
                     LRPGRFDRRIHIDRPELEGRKAIFEVHLQKLKLAGSIFDLKNRLAALTPGFSGADIAN
                     VCNEAALIAARHDENAVKLSHFEQAIERVIGGVERKTRLLSPEEKQVVAYHEAGHAVC
                     GWYLKYADPLLKVSIIPRGQGALGYAQYLPGDVFLLSKQQLLDRMTMALGGRVSEELH
                     FQWVTSGASDDFKKVTNMATAMVTELGMSEKIGWINYKKNDDNDLTKAFSEETGVIID
                     SEVYRIVQECHKRCTDLLKEKAEDVEKIAQLLLKKEVLTREDMINLLGKRPFPERNDA
                     FDKYLNEAETEKIRKSEEQNPDDPSPSAA"
     gene            <127843..>129537
                     /locus_tag="CAGL0J01375g"
                     /db_xref="GeneID:2889840"
     mRNA            <127843..>129537
                     /locus_tag="CAGL0J01375g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447771.1"
                     /db_xref="GeneID:2889840"
     CDS             127843..129537
                     /locus_tag="CAGL0J01375g"
                     /inference="similar to AA sequence:UniProtKB:Q04301"
                     /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
                     YMR088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447771.1"
                     /db_xref="GeneID:2889840"
                     /db_xref="GOA:Q6FPS3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS3"
                     /translation="MENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLW
                     LGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRK
                     FAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERG
                     IYQGYANIVFGLGQILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSH
                     LLPVEERFKWSNLSRIDILGSSTLVFTISGVLFLCSTELNKALLSIFTVISFIAFILI
                     ELYYSKERIMPFELLKGSFGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFF
                     MLFPSISVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPS
                     LSGSAIFGAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQ
                     QGTVTGIFYLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLL
                     SDTSYLRSGHFPDGILFELLKVYRNSFLLSYLPNFILAIAGVAICGGLLVVSYAQD"
     gene            complement(<129649..>130476)
                     /locus_tag="CAGL0J01397g"
                     /db_xref="GeneID:2889841"
     mRNA            complement(<129649..>130476)
                     /locus_tag="CAGL0J01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447772.1"
                     /db_xref="GeneID:2889841"
     CDS             complement(129649..130476)
                     /locus_tag="CAGL0J01397g"
                     /inference="similar to AA sequence:UniProtKB:Q04299"
                     /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
                     YMR087w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447772.1"
                     /db_xref="GeneID:2889841"
                     /db_xref="GOA:Q6FPS2"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS2"
                     /translation="MTRNNTKRKSMNQIRIVICDTNEVVARKLHQYVPKKLTLSQQAV
                     CTHHGPLESLINSMRTDKKKHPGNKYAIVSPGNSFGYLGGGFDLALFNYFGGKPFESW
                     FRKELGNRYHTVGSATVIDLTRCPLNDINELRDGIQYIIHVPTVVAPTKPIYQESQKL
                     KTGYEPVFNAMWNSVMHAPHDVDGLIIPGLCTGYAGVPPDISCKSMAFALSLYMLQDK
                     ISVELRNALIMYFLGYPFKPFILESCLEECQALGLNIHSLESFNVEEDDIQQLLPKF"
     gene            complement(<130812..>133832)
                     /locus_tag="CAGL0J01419g"
                     /db_xref="GeneID:2889842"
     mRNA            complement(<130812..>133832)
                     /locus_tag="CAGL0J01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447773.1"
                     /db_xref="GeneID:2889842"
     CDS             complement(130812..133832)
                     /locus_tag="CAGL0J01419g"
                     /note="weakly similar to uniprot|Q04279 Saccharomyces
                     cerevisiae YMR086w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447773.1"
                     /db_xref="GeneID:2889842"
                     /db_xref="GOA:Q6FPS1"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS1"
                     /translation="MFRSRNYNDQMRYANPNAVAAASALGNIMMPKQPQSQAQPQGAK
                     RAPVRSSSMMNMRRGSLLRKPEEKKSTPSRTGSLVQRKPSITNQKRHSISSTPQSSAP
                     NRTSSLPTKRNSLVSRSGSFTRRMKNAQSTFNEFGPQASGVANVRNSGEQVVKMVTKY
                     IPGKNGLIAVQVPATTEQPRKTSSLTRRPGSMTSISNKNGPKRKISQQSLHSHSVQQS
                     NPQKPSKKKEVIDSSNPEDSFNRAVDKVDESVPLIETSMREETEQELLEQTVAIDESV
                     IKADENPAGLQNLLEDNIVLEETMEEQKKDGKAPLENDATSNEKVNIEPLPEVAVDST
                     DIPAPLEESERQETNIAPKEDSMKEEIEPEALDNTAKNITEFDSEQMKDNKTVTDSIN
                     ELENIPGTMDNEMQELKESIANDINSQLTTEEMIDEMEGSKTDMMTTDLNEKFSKAEL
                     SEQNLPDNNDSPLLKQQKFEENKLKESIEAFGKGANEGNENNVLQDNVVGNDITLQHD
                     IVTNIRSNETVSSPTDSEFVDSSSVMENDEQKENVENLASKNKSPNKQKPQNMAQYLR
                     SANPYLTTGGSATSAKKSPATSPKKQGSSGPIKSAMKKSSRPLSTTSSVYSDINSPAD
                     GAYLSLTTAENTRINAKLAVEEPIDWHPNADKSKRASMPVRSSSKLYKKTSNSQSQEK
                     VGYNRSSRQYQGPIQTPPNTTKTPGGVTKMGVVSAAALSSNNNAAAAEDKSNRQSLLK
                     NRALEMAKQVNITPKKAKPVTPSVPSSTVTPPAVNPVLNAALYPKEPLQKKSSFEKLR
                     NTDKNLGFKKLSLRDSAFMDGADEQALVNAGSRNSMMNESPGQAPPKLATASTNSGWK
                     SRFQDSDSDVEPVQANAAPVAPPRSEERVNGFSLFKKKSNTGGNTFLKPPQPDFSAGS
                     EMGEKVSRTSSYNSSPNKTLNNQYSKGSLRSSSMQTAGPGSTAKPNIFANIEETEKRI
                     YSNPEVMRKDEHNDEGVNHGFGKKLKKLFGRKKH"
     gene            complement(<134383..>135501)
                     /locus_tag="CAGL0J01441g"
                     /db_xref="GeneID:2889843"
     mRNA            complement(<134383..>135501)
                     /locus_tag="CAGL0J01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447774.1"
                     /db_xref="GeneID:2889843"
     CDS             complement(134383..135501)
                     /locus_tag="CAGL0J01441g"
                     /note="highly similar to uniprot|P07246 Saccharomyces
                     cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
                     cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
                     cerevisiae YMR303c ADH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447774.1"
                     /db_xref="GeneID:2889843"
                     /db_xref="GOA:Q6FPS0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FPS0"
                     /translation="MFTRVAAAARIQSRRPLRLRLQSTLSIPQSQKGVIFYEHGGKLE
                     YKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGAGVVVAKGS
                     SVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLSGYTHDGSFQQYATADAIQ
                     AAQIPKGTDLAQVAPILCAGVTVYKALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAM
                     GMRVLGIDAGDEKRKLFESLGGNHFVDFTKTKDLVSEIQEITEGGPHGVINVSVSEKA
                     IGQSVEYVRPCGTVVLVGLPAGATVKSDVFNHVIKSINIKGSYVGNRADTREAIDFFA
                     KGQVKSPIKVVGLSELPEVYKLMEANKIIGRYVVDTSR"
     gene            <136518..>137273
                     /locus_tag="CAGL0J01463g"
                     /db_xref="GeneID:2889844"
     mRNA            <136518..>137273
                     /locus_tag="CAGL0J01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447775.1"
                     /db_xref="GeneID:2889844"
     CDS             136518..137273
                     /locus_tag="CAGL0J01463g"
                     /inference="similar to AA sequence:UniProtKB:P28319"
                     /note="similar to uniprot|P28319 Saccharomyces cerevisiae
                     YKL096w CWP1 cell wall mannoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447775.1"
                     /db_xref="GeneID:2889844"
                     /db_xref="GOA:Q6FPR9"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR9"
                     /translation="MKFTHQFVLSLIALAKLVMADSQQFGIISIASGSDLQYASAFFD
                     SNNLVVGHQPNNQFALVVTDDGKLKSTSGNQFIAVDANSGNLKEVSDSNSASVGFSIK
                     NGHLLYLNSESFYAVPGASSGATWSLSTKNTNSAQGAAASPVVLRTQSTTGTDVVADF
                     TPAAMSSVSSVVPSSISSVHPSSLVSSGSTLVLSKASGSAVPISQIGDGQIQATATSH
                     VPPVQSHNGAIGQHGPYLGMHAGVAAAAIAYLL"
     gene            <138326..>139228
                     /locus_tag="CAGL0J01485g"
                     /db_xref="GeneID:2889817"
     mRNA            <138326..>139228
                     /locus_tag="CAGL0J01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447776.1"
                     /db_xref="GeneID:2889817"
     CDS             138326..139228
                     /locus_tag="CAGL0J01485g"
                     /inference="similar to AA sequence:UniProtKB:P38747"
                     /note="similar to uniprot|P38747 Saccharomyces cerevisiae
                     YHL013c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447776.1"
                     /db_xref="GeneID:2889817"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR8"
                     /translation="MDAREELLAKHRKEKRDLVNRITGMKKQATKAKRKEVNSKCEQL
                     EQELREKHEQELKELDGEGGDVEEVTPEQLLAQLQVEDDGAKEANEANEAKADKEAKV
                     GPSQQPKKKRNRQKEKLARREAEIARMKEEAKKEAAEQPDLKKIEQDAIWQLCQMKGL
                     VPYDIQPDGHCLFASILDQVKTRHGDPQTEMDVHTLRCLACDYILEHRDEFIPYLFDE
                     ATMSLKDIDEYTEEMKSTAKWGGEVEILALSKALDCPISVLMSGQATHTVNETGSKPE
                     LKLVYYKHTYALGEHYNSLRDSKI"
     gene            <139697..>143500
                     /locus_tag="CAGL0J01507g"
                     /db_xref="GeneID:2889818"
     mRNA            <139697..>143500
                     /locus_tag="CAGL0J01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447777.1"
                     /db_xref="GeneID:2889818"
     CDS             139697..143500
                     /locus_tag="CAGL0J01507g"
                     /inference="similar to AA sequence:UniProtKB:Q04264"
                     /note="similar to uniprot|Q04264 Saccharomyces cerevisiae
                     YMR076c PDS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447777.1"
                     /db_xref="GeneID:2889818"
                     /db_xref="GOA:Q6FPR7"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR7"
                     /translation="MAMPGAVRKLQFSKPIISTLENTIAASELVGRLCNLHEELAQFV
                     QDQVDLSSLDAVKGDLINHKLLKHKDLGVRAFTACCLSDILRLYAPEAPYTDGQLTDI
                     FKLVLSQFEYLGDPDNGYYVQQTYLITRLLEYRSIVLITDLPTSDKLLFRLFEIFYDD
                     NHSYQNKLFNVIGGLLGEVLSEFENMPLNVLKLIFNKFLTYNPEKAPKGLGVASNCGY
                     EVSLILCENYTARMSRYLTKYYSEILYNITNEKNIDDSYEMRTKLIIATEKLHKLVYR
                     LWETVPDLILSVIGFVYHELSSENEIIRKLATRLVGKMISKNTMANFVQAHEDTFKAW
                     MTKIADIDADVRVEWISCIPNILEVRSDISDDIGHGLAKTLIDSDARVRKLSVTVFDE
                     VPVKAIWENVKNISVYKSLLQLTREKNREIRELCIHSVGRFYAESRRNIEKESYDTEI
                     WSIVESIPSTLFNLYYINDAHINQWVDEIVFDYLLPFEDDDTKRVRELLSIVSKLDKK
                     AFSSFIAFNKRQVPSAVAMAKFVEFCEVLKQSEYEDDLDTIQKYNKTIDWLSSSMADP
                     IKTADVLEAIKELNMGRVFFLIKNCVRADVTYSTFRNSYNELLDKLGDDNLFKKNRVK
                     NSTSVSPQDIAHEIKALLLRSSPIIFNISNIGILLDNSVFENEAETSLKRKLVNEVSK
                     ISPTLFRDQLKNLKDTIIYLEDFNSRQEQALATEALKTIYKISKSVEDNNTFDDKLFS
                     SKLIEFALNGSPQLAKYATKMIALSPDSERELRGLVLKILPLDIDKDQNFTSHLAILM
                     EVFRFTPHLLDDESTNIVSYLIKNVLLSNYKIEEDKVEEGESLFEEHIAESNEHACLA
                     NKLFTLKLFTNKLRALSLHDDDDDLSKAFIEKTLKLYIYLIASGGELVSETSSSKPTP
                     EAYQTILRLSAALQILKVARISSLNTFIKSTEICKLVNIVEDESLEVRRRFLDQLKDS
                     LSCELISIKFLPLIFFTAYEPDKELKASTKIWINYTCAKPSFKKGTLFERVLPRLIHA
                     IAHHPDVIEGFQGTEEEVIIALTTAVDYLVFYFDSVASQENFSLLYYLSERVKNYQDI
                     LDEDEESSANEDDSISRWKPFQYIYVVGELSQIILLTIKERRSWQHIAYPGKLNLPSD
                     LFKPFDSAESAQATFKNYLSEKYAEKIKGNIVAKVGKLIHASQTQRQRSQKRLLDQEY
                     REDTSPKKQRTKGSKTQRKDRQNDGSDIESDEEIYRGGNVEANASGVRKSNRARKQVD
                     YNEDD"
     gene            complement(<143666..>145681)
                     /locus_tag="CAGL0J01529g"
                     /db_xref="GeneID:2889819"
     mRNA            complement(<143666..>145681)
                     /locus_tag="CAGL0J01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447778.1"
                     /db_xref="GeneID:2889819"
     CDS             complement(143666..145681)
                     /locus_tag="CAGL0J01529g"
                     /inference="similar to AA sequence:UniProtKB:Q04779"
                     /note="similar to uniprot|Q04779 Saccharomyces cerevisiae
                     YMR075w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447778.1"
                     /db_xref="GeneID:2889819"
                     /db_xref="GOA:Q6FPR6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR6"
                     /translation="MSGQSSNTSSKGSSVTPASDGKTINGLEKVKVKLEKVNERGRSR
                     PKRSSSQNVDYDLKKRKIITEDLNLGKKNGDQSEAGSTGNGTPTGSTNGPEFKAEDII
                     EYNRKGEIVKVNEPPTIETVNGANGIPLSQFPPDKVKKEYLWNFKKSNSGQYLLSAAV
                     AAKSSKDNEEKPNFTERFEQLLLQAKATTEKERELTKPSHIRHQVKSSSKTEHVLVPK
                     GINLHNPHIKTKLKDTHAFDSKTKLISQNPVGQMNDIAMAKKKSSDGTTQEIENDDYC
                     SACFQTGSFLCCDTCPKSFHFLCLNPPLDPDHLPEGDWSCPQCMVKLRYANNTQYLKA
                     QKAYTAQMPKGKRLFGKLLFSLQGTNPRQFNLPNFIKETFQSVKTGPRGQYSDDTIKE
                     PLSDKPIFNSPYGQSITKLDSYNLDSHIDQTTGKILTCYRCGVSRLGSWSHPEEARLL
                     IKCDYCNTRWHLDCVPEVPRASLKNLGSKWQCPLHSEPPNTTKFDDQSKIKKSRKLIK
                     NQRYMEPLQSCGYRNEGNIEVALDEISALPPKNARNINVAYKPIPLLNESNFILDFEE
                     KLRQVKENEFRKSVSAQSKILEQLMCTLKKDEKEDIMTLLQFRFKKSKELKQLWDFSE
                     LTSKLNAKIQPQNETKNEDIQALLALKKIIESKPKEEILRFLDLSDD"
     gene            complement(146404..146477)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0J01551r"
                     /db_xref="GeneID:2889820"
     tRNA            complement(146404..146477)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0J01551r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2889820"
     gene            <151584..>152618
                     /locus_tag="CAGL0J01595g"
                     /db_xref="GeneID:2889822"
     mRNA            <151584..>152618
                     /locus_tag="CAGL0J01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447780.1"
                     /db_xref="GeneID:2889822"
     CDS             151584..152618
                     /locus_tag="CAGL0J01595g"
                     /note="some similarities with uniprot|Q12531 Saccharomyces
                     cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
                     cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164c MSS11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447780.1"
                     /db_xref="GeneID:2889822"
                     /db_xref="GOA:Q6FPR4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR4"
                     /translation="MLSICRIFCKLILTPCDFEVSIKPQKTLPIMIAMDDRYYNLENK
                     FVPVGLPAVSPSAQYYPADASRPQSNVQSPVYYVPQNQINYIQRPSVSYVPTMEDQQY
                     TYTTMAHPQQQMILPVRNASPIEVQQQQLQQQQLQQQQQQQQQQQQQQQQQQQQQQQQ
                     QQQQHPLVKLPPISAIIPPGNSSPVNTTGQVQTSDQARNYNPGFRQDVQIALNPKSLS
                     APTSGRNSISINPLMYNPHQQQQLLALAGVSIPPTLMEHQLTDAMTKQEIKLTKRQLK
                     KATTRLRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLK
                     SHEKNSLNKK"
     gene            154247..154355
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0J01617r"
                     /db_xref="GeneID:2889823"
     tRNA            join(154247..154285,154311..154355)
                     /gene="tRNA-Leu (TAG)"
                     /locus_tag="CAGL0J01617r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2889823"
     gene            <154646..>155629
                     /locus_tag="CAGL0J01661g"
                     /db_xref="GeneID:2889824"
     mRNA            <154646..>155629
                     /locus_tag="CAGL0J01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447781.1"
                     /db_xref="GeneID:2889824"
     CDS             154646..155629
                     /locus_tag="CAGL0J01661g"
                     /note="highly similar to uniprot|Q12251 Saccharomyces
                     cerevisiae YPR011c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447781.1"
                     /db_xref="GeneID:2889824"
                     /db_xref="GOA:Q6FPR3"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR3"
                     /translation="MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPF
                     ERVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVF
                     EGCKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSK
                     LSKSRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLK
                     EFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHY
                     NSVWDALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW"
     gene            <156341..>156556
                     /locus_tag="CAGL0J01699g"
                     /db_xref="GeneID:9488017"
     mRNA            <156341..>156556
                     /locus_tag="CAGL0J01699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999520.1"
                     /db_xref="GeneID:9488017"
     CDS             156341..156556
                     /locus_tag="CAGL0J01699g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999566.1"
                     /db_xref="GeneID:9488017"
                     /db_xref="GOA:B4UN23"
                     /db_xref="UniProtKB/TrEMBL:B4UN23"
                     /translation="MRPAQLLMNAAKKSSGTKVPIELAPLFAAIGVALCSGTFFTYKK
                     LTYDDSLRLKSNPDMSGLDDVLKEAKE"
     gene            complement(157157..157229)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01705r"
                     /db_xref="GeneID:2889826"
     tRNA            complement(157157..157229)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01705r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2889826"
     gene            complement(<157842..>160781)
                     /locus_tag="CAGL0J01727g"
                     /db_xref="GeneID:2889827"
     mRNA            complement(<157842..>160781)
                     /locus_tag="CAGL0J01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447783.1"
                     /db_xref="GeneID:2889827"
     CDS             complement(157842..160781)
                     /locus_tag="CAGL0J01727g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447783.1"
                     /db_xref="GeneID:2889827"
                     /db_xref="GOA:Q6FPR1"
                     /db_xref="InterPro:IPR002494"
                     /db_xref="UniProtKB/TrEMBL:Q6FPR1"
                     /translation="MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSA
                     LTLNDGSEYIFDGGFRGAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTG
                     PDTVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIH
                     DPNELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSAS
                     FTDNVIHLSPGGAISLRRPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTS
                     EGVYKYNIGCGYNPELASAQEIKIYFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSS
                     VKPSSMNPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSPSSINPSSMNPSS
                     PSSMNPPFANSSSMNPSSMNPSSMNPSSPSSMNPSSINPSSMNPSSINPSSMNPSSMN
                     PSSVNPSSMNPSSVNPSSVNPSSMNPSSMNPSSMNPSSMNPSSVNPSSMNPSSPSSMN
                     PSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPS
                     SMNPPFANSSSMNPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMN
                     PSSMNPSSMNPSSMNPSSPSSMNPSSINPSSMNPSSMNPSSVNPSSVNPSVEPSILKP
                     SNVNPSSFDSSSMNPSSVNPSSVNPSSMSPSSVNPSSVKPSSVKPSSDKPSNANPSSV
                     KPSSINPSVEPSILKPSNVNPSSFNSSGINPSSVNPSSVKPSVHPSVKPSSEKPSNVN
                     PTSVKPSSASPSSAHPSNISSKPTVSVSVSSVSNKPASDVLSSNKYVSSGSVVVSASR
                     VISSRSPSSIVLGNGGGLVVSSQRPGSVQNSVRPSASPSSVRQGSAQPAANASTKTVS
                     GTQASRAPSGVNSVSQVRVSSNSASGVVNSRAPTVVSSTFRGSAVMLHVYGIELVLPV
                     LAALLFI"
     gene            complement(163678..163750)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01749r"
                     /db_xref="GeneID:2889828"
     tRNA            complement(163678..163750)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01749r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2889828"
     gene            complement(<164808..>172073)
                     /locus_tag="CAGL0J01774g"
                     /db_xref="GeneID:9488027"
     mRNA            complement(<164808..>172073)
                     /locus_tag="CAGL0J01774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999521.1"
                     /db_xref="GeneID:9488027"
     CDS             complement(164808..172073)
                     /locus_tag="CAGL0J01774g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999567.1"
                     /db_xref="GeneID:9488027"
                     /db_xref="GOA:B4UN24"
                     /db_xref="UniProtKB/TrEMBL:B4UN24"
                     /translation="MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTIS
                     YVDGSEYNFGGGIVSSQEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQ
                     TINFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSR
                     EGNILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNT
                     INLGGISGISVKSTSSNIIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYV
                     YDIGCGYDETTLGSTTGYIVYHGESLKTFVIATSLETAPDYQKCYIPGQHENHDSGSG
                     STPGEGSGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGST
                     PGEGSGSGSGTGSGSGSGTEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSGSGSG
                     SEGGSGSGSGSRSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGSTPGEG
                     SGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSG
                     SGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSE
                     GGSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSG
                     SGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSG
                     SGTGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSG
                     SGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSTPGEGSGSGSGSG
                     SGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSG
                     STPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSGSGSGCGSEGGSGSGSGSGSG
                     STPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSG
                     STPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGST
                     PGEGSGSGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGSGST
                     PGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGST
                     PGEGSGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSA
                     SGEGSGSGSGTGSGSGSGSGSASGEGSGSGSGSGSGSTSGEGSGSGSGSGSGSAPGEG
                     SGSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSG
                     SGSGSGSGSTPGEGSGSGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSG
                     SGSGSGTGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSTPGEGSG
                     SGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSG
                     SGSGTGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGG
                     SGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGSTPGEGSGSGSG
                     SGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSGSGSGSGSGSEGGSGSNPGTGEGGSGS
                     EGGSGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDG
                     KPTVILTQYQSPTPSPGEGGSGSNPGAGEGGSGSEGGSGEGGSGSEGGSGEGGSGGSN
                     PVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSN
                     PGAGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGK
                     PTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVHITTYTDSDGHTITSTYTEMFKTLI
                     DAEPQYVSETTQTITTTDAEGHTTTITTTYNIDNNGNAVPIVPSSSSMSSSSSSSMSS
                     SSSSSMSSSSSSSMSSSSSSSMSSSSSSSMPSSSSIISSSIFSSVSTPSGQDYTITTT
                     GSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEKDRTTTVTHSNGVIETNVVSHI
                     TTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIETNVVSHITTVDTKGNPTTIVT
                     TTTKFNNAHTTTFSNKNGSVDTKTVVGVTTTNQFGQQIITSLTFTGSEAHSNNNVHTS
                     AGPNDAAGTSPAGTNNPQTKPTGNAGSTARLSDTTPAPNAGSNGSSPAAADAESAVAP
                     KAPASNSAAVPQQSGASSTSHGSAAPTIPQINKNAASSFKQNNFGVIILFALLFTML"
     gene            complement(<173901..>177152)
                     /locus_tag="CAGL0J01800g"
                     /db_xref="GeneID:9488018"
     mRNA            complement(<173901..>177152)
                     /locus_tag="CAGL0J01800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999522.1"
                     /db_xref="GeneID:9488018"
     CDS             complement(173901..177152)
                     /locus_tag="CAGL0J01800g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999568.1"
                     /db_xref="GeneID:9488018"
                     /db_xref="GOA:B4UN25"
                     /db_xref="UniProtKB/TrEMBL:B4UN25"
                     /translation="MKLILLIQLWWLTLVNTKSIYPGPTVLTGNQIFEDEVIIDNGGG
                     LVLNDGSEYIFNGGYHGGKQCSIDINAAKGLPFTLTTSSDAKLFENGCVFKIRNANTG
                     AKTIQSINFSPIEFKNTNKFILELGHTNSDASSRLILGSPEIVNSGEISYISTGVEIG
                     DSNNEGNLLKIGRPTGSINNTGKISFDAASKYYLFGKVFGLGGSISVHRGTLYVDSLS
                     FSNIIYLGSNTAVAFKNSISAPITVRGLETSSAISSAGSDGKFNYNDKTGLLVVTTSE
                     GSFIYNIGCGYKSELILTSQTKTWYQGKLYDYFSVTFHQVPPTNTICVESSKEFRRVK
                     STLLDKYGDIKGWDIMNLFKRDGENVSPANAPANAPANPPANAQPDVNALANAPANPP
                     ANAPANPPANAPANAPANPPANAPVNAPANPPANAQPDVNAPANAPANAPANPPANAP
                     ANPPENPPANAPANPPANAPANAPANAPANAQPDVNAPANPPANPPANAPANPPANAQ
                     PDVDTPVNAAPNGPAKNGTYVGPQPKPNKPSQEEPNANSPAAGPANPQPQGNTPPVVQ
                     PANNDTSSNPQPKPDVNSNANSNANSNANSNANSPAAGPANPQPQGNTPPVVQPANND
                     TSSNPQPKPDVNSNANSNANSPAAGPANPQPQGNTPPVVQPANNDTSSNPQPKPDVNS
                     NANSNANSPAAGPANPQPQGNTPPVVQPANNDTSNNPQPKPNSPLGKPPHVDTSTPSV
                     NFQQPSVYSPTAKPSVINRFANSSSVVHPGIQPSNINSIGSQDIAGSSNGLSSKNSIA
                     IGSPLAVLSPTEEPSISQRVVINPALSSSVKLSSSPQAYMNSSSTVSSSSKSSVETSN
                     NRNSDNGYAKPSKVNSGIHLNPSSHNIDDSSKSASASPKSSKPSSASSNVSKPNPSGD
                     NRVSTINSKKGNGLSSKATPSPKPNVNSSQGGKAGPGNGHSSNNVSKENEKPSTVKSN
                     SGKSNTVKPTSGKSNTGKSEAQKPSTKTLSGSASQPKANQGPGGTQPTKGPSPGSNPA
                     QQVNGGSLSGSNIIPINSRIPTILSSTFRGNAAMLSIQGIELVLPALVALLFL"
     gene            complement(179238..179310)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01826r"
                     /db_xref="GeneID:2889809"
     tRNA            complement(179238..179310)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J01826r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2889809"
     gene            <179922..>183530
                     /locus_tag="CAGL0J01848g"
                     /db_xref="GeneID:2889810"
     mRNA            <179922..>183530
                     /locus_tag="CAGL0J01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447785.1"
                     /db_xref="GeneID:2889810"
     CDS             179922..183530
                     /locus_tag="CAGL0J01848g"
                     /note="highly similar to uniprot|P22138 Saccharomyces
                     cerevisiae YPR010c RPA135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447785.1"
                     /db_xref="GeneID:2889810"
                     /db_xref="GOA:Q6FPQ9"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ9"
                     /translation="MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQP
                     HVGSFNALTEGPDGGLLQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIA
                     KPTANDGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPI
                     MLQSNRCHLNKMSPHELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPS
                     FANRGASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKA
                     LVDTSDREIFDGIIGSNTNNSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLV
                     FQASPDKSDYEVGQEVLNRIVLVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPD
                     ATQHQEVLLGGFLYGMILKEKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRV
                     NDNIGSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQ
                     LKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLG
                     VTPASHTFAAGPSLCCVQLDGKIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIG
                     YVPPSSKGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNI
                     HTHVEFSPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYR
                     LQTGQTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYG
                     TMYKVEKVDLSLNRSRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPIC
                     AYFDDTIGKTKIKTYHSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKF
                     SSRHGQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALH
                     GIAQDSTPWIFNEQDTPADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYY
                     QRLRHMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDR
                     LLNSSDYTQAAICRECGSILTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLFEHEEKT
                     EEKIFIDDSQIWEDGQGQKFVGGNDTTTVAIPFVLKYLDSELSAMGIRLRYNVDPK"
     gene            <184269..>187109
                     /locus_tag="CAGL0J01870g"
                     /db_xref="GeneID:2889811"
     mRNA            <184269..>187109
                     /locus_tag="CAGL0J01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447786.1"
                     /db_xref="GeneID:2889811"
     CDS             184269..187109
                     /locus_tag="CAGL0J01870g"
                     /note="highly similar to uniprot|P13586 Saccharomyces
                     cerevisiae YGL167c PMR1 or uniprot|Q01896 Saccharomyces
                     cerevisiae YDR039c ENA2 or uniprot|P19657 Saccharomyces
                     cerevisiae YPL036w PMA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447786.1"
                     /db_xref="GeneID:2889811"
                     /db_xref="GOA:Q6FPQ8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ8"
                     /translation="MVESYVMKAVEESVDDSVEETHEMLPSAPVLDEEAYELLNRPNP
                     SLKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSF
                     VEDRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVP
                     TKCHLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEP
                     LHKDAQTIDPEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMV
                     NSIEKPKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAI
                     PEGLPIIVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSK
                     LFCLDSSGTYENAISPEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYIGNPTDV
                     ALIEVLTKFGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDK
                     SSYYLDKAGEVREFDEHSKVMVLEAAHSCASDGLRTIACAFKPTDSDNVISEDDINGL
                     TFTGLFGLADPPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESS
                     VMTGDKVSELTEDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAP
                     ALKLADIGIAMGISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLS
                     ISVATLSLIAITTIAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSR
                     EERILNMNILLRLLYLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFNA
                     VACRHTTKSIFQIGLFSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTL
                     VLVSSSVLIVDEIRKAIYALARVNEPVYSSEV"
     gene            <187614..>191738
                     /locus_tag="CAGL0J01892g"
                     /db_xref="GeneID:2889812"
     mRNA            <187614..>191738
                     /locus_tag="CAGL0J01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447787.1"
                     /db_xref="GeneID:2889812"
     CDS             187614..191738
                     /locus_tag="CAGL0J01892g"
                     /inference="similar to AA sequence:UniProtKB:P32521"
                     /note="similar to uniprot|P32521 Saccharomyces cerevisiae
                     YIR006c PAN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447787.1"
                     /db_xref="GeneID:2889812"
                     /db_xref="GOA:Q6FPQ7"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013182"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR026812"
                     /translation="MYQYSNQTGNGVYGNPPMQPLQNYGSSGYQQTAPMQQPLQTGYQ
                     QPMQQTMNQNQGMQLPQQQYQQQQPLQQQPMQQQPMQQQSFQQPQLQQPLQQQPTQTG
                     MQQQPLQQQLTQSGMLQQPLQPQMQQSSQTIQPNQLNVQNTVQSQQSVQPLLPQQTGF
                     YRQGNQPVLEPLKPTATGFVNSFANNGLDNNLKIPAIRLSFITAQDQAKFETLFRSIV
                     TKGSNTVSGENCRAILMKSGLQPSQLARIWQLSDTNRAGELLFPEFALAMHLINNVLQ
                     GDSIPYELDSKTKNEVSSFIDAINLSVVSTESDFKTPFDDLFKPQQSLQPQGTGFLPQ
                     TSFGLPAQPTGGFGQPQPTTFGQLQAQVTGGFGQPQPTTFGLQPQTTGGFVQAQQVTG
                     GIAQQPSMNPLTQQGTGFAQNQQGTGGFLQQQGTGSFNNAGFVQPQNTGSFVPQQQQQ
                     PVVQSQPIAPQSTGGFGPPMPTTFGIQPQSTGGFVQPQVTGGLQPALTGNIPQTSFGA
                     QPFNQQLQPQATGYLPPSQFSATMPLTAQKTGFGNNEIYAQSNFNGPSFSTQESDIIT
                     SEEKSLFYKIFETFSQNRGVLDSATAVEIFRKSGLNRSDLEKIWNLCDINNTGQLNKQ
                     EFALGMHLVYGRLNGRSIPDRLPPSLIPSSTKILDNVKNQLISSSSDGNRKSFTRMDA
                     LSYKNDDNDKLPNFRNRRKNYPTDNDADKERQRRQEREREEAAKKKEQERKTKMDIER
                     ARKQGSFTNSEPEFTDVSVSEIEDIKRRITEAQQKLAVRNQSIPNDLKKRFNEVVARL
                     PTLFVEIYKVDTEIMQARIELCKRRTPSSIIGTGPGGSITEDDRRKAKSKALLRSRMN
                     ALTGKGDNSDEPDIESESFTKEIEKIQSESAQNKKIIKDIRISISELSAPIRSIMTGS
                     LPTCSSTDFEKWEIGVGLENDVREFVLTLKKGLLYVSEPSHMNSNQTLSHPPAAALKK
                     EATGEDRAAQLKEQAQKRMKERLAKFGISRRETRDLESSKQQESGSTPDAVPAAQTAN
                     ASQTPFEEVISSPQKMEVTSTAGEDNEEEDEEERKLKEQLELLKQKKNAEKEKRLADL
                     RRQIEEAEKEEEHPSVAQSNSGNVQSSSNQPASVPVANSQPQNLQNTHITTKPLSLNQ
                     TGSSYDMASNTYFKPTQTSQSAFDREKAEQQRKIQRGLESDDDGWSDDDDDLYSKPNT
                     APQTAPVLDSSNTPQPGMNASVPAPIAPPIPTPQASSPAVPVAPPIPAVTPSESSIPM
                     TSNADVAGADHLDQDTDISGAAASADKQNTSHVSHIPPVPVAPPLPQVSSIAPPPPLP
                     NLSVPQPHETVDNDDGSDVLSIPDSVESDKEDLAPAGHTPAAMGIPPPPPLPNF"
     gene            complement(<191912..>192421)
                     /locus_tag="CAGL0J01914g"
                     /db_xref="GeneID:2889813"
     mRNA            complement(<191912..>192421)
                     /locus_tag="CAGL0J01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447788.1"
                     /db_xref="GeneID:2889813"
     CDS             complement(191912..192421)
                     /locus_tag="CAGL0J01914g"
                     /inference="similar to AA sequence:UniProtKB:P40565"
                     /note="similar to uniprot|P40565 Saccharomyces cerevisiae
                     YIR005w IST3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447788.1"
                     /db_xref="GeneID:2889813"
                     /db_xref="GOA:Q6FPQ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ6"
                     /translation="MNQIKAIQRINEKELEAGILKPEHSWHQEYKDQAYIFIGGLNRQ
                     LTEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAG
                     RQIKVDHIFFTPRDDIPEYTEAVREFLSKDKIDIHKDHLSTDNIQKETKYTNNEEDEL
                     NDPMASYSR"
     gene            complement(<192784..>194061)
                     /locus_tag="CAGL0J01936g"
                     /db_xref="GeneID:2889814"
     mRNA            complement(<192784..>194061)
                     /locus_tag="CAGL0J01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447789.1"
                     /db_xref="GeneID:2889814"
     CDS             complement(192784..194061)
                     /locus_tag="CAGL0J01936g"
                     /note="highly similar to uniprot|P40564 Saccharomyces
                     cerevisiae YIR004w DJP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447789.1"
                     /db_xref="GeneID:2889814"
                     /db_xref="GOA:Q6FPQ5"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ5"
                     /translation="MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTA
                     TERFQAISEAYQVLSSEELRAKYDKFGKQEAIPKGGFEDAAEQFSAIFGGEAFASYIG
                     ELTLLKNLQKTEELNAEDEAQKQKEAEEAQKRKEKEEEMKKNGHVQGSGQDITVHPDP
                     EGTKPKDDAVNQKKKTKLEEFEEQQKIEREKRIEELSKTLIERLSILTESVYDDACKN
                     SFQKKFEEEANMLKMESFGVDILHTIGDIYCEKAKIFLASQNLFGFGGIFHSVKAKGG
                     VLMDTLRTVSAAIDAQNTMKELEKMKEASTEDTEENSKNQQKTETETTTAPKPKPTAE
                     ELAQQEQLLMGKVLSAAWHGTKFEMTSTLRSVCDKVLDDQKIDLNTRIKRAEALRLLG
                     KVFQKTYRTKSEQEEAQIFEELVAEATKKHRNT"
     gene            complement(<194396..>196501)
                     /locus_tag="CAGL0J01958g"
                     /db_xref="GeneID:2889815"
     mRNA            complement(<194396..>196501)
                     /locus_tag="CAGL0J01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447790.1"
                     /db_xref="GeneID:2889815"
     CDS             complement(194396..196501)
                     /locus_tag="CAGL0J01958g"
                     /note="weakly similar to uniprot|P40563 Saccharomyces
                     cerevisiae YIR003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447790.1"
                     /db_xref="GeneID:2889815"
                     /db_xref="GOA:Q6FPQ4"
                     /db_xref="InterPro:IPR021582"
                     /translation="MIPAIPARPQRKKGDSAEDSPVPEVPQRPMRHSTTEEIADLVSN
                     TTKELEEMEQLISHGHKGEEPVVPQRRPKVVKAKEHENKQVVDTPEMPSIPQRPRRKQ
                     TSESLESVSVADGQGSKATEEMTATDSPMEDKDTNMVENTADVSKAKESTELNVPGGT
                     EETFTTEDPLPATTGSHPEAIKEISDELNEVVAGTEKPIEHTISNDKEETTLMKTSEQ
                     RDEEMKETKSNRASEKLSDNTSENETVKTSDFVAKTAEKTAEMVSPQESRDEIEKSVA
                     KTDEETDDKQIEEQKIESIEESIPESIEVPMKKSTEEPEKEPVEDSSEILVKGQTEEP
                     SEKSVSSSPDQSNDAPKTSTESANEIQRKSQEPTTETTSETSEKSTKDSTEPSEKVSQ
                     DRSDQNETADGEETKPHVPESRPKKRGPPPVPKKPSSRIAAFQEMLQKQQEAQFEKSQ
                     KKGEQNDGAMNSDARTKFANNLNGLFALPGMVPGGPPPPALAKVLKDPQDTANDKTST
                     SNDQDTGSGTNLKDVRHGRARGPRGRKLPTKVATTEKVKVSETGNTIEIFSAWKLSIK
                     GQVVHDADDDIDCRDQDNYVETEEQNMEEQEEREMEKELMASESTVEEEETVEQEKTV
                     EEEKPVKEELTVKEEQTKSAEPVLVNVPTGTSSDILDNEPTKTTLDVQEPSPEQKLDT
                     EAREESGTLPTEAEPLDNE"
     gene            <196812..>199970
                     /locus_tag="CAGL0J01980g"
                     /db_xref="GeneID:2889816"
     mRNA            <196812..>199970
                     /locus_tag="CAGL0J01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447791.1"
                     /db_xref="GeneID:2889816"
     CDS             196812..199970
                     /locus_tag="CAGL0J01980g"
                     /inference="similar to AA sequence:UniProtKB:P40562"
                     /note="similar to uniprot|P40562 Saccharomyces cerevisiae
                     YIR002c SJH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447791.1"
                     /db_xref="GeneID:2889816"
                     /db_xref="GOA:Q6FPQ3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /translation="MEDSDFDDAELDELYEKAINRRVNETLIRRSLPVQRDLQNGVVP
                     GQDTYYEEIRTEVTFGPTHHQLNEELLHSYIYPTNFEVRDYQFDIVRKGLLQNILCAI
                     PTGMGKTFIASTVMLNFFRWTKTAKIIFTAPTRPLVAQQIKACLGITGIPHDQTAILL
                     DKTRKNREEIWANKRVFFTTPQVVENDLKRGVLNPKDIVCLVIDEAHRATGSYAYANL
                     VKFINRFNSSYRLLALTATPATDIEGVQEVVNNLNISKIEIRTEESMDIVKYMKKKIK
                     DRVNIQTTVEIENIVEQLGIAILPVLNQAVELGIYESCPPSAINAFKAMQKSQAIIMN
                     PSIPEGIKWRNYFILQLLNHVGQMLKRIKIYGIRTFFSYFQNKVKEFTTKYDLGKSTN
                     KIAAGFYYHPMIQAITKECEEKIKDPNFLGHGKLEHLRDELTQFFYENPFESRVIIFT
                     ELRESALEIVKCIDSMENSEIRPHIFIGQAKGKEGFDEVKFVRKHGPKGRKKSDREKR
                     LEEERRMDEEKKQAALQEKLERTSRRTGSSEEAQLSGMNQKQQKEVIKKFKSGLYNVL
                     VCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIVLMFSSNEASKFD
                     QSMNDYYNLQKLISQHLVQYRKSDRILPPENQEPECEKKFIEVSEEDQELNNMEDTDD
                     VIRFATQCMLGKIPKTKKGRDKGKAKKGKTFFMPDNVITGIITANNLVRKRKSAQNGS
                     GAALLDSIVNDDIDLEDEDGQVEILDVDQEVNRRLASNAVQKTNDMALQIRNEETPEI
                     GDTRNKAKASSSMKVKKEPTMAVDHSDDEEDLPLSRHVERASRETAKEVPNATNVAEK
                     PFPPLEFGVQRPSKRQRLQPEVQPEVQPEVQPEVQPEVQPEVQPEVTVKPEVKIKTEE
                     GSKLYKNIFFSDEGFLQPHEKELFLSKYNPEDATVTIEPVPRFVRAHGRVKHSKRTEQ
                     LITLFEDMNHNRVARTIEMNKLRGIARRLHTVSQSQGQSNSQSQAHSTSQKSQQASQK
                     DRSSQDKDLTNSELEDLLDSDF"
     gene            200163..200405
                     /gene="SNR14"
                     /locus_tag="CAGL0J01994r"
                     /db_xref="GeneID:2889782"
     ncRNA           200163..200405
                     /ncRNA_class="snRNA"
                     /gene="SNR14"
                     /locus_tag="CAGL0J01994r"
                     /product="U4 RNA"
                     /note="SNR14 noncoding RNA U4"
                     /transcript_id="XR_002648367.1"
                     /db_xref="GeneID:2889782"
     gene            <200829..>201914
                     /locus_tag="CAGL0J02002g"
                     /db_xref="GeneID:2889783"
     mRNA            <200829..>201914
                     /locus_tag="CAGL0J02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447792.1"
                     /db_xref="GeneID:2889783"
     CDS             200829..201914
                     /locus_tag="CAGL0J02002g"
                     /inference="similar to AA sequence:UniProtKB:P40556"
                     /note="similar to uniprot|P40556 Saccharomyces cerevisiae
                     YIL006w or uniprot|P39953 Saccharomyces cerevisiae
                     YEL006w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447792.1"
                     /db_xref="GeneID:2889783"
                     /db_xref="GOA:Q6FPQ2"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ2"
                     /translation="MGQDEFYREKSHPEEICFPDSASPLTSTDVIEPFRGDTIDNKME
                     AYKGLVQEVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQ
                     TRTTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLR
                     TNSSNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKK
                     IINQEGVKALYAGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLI
                     LASSVSKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFG
                     TNLFRTLPASAITLVSFEYVRNFLNKI"
     gene            complement(<203412..>204836)
                     /locus_tag="CAGL0J02024g"
                     /db_xref="GeneID:2889784"
     mRNA            complement(<203412..>204836)
                     /locus_tag="CAGL0J02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447793.1"
                     /db_xref="GeneID:2889784"
     CDS             complement(203412..204836)
                     /locus_tag="CAGL0J02024g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447793.1"
                     /db_xref="GeneID:2889784"
                     /db_xref="GOA:Q6FPQ1"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ1"
                     /translation="MINNFNFSAGSRWTSFTKKFRNVKESLTSFSVFKWKRSDKLNKF
                     KHWFHNGAFSSKSIDVTRNIYEKPVDYSEVIEIVYGPNATLEDYEFDMEVVSNSFCSM
                     NNIASRIPSWEDGSGSSAETVLEPQAVYKDARERGQRSLFEAYKQMYPILPYMPDGNE
                     SGELSDETNDNSVSQVCETSSIYDGSSCWEGSIAYGHDRTQQEAIDCESINSSTVSMV
                     TIIRTKLPKECFSSVMLSDISTYATKNLDLNSDSNSSVSDFNESVPNNPSLFPSGSMK
                     RMKKLARKHGFKNLKEAFSKDIQGRITEIHDDIREEKPEHKVEHKVELKVEHKVEHKN
                     EESDAGRESAEETNNSCCSKAKGKLRRGWHVINKKKKKGKKSKSKKNKNKKPLGMKMP
                     VEEFEAKVAMSSPTSVAAVINGRNHLEFLPEDNTDDKANESLDQSSPIMSEAAKYRKM
                     IFDQIDAYFQDEEYKDGESAWTVQ"
     gene            <205632..>205871
                     /locus_tag="CAGL0J02046g"
                     /db_xref="GeneID:2889785"
     mRNA            <205632..>205871
                     /locus_tag="CAGL0J02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447794.1"
                     /db_xref="GeneID:2889785"
     CDS             205632..205871
                     /locus_tag="CAGL0J02046g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447794.1"
                     /db_xref="GeneID:2889785"
                     /db_xref="GOA:Q6FPQ0"
                     /db_xref="UniProtKB/TrEMBL:Q6FPQ0"
                     /translation="MLYSRRRNCTGSKDLCFHAQLQDLSDIGALLFTLEFTGKRYTYY
                     IFLRQTLQTVWPLWTGSVLPHWIYSIASVGGPSSL"
     gene            <207414..>209540
                     /locus_tag="CAGL0J02068g"
                     /db_xref="GeneID:2889786"
     mRNA            <207414..>209540
                     /locus_tag="CAGL0J02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447795.1"
                     /db_xref="GeneID:2889786"
     CDS             207414..209540
                     /locus_tag="CAGL0J02068g"
                     /inference="similar to AA sequence:UniProtKB:P40557"
                     /note="similar to uniprot|P40557 Saccharomyces cerevisiae
                     YIL005w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447795.1"
                     /db_xref="GeneID:2889786"
                     /db_xref="GOA:Q6FPP9"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6FPP9"
                     /translation="MLYSYLWSFMWLLAIACARPPPKVDERNDKPPRGFPLPLNKKNF
                     EVELSNGFHLVEFYSPYCSHCKNLAPIWEDTWVSFREEGKKLNMKLSQVNCVESGDIC
                     HKEDIRAYPTIRLYGPDGFLEEYHGKRTKEEFLKFARKSIMEYGDTDDLILPSLSKLL
                     SGKDFSQLISGKSTKPMLVSFWPTSDMQEDSSVETKFNNCPKCEIYQRKWNLINNAVD
                     GLGVDSGHLNCGSEQNLCERLGFADLASSAKSGGNVKPRLALIIPKKVTNNLFIYPEG
                     QDVSNQADVLDFIKRISVNSEAAEISESEIIDYSRNSMPLFSEFVHTNAKKVHSGQNI
                     YIIFCYNHKTVVPEDFTILEHLVEPLASRPNTYLRKFNGTIPELTKKVYDPFYQVVNY
                     NDSEPRKELNEEFQTMAAVTEYPTFLIIKEGELQTHVFNGFSTTEMRNLDTILDWIDD
                     TIVPSLPKLTWDNFEEMLNVNPSKYRTMAILLMSTKWEYDDKVNAAQKFFTSFLDYEH
                     VRMQKMFEIVQQERLKKANAIEKMREKQENTKNILAKMRQEISHPNDRKVQYMYLDLA
                     KDERLLKRLGVHNANIAPNQVLLIDKARKTLYAENHFEERLTGKDTYGIREALLSINI
                     PEKCQLSTILRAQHLKIKLQKKIKIPHVKVSNGSNSNILYFFAILLLLVLLRKSPVYR
                     MVSRKWHSHRASYQANTSYSKLEAQD"
     gene            complement(<209869..>210288)
                     /locus_tag="CAGL0J02090g"
                     /db_xref="GeneID:2889787"
     mRNA            complement(<209869..>210288)
                     /locus_tag="CAGL0J02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447796.1"
                     /db_xref="GeneID:2889787"
     CDS             complement(209869..210288)
                     /locus_tag="CAGL0J02090g"
                     /note="highly similar to uniprot|P22804 Saccharomyces
                     cerevisiae YIL004c BET1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447796.1"
                     /db_xref="GeneID:2889787"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:Q6FPP8"
                     /translation="MSSEYAESTLYQRDPSRTQLFGAADPTLIDDRTSPYDKGKLDYS
                     QSTLAHLESQSEEQMGVMTEKIRALKSLSMRMGDEIRGSNKTLDQLDDTFQRTTVKLK
                     QTFNNMMDMAKRSRISIKTWLLLFFFIFLLFFYVWIT"
     gene            <210632..>211489
                     /locus_tag="CAGL0J02112g"
                     /db_xref="GeneID:2889788"
     mRNA            <210632..>211489
                     /locus_tag="CAGL0J02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447797.1"
                     /db_xref="GeneID:2889788"
     CDS             210632..211489
                     /locus_tag="CAGL0J02112g"
                     /note="highly similar to uniprot|P40558 Saccharomyces
                     cerevisiae YIL003w or uniprot|P52920 Saccharomyces
                     cerevisiae YGL091c NBP35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447797.1"
                     /db_xref="GeneID:2889788"
                     /db_xref="GOA:Q6FPP7"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR015223"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /translation="MDPEEQLESTEGVPAKSLSLIKHILLVLSGKGGVGKSSVTTQTA
                     LTLCGMGYNVGVLDIDLTGPSLPRMFGIEDSSIYQSADGWMPIPVETNGKGKLCVVSL
                     GFLLGSRGTSVVWRGPKKTSMIRQFIKDVTWGELDYLLIDTPPGTSDEHISIAEELRF
                     TNPDGAIVVTTPQGVATADVKKEINFCRKVNLRILGVIENMSGFVCPYCTECTNIFSK
                     GGGESLAKQFDVPYLGNIPIDPKFVDLIENQKKMEGTLVELYEKSSLYPIYLEIMKKV
                     QEESSKPQE"
     gene            <211750..>212034
                     /locus_tag="CAGL0J02128g"
                     /db_xref="GeneID:9488019"
     mRNA            <211750..>212034
                     /locus_tag="CAGL0J02128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999523.1"
                     /db_xref="GeneID:9488019"
     CDS             211750..212034
                     /locus_tag="CAGL0J02128g"
                     /inference="similar to AA sequence:UniProtKB:Q3E7Z5"
                     /note="similar to uniprot|Q3E7Z5 Saccharomyces cerevisiae
                     YIL002wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999569.1"
                     /db_xref="GeneID:9488019"
                     /db_xref="GOA:B4UN26"
                     /db_xref="UniProtKB/TrEMBL:B4UN26"
                     /translation="MKWPRKLFDKITSIDRPVKITLNIMTIEDHNLTNSEAKNLQDAL
                     KDILQGEKQASEMEQKLDQVEKNLDMLLKQLESFEDARLQNGKSEKDEQK"
     gene            complement(<212192..>215047)
                     /locus_tag="CAGL0J02134g"
                     /db_xref="GeneID:2889789"
     mRNA            complement(<212192..>215047)
                     /locus_tag="CAGL0J02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447798.1"
                     /db_xref="GeneID:2889789"
     CDS             complement(212192..215047)
                     /locus_tag="CAGL0J02134g"
                     /inference="similar to AA sequence:UniProtKB:P40559"
                     /note="similar to uniprot|P40559 Saccharomyces cerevisiae
                     YIL002c INP51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447798.1"
                     /db_xref="GeneID:2889789"
                     /db_xref="GOA:Q6FPP6"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:Q6FPP6"
                     /translation="MRIFVGRNPRSVVLSSESYSLKFERLYDRSNQTQGNVQAQQGQP
                     NQIKAPTVSIKNVSASELVKDGYRELRALRLNGLLGLLTINGDVYVVVVGGVQSIGYP
                     RWHLDDSSKITPEQSINKILEVDFISLDTEIYDHLFFDRSEQNFDKLLHEHPCGVYKR
                     LFADGSFYYTKDYDLTNAVKSPGLTHNLDYAIDNFDTSFIWNANLIGEIINWRGRLSM
                     KEKQAFDNAPFLMFVIRGFCKTSIVNDPDLTATVTVLSRVSTEGHKSISDSEGMHEDS
                     RVSTIIETETIVTTDSFILSYTQIAGNIPLFYEIIDGQLLSGKKLKLLKQPGEGQNEF
                     NKHFDTLESKFGIVSVVNLVKSRSDSQETLASIYKQYSDTRGIKISNIPCGSQTLNKS
                     PHKVLYSLKQDIYECGAFAYNIKKGIYFGKQTGVIRISAADPIEKPILLEKLISKEVL
                     ELATKELDGFSITSPLLEVHDKLWSENHFWLERVYAKNQKNYNKSAKIYLKLFSSHVK
                     LFDPVHFYISQYLRQFRSSFTHMKDIKVFAGTFNVSGKLSKDDISQWIFPNGVTTEED
                     FADVYVFGLEEVVELTPGHMLAIDPYIKQFWEKKLLDTINYYDKDSSYTKVWSSQLGG
                     VLLILLMKSSESLKVKHVEGDVKKTGFGGITSNKGAVAVSFNYSATRFCVLVSHLAAG
                     LENVEQRHNDYKMISKNIRFSRGLRIKDHDAIIWMGDFNYRILMSNEEVRKLIALKDY
                     KSLFEKDQLNQQMIAGESFPYFHEMPIEFPPTYKFDPGTRQYDTSEKLRIPAWTDRIL
                     GRGDVLRQLTYTYAPDVLFSDHRPVSAVFSANVTVVDEKKKAELSSVIHTKLMERLEG
                     CDEDERIEILNDGNFKLNELDDEISNITNMNAKPEQKRARKLPPPSSEIRKWWVGNGK
                     QVKVFLDTDPEEFMLNPEHTPNPFDSNDTSPLFVPRS"
     gene            <215693..>217195
                     /locus_tag="CAGL0J02156g"
                     /db_xref="GeneID:2889790"
     mRNA            <215693..>217195
                     /locus_tag="CAGL0J02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447799.1"
                     /db_xref="GeneID:2889790"
     CDS             215693..217195
                     /locus_tag="CAGL0J02156g"
                     /inference="similar to AA sequence:UniProtKB:P40560"
                     /note="similar to uniprot|P40560 Saccharomyces cerevisiae
                     YIL001w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447799.1"
                     /db_xref="GeneID:2889790"
                     /db_xref="GOA:F2Z6E2"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:F2Z6E2"
                     /translation="MVEGSATSIDPRFAELCMACRVGDIENADRLISTGININSVDEY
                     DNSPLFLASLCGHEEVVKLLLERGAACDRDKFEGARCIYGALTDSIRDILLSHDISKA
                     VDLNQPFATHISSLIRDFWFFMTFDLTIDFSKEDINFKAHKFLLNILCPEFFDSNWLC
                     DNDSIDLSSVTDSATFEYFLGYAYLLPAVHKLSHRDYDELIKFSEVTKLHILTEFLHQ
                     SRTTYDAAEKSTLVMDFQFKFREYLREALKVFVEDKIINNYEENLNNITNKCLAFHDI
                     YLRVQNHDTQVRYYPCHLAILERAPLFQLVFNSNFREKSVYISKSEYNDSITVNFPNC
                     DFNVVEIILRYLYYDCPEIPIEYAAETVVMADILLEDRLKAIATANLVKSKSVFDYYS
                     VFDILKLGWEMRSEKLEHFAAKEIAENLFKYEEDQNLKQAILESSQRISARQETDTIE
                     LVDDIRYYLVSSFVTNVNSDIVEEEDYENIEYQKRIAVVNKILRQLNIDA"
     misc_feature    217322..217432
                     /note="Centromere Cen0J"
     gene            complement(<217645..>218079)
                     /locus_tag="CAGL0J02200g"
                     /db_xref="GeneID:2889792"
     mRNA            complement(<217645..>218079)
                     /locus_tag="CAGL0J02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447800.1"
                     /db_xref="GeneID:2889792"
     CDS             complement(217645..218079)
                     /locus_tag="CAGL0J02200g"
                     /inference="similar to AA sequence:UniProtKB:P40561"
                     /note="similar to uniprot|P40561 Saccharomyces cerevisiae
                     YIR001c SGN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447800.1"
                     /db_xref="GeneID:2889792"
                     /db_xref="GOA:F2Z6F7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:F2Z6F7"
                     /translation="MAISPQKISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADA
                     CSIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKA
                     LDFNGTNLRQHVISVERKRTNIPNYKQNTSNNTDSGTENKNT"
     gene            <219375..>220091
                     /locus_tag="CAGL0J02222g"
                     /db_xref="GeneID:2889793"
     mRNA            <219375..>220091
                     /locus_tag="CAGL0J02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447801.1"
                     /db_xref="GeneID:2889793"
     CDS             219375..220091
                     /locus_tag="CAGL0J02222g"
                     /inference="similar to AA sequence:UniProtKB:P40007"
                     /note="similar to uniprot|P40007 Saccharomyces cerevisiae
                     YER002w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447801.1"
                     /db_xref="GeneID:2889793"
                     /db_xref="GOA:Q76IQ1"
                     /db_xref="InterPro:IPR019002"
                     /translation="MTSVRKRKMNRSSVKKVSRRNKDKQKKKLIACNPIIAKNWDYSL
                     TLAQNYEKLGLKAKLQTPAGGQEAKYDTVIKKEATIDPVTQFGEDSDSDSEEDSSNSQ
                     EDNEGQNVEDIDENEIPEGEARIIRDAEGNVVKVVYGKKKVFDIDDDIDTIKAKLADQ
                     QKEETEVVKQLEAFASRPIVKKERVQSPREVEWLEKLYKKHGDNYKAMFFDRKLNIYQ
                     QSEGEIKRKMRKWKSENNIA"
     gene            complement(<220448..>221737)
                     /locus_tag="CAGL0J02244g"
                     /db_xref="GeneID:2889794"
     mRNA            complement(<220448..>221737)
                     /locus_tag="CAGL0J02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447802.1"
                     /db_xref="GeneID:2889794"
     CDS             complement(220448..221737)
                     /locus_tag="CAGL0J02244g"
                     /note="highly similar to uniprot|P29952 Saccharomyces
                     cerevisiae YER003c PMI40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447802.1"
                     /db_xref="GeneID:2889794"
                     /db_xref="GOA:Q76IQ2"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016305"
                     /db_xref="InterPro:IPR018050"
                     /translation="MTSDRFFRLDAGYQQYDWGKIGSSSAVAKFAAHSDPSVKIDETK
                     PYAELWMGTHSKLPSVNHETKATLNDILAKNSQELIGEDVINKFKSTNELPFLFKVLS
                     IEKVLSIQAHPDKELGKKLHMEDPKNYPDDNHKPEMAVAITEFEGFCGFKPLEEIADE
                     LETIPEFRDVVGDEVANEFIQNYKTGVENSSSACANNKKLLQKVFEKVMTAPCDILEK
                     NADGMAKRANENPSSFKSSDLPELVVRLNRQFPKDVGLFCGCLMLNHCKLQPGQALFL
                     EAKDPHAYICGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYRYDPVEKQVMSAEE
                     FPRAGGDGATIMYNPPIAEFSVLETTFKNKTGKATVEGLKGPSIVITTAGEGYISADG
                     QKLKAEPGFVFFIGANVPVELETTDKDFTTYRAFVEA"
     gene            complement(<222727..>223485)
                     /locus_tag="CAGL0J02266g"
                     /db_xref="GeneID:2889795"
     mRNA            complement(join(<222727..223258,223475..>223485))
                     /locus_tag="CAGL0J02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447803.1"
                     /db_xref="GeneID:2889795"
     CDS             complement(join(222727..223258,223475..223485))
                     /locus_tag="CAGL0J02266g"
                     /note="highly similar to uniprot|P89886 Saccharomyces
                     cerevisiae YER007ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447803.1"
                     /db_xref="GeneID:2889795"
                     /db_xref="GOA:Q6FPP1"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:Q6FPP1"
                     /translation="MFKKFSKEDVHSRSKVKSSVQRTLKTKLVSQYPKLEDVIDELIP
                     KKSQIELIKCEDKIQLYTVDEEVLFFQKFNDLIPSLKLVHKYPEAFPTVQVDRGAIKF
                     VLSGANIMCPGLTSAGASLPEAPGLEKGTIVVINAENKENALAIGELMMSTEEIKSIN
                     KGHGVELIHHLGDPLWHFTL"
     gene            complement(<223820..>225445)
                     /locus_tag="CAGL0J02288g"
                     /db_xref="GeneID:2889757"
     mRNA            complement(<223820..>225445)
                     /locus_tag="CAGL0J02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447804.1"
                     /db_xref="GeneID:2889757"
     CDS             complement(223820..225445)
                     /locus_tag="CAGL0J02288g"
                     /inference="similar to AA sequence:UniProtKB:P12630"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015w BAR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447804.1"
                     /db_xref="GeneID:2889757"
                     /db_xref="GOA:F2Z5X7"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:F2Z5X7"
                     /translation="MIQFINCYFIFNLVTVVNCLRLTIEKRIVSSHASLSKRSAVDLQ
                     FRRFNNLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDC
                     SGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFA
                     TNATFSGVLGIGFPAMESVNGYEFAPGKFYPNFPLALKNAGFTNIAAYSIEYNDESKK
                     GSILFGSIDTSRFIGPLYTFPMINEFPGIADEPSTLSLTLDGIGIDGSCEQWVISNTK
                     LPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGE
                     LHMKIPLRSFILLPDEESNGLCGLGITSSKGRVILGDSFLTHVYTVFDLDNYMISLAP
                     MAKSSLPGKVIEIPANGLIENAVISKSEKWTHFNDITVNEYGFRNYCDGELQDIHSYS
                     SKLNSSSLVYSSNFSSDEEQNSSESVSPSIFNTDSSIKEIYPSLSQKEHLSALLTTIS
                     TSEIHKPVTATITDSITTTIRVTKILTVLQCAT"
     gene            complement(<226364..>226825)
                     /locus_tag="CAGL0J02310g"
                     /db_xref="GeneID:2889758"
     mRNA            complement(<226364..>226825)
                     /locus_tag="CAGL0J02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447805.1"
                     /db_xref="GeneID:2889758"
     CDS             complement(226364..226825)
                     /locus_tag="CAGL0J02310g"
                     /inference="similar to AA sequence:UniProtKB:P40548"
                     /note="similar to uniprot|P40548 Saccharomyces cerevisiae
                     YIL016w SNL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447805.1"
                     /db_xref="GeneID:2889758"
                     /db_xref="GOA:F2Z605"
                     /db_xref="InterPro:IPR003103"
                     /db_xref="UniProtKB/TrEMBL:F2Z605"
                     /translation="MDSLIEYVKQQNIDVQGICVATVSAAVFAVLLWKFTSGSGSSKK
                     SKSKSYKKKNKKEKVAALTHEMQIENIHLRYKNEFEDRVNNILGAYNPDDEKSVYEKK
                     YCNEMLLKLLIELDGVDLVSEEPEKKAILKAKRKAVIKEIQTQLKKLDTLV"
     gene            <227226..>229910
                     /locus_tag="CAGL0J02332g"
                     /db_xref="GeneID:2889759"
     mRNA            <227226..>229910
                     /locus_tag="CAGL0J02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447806.1"
                     /db_xref="GeneID:2889759"
     CDS             227226..229910
                     /locus_tag="CAGL0J02332g"
                     /inference="similar to AA sequence:UniProtKB:P40547"
                     /note="similar to uniprot|P40547 Saccharomyces cerevisiae
                     YIL017c VID28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447806.1"
                     /db_xref="GeneID:2889759"
                     /db_xref="GOA:Q6FPN8"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN8"
                     /translation="MVSFDSVSSSEHSLVALRNRIVGDATAKLDVYLGQNSTIFKELT
                     SISASDDIDLQHLKLDILLILLNVDKNTIESLGESYNDVVVSVLQDIELPKTFLTNNT
                     SINRKYIKLINMSKGYTECDEFPFLKETEQYLSHLIDKLLSDIANSSEIANTIELLTL
                     QLQNGKNRSFLMTKSLKEQIESMLFKCYRKYAELINYKYMIRLRVQKDKKNNKYKPLS
                     NKGLNSCISLPNSITISNQQDEKLLYLCLVLYTWSHKINQTASLWESSEFQFFISSFL
                     KGENIQLKCAALEFLIAPYLNTENTWKKRKIIIKYLPYLVDLLNYQPLPKWFDIFETL
                     TDLIELYNRHEPMNNPIIMFLSKSNMLYGILGVFFECMSLKTQNNASIKTLTKCVKFC
                     AAFAANDEKYRALLLEHKFLLNNLEFGLELHLSLLNEFIEFFNTFKNGNLISSTEPFP
                     CLYDSELCFEWLSLLKSFSRSVTALRTSLKRNKLPELLLRLLRKIHRITKECFEVGPE
                     FLGAELKVMGQTLGTICNFVVEFSNLQPYLVKNGIIEIIQDLLSDPLLNDSIEWNLQS
                     RKNALQGCNTEDVKTNSLWVLRHLMYNCQNEEKLELLAKIPMETILEFVNDPSWPVQA
                     QAFQLIRNLTSNSRKVVNILLENFKEVEYNLDPVTGKTKAIGNTYLFEFLVHKMTKLD
                     PRDPPQKKTLEGILYIIVNLAAVNENKKQLVVEQDEILEILSEILAASAQNPTRYGND
                     SDLKLASLWVLNNLLWNSESANHSQFGLDGYPPTSRDSSSAPIDYSEPPSGRVSRNEI
                     HGITSNTDHNSAIDEDIDDSSALQDNEERNDEFVRHIPEGRSQNNNSTVLRCKKLVDL
                     GIHELVKKNIFDDSLSVREKARTLSFHMDLLLRDSNSS"
     gene            complement(<230262..>231571)
                     /locus_tag="CAGL0J02354g"
                     /db_xref="GeneID:2889760"
     mRNA            complement(join(<230262..231022,231568..>231571))
                     /locus_tag="CAGL0J02354g"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_447807.1"
                     /db_xref="GeneID:2889760"
     CDS             complement(join(230262..231022,231568..231571))
                     /locus_tag="CAGL0J02354g"
                     /note="highly similar to uniprot|P05736 Saccharomyces
                     cerevisiae YIL018w RPL5A and highly similar to
                     uniprot|P05736 Saccharomyces cerevisiae YFR031ca RPL5B"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_447807.1"
                     /db_xref="GeneID:2889760"
                     /db_xref="GOA:Q6FPN7"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGV
                     VKQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVL
                     PLGSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKIISS
                     DARGVIGVIAGGGRTDKPLLKAGRAFHKYKLKRNSWPKTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
     gene            complement(<232589..>233593)
                     /locus_tag="CAGL0J02376g"
                     /db_xref="GeneID:2889761"
     mRNA            complement(<232589..>233593)
                     /locus_tag="CAGL0J02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447808.1"
                     /db_xref="GeneID:2889761"
     CDS             complement(232589..233593)
                     /locus_tag="CAGL0J02376g"
                     /inference="similar to AA sequence:UniProtKB:P40546"
                     /note="similar to uniprot|P40546 Saccharomyces cerevisiae
                     YIL019w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447808.1"
                     /db_xref="GeneID:2889761"
                     /db_xref="GOA:Q6FPN6"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN6"
                     /translation="MGETDAEYLKMLELQRQAFEAQFGSLESMGYEDKTKEGDDSGSS
                     DVDSFSGDSDLSDKEGSDESEQDEEQFRGFDEEDDVEDKSVSKSADIRQPKVIKFSGA
                     NDTYVPPSKKEQKLLRSGKTLNKNRKLLESEGTETKPGDDEGEDMEMENLQNDIELQR
                     FLKESHLLSAFNSATSGASLTLDGLKDTTVSYQDDEVMGKARARTLEMRLQNISKVNG
                     DGRKISKLEKVPMHVRKGMIDKHVKRIKKYEEEAADAGIVLSKVKSGNFRKIESTYVK
                     DIERRIGSSIKSKDLEKSKKRTRGLKVQSVGRSTRNGLVISSEDIARINGSGKSKRRR
                     "
     gene            <233987..>234772
                     /locus_tag="CAGL0J02398g"
                     /db_xref="GeneID:2889762"
     mRNA            <233987..>234772
                     /locus_tag="CAGL0J02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447809.1"
                     /db_xref="GeneID:2889762"
     CDS             233987..234772
                     /locus_tag="CAGL0J02398g"
                     /note="highly similar to uniprot|P40545 Saccharomyces
                     cerevisiae YIL020c HIS6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447809.1"
                     /db_xref="GeneID:2889762"
                     /db_xref="GOA:Q6FPN5"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011858"
                     /db_xref="InterPro:IPR013785"
                     /translation="MTKFVGCIDLHDGQVKQIVGGTLKDNDDSLETNFVSKYPPSYYA
                     QLYLENRIEGCHVIKLGPNNDAAAMEALNAAPGFLQVGGGINDENCLQWLEKASKIIV
                     TSWLFTKEGTFLMDRLQLLSNKCGPDRIVVDLSCRRTPDSKWVVAMNKWQTLTTLELN
                     KETFTELSKYTDEFLIHAADVEGLCKGIETDLVTKLYEWTKDINKEVKIVYAGGAKSI
                     SDLELVDKLSNGTVDLTYGSSLDIFGGKLVRFQDCCEWNSKHN"
     gene            complement(<234977..>235915)
                     /locus_tag="CAGL0J02420g"
                     /db_xref="GeneID:2889763"
     mRNA            complement(<234977..>235915)
                     /locus_tag="CAGL0J02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447810.1"
                     /db_xref="GeneID:2889763"
     CDS             complement(234977..235915)
                     /locus_tag="CAGL0J02420g"
                     /note="highly similar to uniprot|P16370 Saccharomyces
                     cerevisiae YIL021w RPB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447810.1"
                     /db_xref="GeneID:2889763"
                     /db_xref="GOA:Q6FPN4"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN4"
                     /translation="MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTL
                     AIDSVEVETNTTVLADEFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQ
                     AVGESESTTNVYAKDLLIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAK
                     KGIAKEHAKWGPAAAIEFEYDPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEP
                     FDYKAKADTFYMNVEAVGSIAVDQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGD
                     AKGNGIEEDGDAMMMNGHDGPYGDNGRSSDTYGSAW"
     gene            complement(<236641..>237879)
                     /locus_tag="CAGL0J02442g"
                     /db_xref="GeneID:2889764"
     mRNA            complement(<236641..>237879)
                     /locus_tag="CAGL0J02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447811.1"
                     /db_xref="GeneID:2889764"
     CDS             complement(236641..237879)
                     /locus_tag="CAGL0J02442g"
                     /note="highly similar to uniprot|Q01852 Saccharomyces
                     cerevisiae YIL022w TIM44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447811.1"
                     /db_xref="GeneID:2889764"
                     /db_xref="GOA:Q6FPN3"
                     /db_xref="InterPro:IPR007379"
                     /db_xref="InterPro:IPR017303"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN3"
                     /translation="MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEK
                     SQELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELAT
                     KAWDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQ
                     RRLKREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKS
                     VKVSLWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRD
                     YIVPEVLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILDIRGVEVVS
                     AKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRDPEQIDD
                     DETEGWKILEFIRGSSRPFN"
     gene            <238695..>241445
                     /locus_tag="CAGL0J02464g"
                     /db_xref="GeneID:2889765"
     mRNA            <238695..>241445
                     /locus_tag="CAGL0J02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447812.1"
                     /db_xref="GeneID:2889765"
     CDS             238695..241445
                     /locus_tag="CAGL0J02464g"
                     /inference="similar to AA sequence:UniProtKB:P40537"
                     /note="similar to uniprot|P40537 Saccharomyces cerevisiae
                     YIL031w SMT4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447812.1"
                     /db_xref="GeneID:2889765"
                     /db_xref="GOA:Q6FPN2"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN2"
                     /translation="MSRRRAFQGGIMPVDTLSSSPVAETQERRPVSPVRYRRKRDPKV
                     IAELNQKGHEIFSIGDEDGLPMRHKEKDVQRGEGEERSSNRPTSTSDGNYESLRYVVV
                     GKMKLITLDQKEVDVEEAVLEFSNKKGELNPSMKIRPTDSRSKVKDFKIKILRDCSKI
                     WFTERVAKVGIFLKEKLDVPIVDGSNEVLPIICIVWVRSLQDSTIFLRLSRIQIVLHE
                     LAKSRKTLHTTLTVLTNLTELELQRCIKSNMITELQKLSRAKRRLISSSSDGINDQDD
                     VPNKGVSNTNNVSRKNGIRSLISKASKAAYNTGNGKSIRIPFSVNGANNRKISSTSQS
                     VDPIPSSNFYSSSSPSGNTRSNSLNKRANEHKLSDHLLSNVKRTRKSMINGSNNSIKD
                     PMSIDDEEIAFDEDKSNAEDELFYETPKIFEPNLVYKFTDGSYYTITNQDFKCLYNKD
                     WINDSILDFFTKYFIESAITNNKVRKEDVHIMSSFFYTKLTSTEEEVYSNVKKWVNNT
                     DLFKTKYVVIPINNNFHWFGCIITNLDSFFIYYNENKMSKNSKNLANMDREEDDITVS
                     PPIITILTFDSLKQTHSREIDPIKEFLIGYAKDKYQLDIDKSLIKMKTCAVPQQANFS
                     DCGVHVIFNIKGFFENPHQTVELWYSKKMKNKHDMRYINEYFNKSGRNNSRKFLRDIL
                     LSLQKQQVLHNAGIEANGQALSNVDEDEDIEIIEDLYDAKDSKLAPIDVKKNVNDIDI
                     GRQSLSSRVGLQSEPPSPTPEFQEDQSIPSSSIMNVNSKAEEQGHIISNLSRSSHILA
                     SYKDSESNQVYTSPYFGKSILKDRVDNYTASTENAHSNSTYSNGHEKSNANNSGSPTM
                     DIGVGENSEISADDFSERYNESDVNLIPEGVAPKSEQDEDALDLIRDSLARELNENID
                     TH"
     gene            complement(<241644..>245351)
                     /locus_tag="CAGL0J02486g"
                     /db_xref="GeneID:2889766"
     mRNA            complement(<241644..>245351)
                     /locus_tag="CAGL0J02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447813.1"
                     /db_xref="GeneID:2889766"
     CDS             complement(241644..245351)
                     /locus_tag="CAGL0J02486g"
                     /inference="similar to AA sequence:UniProtKB:P40318"
                     /note="similar to uniprot|P40318 Saccharomyces cerevisiae
                     YIL030c SSM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447813.1"
                     /db_xref="GeneID:2889766"
                     /db_xref="GOA:Q6FPN1"
                     /db_xref="InterPro:IPR011016"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN1"
                     /translation="MDIPQGATCRICRGEATEESPLFHPCRCRGSIKYIHESCLLEWI
                     SSKNIDISKTGAEVNCDICHHPFNFKTTYVEDMPEKIPFPILLKSTLKATFSKMRKSL
                     EISLALVLFLFGWPLVWNTWARLYTFALDGTIPYEEDTIRSILFGFQENPEYYRNIVL
                     TKSTVLKQLLWNYKFTALQIALIVILHIALYFQYDMIVREEVFSKMILHKIGPKLSIN
                     DMKARLMERFPMMDEAMIDHLAVALRARENNRQGIQDEAQRPIVVDRVQEREPLHEVN
                     ADEEVNPQNNINNMHLDSDDDENDPDFVVNDHDSDTDDEANHWGVGQQDEMNDPFRER
                     FEEMMNRRAQNQFDNLLAQQQERNAQNAMNRPNAPIFIPPVQEAQPDEAMQDNDGANA
                     VLINVKLKLSSILIYFVVGAVVCSLYLLLSYLIPTVVGYGLIRVYLKILEIAFRGFNL
                     LMHYSKLSVVYFGLVKYIPFISVVHQELVVATTHQYLEYYQGYFDNSMKHSMLLRALP
                     CLTTYLTAIAINTVVSEMISKGYGRHNGLSSNVKRQIFQITFAIRCTLKVFTLFFIEL
                     AGFPILAGVMLDIALFCPILGSPNKLLSIPQLFRIWPKLSFFAYWIIGTLYMYWFAKY
                     IGMIRKHIIRPGVLFFIRSPEDPNIRILHDSLIHPMGIQLSRLCLSMFIYAVFIIAGF
                     GLHTRVIFPMLWKSGFSTFSDKCKPDSFFDKTSLTILLAFTVTRNILEKNSVLKRAVK
                     DYWVYVFHVCARNLRLSSFIIGKDVPTERGHILYRNWFFKLFASQKAQWSNTELFTSP
                     KTYDEALELFRENKSVHAYFIPDGVLMRVPSSDIVSRSYVQTMFVPVTTDDKILKPLD
                     FKKINERNKSTAGEFGYLDEQNTEFDHYFVVYVPPNFRMRYMILIGLIWFFSSLLFIS
                     ICLMSHYTSKLLMLPIEVFIMTNSNENKEEHINPYYVCIGLIILSQLLPKVYKLVEKR
                     TLNKTHQVETEVEAENEDDENDVEVPMEPEVAFLDIVKDFKESFVFKLILSTLIAMGE
                     FWIALISNIALLVHLIIAYNYCIALCGGSRFISFLPSSSGDLFTSTNDKIRTIFTIIN
                     SVLLLLKGKRTGSVFIKNKNRRTSELLKRLLSAVLTNTLKFHGSNLLVLAVLCVIFNV
                     INGTLYLDMTWSSTAKFIPLVFNSVPSHSWSRTEHAYMMTLLLAYFSYFISNFMVTFS
                     KYWNVLEQGVKDTIYTKGKKLENLPEEKDGQ"
     gene            complement(<246210..>248822)
                     /locus_tag="CAGL0J02508g"
                     /db_xref="GeneID:2889767"
     mRNA            complement(<246210..>248822)
                     /locus_tag="CAGL0J02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447814.1"
                     /db_xref="GeneID:2889767"
     CDS             complement(246210..248822)
                     /locus_tag="CAGL0J02508g"
                     /note="some similarities with CA1576|CaHYR1 Candida
                     albicans CaHYR1 and DEHA-IPF10153.1 Debaryomyces hansenii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447814.1"
                     /db_xref="GeneID:2889767"
                     /db_xref="GOA:Q6FPN0"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:Q6FPN0"
                     /translation="MSLITIFAFFIKATLVLSLDILTPTTLTGDQTFNEDVSVVSSLT
                     LNDGSQYLFNNLLQIAPSSASVTANALAAVSVFTFSLPPSSSLSNSGTLIISNSNTGP
                     STEQHIVITPNVMANTGTITLSLAHTNTDSSSTLIIDPVTFYNTGTINYESIGSETND
                     PSLTGNILSIGSSGRTLQNLGTINLNAANSYYLLGTITENSGSINVQKGFLYVNALDF
                     IGNTINLSTTTALAFISPVSQVVRVRGVFFGNIIASVGSSGTFSYNTQTGILTVTTNG
                     VYSYDIGCGYNPALMSGQQETLSFQGNLYDTFLVLVNQPIPSDLTCAAVSSSITPSSS
                     VEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPS
                     SSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVE
                     PSSPAVPSSSAEPSSSVVPPITPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPT
                     VPTSSVSPSSPTVPTSSESPSTLSTPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSS
                     AGGGNGGDNGQPGADGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAG
                     QPGAAGQPGAAGQPGAAGQPGAGSGGGSEQPTPGAGAGSGSADGNQSGTSSGTGNGQA
                     GSGQAGSGQVGSGQAGAGQAGSGQAGAGQAGSGQAGAGQAGLDNTASGQSEGGQASAM
                     DGDQSGRGGQSNSGSLLQPNAQQGTGSGTGSDTGADQASGESPGQIGDAQPGSGTDQS
                     SGRHSLAAEARTSQSHSLAADARTRSTTRQTSVIAPGTAPGTAVVTTFHGCGTVNHKG
                     MINILLALALLVLL"
     gene            complement(<250629..>252893)
                     /locus_tag="CAGL0J02530g"
                     /db_xref="GeneID:2889768"
     mRNA            complement(<250629..>252893)
                     /locus_tag="CAGL0J02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447815.1"
                     /db_xref="GeneID:2889768"
     CDS             complement(250629..252893)
                     /locus_tag="CAGL0J02530g"
                     /note="some similarities with CA1621|CaIFF6 Candida
                     albicans CaIFF6 and DEHA-IPF4655.1 Debaryomyces hansenii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447815.1"
                     /db_xref="GeneID:2889768"
                     /db_xref="GOA:Q6FPM9"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM9"
                     /translation="MLMFSRILLFFASYVLVKAQQTITTPTTLTGNQNFNEDIDVQSS
                     LTLNDGSEYIFNNLLDISLDTASVEANAQSGSVFTFSMPPSSSFSNLGTLTINNNAGV
                     VSEQHININPSTFSNSGTLTIRVVHYQSDSSSTMLIDSPSFANSGTINYERTGTEIND
                     PGLEGNILHIGSAGHALDNTGIINLAAGNNYYLQGNIQGEGGSINVNYGLLHIDSTSF
                     AGNTINLGPEGALAMIRPVPETVVVRGFAAPNFIASAGTNGAFAYNEQTGILTVTTDG
                     NTYTYDIGCGYDPALLIGTQSSIGYEGNLVDGYGVAYTGAAPADVTCAAASSSIVPSS
                     SVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVDT
                     SSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSV
                     EPSSSVEPSSSVEPSSSVEPSSSVDTSSSVEPSSSVEPSSSSSSSSSSSSSSSSPSSS
                     SSSSSSSSAVVTTITTTIEDPGVPPVIITTTITIGAGTGQGEQGQAGQAGQAGQAGQA
                     GQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGSGQAGQAGQAGQAGS
                     GQAGQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGSGQAGQ
                     AGSGQAGSGSGNQEHSHSLAALGRTGTTSGRAQPTTILTPSHLATTFHGGVEHVNVGL
                     FNFMLPFIISVLLL"
     gene            complement(<254862..>257549)
                     /locus_tag="CAGL0J02552g"
                     /db_xref="GeneID:2889746"
     mRNA            complement(<254862..>257549)
                     /locus_tag="CAGL0J02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447816.1"
                     /db_xref="GeneID:2889746"
     CDS             complement(254862..257549)
                     /locus_tag="CAGL0J02552g"
                     /note="some similarities with CA1576|CaHYR1 Candida
                     albicans CaHYR1 and DEHA-IPF10153.1 Debaryomyces hansenii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447816.1"
                     /db_xref="GeneID:2889746"
                     /db_xref="GOA:Q6FPM8"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM8"
                     /translation="MTNMKVFIVLMLGFCLVSALDVNSILSLTGIQLFTEPVHIFSTG
                     ALSLTLGNSYAFNDLLTIDGGGSLSATALLDILLPFSFSIPSTSSVTNSGSMTISNGN
                     LLGLGGSQSINIIPSSLTNTGTITLDLARTVSDATSLLVIDAGVFVNSGTISYIGGGA
                     GGTDPNLLGNILQIGSVGNTIDNTGTIHLNAAPRYNLLGNIIGDGGVIDIEQGTLVIS
                     SQTFTGNSIALHPNTAAAFVNAQANAIVVTGLLDAAAIISLGVDGSFVYDPTTGILTV
                     TTSLGVFLYDIGCGFDPALFLGAQITIQVGGVNVDAYSVVYLGVAPSDTTCAAASSSI
                     IPSSSIVPSSSVEPSSSIEPSSSIEPSSSIEPSSSVVPSSSVEPSSSVVPSSSVEPSS
                     VLPSSSVVPSSSVEPSSSVLPSSSVVPSSSVEPSTPPIPSSSVEPSSSVVPSSPAVPS
                     SSVEPSSPAVPSSSVEPSTPPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPTVP
                     TSSVSPSTISTPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSSAVGGNGGDNGQPGA
                     DGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQP
                     GAGSGGGSEQPTPGAGDGSGSASGNQSGTGSGTGSGQQGSGQAGSGQAGAGQQGSGQA
                     GAGQAGAGAGQQGSGQAGAGQAGAGQAGAGQAGSGQAGAGQAGAGGSGAGSSGSGSGS
                     GAGGAGTSGSGSGAGGSGAGSAGSGSGGSGAGGSGAGGSGAGSAGSGSGGSGAGSAGS
                     GSGGSGAGSSGSGAGASGSGSGAGAGGAGSGGTGAGSGQASPQPHSVAAQARTTTGGS
                     QPTVLAPSQLATTFHGGVEKINVGLFQVLLPFVVSVLLL"
     gene            complement(261092..261164)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J02596r"
                     /db_xref="GeneID:2889748"
     tRNA            complement(261092..261164)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0J02596r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2889748"
     gene            <261400..>261843
                     /locus_tag="CAGL0J02618g"
                     /db_xref="GeneID:2889749"
     mRNA            <261400..>261843
                     /locus_tag="CAGL0J02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447818.1"
                     /db_xref="GeneID:2889749"
     CDS             261400..261843
                     /locus_tag="CAGL0J02618g"
                     /note="weakly similar to uniprot|P14724 Saccharomyces
                     cerevisiae YFR036w CDC26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447818.1"
                     /db_xref="GeneID:2889749"
                     /db_xref="GOA:Q6FPM6"
                     /db_xref="InterPro:IPR018860"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM6"
                     /translation="MIRREATTLTLSQTDINDLVDELEERKLQRIINKQRDRVLRTST
                     KLESGSEDTRLASRDNNDDGIALQYNNGDESLEDAVPIDSFINASPLDNKTMHRTVNF
                     DQGLNVSLGSFAQNTTSNSNWQGNSQSGTSETEAGSTQSNPFYRG"
     gene            complement(<262001..>263644)
                     /locus_tag="CAGL0J02640g"
                     /db_xref="GeneID:2889750"
     mRNA            complement(<262001..>263644)
                     /locus_tag="CAGL0J02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447819.1"
                     /db_xref="GeneID:2889750"
     CDS             complement(262001..263644)
                     /locus_tag="CAGL0J02640g"
                     /inference="similar to AA sequence:UniProtKB:P43609"
                     /note="similar to uniprot|P43609 Saccharomyces cerevisiae
                     YFR037c RSC8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447819.1"
                     /db_xref="GeneID:2889750"
                     /db_xref="GOA:Q6FPM5"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM5"
                     /translation="MSETVKNEMEIDSENVAKVEEVTDKSNGDDDTSSMEDKTLKFLI
                     KQTNEVTIPPFAKWFDMYSVHEIEKRSLPDFFDGSSRFKSEKAYKDTRNFIINTFRLS
                     PTEYLTITAVRRNIAMDVASIVRIHEFLEKWGLINYQVDPRSKPTLIGPSFTGHFQIT
                     LDTPQGLKPFLPEKKIIANKKLKIEAQKKKLVHEDEERVEVLILNDATTKESNEDDQT
                     INEEENSYPTNVSLRQNVYDASKNFNALKEKKLESKDMQKVFVCHICGNDKMTVKYFN
                     LRNKHSSLCHKCFSKEQFGEKFQSSDFIKLADENAFPQRKIWTDQEVVSLLEGLEMFG
                     SDWKHIAKHVGGNKLIADCVDKYMSLPLEDDDVSKLLDKYKSSANQTTSDTIIEVMEN
                     FINALITNGNEDILNSKLPTAAHNCQLKSQYQMRIIAQELITLSAKKLKIKMSKLDSL
                     DKALTEETAKYENEVSKISQQKNNLSKQVSEINQKLSDLNVTKKLVIASEQMDSNMDL
                     VDKEEEEEKNDNQQLAKEVAQHLDDPKLTEPKRFKIWSL"
     gene            <264512..>267046
                     /locus_tag="CAGL0J02662g"
                     /db_xref="GeneID:2889751"
     mRNA            <264512..>267046
                     /locus_tag="CAGL0J02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447820.1"
                     /db_xref="GeneID:2889751"
     CDS             264512..267046
                     /locus_tag="CAGL0J02662g"
                     /inference="similar to AA sequence:UniProtKB:P43610"
                     /note="similar to uniprot|P43610 Saccharomyces cerevisiae
                     YFR038w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447820.1"
                     /db_xref="GeneID:2889751"
                     /db_xref="GOA:Q6FPM4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM4"
                     /translation="MNTRKRFLRSARKAAAVTVNYAEPDDNDLSANTFASDDENADVS
                     VDAEDTPPVWLRDDVRPNEDVQLDSDDENGGDKDDDRDLDDLLLKEKEKHRLEAQTKE
                     EDSDDEVNELDKASVTSKLKKLDEFVKQSQVYSSIIADTLLKRTLERTEESDASNNDP
                     VKEPPAKKAKKSKSILDFFTRRQNTDDNRVEEMAVDVKKETEEERIAKEQPSYLKNCV
                     LKPYQMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSFIYEMDTKGPFLIAAPL
                     STVDNWMNEFAKFAPEIPILKYYSQNGQDARQKLLKKFFKNNNREGVIVTSYEMIIRD
                     ANIIMGEQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLL
                     NFILPDIFADFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLR
                     RLKSVVLKDVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEY
                     IGTVSNKSIRDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLR
                     QVVDSTLLFFFPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQFVGML
                     DLLEDWSELNSFNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVA
                     ADTVIIFDSDWNPQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLE
                     RMVIQMGKFSNLKKLALNERSFLQQSTGMNPNKTSNKELVQELSQLLMSKESSIGFET
                     SKKPKQDDILTEAELKELSDRSLKFYSPDREVEFPHVRLFETTSGF"
     gene            complement(<267249..>267695)
                     /locus_tag="CAGL0J02684g"
                     /db_xref="GeneID:2889532"
     mRNA            complement(<267249..>267695)
                     /locus_tag="CAGL0J02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447821.1"
                     /db_xref="GeneID:2889532"
     CDS             complement(267249..267695)
                     /locus_tag="CAGL0J02684g"
                     /note="highly similar to uniprot|P40030 Saccharomyces
                     cerevisiae YER044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447821.1"
                     /db_xref="GeneID:2889532"
                     /db_xref="GOA:Q6FPM3"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM3"
                     /translation="MLSLQQLTGGVHSAVTNMAPGYLPKWLLFISIVSVFNSVQTYIS
                     GLELTRRVYENKPSETTSLSARTFGTWTFVSCVIRFYGALYITEPHIYQLTFISYIIA
                     LFHFGSELLIFRTCKLGKGFMGPLIVASTSLIWMYNQKEYYTGLPW"
     gene            complement(<267965..>269104)
                     /locus_tag="CAGL0J02706g"
                     /db_xref="GeneID:2889752"
     mRNA            complement(<267965..>269104)
                     /locus_tag="CAGL0J02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447822.1"
                     /db_xref="GeneID:2889752"
     CDS             complement(267965..269104)
                     /locus_tag="CAGL0J02706g"
                     /note="weakly similar to uniprot|P29467 Saccharomyces
                     cerevisiae YER044ca MEI4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447822.1"
                     /db_xref="GeneID:2889752"
                     /db_xref="GOA:Q6FPM2"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM2"
                     /translation="MNLSEADWVICIALVKYKLRTISKQNRVYIPLLTDISSFNEDEL
                     QYCDLRRHLPSELSKNDKQEELINIFNLMWARRKNWENSLYCCDILLNNRTLLIHLLE
                     DCTHQRLLLHYYGNYRFLLFYLNQQPCTRPTITTEAATISFRCYELIIISYFGLATNY
                     HVTNKGIPNPIKRHLIDGLIFKFIKQELTALITNCPGYLNKSLIIRVQNNMLFLNVCV
                     TSLQKSFIQTVSTIINTMITTRTTVFITNTNVEALMINLVTLLESFVSLLKCHNTKSK
                     TAYARISSETRECKDKRIYAALYKKNFGKYNHSYKLFLKCVDKTVMFLLCLYKKLRFN
                     KKTDQERMSQSTVAIMQQKRKQILAGLLAARKRELLIKYRKIRWL"
     gene            complement(<269575..>272382)
                     /locus_tag="CAGL0J02728g"
                     /db_xref="GeneID:2889753"
     mRNA            complement(<269575..>272382)
                     /locus_tag="CAGL0J02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447823.1"
                     /db_xref="GeneID:2889753"
     CDS             complement(269575..272382)
                     /locus_tag="CAGL0J02728g"
                     /inference="similar to AA sequence:UniProtKB:P39955"
                     /note="similar to uniprot|P39955 Saccharomyces cerevisiae
                     YER047c SAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447823.1"
                     /db_xref="GeneID:2889753"
                     /db_xref="GOA:Q6FPM1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM1"
                     /translation="MEGTTNKSLFGKLASLGRRPQQPLTDLSELYSKIANESILFLKL
                     EEKGRYKQAVQGWKAMTTNVMFQLTMIERQYPHADRYTPEEISLQTGINELYQKSMLH
                     LDRVKELNEQYGSQQDNMGNLSYSQVSKGTRINSPVKPLKTHNTSGSIISFSSDNKGR
                     KMNTTLRDNVHYTAPKKSNRTANRLAFSGGDNNSLKDAGYREPKVFFATSKPLGQPKL
                     NDHKSTTADFFDDFDDTAYQDNEFDDPIEDLIDLNSDEDQKFTSPVAIQKSKKVVSEN
                     IADLNRISKRFTSFNGDEDFEFDVDDYFADDYSDNTDDDSSVDSEQEKQARSQALDKL
                     MGEQKIETNSSISTSSASCKSNASDEDISVPIVPPPLPPLPPLDIQDDKRFWSTKRAE
                     LSKINKSAPTLLGNETGKDLSDINLKKTATNPTEKKSRKTGSLTSLSKPVQKISSNNT
                     KKEVPAKIVIPATKPISAAAAAKMVYAKKGATGIPKPNRTKANFSSSVNDQKTMSRPS
                     NLNPTKSVPVIKKTSDTQLSTSSKAVKNVKPVLRKTVIKKPAQQKPTSVKINGSTRPT
                     KGVVTSKKPIKPTQAKKVVKKVDALEDKKGDPDTNIKQAPDGEADEAKLKEALEDEII
                     NSLPGVDRTAAKQIFSEIVVHGDEVHWEDIAGLENAKFSLKEAVVYPFLRPDLFLGLR
                     EPVRGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSKYLGESEKLVRALFAIA
                     KKLSPSIIFVDEIDSIMGSRNSDGENESSRRIKNEFLIQWSSLSSAAAGNNREDGDDG
                     RVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRMVQLKKLLSHQKHNLDDAAFAE
                     LLNLTEGYSGSDITSLAKDAAMGPLRELGDKLLETTRESIRPLEVKDFKNSLEYIKPS
                     VSQEGLEKYEEWAAKFGSSGV"
     gene            complement(<273009..>274157)
                     /locus_tag="CAGL0J02750g"
                     /db_xref="GeneID:2889754"
     mRNA            complement(<273009..>274157)
                     /locus_tag="CAGL0J02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447824.1"
                     /db_xref="GeneID:2889754"
     CDS             complement(273009..274157)
                     /locus_tag="CAGL0J02750g"
                     /note="highly similar to uniprot|P39101 Saccharomyces
                     cerevisiae YER048c CAJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447824.1"
                     /db_xref="GeneID:2889754"
                     /db_xref="GOA:Q6FPM0"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:Q6FPM0"
                     /translation="MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEA
                     QAKFQAVGEAYQVLNDPALRKQYDEFGKDNAVPQQGFEDAEEYFTAIFGGDGFKDWIG
                     DFSLFKELNEATDMMSEDATTDATAAATTSEAGMVKHDGKTDAKDKSGKMTKEQREKL
                     WEMEKKRREEVAKQVEELARKLKEKLLQYNLAVKGGHLDDFNRKLDQEVEELKLESFG
                     LELLYLIARVYKTKANNYLMAKKTFGFSKIFTSTRDNARTVKSAYNLLSTGMEAQKAM
                     EQMSKVDEDQLDQYERAKFENEMAGKALGVMWAMNKFELERKLKDVCNTVLSDKSVSS
                     SERRERAKGLLFIASRFASAKRSPEEAEEAKVFEEFILGEKQKHGSKP"
     gene            274420..274491
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0J02772r"
                     /db_xref="GeneID:2889755"
     tRNA            274420..274491
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0J02772r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2889755"
     gene            <274876..>275187
                     /locus_tag="CAGL0J02794g"
                     /db_xref="GeneID:2889756"
     mRNA            <274876..>275187
                     /locus_tag="CAGL0J02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447825.1"
                     /db_xref="GeneID:2889756"
     CDS             274876..275187
                     /locus_tag="CAGL0J02794g"
                     /inference="similar to AA sequence:UniProtKB:Q6Q560"
                     /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
                     YER048wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447825.1"
                     /db_xref="GeneID:2889756"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL9"
                     /translation="MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKAL
                     TDAAKIESLFQGAQRDLGVLKRQSIISQMYTFDKLVVEPVEPVEPVEPVEPVEPVEPK
                     Q"
     gene            <275547..>277424
                     /locus_tag="CAGL0J02816g"
                     /db_xref="GeneID:2889736"
     mRNA            <275547..>277424
                     /locus_tag="CAGL0J02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447826.1"
                     /db_xref="GeneID:2889736"
     CDS             275547..277424
                     /locus_tag="CAGL0J02816g"
                     /note="highly similar to uniprot|P40032 Saccharomyces
                     cerevisiae YER049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447826.1"
                     /db_xref="GeneID:2889736"
                     /db_xref="GOA:Q6FPL8"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL8"
                     /translation="MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQID
                     SSAPYNWGNISGLVNDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDD
                     LSRLPNMYKLRQILYSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIG
                     SRRISFILYLPDPDRKWKPQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLP
                     GFSFHDVEEVKVDKHRLSIQGWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQ
                     DFEYPKQERDILPYHQVKHFEKVLYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQY
                     ISAEHLTKEGIKKLQEQFLENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDV
                     ETPWQTAMPSHKWRYMYIDGKNPRKLLKASDIMEALNNEELPNFELLRETLPKDGSVD
                     VELKLIDLAIFYKSTIFKKYLALLTALCPLSEQILIRRFRPGNDFTLATQCRLNEFLQ
                     DVEGILPSILVGNLCLTPSSGWESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRT
                     DDNGDSVLVNNPPSWNTFNLVLRDQSVLEFVKYVSCAAKSSRWDVKMEWDVKYVGEDN
                     E"
     gene            complement(<277727..>278209)
                     /locus_tag="CAGL0J02838g"
                     /db_xref="GeneID:2889737"
     mRNA            complement(<277727..>278209)
                     /locus_tag="CAGL0J02838g"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_447827.1"
                     /db_xref="GeneID:2889737"
     CDS             complement(277727..278209)
                     /locus_tag="CAGL0J02838g"
                     /inference="similar to AA sequence:UniProtKB:P40033"
                     /note="similar to uniprot|P40033 Saccharomyces cerevisiae
                     YER050c RSM18"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_447827.1"
                     /db_xref="GeneID:2889737"
                     /db_xref="GOA:Q6FPL7"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL7"
                     /translation="MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEG
                     SRENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLN
                     FYARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNFLE
                     "
     gene            <278605..>279816
                     /locus_tag="CAGL0J02860g"
                     /db_xref="GeneID:2889738"
     mRNA            <278605..>279816
                     /locus_tag="CAGL0J02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447828.1"
                     /db_xref="GeneID:2889738"
     CDS             278605..279816
                     /locus_tag="CAGL0J02860g"
                     /inference="similar to AA sequence:UniProtKB:P40034"
                     /note="similar to uniprot|P40034 Saccharomyces cerevisiae
                     YER051w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447828.1"
                     /db_xref="GeneID:2889738"
                     /db_xref="GOA:Q6FPL6"
                     /db_xref="InterPro:IPR003347"
                     /translation="MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGE
                     DKKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMV
                     VSTNNKTTRDLTVDDITQAVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRI
                     RNVISLEVSHVEDLQYDRPDIVDDKDLVDIVWNNVENLDTENDPRPKVTKYCLMSVKN
                     AFTDYHLDFAGTSVYYNLAFGKKKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTG
                     GVAMELNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTK
                     RYTFPMFDEVMGRTCEWLCQNQKKGKQMQVKKETVNDLISYMKSGKTKYKPTNFINKK
                     QMLQELSNLYL"
     gene            complement(<279998..>281590)
                     /locus_tag="CAGL0J02882g"
                     /db_xref="GeneID:2889739"
     mRNA            complement(<279998..>281590)
                     /locus_tag="CAGL0J02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447829.1"
                     /db_xref="GeneID:2889739"
     CDS             complement(279998..281590)
                     /locus_tag="CAGL0J02882g"
                     /note="highly similar to uniprot|P10869 Saccharomyces
                     cerevisiae YER052c HOM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447829.1"
                     /db_xref="GeneID:2889739"
                     /db_xref="GOA:Q6FPL5"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL5"
                     /translation="MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGG
                     FDNDVAVVCSARSSYTKQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLE
                     DSPLVAKLIDDTNKELALVDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCND
                     RGCKAKYVDLSNVVPSDYQTTTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFG
                     FIPMGLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVT
                     PEEASELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTP
                     PHPPEALSSTFFEKKRRGATAITTKNDIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLV
                     VDLISTSEVHVSMALPIPDSDSMKALRSAVEKLKPLGSVDIIKKMSIVSLVGKQMKQF
                     IGIAGTMFTTLAEQGINIEMISQGANEINISCVIDEMDSIKALQSIHKKLLDELPENG
                     SGSEQFEKAVDERLEQIKRLNL"
     gene            complement(<282119..>283750)
                     /locus_tag="CAGL0J02904g"
                     /db_xref="GeneID:2889740"
     mRNA            complement(<282119..>283750)
                     /locus_tag="CAGL0J02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447830.1"
                     /db_xref="GeneID:2889740"
     CDS             complement(282119..283750)
                     /locus_tag="CAGL0J02904g"
                     /inference="similar to AA sequence:UniProtKB:P40036"
                     /note="similar to uniprot|P40036 Saccharomyces cerevisiae
                     YER054c GIP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447830.1"
                     /db_xref="GeneID:2889740"
                     /db_xref="GOA:Q6FPL4"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="InterPro:IPR016717"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL4"
                     /translation="MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQ
                     FLHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARD
                     DLIPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSL
                     PGTPGLNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYL
                     NEYGIEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQG
                     NAGPKLRKSKRFHAIKKKDKDNENNKENVSNPNSTPSSANSSSTSLRDMGTAANQGNT
                     PYSNYRTDSGASVSNGGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFIN
                     LSQGKEVFLQELSLHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIR
                     YTWDRWRNVQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTR
                     DDTQRLEFWDNNCGKNYCVDLVMDGFRNPFANALK"
     gene            <283904..>284287
                     /locus_tag="CAGL0J02926g"
                     /db_xref="GeneID:2889741"
     mRNA            <283904..>284287
                     /locus_tag="CAGL0J02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447831.1"
                     /db_xref="GeneID:2889741"
     CDS             283904..284287
                     /locus_tag="CAGL0J02926g"
                     /inference="similar to AA sequence:UniProtKB:Q02771"
                     /note="similar to uniprot|Q02771 Saccharomyces cerevisiae
                     YER058w PET117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447831.1"
                     /db_xref="GeneID:2889741"
                     /db_xref="GOA:Q6FPL3"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL3"
                     /translation="MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSC
                     AVTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQ
                     ELRKKYESMQPLSGEVVTQDGERVK"
     gene            <285162..>286709
                     /locus_tag="CAGL0J02948g"
                     /db_xref="GeneID:2889742"
     mRNA            <285162..>286709
                     /locus_tag="CAGL0J02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447832.1"
                     /db_xref="GeneID:2889742"
     CDS             285162..286709
                     /locus_tag="CAGL0J02948g"
                     /note="highly similar to uniprot|P40039 Saccharomyces
                     cerevisiae YER060w or uniprot|P17064 Saccharomyces
                     cerevisiae YER056c FCY2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447832.1"
                     /db_xref="GeneID:2889742"
                     /db_xref="GOA:Q6FPL2"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL2"
                     /translation="MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNR
                     LAAMISAETKGIEPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGV
                     SVLTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWG
                     IVNTVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFA
                     VFLVLIARLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRN
                     TNSYKIFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPD
                     SLHGFGQFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGI
                     SIPACYYFSTFMQYFMDSIAYYLSIYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPI
                     GIAGTISLVVGAFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRPL
                     ELKYFGR"
     gene            complement(<286973..>288319)
                     /locus_tag="CAGL0J02970g"
                     /db_xref="GeneID:2889743"
     mRNA            complement(<286973..>288319)
                     /locus_tag="CAGL0J02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447833.1"
                     /db_xref="GeneID:2889743"
     CDS             complement(286973..288319)
                     /locus_tag="CAGL0J02970g"
                     /inference="similar to AA sequence:UniProtKB:P39525"
                     /note="similar to uniprot|P39525 Saccharomyces cerevisiae
                     YER061c CEM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447833.1"
                     /db_xref="GeneID:2889743"
                     /db_xref="GOA:Q6FPL1"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL1"
                     /translation="MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKG
                     DFAKWRGIFPPELRVGAVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSG
                     LVNKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRI
                     NPYFVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLA
                     GASEASVHPLSLAGFLRAKSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRG
                     APILAEIVGYGLSCDAHHITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATS
                     TKLGDNTECCAIQNTLIDNVNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRT
                     IPHTYNLKNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFGGVNTSLLFRRWHE"
     gene            <288611..>289303
                     /locus_tag="CAGL0J02992g"
                     /db_xref="GeneID:2889744"
     mRNA            <288611..>289303
                     /locus_tag="CAGL0J02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447834.1"
                     /db_xref="GeneID:2889744"
     CDS             288611..289303
                     /locus_tag="CAGL0J02992g"
                     /inference="similar to AA sequence:UniProtKB:P40040"
                     /note="similar to uniprot|P40040 Saccharomyces cerevisiae
                     YER063w THO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447834.1"
                     /db_xref="GeneID:2889744"
                     /db_xref="GOA:Q6FPL0"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:Q6FPL0"
                     /translation="MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDKAKEAA
                     GEAAPAPVTEEAAPAPAAAPVAAEVEEAKPEEAKPEEETKAEPASNEAAPAVASEQPA
                     EASEDKPAEVQEKAPEVKEPEKELFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQI
                     DSLEKLKVRIDRFGVDRNMSIALELGLVKPKEVRQQNRSNKNNNRNGHKGGNNKNRKG
                     RVNKNRGSGRRW"
     gene            complement(<290111..>291832)
                     /locus_tag="CAGL0J03014g"
                     /db_xref="GeneID:2889745"
     mRNA            complement(<290111..>291832)
                     /locus_tag="CAGL0J03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447835.1"
                     /db_xref="GeneID:2889745"
     CDS             complement(290111..291832)
                     /locus_tag="CAGL0J03014g"
                     /note="weakly similar to uniprot|P40522 Saccharomyces
                     cerevisiae YIL056w or uniprot|P40041 Saccharomyces
                     cerevisiae YER064c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447835.1"
                     /db_xref="GeneID:2889745"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK9"
                     /translation="MPFSLSGYGTTHKIREQLRFTDEIKWKQFSSRRLELIDKFELSK
                     YKASEQDDNIKQIANMLRIEFEFPVEATQGFEKLVTAAVQSVRRNRKRSKKKSPSSSS
                     STSKRVRKPLTPTPSKTQAKRNRSDSVTSNSSDDGHASDSSSMSHSRASSATTSTAAA
                     SPHSTSASNNGTHITRVNTPSSIASPPSTISLPFHQSVLSPPNQNFQTAVQNILLPLP
                     TSLKKSTLLSNNTDSNNMPPAQETQKTLTDDDVARSIMSDLIVLPVINNKEFVDLVKE
                     SHTCNTIINKQDSQANTGNSGNSGNSGPDVSTIFAVFANMEILGEMVLKSSVSFSVEK
                     NFNDKFSKFASTKEYITLKTFQQESLTTFAKNLFNKFNINANTFKQNDSPFIVKLLFI
                     IIGALVTDHGFEKTLAVLNPFLEDLTITLFTAPTPTPVAPPEQHQRSKSAVGLDILST
                     VSLQIDQESQQHNSQMTSNQNNLFAQSNGSQTIKLPQIPRRSQTPSNTLSLPIPAPAA
                     SIPPRSVSALTTQSKPDLSVIDNIINRIHQKNTTQNQQVSESNNGMKRHLFKDGNLPH
                     PIAQSLS"
     gene            complement(<292534..>294195)
                     /locus_tag="CAGL0J03058g"
                     /db_xref="GeneID:2889724"
     mRNA            complement(<292534..>294195)
                     /locus_tag="CAGL0J03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447837.2"
                     /db_xref="GeneID:2889724"
     CDS             complement(292534..294195)
                     /locus_tag="CAGL0J03058g"
                     /note="highly similar to uniprot|P28240 Saccharomyces
                     cerevisiae YER065c ICL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447837.2"
                     /db_xref="GeneID:2889724"
                     /db_xref="GOA:Q6FPK7"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /translation="MPVPNSEANEFQALQARIDADAKEIEQWWSEPRWNKTKRTYSAR
                     EIAIRRGTFPPLTYPSSVMAKKVYKVLEKHHKEGTVSRTFGALDPVQVSQMAKFLDTI
                     YVSGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHDRKQWENRAKATSQE
                     ELDAMGPAIDYMTPIIADADAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGH
                     MAGRCVIPVQEHINRLVTIRMCADIMHSELVIVARTDSEAATLISSTIDTRDHYFVVG
                     ATNPDIEPFAEYMDRAIMAGVSGDELQKLEAAWIEKAGLKLFHEAFADEVNKSSVSNK
                     QEIIKKFNDKVGPLTETSHREAKKLAKELLGKDIFFDWDLPRVREGLYRYRGGTQCSV
                     MRARAFAPYADLVWMESNYPDFEQAREFAEGVKAKYPDQWLAYNLSPSFNWPKAMSVD
                     EQATFIERLGQLGYIWQFITLAGLHTTALAIHKFSEDFAREGMKAYAQNVQQIEMDEG
                     VDVLKHQKWSGAEYIDGLLKLAQGGVSATAAMGQGVTEDQFKSNL"
     gene            <295476..>295949
                     /locus_tag="CAGL0J03080g"
                     /db_xref="GeneID:2889725"
     mRNA            <295476..>295949
                     /locus_tag="CAGL0J03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447838.1"
                     /db_xref="GeneID:2889725"
     CDS             295476..295949
                     /locus_tag="CAGL0J03080g"
                     /note="highly similar to uniprot|P40188 Saccharomyces
                     cerevisiae YIL057c or uniprot|P40043 Saccharomyces
                     cerevisiae YER067w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447838.1"
                     /db_xref="GeneID:2889725"
                     /db_xref="GOA:Q6FPK6"
                     /db_xref="InterPro:IPR022554"
                     /translation="MAKKDKKPKVNTIVTKDGESLKVFEDLNDFEMFIKNETEDEEFD
                     HIHCKLTYYPPFVLHESHDDPEKIKDTNNSHNKKFVRHLHQHVEKHLLKDIKEALHKP
                     ELKFHDKSKDETFEHIVWHYGEETEYHDRKFRIQVTVTCNHDDAMVDVDYKTIPL"
     gene            <296729..>298591
                     /locus_tag="CAGL0J03102g"
                     /db_xref="GeneID:2889726"
     mRNA            <296729..>298591
                     /locus_tag="CAGL0J03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447839.1"
                     /db_xref="GeneID:2889726"
     CDS             296729..298591
                     /locus_tag="CAGL0J03102g"
                     /inference="similar to AA sequence:UniProtKB:P34909"
                     /note="similar to uniprot|P34909 Saccharomyces cerevisiae
                     YER068w MOT2 transcriptional repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447839.1"
                     /db_xref="GeneID:2889726"
                     /db_xref="GOA:Q6FPK5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK5"
                     /translation="MINPHVQENLQAIQNTLSNYDTSFLSEDEEDYCPLCIEPMDITD
                     KNFFPCPCGYQICQFCYNNIRQNPELNGRCPACRRKFDDESVRYVVLTPEELKMERAK
                     LARKEKERKQREKEKKEYEQNNRKHLAGTRVIQKNLVYVIGVNPPVPPEEVAATLKSD
                     KYFGQYGKINKIVVNRKAPHGGSNNDHYHHHAPGYGVYITFSSKDDAARCIAQVDGTY
                     MDGRLIKAAYGTTKYCSSYLKGMVCPNPNCMFLHEPGEEVDASNKRELSKPQLHTQNS
                     MNSGSFRNGSEFGSAAASPLPLKAHLNSATSSVAANNDSSASTPVLTPAPAPPSTSNP
                     WGISQTASAIANINLSKPNSSINLPTLNDNVTQDNDNNNEVPSKPKPVSNTNTSSSKK
                     KNSSKEYVDPYDALNGCITFMNERFKSLSNYQNKTFSLRSDAIDQETLKSYPPLFTAS
                     NIKISETSENILTQKLVEILAIKPTDYSQSVIQFLQSVSASQPELINLPSVQSFTSAN
                     NAQATQTPINNPINPNLAQLGNGGVMGPGTPGPQNVMLQAMQPPQQMQAQPPQQMQQM
                     PMNMGGNANGMFVSPQELAQKQAQPQMAQMQSNNVGSNDLLNQLISGKRLAAAN"
     gene            <299422..>302043
                     /locus_tag="CAGL0J03124g"
                     /db_xref="GeneID:2889727"
     mRNA            <299422..>302043
                     /locus_tag="CAGL0J03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447840.1"
                     /db_xref="GeneID:2889727"
     CDS             299422..302043
                     /locus_tag="CAGL0J03124g"
                     /note="highly similar to uniprot|Q01217 Saccharomyces
                     cerevisiae YER069w ARG5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447840.1"
                     /db_xref="GeneID:2889727"
                     /db_xref="GOA:Q6FPK4"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK4"
                     /translation="MVSVLVSTKGFNPAKFKQASKLLNKSTVGFLSTSAKNKYSLQSK
                     VQNIKNSEVPKTFTRSKVGFSKRSLSSSNGIGTSGTRSTVIQLLNNISTKREVEQYLK
                     YFTSVSQQQFAVIKVGGAIISDNLPELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQ
                     GIEPDYIDGIRITDEHTMAVVRECFLEQNLKLVTALEQLGVRARPITSGVFQAEYLDK
                     SKYQLVGDITKVNKDAIEASIKAGALPILTSLAETPSGQMLNVNADVAAGELARVFEP
                     LKIVYLNEKGGIINGETGERISMINLDEEYEDLLKQSWVKYGTKLKIKEIKELLDYLP
                     RSSSVAIINVQDLQKELFTDSGAGTMIRRGYKLLKRSSLSEFQSADALRNVLQRDADI
                     ASKAQSAATYLRELEKAQFVSYSDEPLEALAIVRTEPKIPKLEKFLCSNSAWLNNVTD
                     NVFSTLKRDFPALQWIVSEDDANIAWHFDKSQGSYLKDGKVLFWYGVKDLNTVSELIG
                     EFTKGVTNSGHSSGVFGSQQAKRAYSTVRRTPPKPEATNTSPARVALIGARGYTGRNL
                     VALIDSHPYFEISHVSSRELKGQKLPDYKKAEIIYDNLQIEDIKKLESENAVDFWVMA
                     LPNNVSEPFIEAIDSCNGKSKIIDLSADHRFVSEEEWAYGLPEINDREHIYKAKKISN
                     PGCYATGSQLSIAPLLKYVDGLPTVFGVSGYSGAGAKPSPKNDPENLNNNIIPYALTN
                     HIHEREISTRLGHEVAFMPHVGQWFQGIALTVSIPIKKGSIQSNEEAMNIYKDFYKGE
                     NLVHIMEDIPSVKEIAGTHGVVIGGFKLNDNKDRIVVCGTIDNLLKGAATQCLQNMNL
                     AMGYGEYDGIPKDKIVS"
     gene            <302881..>305565
                     /locus_tag="CAGL0J03146g"
                     /db_xref="GeneID:2889728"
     mRNA            <302881..>305565
                     /locus_tag="CAGL0J03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447841.1"
                     /db_xref="GeneID:2889728"
     CDS             302881..305565
                     /locus_tag="CAGL0J03146g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070w RNR1 or uniprot|P21672 Saccharomyces
                     cerevisiae YIL066c RNR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447841.1"
                     /db_xref="GeneID:2889728"
                     /db_xref="GOA:Q6FPK3"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK3"
                     /translation="MYVYKRSGRKEPVKFDKITARISRLCYGLDPRIDAVKVTQRIIS
                     GVYEGVTTVELDNLAAETCAYMTTIHPDYATLAARVAISNLHKQTTKQFSQVVSNLYH
                     YINPATGKHAPMISDEVYQIVMDNKDELDSAIVYDRDFQFNYFGFKTLERSYLLRING
                     EVAERPQHLIMRVALGIHGRDLEAALETYNLMSLRYFTHASPTLFNAGTPHPQMSSCF
                     LVAMKDDSIEGIYDTLKECALISKTAGGIGLHIHNIRATGSYIAGTNGTSNGLIPMVR
                     VFNNTARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFPALWVP
                     DLFMKRVEQNGNWTLFSPSSAPGLSDCYGKEFEELYERYEREGRGKTIKAQKLWYSIL
                     EAQTETGTPFMIYKDACNEKSNQRNLGVIKSSNLCCEIVEYSSPDETAVCNLASIALP
                     AFIETSEDGKTSTYNFQKLHDIAKVITRNLNKVIDRNYYPVPEAKNSNMRHRPIALGV
                     QGLADTFMLLRLPFDSEGAAKLNIQIFETIYHASLEASCELAQKDGPYQSYQGSPISK
                     GVFQFDMWNAKPFGMWDWDALRKDILKHGVRNSLTMAPMPTASTSQILGYNECFEPVT
                     SNMYSRRVLSGEFQVVNPYLLRDLVDLGIWDEGMKQHIITQNGSIQNLPNIPQELKDL
                     YKTVWEISQKTIINMAADRSVYIDQSHSLNLFLQAPTMGKITSMHFYGWKKGLKTGMY
                     YLRTQAASAAIQFTIDQSVAQQAANNIADLSNLKRPSYVESEPSYVPSDFKADWENIK
                     PSKITYSETEDESRNVSLTPSASSSNDDLSSSVGSLKISEHPATPVSSTTTNIPVKED
                     KKEVAPEAEDAESEFDIYNSKVIACAIDKPEACEMCSG"
     gene            <306171..>308612
                     /locus_tag="CAGL0J03168g"
                     /db_xref="GeneID:2889729"
     mRNA            <306171..>308612
                     /locus_tag="CAGL0J03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447842.1"
                     /db_xref="GeneID:2889729"
     CDS             306171..308612
                     /locus_tag="CAGL0J03168g"
                     /inference="similar to AA sequence:UniProtKB:P32844"
                     /note="similar to uniprot|P32844 Saccharomyces cerevisiae
                     YIL068c SEC6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447842.1"
                     /db_xref="GeneID:2889729"
                     /db_xref="GOA:Q6FPK2"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK2"
                     /translation="MVANSMNLADILKDEVSLERVKELKDQLLKEKSTIDYQLSKESN
                     KNYEAVQESIKLLNISQKDVIEVKDQLSKVKTLSDESKSSISRYDIIFDATRMYEKVD
                     MTSEIYDKIVAFSDTVEQVNRMLDTELAQDGLETGCPYLIQIHYLLTTIRNFQDQMTI
                     MANVSTDDVQRTCQKLFSKVSGLVDKFDQLLESLIYDIVEMIRAENYSLVVRLFKIID
                     FEEREDLRIEAIRNIIKKKEIEAEKSTFKKLPSSKNIGRLELESNSKALEYPTDQGLY
                     QEIINGTITTRVQSRGYKNLLYNKIKQSIQEMFIEVRKEYDGDKKFDVLNNLDWVFNE
                     LLVVKDYVSKYSPPYWNIFDKYYQFYYDELHILINELVDAEPETIIILDIIDFDKTFQ
                     NTLVKDFGFKRKETKTVIGDTQKETLFKDYLNLIVIKMTEWLGNLQKTEFKTFKDRSI
                     PPQSDAENLLLLEGTKTCFQMFSQQVEVAAGSSQAKILVGVIEKFSELIENRLSNWIS
                     VVDEEVRRLMKYNELYDLDPNAIAPENEVPGGLLEYVIALANDQMRAADYAMAIGSKY
                     GAMVTKAYEKEIQTNIDNILDRFADVSQVCISALLTIIFDDLKKPYSEIFSKTWYKGS
                     QAQQISDTISEYLEDIKVLMNPVLYGLFMERLIENTILGYIGALKYEHSIKNKNNKFL
                     ESVKRDFEIFYKLFATYIGSSDETIEIVKEKFEVMDYFMDLCCEPIDSVMGIWDNFLQ
                     RYPDVPVVILEFVLKSRKDIDRSRRKKLVQRAIDLSLRPEHLAFISSEEYEPSYLSNF
                     TIKSAKKSEDVGDDY"
     gene            complement(<308707..>309045)
                     /locus_tag="CAGL0J03190g"
                     /db_xref="GeneID:2889730"
     mRNA            complement(<308707..>309045)
                     /locus_tag="CAGL0J03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447843.1"
                     /db_xref="GeneID:2889730"
     CDS             complement(308707..309045)
                     /locus_tag="CAGL0J03190g"
                     /inference="similar to AA sequence:UniProtKB:P40045"
                     /note="similar to uniprot|P40045 Saccharomyces cerevisiae
                     YER071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447843.1"
                     /db_xref="GeneID:2889730"
                     /db_xref="GOA:Q6FPK1"
                     /db_xref="InterPro:IPR005334"
                     /translation="MVIEKIDDKSSNSPLTAPRLIDLIESQFSESQVSADTLIQHILE
                     SLNKHSSQYKYIVSVTSIDIPTESSSSCEIDNKFGASWNAKKDGFLTHVLEDKHAGKN
                     HVVSVAWLSK"
     gene            <310357..>311910
                     /locus_tag="CAGL0J03212g"
                     /db_xref="GeneID:2889731"
     mRNA            <310357..>311910
                     /locus_tag="CAGL0J03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447844.1"
                     /db_xref="GeneID:2889731"
     CDS             310357..311910
                     /locus_tag="CAGL0J03212g"
                     /note="highly similar to uniprot|P40047 Saccharomyces
                     cerevisiae YER073w ALD5 or uniprot|P46367 Saccharomyces
                     cerevisiae YOR374w ALD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447844.1"
                     /db_xref="GeneID:2889731"
                     /db_xref="GOA:Q6FPK0"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FPK0"
                     /translation="MFSRTITRTLRAPAVLRLYSTNVPLEVPVTLPNGIKYMQPTGLF
                     INGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKAAKEAFENHWSREDPEV
                     RARALFNLADLVEANLETLAGIDSLDNGKSLLCSRADVALVAKYLRSCGGWADKIYGD
                     VIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAELTPLS
                     ALFASKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGSTATGSRIMKTAA
                     DSIKKVTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSRIYVQDKCYDE
                     VLDRLKKYTESLKVGNPFGDNTYQGSQTSQQQLDKILEYVDIGKQEGARIVTGGERIG
                     EKGYFFKPTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMANDSQYGLAAGIHT
                     NDVNKAVEVSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAALDNYTQVKSV
                     RMAITKPRV"
     gene            <313017..>314025
                     /locus_tag="CAGL0J03234g"
                     /db_xref="GeneID:2889732"
     mRNA            join(<313017..313019,313621..>314025)
                     /locus_tag="CAGL0J03234g"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_447845.1"
                     /db_xref="GeneID:2889732"
     CDS             join(313017..313019,313621..314025)
                     /locus_tag="CAGL0J03234g"
                     /note="highly similar to uniprot|P26782 Saccharomyces
                     cerevisiae YIL069c RP50B and highly similar to
                     uniprot|P26782 Saccharomyces cerevisiae YER074w RP50A"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_447845.1"
                     /db_xref="GeneID:2889732"
                     /db_xref="GOA:Q6FPJ9"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ9"
                     /translation="MSDSVTIRTRKVITNPLLARKQFVVDVLHPNRANVSKDELREKL
                     AEAYKAEKDAVSVFGFRTQFGGGKSTGFGLVYNSVADAKKFEPTYRLVRYGLAEKVEK
                     ASRQQRKQKKNRDKKIFGTGRRLAKKVARRNAD"
     gene            <314612..>315166
                     /locus_tag="CAGL0J03245g"
                     /db_xref="GeneID:9488020"
     mRNA            join(<314612..314702,314870..314977,315081..>315166)
                     /locus_tag="CAGL0J03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999524.1"
                     /db_xref="GeneID:9488020"
     CDS             join(314612..314702,314870..314977,315081..315166)
                     /locus_tag="CAGL0J03245g"
                     /inference="similar to AA sequence:UniProtKB:Q3E834"
                     /note="similar to uniprot|Q3E834 Saccharomyces cerevisiae
                     YER074W-A YOS1 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999570.1"
                     /db_xref="GeneID:9488020"
                     /db_xref="GOA:B4UN27"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:B4UN27"
                     /translation="MIFGLGRLFYVTLLLINAVAVLSEERFLSRIGLGRSGSEAPAFG
                     QNANSTKSKVVQLIGAVQTLLRNRTMQELTHSVPLIGINILVIVYELLLG"
     gene            complement(<315380..>318034)
                     /locus_tag="CAGL0J03256g"
                     /db_xref="GeneID:2889733"
     mRNA            complement(<315380..>318034)
                     /locus_tag="CAGL0J03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447846.1"
                     /db_xref="GeneID:2889733"
     CDS             complement(315380..318034)
                     /locus_tag="CAGL0J03256g"
                     /inference="similar to AA sequence:UniProtKB:P40048"
                     /note="similar to uniprot|P40048 Saccharomyces cerevisiae
                     YER075c PTP3 protein-tyrosine phosphatase 3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447846.1"
                     /db_xref="GeneID:2889733"
                     /db_xref="GOA:Q6FPJ8"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ8"
                     /translation="MDSSSPTGDSDFKCAIRQMAPPSLDIPHSNGSSIVRSPLVKSVT
                     SPVFAPSIKQASTFKKPSGCALVSALECNRILENKDIIVLDLRTYSEYSKSSIRDSIH
                     VGLPSTLLRRKNFDFNKLVQNLPVDDRVRLENKMNAMALEAKKLSFLIYDNTPNQTDT
                     SLSLPCYGVATKISEYRNQDERMENCGLYILNVGYSVFKLLFPDDVIESTETCLKNIT
                     ECSAMNSPMVEHPDLFIPMPHNINTSGEEYIRQTVNGLSFSPSLASTATKSPSISGSS
                     INNSMTNSNDFSLESPVSTSSPISALFKFQLPNRQQLASPVFKLPQNEEALSLEDYIS
                     AVNARENQENRTKEFKFQSFEFPKKHQSAEYSTRSPNEDKLNFQRKYAKLCTEYNDDL
                     INEVIPQWFQELVTKSKVEIISQFQKLDYLERRRLNKSISKHKSTKSALTTISRPELS
                     KMTPIDEKSFDFNSNKGSMSTQIKRKKSQKRSYSQPNCSYLKSDWKCCIDVDDMEDEH
                     DIEISSGVELGVKNRYKDIFPFENTRVKLKRRSVSSLSSSQEQTPNHSRDNSLVNKLN
                     DLTLTQPVDNYINANYIELPSLPNTLSDQKKELLKNLSAGKGRNCRYIATQAPMKTTV
                     HDFYTCLLNNKVPIILSLTDTFENGIEKCVQYWEDGDYEGFKVKLLEEIEVPKSYGTE
                     SEPADKDNKNDIVLRRINIEYDEAGCNYEVIQIQIRNWPDLGVLTDPTNIIQIIHLKN
                     SIIDSLFERKMYQPGTRPTVLVHCSAGCGRTGTWCTIDSVISNLDVFEVLRNELQVEM
                     KGKVYDPISWTINTFRKQRISMVQNVNQFLFIYDSLVCYFSLCLENHGKKDILTKPLS
                     AIYDQSRHIKSLNEFVDKKMKEVEPIFI"
     gene            complement(<318843..>320753)
                     /locus_tag="CAGL0J03278g"
                     /db_xref="GeneID:2889734"
     mRNA            complement(<318843..>320753)
                     /locus_tag="CAGL0J03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447847.1"
                     /db_xref="GeneID:2889734"
     CDS             complement(318843..320753)
                     /locus_tag="CAGL0J03278g"
                     /inference="similar to AA sequence:UniProtKB:P40050"
                     /note="similar to uniprot|P40050 Saccharomyces cerevisiae
                     YER077c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447847.1"
                     /db_xref="GeneID:2889734"
                     /db_xref="GOA:Q6FPJ7"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ7"
                     /translation="MSMIAVKVSRVTVRFYHGSLVNFGNTNLKEKLHVLKKKSTVIRK
                     SSKELQRLAEKQKIKRNKAQKASYHKDRAVHILKSKYGISDISRDQLGPTSENDIKFL
                     SKIKDNRLLYTILGVNGFQLRDAILVTKDVEKFLKRGQVEKAVMLVKLAKAKGSSGAN
                     LIMDYYLNELHSPKSAVDMYNWRKKNGIPINEYTDVTLFDGLAKQPEPISTKYGEMVL
                     KILDSKGEDEEFNIREFNAALGALTNCTDYSLAFQLFDSRSQRYSRKFDAITFTTMIK
                     ACNKIKDEDLLISMLNEIIAKMTHRSIDPMLVNQLVSALSGSDRSKRLNREALLLASE
                     VFTLDLGISDSGVERRIHYDVIKESMRSRGDGLRQDKLYPSIIQACNYSDLPQIGIKF
                     FAKITGFPYENETGGEQALLEGPQLTYQLFKNYIDLLVRHRTSVCGSRSMDLFETINS
                     TPSLKQLPMKVLLRHVYTAVQRQGNKQSVYCDATRANALLQRVNEFVKHVEPTKDNVV
                     PLAAWKFVLPIAEKLQQGSQLSEEPQVHLTQSFLSTISALRLPLNKEAKSTLLAGIRV
                     INSLGEQLRLPPTVDLEDIPLELRDKFLYRRLLLRVKTRLVHIVDSIDKNTPQLPDDL
                     SQLISQLGLHKR"
     gene            complement(<321030..>322493)
                     /locus_tag="CAGL0J03300g"
                     /db_xref="GeneID:2889735"
     mRNA            complement(<321030..>322493)
                     /locus_tag="CAGL0J03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447848.1"
                     /db_xref="GeneID:2889735"
     CDS             complement(321030..322493)
                     /locus_tag="CAGL0J03300g"
                     /inference="similar to AA sequence:UniProtKB:P40051"
                     /note="similar to uniprot|P40051 Saccharomyces cerevisiae
                     YER078c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447848.1"
                     /db_xref="GeneID:2889735"
                     /db_xref="GOA:Q6FPJ6"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ6"
                     /translation="MTMMLRRYLSNGAKFVNRPKVQWNLGQRLHENRPFLLQPGELTP
                     GITAAEYYQRRAELVRNLPVGSCLIILANQIKFASGAVFYPFQQDNDLFYLTGWNEPD
                     SIMVLEKPSENIEDHELTMFVPPKNEFKEKWEGFRTGVDAVKEFFNADHSYSVDNSMS
                     MVNELAKIIKRNKGIYFDPDSNKNSKINSNILNLIKETNKGTPKKLKSLVADLRKVKS
                     ESEIRLMRRAGQISGRSYNMAMAQRFRNERTLHTFLEHKFISGGCDKSAYIPVVATGP
                     NALCIHYTSNDDVMYDDEMVLVDAAGALGGYCSDISRTWPVAGKWPSSAHKDLYEAVL
                     NVQRESLKNCKKALENNMSLHDLHEASVKLTKQELKNLNFSKATEIAEKLYPHYIGHN
                     LGLDVHDVPEVSRFNPLVEGQVITIEPGLYIPDSPEYPAEFRNIGIRIEDDVVLKKDG
                     YINLTVEAVKEIKDIENVMQNGTTTDFEDDVVSPLQG"
     gene            <322732..>324672
                     /locus_tag="CAGL0J03322g"
                     /db_xref="GeneID:2889689"
     mRNA            <322732..>324672
                     /locus_tag="CAGL0J03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447849.1"
                     /db_xref="GeneID:2889689"
     CDS             322732..324672
                     /locus_tag="CAGL0J03322g"
                     /inference="similar to AA sequence:UniProtKB:P40053"
                     /note="similar to uniprot|P40053 Saccharomyces cerevisiae
                     YER080w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447849.1"
                     /db_xref="GeneID:2889689"
                     /db_xref="GOA:Q6FPJ5"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /translation="MLRIPSRIGSRQVLACAGRNLKCGSVMRHISRRNISKEPEKVYT
                     NLADVNDPKRDQFFKYTWGTWLQNDKLEKDKRTTKFSLNGLNSVLDDIYRQATKNTKD
                     NFKSETEIVPQPLTNKNRTVSMPNNIAITKLGTLNPNEKSVTIKTIASVHEGKHHRIY
                     KVQTNLSDEKSFVLRIPYQLDDDKATISHRIRSEVATLDFLDLQLKMKVPKVICYAAD
                     DGNPLGVPFILQEYIDGSLLMKDWNPLMDDKALMVETGEGSTENPELASLNKVVKSMA
                     DFHAKLNSISFNAAGSIYFKNDSNLNSETVIDNISNDLASNLKDRWVLGPSVERRLWK
                     KKSDLAIEERLKYLGPWKEDKETSISAQILRDTAILELKNAEARLAKSEQNGSKDKNT
                     ETLIKKQIETFQNVEKISGDLISSEMKAIPNIKDLLKPTIFHPDLDPMNVLIENKTET
                     PFMLDLEGAVVKPFILQSSPQFVAYDGPKIYNMKSDIPEFEKLSEEERKHYEFMYKRT
                     RNQFLWEKAVNERLPNLIMTVAPPVKVLRRPYTAVLEQKTDNDYILVDDSFFQLREAW
                     AFFFKNGLVTKEEFPLTFTDEQVKQHADDLNSLHEKLVSTPFAATQGWVPQDMFDNLV
                     RAGVIIKDSTGNFTVNDINPSA"
     gene            complement(<324829..>326460)
                     /locus_tag="CAGL0J03344g"
                     /db_xref="GeneID:2889690"
     mRNA            complement(<324829..>326460)
                     /locus_tag="CAGL0J03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447850.1"
                     /db_xref="GeneID:2889690"
     CDS             complement(324829..326460)
                     /locus_tag="CAGL0J03344g"
                     /note="highly similar to uniprot|P40055 Saccharomyces
                     cerevisiae YER082c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447850.1"
                     /db_xref="GeneID:2889690"
                     /db_xref="GOA:Q6FPJ4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ4"
                     /translation="MSTEKYRRNANVQRKGVKKTKDVYKTKDKKLKANLRKQDKRYKE
                     AVESASATEFLLPESSGFMEAETEMEKTFRVKQDEIRDSVDVLTASKGIDLKLNDFGP
                     YHVNFNRNGTHMLITGLKGHVASMDWRKGELRAELNLNETCNAACYLQNEQFFAVAQK
                     KYTFIYDHEGVELHRLKQHIEARHLEFLPYHYLLATAGQTGWLKYHDVSTGQMVSELR
                     TKLGPTTSMTHNPWNAVMHLGHSNGTVTLWSPSMPEPLVKLLSGRGPINSVAVDRSGY
                     YMATVSQDKSLKIWDIRNFKELHSVENLPTPGTNVTISDTGVLAVSRGPHVTLWKDAL
                     KSSKSARPCFGSINGDPNRNTPYMTQLFPGNKVRNMKFVPFEDLLSVGHESGVTNLII
                     PGAGEANYDALEINPFETAKQRQEQEVRTLLNKLPADSISLDPNVIGTVSSKAAATRL
                     TAKDLEQVTLQQDNVKNDNSDIPQVKVDTKGKNSGLRAFMRKKTKNVIDERKVRVQKL
                     IEKEKQLRDRKHKISKGELDENYTDVVDSALGRFK"
     gene            complement(<326713..>327555)
                     /locus_tag="CAGL0J03366g"
                     /db_xref="GeneID:2889691"
     mRNA            complement(<326713..>327555)
                     /locus_tag="CAGL0J03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447851.1"
                     /db_xref="GeneID:2889691"
     CDS             complement(326713..327555)
                     /locus_tag="CAGL0J03366g"
                     /inference="similar to AA sequence:UniProtKB:P40056"
                     /note="similar to uniprot|P40056 Saccharomyces cerevisiae
                     YER083c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447851.1"
                     /db_xref="GeneID:2889691"
                     /db_xref="GOA:Q6FPJ3"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /translation="MSLSEAEKRKILRERRQQKFSRGGASERLNKIVGGQGSQLDTKS
                     ALDEKPEVVEEIPREAVKPEMNSSVQAKKESTAQAKAEDPQVELFRQLAEMQGQGATE
                     STPDLFSMMKNLGATGDSPFPMAEQQVEAIDPELVEYHKYRVNTLTAKTTLVKWIVLL
                     AYIFLLTRTDDTYFPFVVRSYLPEVFTSQSSFFSIFLTFEILATSIYYQLSVGVERET
                     GVKTLQDTSKIVSLVSMVPEGILPIADLRGKVILAMKYWNIIAMMIGDVCFVLVAIGL
                     VSQI"
     gene            <327822..>329105
                     /locus_tag="CAGL0J03388g"
                     /db_xref="GeneID:2889692"
     mRNA            <327822..>329105
                     /locus_tag="CAGL0J03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447852.1"
                     /db_xref="GeneID:2889692"
     CDS             327822..329105
                     /locus_tag="CAGL0J03388g"
                     /inference="similar to AA sequence:UniProtKB:Q12476"
                     /note="similar to uniprot|Q12476 Saccharomyces cerevisiae
                     YDL175c or uniprot|P40507 Saccharomyces cerevisiae
                     YIL079c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447852.1"
                     /db_xref="GeneID:2889692"
                     /db_xref="GOA:Q6FPJ2"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR016713"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ2"
                     /translation="MATFVEDTKGEKMLAPSIEDVNEDPDELRSIRGQSRYFGETEDD
                     TIKEPEAKCSNCSETGHFKRDCPHVICSYCGVMDDHYSQQCPTTMRCALCNESGHYRM
                     HCPLKWKKLNCTLCNSPKHLRNRCPSVWRVYLLKNEDNKRKVLPMHQIYCYNCGDKGH
                     YGDECDKARSSRVPNDDGSAFSGKNLSSELRGQYTHNIDRQRSSQDMVSSVYDNLRSS
                     QPIAYQVGSDRGSLLEDSDKQTDSNRPSRFSNTKIDTARLSKTPARYVQDRSSKNKRK
                     FKDSLYDDGEDDEDEEDQLYKENSRHDNHKRSDRRSRYGNKKTNGNSGYNQQQSHFYR
                     PPYQGYQSASYEQYPSQNSGYEHHSGILPTRSGVNVGATNTGHYQQQYYQNNSSTYPP
                     QNMIYNQQVPMSAYAPPAPTPVKPSRSGVIKRYDE"
     gene            complement(329320..329393)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0J03410r"
                     /db_xref="GeneID:2889693"
     tRNA            complement(329320..329393)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0J03410r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2889693"
     gene            <330031..>331899
                     /locus_tag="CAGL0J03432g"
                     /db_xref="GeneID:2889694"
     mRNA            <330031..>331899
                     /locus_tag="CAGL0J03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447853.1"
                     /db_xref="GeneID:2889694"
     CDS             330031..331899
                     /locus_tag="CAGL0J03432g"
                     /inference="similar to AA sequence:UniProtKB:P53974"
                     /note="similar to uniprot|P53974 Saccharomyces cerevisiae
                     YNL020c ARK1 or uniprot|P40494 Saccharomyces cerevisiae
                     YIL095w PRK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447853.1"
                     /db_xref="GeneID:2889694"
                     /db_xref="GOA:Q6FPJ1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ1"
                     /translation="MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPA
                     DQFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGT
                     YEVFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDI
                     KIENVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLT
                     KGFSVNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIM
                     SMLAKNPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYK
                     PMNQNSGISTPHSAGKMLAGFQNDMPKPSTKLGKQELFSRSKTVPNDIGGLNERSDIS
                     AFLLRKKAELEATPNPLESSKYIDDDSSSTTSEDSFDDHASFISKTQSAHSVSTVDRF
                     NAYLKANDSISEEDSDESFMPGASHLNRFRSDTQETSNKRQTKDEILLKRRSLPFTNN
                     EARRNQSTDSELDTLSKAEKKEQLRQRMMSALNASEDVIKKTKSRDGSVSNDNNYLLK
                     SKLHGRRDNEQRFSSVVVNPLDNSNNLPTKKTPPVKPPKPDHLKPKVPPKPAFLKT"
     gene            complement(<332090..>334171)
                     /locus_tag="CAGL0J03454g"
                     /db_xref="GeneID:2889695"
     mRNA            complement(<332090..>334171)
                     /locus_tag="CAGL0J03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447854.1"
                     /db_xref="GeneID:2889695"
     CDS             complement(332090..334171)
                     /locus_tag="CAGL0J03454g"
                     /note="highly similar to uniprot|P53973 Saccharomyces
                     cerevisiae YNL021w HDA1 histone deacetylase A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447854.1"
                     /db_xref="GeneID:2889695"
                     /db_xref="GOA:Q6FPJ0"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6FPJ0"
                     /translation="MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLK
                     TGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIG
                     DLMLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYAT
                     SRLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKN
                     YPESVRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGE
                     GKGKGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQ
                     CHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDP
                     LREPKAEALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQ
                     EQFHQLSEDFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITG
                     TIDPSTSLVVDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDN
                     YLKFFPSLTKVAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNES
                     LGDWYFKNSLVFTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFI
                     LDSFEEWSDSE"
     gene            <334536..>336089
                     /locus_tag="CAGL0J03476g"
                     /db_xref="GeneID:2889696"
     mRNA            <334536..>336089
                     /locus_tag="CAGL0J03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447855.1"
                     /db_xref="GeneID:2889696"
     CDS             334536..336089
                     /locus_tag="CAGL0J03476g"
                     /note="highly similar to uniprot|P25382 Saccharomyces
                     cerevisiae YCR072c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447855.1"
                     /db_xref="GeneID:2889696"
                     /db_xref="GOA:Q6FPI9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI9"
                     /translation="MSTQLPPPSKKQKKEAQNAREVVGLVPEDVPHVSIKFKAEDTGE
                     FVGGTLRVPGGITEKQLEELLNQLNGNGEDPVPYTFSCTVKNTKNAVTTTHTVDIVDN
                     IYSSLLKPGHNSTEDIITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSR
                     VVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAE
                     SGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTL
                     GGHTNSVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDY
                     ALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLK
                     GTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVY
                     QVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGK
                     DKMMRLWTH"
     gene            <336384..>336755
                     /locus_tag="CAGL0J03498g"
                     /db_xref="GeneID:2889697"
     mRNA            <336384..>336755
                     /locus_tag="CAGL0J03498g"
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /transcript_id="XM_447856.1"
                     /db_xref="GeneID:2889697"
     CDS             336384..336755
                     /locus_tag="CAGL0J03498g"
                     /inference="similar to AA sequence:UniProtKB:P25642"
                     /note="similar to uniprot|P25642 Saccharomyces cerevisiae
                     YCR071c IMG2"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /protein_id="XP_447856.1"
                     /db_xref="GeneID:2889697"
                     /db_xref="GOA:Q6FPI8"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI8"
                     /translation="MLSRVARRNGVFVRFQSSAVFPSVSEVRNDELVGHGSYTSKSYF
                     VERSRVGNLPVYSDYRGGGNKVVTEIRRIRGNAVQLKKDLQAVLPHIPEKDWRVISQS
                     NKIEIKGNYISELKSVLSETF"
     gene            complement(<336992..>337960)
                     /locus_tag="CAGL0J03520g"
                     /db_xref="GeneID:2889698"
     mRNA            complement(<336992..>337960)
                     /locus_tag="CAGL0J03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447857.1"
                     /db_xref="GeneID:2889698"
     CDS             complement(336992..337960)
                     /locus_tag="CAGL0J03520g"
                     /inference="similar to AA sequence:UniProtKB:P25334"
                     /note="similar to uniprot|P25334 Saccharomyces cerevisiae
                     YCR069w SCC3 peptidyl-prolyl cis-trans isomerase
                     precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447857.1"
                     /db_xref="GeneID:2889698"
                     /db_xref="GOA:Q6FPI7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI7"
                     /translation="MLANILLFLFTMLFSMQSTLADSADVDLRSMYAPDPPATNRISM
                     TISYFPKGSDVKKEVDFSIDVYGTVCPKARDNFITLIRGIKAVIEGRGSGVMTLRYPG
                     TKFTNVLPNKYILGGEILPGISPYSIYGDKWPEENFDLKFDRPGRIAMWNHGQGKQES
                     QFFISTNPKPDTELDGRYSIFGQVVSGLDVILNEVQHAEVSSTKDMILKYMVKEDLRL
                     AKPDELHAKWLKRLEEYNNGDKTKGVSIARYFKAEETAAIPKKMPANALYNGYVRHSG
                     FPLFKVFFILVSLAVCFYVFKHRAEFLKRTNIVSLKQWRSVPETKA"
     gene            complement(<338756..>340270)
                     /locus_tag="CAGL0J03542g"
                     /db_xref="GeneID:2889699"
     mRNA            complement(<338756..>340270)
                     /locus_tag="CAGL0J03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447858.1"
                     /db_xref="GeneID:2889699"
     CDS             complement(338756..340270)
                     /locus_tag="CAGL0J03542g"
                     /inference="similar to AA sequence:UniProtKB:P25641"
                     /note="similar to uniprot|P25641 Saccharomyces cerevisiae
                     YCR068w CVT17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447858.1"
                     /db_xref="GeneID:2889699"
                     /db_xref="GOA:Q6FPI6"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /translation="MLGRQVTMLLKVIVAVAVLFVWHRSRDSSRGDGSNGDGLSDSSG
                     NGFRLEHIWAYDPEDVVSSCVDVSEEMRVSADEYVSMESGSEFVESWWAKTGARPFSH
                     VFDLRSRSMDIQRLQDRDPVSMEKYIDFSLENPELARTIELEWETAKIQVPDVRNRNT
                     VLALALMSSNAYVRTPYTGDWRNLSSSWGHTGEEKFGWDKDGLRGHIFVNKITKVVVI
                     AIKGTSSQGLFGSGEEDTITNDKINDNLLFSCCCARISYLWTTVCDCYMKSYTCDENC
                     VEAELKRKDRYYAATLKLYKQVTEMYPDSAIWLTGHSLGGALAALLGRTYGVPAVTFE
                     APGELLPAKRLHLPLPPGLPDYEEAIWHFGHNADPIFMGTCNGASSSCSIGGYAMETA
                     CHSGQYCMYDVVNDKGWRVNLLNHRIHRVIDEVILEYGRPAKCQRAPTCIDCYNWKFV
                     NKRRNRREESSSSIASSSQLTSSHSESETLTSTDAPEKTCIGRNWLGICTDYGV"
     gene            <340647..>343736
                     /locus_tag="CAGL0J03564g"
                     /db_xref="GeneID:2889700"
     mRNA            <340647..>343736
                     /locus_tag="CAGL0J03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447859.1"
                     /db_xref="GeneID:2889700"
     CDS             340647..343736
                     /locus_tag="CAGL0J03564g"
                     /inference="similar to AA sequence:UniProtKB:P25365"
                     /note="similar to uniprot|P25365 Saccharomyces cerevisiae
                     YCR067c SED4 or uniprot|P11655 Saccharomyces cerevisiae
                     YNR026c SEC12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447859.1"
                     /db_xref="GeneID:2889700"
                     /db_xref="GOA:Q6FPI5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MVFDSEYDLGYPVYGAQFLSDGMLLVAGGGGVGVMIPNKLTALR
                     VNFEKKKVLKRYREITLDSQDDSPSNLGVAQNMILMGCNEGYDKISSTGENHHIRKFV
                     FENDHLKFIGAIDFDGSTDPEVYTKLICMSKDGTIAAIASSKLPTVIRIIDPIDLTEK
                     YEIETGRDVRDIHFSPDGKLLVYITATSLEVVSVVTGRFLFRKTDFNKATDLARVKFI
                     NDDDFVLASGFKDKAGIALTTFRIRNTNPTILSSKKVFKDYKKITAMDVDPKGQLIAL
                     TTDDNSLALLSVKKLNVIKLFKQVHKDTITRVTVSPGGQYVATGSTDKTVHIFKISPD
                     AMGGSNLWKSLLRFLFNVMKLAVVVIWAHLFYKYDLHHKLYDVTKVQLEKRSIEFPSF
                     LDGILGTTTTRSTIIEGDIVSVVTDTAPALTSSVFSEDNKEYAKVEETTPSNSWSSVS
                     ESYWPSEVSNDIESVQENFDDIENKILENEDVVMKNDAIETEDESVGFDIDDTIKPIA
                     PIDIDLELDDPLASTSVDTSEVLSSQVPVQLETLSGQSEIIDDKPEHLDEEVSEGFLG
                     DHSKANLETEIENASTSISIEESTNSHSTFIESSSSLEEGRNTTSESSREISSETSII
                     KEDMLYPTENVSEQSATDKVNKNQSIDKIDVSSSSSIPTSSEGSSNSIVGDEAQMHIS
                     SLSSIETELSSSSIMINEESTIRNADSVVDENHSESKLPTEAKTSIVGSIDNENIDST
                     ELNNLEEAVKTSSNESSLSQVTEELVKNNERVSNQSLSTVSTEHTEMKESSNLTEKKP
                     ESNSPESNLSESSLQTHDFSQISDTERNIVSSSAFVTDLPSEEASVNPGNTEGTIVNA
                     SLVDSQSSNSSVKTVETNVSQDEQTSQNETLSVGAATIDVIQGSYTSVSDSLDGMNNE
                     EVGNKVHIEDVSNTLEIDSSASALSEQGDNQFSDSTPEVVNVINEFTTTPENETSSPL
                     ASSSTTFMTESPSPIAVANEVIENIQQDEQVAQQMEDTNSGSSNFQDTQHNVINDEL"
     gene            complement(<343893..>345128)
                     /locus_tag="CAGL0J03586g"
                     /db_xref="GeneID:2889701"
     mRNA            complement(<343893..>345128)
                     /locus_tag="CAGL0J03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447860.1"
                     /db_xref="GeneID:2889701"
     CDS             complement(343893..345128)
                     /locus_tag="CAGL0J03586g"
                     /inference="similar to AA sequence:UniProtKB:P10862"
                     /note="similar to uniprot|P10862 Saccharomyces cerevisiae
                     YCR066w RAD18 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447860.1"
                     /db_xref="GeneID:2889701"
                     /db_xref="GOA:Q6FPI4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004580"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /translation="MDVLTSAADFKKSKVPQLQELDDLLRCHICKDFLKNPVLTPCGH
                     TFCSLCIRGYLSNEPKCPLCLHELRESMLRSEYLVNEITETYKAARQRLLDELNSLET
                     NQDNSVIEVVSDKEPSLLQIDDDVNENSNHITVNDTSDIIDEDNEIQITGTKRTARTI
                     LNGSRPTKAAKISDMFTTRKAKTEEKAPCPICSQLFPIRYLERTHLDECLTKPPTSSP
                     PIKQSRLSPKPSESVSHVKRYLNSTNTSTQQRLPKLNFAKMTTSQLKQKLASLSLPVS
                     GTRANMVARYNYYEMLWNSNFIDSINPVSESELRRQLMSWDASHNGNNNSSNGGTNTI
                     SQLMKMNSKNKGKEYEKLLKDFKKDSFDKKGWMLLHKNSFNRLLCDAKKTRRKTENET
                     LMTSQSPRESSTQTELSAT"
     gene            complement(<345752..>347398)
                     /locus_tag="CAGL0J03608g"
                     /db_xref="GeneID:2889681"
     mRNA            complement(<345752..>347398)
                     /locus_tag="CAGL0J03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447861.1"
                     /db_xref="GeneID:2889681"
     CDS             complement(345752..347398)
                     /locus_tag="CAGL0J03608g"
                     /inference="similar to AA sequence:UniProtKB:P25364"
                     /note="similar to uniprot|P25364 Saccharomyces cerevisiae
                     YCR065w HCM1 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447861.1"
                     /db_xref="GeneID:2889681"
                     /db_xref="GOA:Q6FPI3"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI3"
                     /translation="MEPEFISMYNLHSTSPANIFIDTSNMKKRAMDEALITPPKSTPA
                     KSRLVKNPPMGDSSDSRPLSPARSSPITTTKAKRQKTVGSARSNGTLTLEELFESLAK
                     RKESGDKNSKPQYSYAVLICLAILQSPEGKLTLSQIYCWISVHFPYYRPKDASWQNSI
                     RHNLSLNSAFTKTEKSSDGKGHFWQVKVGSESKFFKGDYGDYENLRKQVQTIEKYFDI
                     DPAMLEEFDNEKPTYLNRESTNEKKNTSNAQTSASESSSISSTPNADSSFTDLNSTFS
                     IKVSPPEDKPKDGSISQGKEEVFNFGMVIRQNDHNLLDSPYPMKKTELPEIATPLSKS
                     KTERLPTIGDIQDPITTLNPLNSPPNMRRYMCSFNSSFDTDSPSHARHEPSTLLGPVP
                     MSSSPTTLPQITTPYVNRYSEDTTHLKLPPIQVNVLKTPEVNSITNVKTPARFTETPK
                     DSNSILRKLQTPSHLFEDTYLSPMFRAMGTPLKFSATPCDTKHNNLSPRSQQIPGFHK
                     ATKFPSSGLFGVDIFSVLKRAGSTSSNAQDKKDESNDGSK"
     gene            complement(<348518..>348964)
                     /locus_tag="CAGL0J03630g"
                     /db_xref="GeneID:2889682"
     mRNA            complement(<348518..>348964)
                     /locus_tag="CAGL0J03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447862.1"
                     /db_xref="GeneID:2889682"
     CDS             complement(348518..348964)
                     /locus_tag="CAGL0J03630g"
                     /inference="similar to AA sequence:UniProtKB:P25337"
                     /note="similar to uniprot|P25337 Saccharomyces cerevisiae
                     YCR063w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447862.1"
                     /db_xref="GeneID:2889682"
                     /db_xref="GOA:Q6FPI2"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI2"
                     /translation="MKVKGYERVEPVLAEFERRLKEIGKDKSKSLGKGQGKEDLWRIV
                     QIHSERSRYVYTMYYKRRAISRELYEWLLKKKVADRRLIAKWRKRGYEKLCCLQCVQQ
                     SETNHGSTCICRVPRLQLEAEAEKKGVPVSFKECVNCGCHGCASTD"
     gene            <349217..>352498
                     /locus_tag="CAGL0J03652g"
                     /db_xref="GeneID:2889683"
     mRNA            <349217..>352498
                     /locus_tag="CAGL0J03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447863.1"
                     /db_xref="GeneID:2889683"
     CDS             349217..352498
                     /locus_tag="CAGL0J03652g"
                     /note="highly similar to uniprot|P26637 Saccharomyces
                     cerevisiae YPL160w CDC60 leucine-tRNA ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447863.1"
                     /db_xref="GeneID:2889683"
                     /db_xref="GOA:Q6FPI1"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI1"
                     /translation="MSDEKKGLVLENTGRRDALIAIEKKYQQVWAEEHQFELDAPSID
                     DEPITMSTEELHKKYPKFMSSMAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALF
                     PLGFHCTGMPILACADKLKREAEMFGTDFSKAPAEDEEEPQVEEKKAESEDVTKFKAK
                     KSKAAAKKGRGKYQFEIMLQLGIPRDEVYKFADASYWLTYFPPLCQRDCSSLGSRIDW
                     RRSYITTDENPYYDAFIRWQMNKLKALGKIKFGERYTIYSVKDGQPCMDHDRQSGEGV
                     TPQEYVGIKIEATEFAPEAKKLIDENDKIDKSKKIYFVAATLRPETMYGQTCCFVSPK
                     IDYGIFDAGDSYYITTERAFKNMSYQKLTPVRGEYSPVAVINGKAFIGTKIHAPLTPY
                     KELRILPMETVIATKGTGVVTCVPTNSPDDYMTVKDLIKKSEYYGIDPTWIDMELIPV
                     IKTDKYGDLTAKALCEELKIQSPNDTTKLAEAKKIAYKEDYYSGVMIYGDYKGEKVEI
                     AKAKVKADMIAKGEAFVYNEPEGLVMSRSGDECIVSLEDQWYLDYGEEEWRKQAEECL
                     SQMEVFAPEVNHAFKGVLGWLRNWAVSRTYGLGTKLPWDDKYLVESLSDSTIYQAFYT
                     VAHLLFKDYYGKEIGPLNIKPEQMTDDVFDYIFQHVDDVKSDIPLRSLQILRREFEYF
                     YPLDVSISGKDLIPNHLTFFIYTHVALFPKKFWPKGIRANGHLMLNNAKMSKSTGNFM
                     TLEQIVEKFGADASRIALADAGDTVEDANLDESNANAAILRLFNLKEWSEEIVKDIDT
                     LRSGEITEIFDVAFEHEMNSLIEETYKQYELTNYKNALKTGLFDFQTARDYYREATGT
                     MHKDLVLRYIETQALMLAPIAPHFAEYVYRDVLGKKGSVQTANFPRASKPIDRSILAG
                     LEYVRALQRSIREAEGQALKKKKGKGAEVDQSKPVKLTLLVSKTFPEWQAGCIEIVRE
                     MFANQTLNDNKMIKEKVNPKEMKRAMPFISLLKQRLATESPEAVFNRELQFNETETIK
                     ATIDNIKKAAQQLKVEEIEVLAFPHGSNVATNIFTGQEVELPSAPKAIESALPGNPSI
                     LFNNI"
     gene            <352904..>354208
                     /locus_tag="CAGL0J03674g"
                     /db_xref="GeneID:2889684"
     mRNA            <352904..>354208
                     /locus_tag="CAGL0J03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447864.1"
                     /db_xref="GeneID:2889684"
     CDS             352904..354208
                     /locus_tag="CAGL0J03674g"
                     /inference="similar to AA sequence:UniProtKB:Q08650"
                     /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
                     YOR245c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447864.1"
                     /db_xref="GeneID:2889684"
                     /db_xref="GOA:Q6FPI0"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:Q6FPI0"
                     /translation="MFGNAFHLRNRIHKRSSSSDRLDQDESSDDGDNAPNIVEQKTKD
                     IKLVKPLKRPRLSNCCSPTTPMANRLQTMAVAWHISSFVLFSIFSLLIISNPFTWIVV
                     IPYLIYFFNDRSPANGDVVYRYSPWVRSLKIWKYYCDYFPIELVKTVDLEPTFTPCNE
                     EEEKENKKLQEYYTLRLWPSDYEIRLFKKNTVYSHGYKRTGPKYIFGYHPHGIGALGS
                     FGAFATEGRGWSNKFPGIPVSLLTLVTQFHIPFYRDYLLSVGISSVSRKNALKVLDNN
                     QSICIVVGGARESLISIPGTSGLILNKRKGFIKLAIQAGNVSLVPVYTFGENDCYNIL
                     ATDETSIIRKLQLWVKENFGFTIPIFYARGLFNYDFGLLPFRAPLHVVVGRPIHVKEQ
                     QENPEQSLVDHYHELYVEELKRIYLENRDRYGYGAADFEILG"
     gene            complement(<354372..>355712)
                     /locus_tag="CAGL0J03696g"
                     /db_xref="GeneID:2889685"
     mRNA            complement(<354372..>355712)
                     /locus_tag="CAGL0J03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447865.1"
                     /db_xref="GeneID:2889685"
     CDS             complement(354372..355712)
                     /locus_tag="CAGL0J03696g"
                     /note="highly similar to uniprot|Q08649 Saccharomyces
                     cerevisiae YOR244w ESA1 histone acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447865.1"
                     /db_xref="GeneID:2889685"
                     /db_xref="GOA:Q6FPH9"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /translation="MAGAEVEEEAGIPKKIESTEEVLIKCQCWVRKDEEERLAEILSI
                     NARVSPSKFYVHYVNFNKRLDEWVTGDRINLDKEVIFPRPKRQLEEDTNKKQKKKKKF
                     PQKAAVVESDAKSSEMGEGSDVMDLDNLNVRGLKDEEISREDEIKKLRTSGSMIQNPH
                     EVAHVRNLSKIIMGKFEIEPWYFSPYPIELTDLDVVYIDDFTLQYFGSRKQYERYRKK
                     CTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYC
                     MTRRDEMGHHFVGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGK
                     VGSPEKPLSDLGLLSYRAYWSDVLITLLVEHGKEVTIDEISSMTSMTTTDILHTLKTL
                     NILRYYKGQHIIFLNDDILERYNQLKTKKRRHIDAEKLLWKPPVFTASQLRFAW"
     gene            <356163..>358181
                     /locus_tag="CAGL0J03718g"
                     /db_xref="GeneID:2889686"
     mRNA            <356163..>358181
                     /locus_tag="CAGL0J03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447866.1"
                     /db_xref="GeneID:2889686"
     CDS             356163..358181
                     /locus_tag="CAGL0J03718g"
                     /inference="similar to AA sequence:UniProtKB:Q08647"
                     /note="similar to uniprot|Q08647 Saccharomyces cerevisiae
                     YOR243c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447866.1"
                     /db_xref="GeneID:2889686"
                     /db_xref="GOA:Q6FPH8"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="InterPro:IPR020119"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH8"
                     /translation="MTAEKRSAEVADDEVLKRVKLEVTGDIKERDAGITLYLSDLPGF
                     TGQIKQRYTDFLVNEITMEGEVVHLVDKGFKVPKRNAEPKMSDEERKAQKQAEYAKRE
                     AFEVEEELKASLIDIFGEEDFNKIVDVYKNAQKMESQKSFDDKATRTKIHQLIRQAFN
                     NELESVTTAENTFKIARNNRNSRVNKQTLVESTKDENGVENYGYGPAKEFIHFTLHKE
                     NKDTMEAVNVLTKLMRVPNKLVRYAGTKDRRAVTCQRLSISGVNLERLNALNRTLKGM
                     IIGGYKYSDVSMNLGELNGNEFHIVIRDAKVDPACGKSLKEVLEAGSKSLVDNGFVNY
                     YGLQRFGTFSISTHTIGKELLLGNWRAAIEMILSDQENILPASKEARQLWAQNRDPYE
                     AMKKMPKQCIAENAILHTLSNHRKEESGDFGTGAYHDAIMKIPRNLRTMYVHAYQSYV
                     WNKVASKRIELFGTDIRVGDLVIIEKDEDKQTDKADGSTSDDDFDEDLRSADFIRAKA
                     LTEEEVKSGKYTIEDVVLPTPGFDILYPSSDELKQLYVDIMGADGMDPFDMRRKVRDF
                     SLAGSYRNIIQKPKNFEYKIIQYEDPVQQIVNTDLEILNNQRAKENHQKYMKAKLERY
                     VPDKPGSRTAVVLKFQLGTSAYATMALRELMKLETSRRGDMCAVTSST"
     gene            <358554..>359663
                     /locus_tag="CAGL0J03740g"
                     /db_xref="GeneID:2889687"
     mRNA            <358554..>359663
                     /locus_tag="CAGL0J03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447867.1"
                     /db_xref="GeneID:2889687"
     CDS             358554..359663
                     /locus_tag="CAGL0J03740g"
                     /note="weakly similar to uniprot|Q08646 Saccharomyces
                     cerevisiae YOR242c SSP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447867.1"
                     /db_xref="GeneID:2889687"
                     /db_xref="GOA:Q6FPH7"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH7"
                     /translation="MDLSNHWARNFSGKLHNIHNGPTLSSIFGLDANYKQDVNISNVH
                     VAEVKPFSIRRLAKTLILGSPIESVALNKDNTGKIKKRGAIVLSSYGSCADLKRPKIN
                     SADKICRSRTDDNLQKALLGLIQDMSSEDAIELCRNVSLFQKCNKFGNSSILSLGSDT
                     KDITDIVFDNIPANIGLESIVYQLQGGPIAKIQAVPHESNVDQLKKLHVKFTTSKAAS
                     DFMKLGTRNMFKVNGVYLRPKWVQFCETKTDKWYQDLIKQNTSKNVCRCIILKRYPTK
                     NNMRYIQSTKQPPLENIDVNAIRRDFENYGNILDITPVISRKLCISIVYYDIFSAMKA
                     MMSYEDNTSFLHENYYGKWAIWYGKDISDRPVIPV"
     gene            complement(<359858..>361342)
                     /locus_tag="CAGL0J03762g"
                     /db_xref="GeneID:2889688"
     mRNA            complement(<359858..>361342)
                     /locus_tag="CAGL0J03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447868.1"
                     /db_xref="GeneID:2889688"
     CDS             complement(359858..361342)
                     /locus_tag="CAGL0J03762g"
                     /note="highly similar to uniprot|Q08645 Saccharomyces
                     cerevisiae YOR241w MET7 tetrahydrofolylpolyglutamate
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447868.1"
                     /db_xref="GeneID:2889688"
                     /db_xref="GOA:Q6FPH6"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH6"
                     /translation="MLITPTLRMASKRTYQDALTALNSLQSNYANIMAVRQSGDRKNR
                     MSILEMYEWSRRLGYKVSDFNKLNIVHITGTKGKGSTAAFTSSILQQYQDKLTKIGLY
                     TSPHLRSVRERIRINGEPISESKFTEYFFQVWDKLDKTTSPLNEFPHMVPGSKPGYFK
                     FLTLLSFHAFMKEECSCCVYEVGVGGELDSTNIIEKPVTCGVSLLGIDHTFMLGDTIE
                     EIAWNKGGIFKKDAPAYTIMGQEPAGLKVLQERAKERETSLTEVPTFKQLDNIKLGIA
                     GDFQKTNASLAVVLASQALNSLSIIKEDTPINSDSILPEKFITGLKKTIWEGRCQYIK
                     TGKINWYIDGAHTKESIEAASRWFAQEVASNNNKKILLFNQQTRDAALLLKVLHSVTN
                     NRLNFSEALFTTNVTWKTGSYNADLVSINVSQEQVDKLEVQKELASVWKDLSSETKSN
                     ICANIESAINIIEDYDIDEVDVFVTGSLHLVGGFLVVLDKYNNQ"
     gene            complement(<361909..>363517)
                     /locus_tag="CAGL0J03780g"
                     /db_xref="GeneID:2889656"
     mRNA            complement(join(<361909..362911,362913..>363517))
                     /locus_tag="CAGL0J03780g"
                     /product="uncharacterized protein"
                     /artificial_location="low-quality sequence region"
                     /transcript_id="XM_447869.1"
                     /db_xref="GeneID:2889656"
     CDS             complement(join(361909..362911,362913..363517))
                     /locus_tag="CAGL0J03780g"
                     /inference="similar to AA sequence:UniProtKB:Q08641"
                     /artificial_location="low-quality sequence region"
                     /note="similar to uniprot|Q08641 Saccharomyces cerevisiae
                     YOR240w ABP140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447869.1"
                     /db_xref="GeneID:2889656"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH5"
                     /translation="MGVADLIKKFEQISQESPKTEVKKPTPAVAEPSDATEATEATEA
                     TEATEALTDESAEPAEPTPVEASEETPVETTTEETPAEAAQEAEATTEETPAETAQEA
                     EANTEETPAETAENTPATDSETAPEETPAQEAESEKTEDDQEASAEGDNTQENSEQSS
                     KSKKNKKKKNKKKAKKAAAKAATEGENGSNEEETPSDSLRPCQSENKEEIKAITQDLH
                     EETFEGIAHESAPNEVEGTSRLGRDNPFEFGKRNLTEDSDVWNHNAWDNVEWGEEQIQ
                     QAEEKIKLQYDCPVSEFDKELYNSNPSRYWDIFYKNNKENFFKDRKWLQIEFPILYQS
                     TKKDAGPVTIFEIGCGAGNTFFPILNENENENLRIIAADFAPRAVELVKESENFNPKY
                     GHATVWDLANPDGQLPDGVEPHSVDIAVMIFVFSALSPSQWDHAMDNLHNILKPGGKI
                     LFRDYGRYDQVQVRFKKNRLLDDNFYVRGDGTRVYFFTEEELRDIFTKKYFKENKIGT
                     DRRLLVNRKRQLKMYRCWLQAVFDVPN"
     gene            <363777..>365039
                     /locus_tag="CAGL0J03806g"
                     /db_xref="GeneID:2889657"
     mRNA            <363777..>365039
                     /locus_tag="CAGL0J03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447870.1"
                     /db_xref="GeneID:2889657"
     CDS             363777..365039
                     /locus_tag="CAGL0J03806g"
                     /inference="similar to AA sequence:UniProtKB:Q12363"
                     /note="similar to uniprot|Q12363 Saccharomyces cerevisiae
                     YOR230w WTM1 or uniprot|Q12206 Saccharomyces cerevisiae
                     YOR229w WTM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447870.1"
                     /db_xref="GeneID:2889657"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH4"
                     /translation="MTWNKTATYEHISSIKPRFISRAFAAENQLKSLAFSNELVPDTD
                     AHELKTKLLYSQGSEIYELECAYPLITEDKEPVSDYGDAFKAMENVPLQPKWVYQGET
                     VAKMEFLGEEEDTNVIAMSKNGSLAWFTEGVKVPVHIVQEMMGPSTKFSSIHSLTRPD
                     NLAVADFSLSLDQETIVKSQSNGDEEDSILKLIDNAGKPSEVLRVIRVPGTTVTHSVR
                     FLDNHVFASCSDDNVIRFWDTRTADKPLWSLSDPQNGSLTAFDVSQLSGNLFATGFST
                     GVVKLWDARAVEDATLDLSNRQNGEEPIQKEIANWYHRGGDSVVDLKFSSTSPTEFLT
                     VGGSGNVYHWDADYALSNYDPENHAPQEASEQLQNESLTFLHTGGSRRSTTAYGLRNT
                     VAWHPVIEGLVAHVDPDTLITTYLPYNN"
     gene            <365325..>366728
                     /locus_tag="CAGL0J03828g"
                     /db_xref="GeneID:2889658"
     mRNA            <365325..>366728
                     /locus_tag="CAGL0J03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447871.1"
                     /db_xref="GeneID:2889658"
     CDS             365325..366728
                     /locus_tag="CAGL0J03828g"
                     /inference="similar to AA sequence:UniProtKB:P32490"
                     /note="similar to uniprot|P32490 Saccharomyces cerevisiae
                     YOR231w MKK1 ser/thr protein kinase or uniprot|P32491
                     Saccharomyces cerevisiae YPL140c MKK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447871.1"
                     /db_xref="GeneID:2889658"
                     /db_xref="GOA:Q6FPH3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH3"
                     /translation="MASLFRPPESTRQNARSPRLKLPPLSNVSLAVPGESPTGKLSAT
                     SSRGSSATSANMKRPMPPPLPKLDVPLSAASSTEGLVRKMKQLSVEDESPQSGSSRGV
                     ERDDTTAVNQSVDSFFSNLISVYDQSSSAITSPKIDEPEDSAVKDALATRVPRSLTQG
                     KDIDELSEEVWHSKNLLAEIETQGVLGEGAGGSVAKCKLRTGKKVFALKTINILNGDP
                     EFQKQLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSR
                     GGRISEKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAV
                     NSLATTFTGTSYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPFGPDKMATTIAP
                     IELLTLILTFTPHLDDEPDKNIKWSRAFKSFIEYCLRKEARARPSPRQMIQHPWIQGQ
                     MKKQVDMRKFITKCWQK"
     gene            <367053..>367748
                     /locus_tag="CAGL0J03850g"
                     /db_xref="GeneID:2889659"
     mRNA            <367053..>367748
                     /locus_tag="CAGL0J03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447872.1"
                     /db_xref="GeneID:2889659"
     CDS             367053..367748
                     /locus_tag="CAGL0J03850g"
                     /note="highly similar to uniprot|P38523 Saccharomyces
                     cerevisiae YOR232w MGE1 heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447872.1"
                     /db_xref="GeneID:2889659"
                     /db_xref="GOA:Q6FPH2"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /translation="MRAFSNVSRISRVSRVSRVALAAPARTVPLMNRNAMSMMRFYSE
                     DAKASEKAGEKAEEKAEEQNLSAEEQKLKDLQEQLDKKTKEAAELKDRLLRSVADFRN
                     LQEVTKKDVEKAKSYALQKFAKDLLESVDNFGHALGAFKEEDLEKSKEISDLYTGVKM
                     TRDVFEKTLKKYGIEKLDPLGERFDPNKHEATFELAQPDKEPGTVFHVQQLGYTLNER
                     VIRPAKVGVVKED"
     gene            <368472..>370457
                     /locus_tag="CAGL0J03872g"
                     /db_xref="GeneID:2889660"
     mRNA            <368472..>370457
                     /locus_tag="CAGL0J03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447873.1"
                     /db_xref="GeneID:2889660"
     CDS             368472..370457
                     /locus_tag="CAGL0J03872g"
                     /inference="similar to AA sequence:UniProtKB:Q01919"
                     /note="similar to uniprot|Q01919 Saccharomyces cerevisiae
                     YOR233w KIN4 ser/thr protein kinase or and similar to
                     uniprot|Q03002 Saccharomyces cerevisiae YPL141c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447873.1"
                     /db_xref="GeneID:2889660"
                     /db_xref="GOA:Q6FPH1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH1"
                     /translation="MATIPKRHTYGGGPEVHYTRNPYSAAPRNSMSSRGKKHVTFGPY
                     IVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYR
                     EINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFA
                     QLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPC
                     YAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITR
                     TPLKFPEYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKLI
                     KNSANVQLDHTKRVSRTSQHFETEQENSSVNQPVRSDMVNKAMDTSNTTDDAQHSIPN
                     RQPLANVFINSRTYSARSASYAPRHSMSDDPNAIESARHAVQNKHESNLATVMGSPNK
                     DKDDTTEDNNLETVARTSSHHRKPRPTSYYPVDINRSANNFSPIVLNLTNSDENDNSK
                     HPYSTSTSNNPVAPTPQRDQSQVVTDEHGLQLEKNRVREQPLTSDKSRMSSLRSNATA
                     KSSDSKKNKRFSLLSFYTNNGSKTSLHNDSKVSVTPSSKEESATVPPSIPSVVHHTDT
                     TENKRNHRASMMGPSAGGDKSTARRVIDFFKRRSMRM"
     gene            370868..371465
                     /gene="SNR17"
                     /locus_tag="CAGL0J03883r"
                     /db_xref="GeneID:9488021"
     ncRNA           370868..371465
                     /ncRNA_class="snoRNA"
                     /gene="SNR17"
                     /locus_tag="CAGL0J03883r"
                     /product="U3 RNA"
                     /note="C/D snoRNA SNR17 (U3 RNA)"
                     /transcript_id="XR_002648368.1"
                     /db_xref="GeneID:9488021"
     gene            <371724..>372377
                     /locus_tag="CAGL0J03894g"
                     /db_xref="GeneID:2889661"
     mRNA            <371724..>372377
                     /locus_tag="CAGL0J03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447874.1"
                     /db_xref="GeneID:2889661"
     CDS             371724..372377
                     /locus_tag="CAGL0J03894g"
                     /inference="similar to AA sequence:UniProtKB:P07807"
                     /note="similar to uniprot|P07807 Saccharomyces cerevisiae
                     YOR236w DFR1 dihydrofolate reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447874.1"
                     /db_xref="GeneID:2889661"
                     /db_xref="GOA:Q6FPH0"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012259"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="PDB:3CSE"
                     /db_xref="PDB:3EEJ"
                     /db_xref="PDB:3EEK"
                     /db_xref="PDB:3EEL"
                     /db_xref="PDB:3EEM"
                     /db_xref="PDB:3QLX"
                     /db_xref="PDB:3QLY"
                     /db_xref="PDB:3QLZ"
                     /db_xref="PDB:3RO9"
                     /db_xref="PDB:3ROA"
                     /db_xref="PDB:4H98"
                     /db_xref="PDB:4HOG"
                     /db_xref="UniProtKB/TrEMBL:Q6FPH0"
                     /translation="MSKVPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTN
                     DNSKQNVVIMGRKTWESIPQKFRPLPKRINVVVSRSFDGELRKVEDGIYHSNSLRNCL
                     TALQSSLANENKIERIYIIGGGEIYRQSMDLADHWLITKIMPLPETTIPQMDTFLQKQ
                     ELEQRFYDNSDKLVDFLPSSIQLEGRLTSQEWNGELVKGLPVQEKGYQFYFTLYTKK"
     gene            <373116..>374417
                     /locus_tag="CAGL0J03916g"
                     /db_xref="GeneID:2889662"
     mRNA            <373116..>374417
                     /locus_tag="CAGL0J03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447875.1"
                     /db_xref="GeneID:2889662"
     CDS             373116..374417
                     /locus_tag="CAGL0J03916g"
                     /inference="similar to AA sequence:UniProtKB:P35844"
                     /note="similar to uniprot|P35844 Saccharomyces cerevisiae
                     YPL145c KES1 or uniprot|P35843 Saccharomyces cerevisiae
                     YOR237w HES1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447875.1"
                     /db_xref="GeneID:2889662"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG9"
                     /translation="MTQDRASSSTWTTFLKSLASFNGDLSALSAPPFILSPVSLVEFC
                     QYWAEHPDLFLEPSFINETNYKERMGQCDPDIDSPEAARMLAVIKWFLSTLRSQYSSR
                     SEKSGSEKKPLNPFLGELFVGKWESKTYPHFGETILLSEQVSHHPPMSAYSIYNEKNN
                     VKIEGYNNIKSSISKTLTLNVKQYGHNLLTIGDKETYLVIPPPLHIEGILMASPFVEL
                     EGKSYIQSTTGMCCQFEYSGRGYFSGQKNSFKAKVYKSGADLKNNGTPLYVISGQWSG
                     SSKIVKNLPNGKQSAPVLFHDTNITATESLQVKTIDKQHPLESRRAWKDVADAIRLGD
                     YGLINKTKSALENKQREMRKEEAANGTTWKRRWFNEVDYSQNMKDKDLFLTLANELGL
                     SIKNVPSGTLVNDREDQKANSSAKHWRFDHSKWVADDEITV"
     gene            <374722..>375609
                     /locus_tag="CAGL0J03938g"
                     /db_xref="GeneID:2889663"
     mRNA            <374722..>375609
                     /locus_tag="CAGL0J03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447876.1"
                     /db_xref="GeneID:2889663"
     CDS             374722..375609
                     /locus_tag="CAGL0J03938g"
                     /inference="similar to AA sequence:UniProtKB:Q08634"
                     /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
                     YOR238w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447876.1"
                     /db_xref="GeneID:2889663"
                     /db_xref="GOA:Q6FPG8"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG8"
                     /translation="MSSLRKDHAIMVPCHSIWNYFTSCSDYIHLGQDPEQWFLAPFQY
                     EGRDHLSFIKHGLAGLDTLLSDFANSTLIFSGSQTKAEAGPVSEAQSYQLLMYRIIKQ
                     SIDDINVVNGIFGNIDSEILKLIQSIISKMRDQEITLDQLFESHRITLEEYALDSFDN
                     LLYSLGQFQAVNGNYPKKMTIVGFGFKQSRYLDLHAKAIDFKNINYISIEPSPTGYNS
                     EQLEVYFSTLSAMEKKNAAALFQNDYYGRRSPLLDKKQSRNPFNKQPKYEILNILKGL
                     ENYSDEEFLQKHIVGHTPW"
     gene            complement(<375780..>377087)
                     /locus_tag="CAGL0J03960g"
                     /db_xref="GeneID:2889664"
     mRNA            complement(<375780..>377087)
                     /locus_tag="CAGL0J03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447877.1"
                     /db_xref="GeneID:2889664"
     CDS             complement(375780..377087)
                     /locus_tag="CAGL0J03960g"
                     /inference="similar to AA sequence:UniProtKB:Q12206"
                     /note="similar to uniprot|Q12206 Saccharomyces cerevisiae
                     YOR229w WTM2 or uniprot|Q12363 Saccharomyces cerevisiae
                     YOR230w WTM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447877.1"
                     /db_xref="GeneID:2889664"
                     /db_xref="GOA:Q6FPG7"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG7"
                     /translation="MLHNRRPNLYQHISEFTPKFVNKLSAGHADRTLAWRHDVIPDKS
                     NKNFSTTLIYSQGSDIYEFKGVFPLDILPYTPVEEQASDESAKVEEGKYGIVQDADVV
                     NSAKWVYQGETVAKMTYLDDLNDNALIAMSKNGSLAWFKDDCKVPVHIVQEMMGPSTS
                     FASMHSGQKPAELAVSDFSLSMDSETIVKSQSNGYEEESILKIIDNSGKPGEILRTMK
                     VPGTVVTHTVRFFDNHLFASCSDDNVIRFWDTRTDDKPIWILSEPQNGRLTTFDVSPI
                     TENLFATGFSTGLIKLWDARATYEATQDLSYRQNGEDPIQVEMAKVFHSGGDSVVDIK
                     FSETSSSEFVTVGGSGNIYHWDMEYLFSRNDDDNEDYLPSLEPEELQSHCLKFCQPSR
                     VKSGSRNTVALHPMVHDLSATISSKNSITVYKPFDGTEFSKND"
     gene            <377534..>377881
                     /locus_tag="CAGL0J03982g"
                     /db_xref="GeneID:2889665"
     mRNA            <377534..>377881
                     /locus_tag="CAGL0J03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447878.1"
                     /db_xref="GeneID:2889665"
     CDS             377534..377881
                     /locus_tag="CAGL0J03982g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447878.1"
                     /db_xref="GeneID:2889665"
                     /db_xref="GOA:Q6FPG6"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG6"
                     /translation="MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRN
                     TSTFEGYSIQRLPEGIIAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPK
                     FGITCLSFDTRLP"
     gene            <378245..>379111
                     /locus_tag="CAGL0J04004g"
                     /db_xref="GeneID:2889666"
     mRNA            <378245..>379111
                     /locus_tag="CAGL0J04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447879.1"
                     /db_xref="GeneID:2889666"
     CDS             378245..379111
                     /locus_tag="CAGL0J04004g"
                     /inference="similar to AA sequence:UniProtKB:Q12106"
                     /note="similar to uniprot|Q12106 Saccharomyces cerevisiae
                     YOR228c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447879.1"
                     /db_xref="GeneID:2889666"
                     /db_xref="GOA:Q6FPG5"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG5"
                     /translation="MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKL
                     QRLSIVPMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHI
                     ASGVLLRGWKLYKSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPL
                     SMSGYVLTPLVLYHLLIMKWVPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSAL
                     ISAASYHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQF
                     NDIFTKLNFLRT"
     gene            complement(<379502..>383098)
                     /locus_tag="CAGL0J04026g"
                     /db_xref="GeneID:2889667"
     mRNA            complement(<379502..>383098)
                     /locus_tag="CAGL0J04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447880.1"
                     /db_xref="GeneID:2889667"
     CDS             complement(379502..383098)
                     /locus_tag="CAGL0J04026g"
                     /inference="similar to AA sequence:UniProtKB:Q12276"
                     /note="similar to uniprot|Q12276 Saccharomyces cerevisiae
                     YOR227w or uniprot|Q03016 Saccharomyces cerevisiae
                     YPL137c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447880.1"
                     /db_xref="GeneID:2889667"
                     /db_xref="GOA:Q6FPG4"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG4"
                     /translation="MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNR
                     LGRRATISVRETMPEGVARRRPRSSSISNGDLSNDKSAQREAPATDYSRRHSVSHSEK
                     EKKKSIFGSLFGKKSDSTDKKPPQSSAKSPVSVKTSTSSASPTASVPININVNREKPK
                     SHEPKSPSSPLRLFHFGQSNSESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQ
                     SRDKESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISV
                     GITTTSDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVT
                     GYRIRSGSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHE
                     TFFETEGYDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTA
                     PLQTLKFLNPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIE
                     KLGIRNVVLSSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNV
                     LRERTGRPLEELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMS
                     FLFDVISQFSVQGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGS
                     LLKYLSRLPNLRFLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIML
                     CEILQKCPKLAHVSMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDR
                     STLLGLDVDYGDISDEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISEN
                     AEGILHRLTSNLGDQSDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKE
                     KENLLRLVLLEKNLSNIMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNST
                     NTSHIRPFLKHLDSDRIFGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGKALLY
                     KTSSSTSLLVKKQEHEEGEFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPE
                     RVTVPKIQTVPSGNELREAIIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILG
                     AQDVDYTSRNASEGNTEASGRSTSTDSKTDELVTEKYDELLNSISQKRTSKQ"
     gene            <383930..>384367
                     /locus_tag="CAGL0J04048g"
                     /db_xref="GeneID:2889643"
     mRNA            <383930..>384367
                     /locus_tag="CAGL0J04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447881.1"
                     /db_xref="GeneID:2889643"
     CDS             383930..384367
                     /locus_tag="CAGL0J04048g"
                     /note="highly similar to uniprot|Q12056 Saccharomyces
                     cerevisiae YOR226c ISU2 or uniprot|Q03020 Saccharomyces
                     cerevisiae YPL135w ISU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447881.1"
                     /db_xref="GeneID:2889643"
                     /db_xref="GOA:Q6FPG3"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG3"
                     /translation="MFLRSTRLMRPFTRMYHPKVIEHYTNPRNVGSMDKTLRNVGTGV
                     VGAPACGDVIKLQIQVNDNTGVIEEAKFKTFGCGSAIASSSYLTELVQGITIEDAEKI
                     KNIEIAKELSLPPVKLHCSMLAEDAIKAAVRDYKTKRSSTTLH"
     gene            <384719..>385171
                     /locus_tag="CAGL0J04070g"
                     /db_xref="GeneID:2889644"
     mRNA            <384719..>385171
                     /locus_tag="CAGL0J04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447882.1"
                     /db_xref="GeneID:2889644"
     CDS             384719..385171
                     /locus_tag="CAGL0J04070g"
                     /note="highly similar to uniprot|P20436 Saccharomyces
                     cerevisiae YOR224c RPB8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447882.1"
                     /db_xref="GeneID:2889644"
                     /db_xref="GOA:Q6FPG2"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG2"
                     /translation="MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINT
                     NLFPVQVNEQLTVTVASSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMH
                     GTAYKFEEVSKDVIAVYYSFGGLLMRLEGNYRNLNNLKQETAYLLIRR"
     gene            complement(<385424..>386329)
                     /locus_tag="CAGL0J04092g"
                     /db_xref="GeneID:2889645"
     mRNA            complement(<385424..>386329)
                     /locus_tag="CAGL0J04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447883.1"
                     /db_xref="GeneID:2889645"
     CDS             complement(385424..386329)
                     /locus_tag="CAGL0J04092g"
                     /inference="similar to AA sequence:UniProtKB:Q12015"
                     /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
                     YOR223w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447883.1"
                     /db_xref="GeneID:2889645"
                     /db_xref="GOA:Q6FPG1"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG1"
                     /translation="MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVS
                     MDTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTE
                     GTLNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEE
                     EIELLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPM
                     ATAGDGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGL
                     FNKRQRMSIIVGVATNVLFCLVRGF"
     gene            complement(<386924..>387835)
                     /locus_tag="CAGL0J04114g"
                     /db_xref="GeneID:2889646"
     mRNA            complement(<386924..>387835)
                     /locus_tag="CAGL0J04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447884.1"
                     /db_xref="GeneID:2889646"
     CDS             complement(386924..387835)
                     /locus_tag="CAGL0J04114g"
                     /inference="similar to AA sequence:UniProtKB:Q99297"
                     /note="similar to uniprot|Q99297 Saccharomyces cerevisiae
                     YOR222w ODC2 or uniprot|Q03028 Saccharomyces cerevisiae
                     YPL134c ODC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447884.1"
                     /db_xref="GeneID:2889646"
                     /db_xref="GOA:Q6FPG0"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FPG0"
                     /translation="MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGT
                     GSGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLY
                     GVDKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGI
                     LSLYNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYS
                     TEHTILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKIL
                     RLGPGGGIMLVVFNGMMAFFQEMKYGK"
     gene            <388375..>389409
                     /locus_tag="CAGL0J04136g"
                     /db_xref="GeneID:2889647"
     mRNA            <388375..>389409
                     /locus_tag="CAGL0J04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447885.1"
                     /db_xref="GeneID:2889647"
     CDS             388375..389409
                     /locus_tag="CAGL0J04136g"
                     /inference="similar to AA sequence:UniProtKB:Q12283"
                     /note="similar to uniprot|Q12283 Saccharomyces cerevisiae
                     YOR221c MCT1 malonyl-CoA:ACP transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447885.1"
                     /db_xref="GeneID:2889647"
                     /db_xref="GOA:Q6FPF9"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF9"
                     /translation="MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLE
                     YIFRNPSSPGSIAVCSNFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFT
                     TKELFEIANYRNDLMVKYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESP
                     TFPGSHTISVANANSVKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNN
                     TVLRPIQEPLYDFIWKIMKNNGTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSST
                     TVQFTKCYDTINRIAEATKDQEDPLDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMAT
                     IDSYHGTHDL"
     gene            complement(<389834..>390529)
                     /locus_tag="CAGL0J04158g"
                     /db_xref="GeneID:2889648"
     mRNA            complement(<389834..>390529)
                     /locus_tag="CAGL0J04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447886.1"
                     /db_xref="GeneID:2889648"
     CDS             complement(389834..390529)
                     /locus_tag="CAGL0J04158g"
                     /inference="similar to AA sequence:UniProtKB:Q12044"
                     /note="similar to uniprot|Q12044 Saccharomyces cerevisiae
                     YOR220w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447886.1"
                     /db_xref="GeneID:2889648"
                     /db_xref="GOA:Q6FPF8"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF8"
                     /translation="MKTQVLITDVPKNKFDSKWPDTLEKKLFKEKYPQYRKHLQYFTP
                     LPFLDRVIIILDDEAATMEIYEYLQKEEPSVVNDKSIKLYLTESLLSNRFRSRSMGES
                     SPEDSNAASNGSADSNSAIGDKPILSLDTNPVSTGINVQSLAMGSPSLSPDRRTSLES
                     PTLLKFANDEKAHLYREPLPTKSDSSKESSPGTTELHKSQKLTVSTDAVNKMASNTPP
                     PLSPSITVDEFFN"
     gene            <391191..>393203
                     /locus_tag="CAGL0J04180g"
                     /db_xref="GeneID:2889649"
     mRNA            <391191..>393203
                     /locus_tag="CAGL0J04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447887.1"
                     /db_xref="GeneID:2889649"
     CDS             391191..393203
                     /locus_tag="CAGL0J04180g"
                     /inference="similar to AA sequence:UniProtKB:P43579"
                     /note="similar to uniprot|P43579 Saccharomyces cerevisiae
                     YFL013c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447887.1"
                     /db_xref="GeneID:2889649"
                     /db_xref="GOA:Q6FPF7"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF7"
                     /translation="MAKRIYDPIHDVFQDTGDNEPKRSKVLSVSELNSSETSRRNVSS
                     ISSLLTSDDQTAEKAIPERAHRNSISNLLSNDPEEDNNAEKEKVVPVPHMTNTKYTRH
                     LKKPDGDFFSRKDIQYDMLKALLTDDRCLFTNHLKAQYTNSLAPMSLPNNKIPIITDK
                     EYDARTFVFNDKLTFAQMYALTMATSSKCSKILRDKLLLDGQVAFSTCVLGFLVNIGR
                     LNTTINFYLEMTSQLRTYHSVPCLQAHTLDIKSLQDTPRIKSILRNLPTGNNPIHLSL
                     IYKLLGVISEEKFNEIGDSASQKLDKQVSSAEKFGLNGKFNCINMLFALCDNATIVRT
                     QFLSKYIQLIDPQDNNHRFDLDKDLTLFNILDNSKFDVIDRVNVVLWLLYIHTETDLT
                     EAEVVESLKLFIPPTSVPDLQHNKIPLRLTTNNYDVDTEEELKYGKEQKEKRLLFLQK
                     LDKSDTRKEEKTSTADSKDDDSITERATRRKRKKTLEKEILLESSKPNKKIKKEEETE
                     DRVKVEPEQDQEALKTAKEKPEAPLLAAERTPDVKKSKESIHQDRADRLINFDQNKEV
                     GILEKSRERKTQRELLQDLSDAQEIVKRKRKQIGMLRLFNKYDDIPMGSVIGVRGKKR
                     RKYKDDVLGYETSFLKTLSIAKQKFIKALRSADTKPQQSENNIFHL"
     gene            complement(<393611..>393922)
                     /locus_tag="CAGL0J04202g"
                     /db_xref="GeneID:2889650"
     mRNA            complement(<393611..>393922)
                     /locus_tag="CAGL0J04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447888.1"
                     /db_xref="GeneID:2889650"
     CDS             complement(393611..393922)
                     /locus_tag="CAGL0J04202g"
                     /inference="similar to AA sequence:UniProtKB:P22943"
                     /note="similar to uniprot|P22943 Saccharomyces cerevisiae
                     YFL014w HSP12 heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447888.1"
                     /db_xref="GeneID:2889650"
                     /db_xref="GOA:Q6FPF6"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="InterPro:IPR016360"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF6"
                     /translation="MSDAGRKNFSDKLNEGLTPDSQKSTWDKGKEFVTDETDKLAGKF
                     QGEENKGVAQGMHDSAQKGADEANAESYADTAREYMDAAKSKLNDAVEYVSKSVHGGE
                     K"
     gene            <395856..>397424
                     /locus_tag="CAGL0J04224g"
                     /db_xref="GeneID:2889651"
     mRNA            <395856..>397424
                     /locus_tag="CAGL0J04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447889.1"
                     /db_xref="GeneID:2889651"
     CDS             395856..397424
                     /locus_tag="CAGL0J04224g"
                     /inference="similar to AA sequence:UniProtKB:P35191"
                     /note="similar to uniprot|P35191 Saccharomyces cerevisiae
                     YFL016c MDJ1 heat shock protein - chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447889.1"
                     /db_xref="GeneID:2889651"
                     /db_xref="GOA:Q6FPF5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF5"
                     /translation="MKSTRSLLLQRRYLSLTHRRVLSSSVRQPLLRRGFHSTSSVKQE
                     FKDPYETLGVKKSSSQSDIKKAYYKLAKKYHPDINKEAGAEKKFHDLQNAYEILSDES
                     KRKQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINF
                     EDLFGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFR
                     ALDPCGTCNGSGLKSGASKTTCPSCHGSGTTVHVRAGFQMMSTCQTCGGEGTTVNASD
                     FCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSRG
                     DILVRIRVNKDPHFSIKNKYDIWYTKEIPITTAALGGTVSIPTIEGTKIRIKVPAGTA
                     PEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADVTND
                     TNAKRTMESFASSVEKSVEDKLSDNDNKTSNNSKETYNTTEDNSMNPDAPSTLGRLEK
                     FISNTFKKIKGDKN"
     gene            <398083..>399294
                     /locus_tag="CAGL0J04246g"
                     /db_xref="GeneID:2889652"
     mRNA            <398083..>399294
                     /locus_tag="CAGL0J04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447890.1"
                     /db_xref="GeneID:2889652"
     CDS             398083..399294
                     /locus_tag="CAGL0J04246g"
                     /inference="similar to AA sequence:UniProtKB:Q04740"
                     /note="similar to uniprot|Q04740 Saccharomyces cerevisiae
                     YMR234w RNH1 ribonuclease H"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447890.1"
                     /db_xref="GeneID:2889652"
                     /db_xref="GOA:Q6FPF4"
                     /db_xref="InterPro:IPR002156"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR011320"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF4"
                     /translation="MAKKKGGFYAVQNGRSTGVFTDWNQCSSQVKGYQGAVYKKFDTY
                     QEAQAFSESSSGYGASHSSSGSGSGNRVRGTGGYRGTGGYRDTGGYRDSSSSNHEPVH
                     AYFFGSGLTIDSTPNSSPSRSESYKSDNYKSSSSNTYKSPHSSNGKIKKKTYNTRSDK
                     YYAVKNSNHPWQNQVFTNWSECQDYVKGRKGVSFKKFESEQGAYDFLDGNTESTDSRI
                     LGMSREDFKQQYRASDDHKPVQKVTTYCDGSSLGNGTHASKAGYGVYFPHNPSYNISK
                     PLLIGPQTNNRAEIMAVSEALDTIWNDLTCHGNKVEYTIKTDSEYVSKLLNDRYSSYT
                     EKEMETLPNKDLVKPLIEKYVKVKTYYDVNKDKFSNDKGLKIEWVKGHAGEPGNEMAD
                     LLARRGADQRN"
     gene            complement(<399703..>401283)
                     /locus_tag="CAGL0J04268g"
                     /db_xref="GeneID:2889653"
     mRNA            complement(<399703..>401283)
                     /locus_tag="CAGL0J04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447891.1"
                     /db_xref="GeneID:2889653"
     CDS             complement(399703..401283)
                     /locus_tag="CAGL0J04268g"
                     /note="highly similar to uniprot|P32316 Saccharomyces
                     cerevisiae YBL015w ACH1 acetyl-CoA hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447891.1"
                     /db_xref="GeneID:2889653"
                     /db_xref="GOA:Q6FPF3"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /translation="MTVSKLLKERVRYAPYLAKVKTPEELIPLFKNGQYLGWSGFTGV
                     GTPKAVPDALIKHVEDNNLQGKLRFNLFVGASAGPEENKWAEHDMIIRRAPHQVGKPI
                     AKAINNGKIQFFDKHLSMFPQDLTYGYYTRDRTDGKILDYMIIEATAIKEDGSIVPGP
                     SVGGSPEFISVSDKVIIEVNTATPSFEGVHDIDMPVNPPHRVPYPYTKVDQKIGVDSI
                     PVDPERVIAIVESKTRDQVGPNTPSDDMSKAIAGNLIEFFRNEVKHGRLPENLLPLQS
                     GIGNIANAVIEGLTDANFKHLNVWTEVLQDSFLDLFENGSLDYATATSIRLTEPGFER
                     VFKNWDFYKSRLCLRSQVVSNNPELIRRLGVIAMNTPVEADIYAHANSTNVNGSRMLN
                     GLGGSADFLRNAKLSIMHCPAARPTKVDPTGISSIVPMVSHVDQTEHDLDVLVTDQGL
                     ADLRGLSPRERAREIINKCAHPDYKPLLQDYLDRAEHYATKHGCLHEPHMLKNAFKFH
                     TNLAEKGTMKVESWDPVE"
     gene            complement(<403542..>404615)
                     /locus_tag="CAGL0J04290g"
                     /db_xref="GeneID:2889654"
     mRNA            complement(<403542..>404615)
                     /locus_tag="CAGL0J04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447892.1"
                     /db_xref="GeneID:2889654"
     CDS             complement(403542..404615)
                     /locus_tag="CAGL0J04290g"
                     /inference="similar to AA sequence:UniProtKB:P16892"
                     /note="similar to uniprot|P16892 Saccharomyces cerevisiae
                     YBL016w FUS3 or uniprot|P14681 Saccharomyces cerevisiae
                     YGR040w KSS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447892.1"
                     /db_xref="GeneID:2889654"
                     /db_xref="GOA:Q6FPF2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF2"
                     /translation="MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKI
                     VPFDKPLFALRTLREIKILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHR
                     VIATQTLTDDHIQYFIYQTLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLAR
                     IIDSGENGDNEVDKIGMTEYVATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKR
                     PLFPGKDYRHQLLLIFGLIGTPDSSDKSMECIESRRARQYIASLQKYPPVRPLQKAFP
                     GVNPVGVDLLSRMLVFDPRERISADDALAHPYLSTYHVPEDEPAGEPIPPDFFQFDQY
                     KEVLTTKDLKKLLWNEIFHEQAT"
     gene            <406058..>410602
                     /locus_tag="CAGL0J04312g"
                     /db_xref="GeneID:2889655"
     mRNA            <406058..>410602
                     /locus_tag="CAGL0J04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447893.1"
                     /db_xref="GeneID:2889655"
     CDS             406058..410602
                     /locus_tag="CAGL0J04312g"
                     /inference="similar to AA sequence:UniProtKB:P32319"
                     /note="similar to uniprot|P32319 Saccharomyces cerevisiae
                     YBL017c PEP1 or uniprot|P40438 Saccharomyces cerevisiae
                     YIL173w VTH1 or uniprot|P40890 Saccharomyces cerevisiae
                     YJL222w VTH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447893.1"
                     /db_xref="GeneID:2889655"
                     /db_xref="GOA:Q6FPF1"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="InterPro:IPR011040"
                     /translation="MRLPSIFLVFFYLFARTLCWSPEVSLLHGVDSLASIIPFDDSST
                     ILSVGRKGVNVSHDYGRTWETKLRNKGEYPVSVTLNTFRPNSRAFVFLNGKLYGTHNE
                     GSDWFESKFPSDRQLTKALTIDFSPFAKDVIIASFVAKDNQNDEKEFNYVSTDDGKSF
                     RVLDVGQEYESMRCRFLSISHESNFPHNDNIICMTKTSSPDQNKLLLSENRGKSFKEL
                     SIGEDIAFDNFYLTNSYLVIRSIRDIHNKAAEVDLYVSSDAKDFKKAYLPTTLRRSDI
                     RRIIELLGRKMFITLTRSSESNVQDDNGNTLFTDGLVSNSDGLKFTSFSTSASKSRTT
                     ITPVEFLNGTFIQKQVGRNSGGYSISIDNGNTWRKLKYSDKGNKNPIKCQDENDCNLE
                     LLIPQIFHGPTAGILVMLGHINDNFSDQQTFISRDGGLNWEMGLEFPGIYATGDLGNV
                     IVACPVDPSSDNDPQSEIYYSLDQGMTWSEYQLDEMFIPIDVINITPDGSGLSFILTG
                     FSLDKPDDQRPNIDNRVTYLIDFNNVHDGKKCKAKDYEKFELAEGSCINGAKYTFNRR
                     KQSAKCIGGEVFKDLLFDMEVCTECQEQDYECSSEFIKDSKGVCVVDEKWLSATGNCP
                     STDIKKPAMRLIADNMCKKELPIQSKSVSCKNKNPSDPKDIPKKPKEGDRPTFGTGDI
                     QATFNTFKGKVRFYQYFDTDEDESLILATSEGEAYISHDSGQTYTHFNYNKPKVHEIV
                     FNEYFNSSAYIFDIDGNLHVTHDRGYTFDTIRLPASLQLGLPLNFHSKDPNTFIYYGG
                     KNCKSIFDTNCHIVAFITRDGGKSFSELLPNAIHCEFVGSSLKLSDSDDLLFCQVKDE
                     TSSKTRQRSLVSTTDYFETEPKVVFQKILGYMTNGEYVIIAVPGENHEITAYVTMDGD
                     EFAETLLPYDLDIEQPEAFTVLGSSTGSVFLHFTSFQENSVAFGSLLKSNTNGTSYVK
                     LQSNVNRNEAGYVDFEKVQGLDGIILTNVVTNADEIKDGSSQKHLRTKITFNDGVDWE
                     YIKPPKKDSSGDSYHCKSNKLEHCSLNLHSYTERKDFRDTFSSGSALGMMIGVGNVGD
                     KLLPFEECSTFLTIDGGKSWTEIKKGAYQWEFGDHGGILILSRDGEMTNSISYSTDFG
                     KSWYDYQFSDEKVLVSDIVTVPQDSALRFLLITADRIGRGFESGTVTVDFSGLFKRQC
                     VLDFNNENHDDFDYFSIGNSENECIFGHKVKYLRKNSEECYVGAVSLSQFTRVMKNCT
                     CTRADFECDYNFVRQYDGTCKLVDGLQPGNEAAICKKDPDLVEYFQSTGYRKIPLSTC
                     QGGLKLDGRTEPLPCPGKEKEFKQKYGISGSSFFLLFFVPFLFFVSAGWFVYDRGIRR
                     NGGFARFGEIRLGDDQLIEENTTDKVVNTIIRFGVASFEVMAGGFGIIRRIANNSFNR
                     ITGRMNGRYRPSYSNLMHDDFLDEADDLLAGHDDDANDLASFMDDDSNFDIEDETTSV
                     NDSGYRDQSPETENVVDSNN"
     gene            <411050..>411427
                     /locus_tag="CAGL0J04334g"
                     /db_xref="GeneID:2889632"
     mRNA            <411050..>411427
                     /locus_tag="CAGL0J04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447894.1"
                     /db_xref="GeneID:2889632"
     CDS             411050..411427
                     /locus_tag="CAGL0J04334g"
                     /inference="similar to AA sequence:UniProtKB:P38208"
                     /note="similar to uniprot|P38208 Saccharomyces cerevisiae
                     YBL018c POP8 required for processing of tRNAs and rRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447894.1"
                     /db_xref="GeneID:2889632"
                     /db_xref="InterPro:IPR020347"
                     /db_xref="UniProtKB/TrEMBL:Q6FPF0"
                     /translation="MGSTKYKEWQYFLLSIRAESDVDHIDEVTWKQAVSNALRKSHGL
                     FGEQIELYWLKIDNKRAIIKCGFADKDILKTALATYISSTELVGSPLVITMEQEASQL
                     NNLFLPEDDKLWFNKIVEIENGD"
     gene            complement(<411562..>413079)
                     /locus_tag="CAGL0J04356g"
                     /db_xref="GeneID:2889633"
     mRNA            complement(<411562..>413079)
                     /locus_tag="CAGL0J04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447895.1"
                     /db_xref="GeneID:2889633"
     CDS             complement(411562..413079)
                     /locus_tag="CAGL0J04356g"
                     /inference="similar to AA sequence:UniProtKB:P38207"
                     /note="similar to uniprot|P38207 Saccharomyces cerevisiae
                     YBL019w APN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447895.1"
                     /db_xref="GeneID:2889633"
                     /db_xref="GOA:Q6FPE9"
                     /db_xref="InterPro:IPR004808"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR010666"
                     /db_xref="InterPro:IPR020848"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE9"
                     /translation="MGAIDPLLPDNIRFVTFNVNGVRTFFHYAPFSEMRQSLRSVFDW
                     FESDVITFQELKTEPLSLNKWGKVDGFYSFISIPQKRKGYSGVGCWVRIPPRDSPKYN
                     ALQVLRAEEGITGYLEVKNGKQSVSYRDDSEIGIGGYIPDDSLPDHISTSDALQLDSE
                     GRCVIVELKCGIVVISVYCPANSTCTDEGEVFRMRYLKLLFARIRNLQMMGKMVVLMG
                     DLNICRDLIDHAVSLEEYHISIGNESTGTQIDEEYRDFAIKFIVNPEVPHRLLLNQIL
                     DDSMVPNTDNEFCLIDTTRKVQGRDRLKMYTVWNTLKNTRPSNFGSRIDFILVSKDLG
                     NNIEKADILPDINGSDHCPVFCDINLNNLTLTSNISVEEKIPKFEARYRYNMTNRNIF
                     DMFAKKSGKSSSSIGNKLKSEPIKDKVSKPIHKRSAEAITDKMGTTPNQTPKDKIALF
                     FQGSFGPPPLCKHKQHAILKTSKTSNNPGKKFWTCSKPRGHQNDENSSCGFFEWA"
     gene            complement(<413393..>415048)
                     /locus_tag="CAGL0J04378g"
                     /db_xref="GeneID:2889634"
     mRNA            complement(<413393..>415048)
                     /locus_tag="CAGL0J04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447896.1"
                     /db_xref="GeneID:2889634"
     CDS             complement(413393..415048)
                     /locus_tag="CAGL0J04378g"
                     /inference="similar to AA sequence:UniProtKB:P38206"
                     /note="similar to uniprot|P38206 Saccharomyces cerevisiae
                     YBL020w RFT1 nuclear division protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447896.1"
                     /db_xref="GeneID:2889634"
                     /db_xref="GOA:Q6FPE8"
                     /db_xref="InterPro:IPR007594"
                     /translation="MSGADILEKTTRGATFLMMGQLFSKIVTFLLNNTLVRYLSPRIF
                     GITAFLEFIVGTVLFFSREAIRLSTQRIADGNDADNDHDHDRDDSALQVCVNFAMIPL
                     FIGIPLSIGLIAWQYHNINGYFVTLPFFQWSVFAIWVGIILELVNEPLFVLNQHFLNY
                     GARSRYESIAVTANCLVNFTVVYSYEKKLILTSYFDDSERFREGIAILAFALGKLAYA
                     ATLLMCYYYNYLMNFKSNKPFKLSLQKIKSKVNEKQTYYFRSDILEHFKKVYFQLCFK
                     HLLTEGDKLIINTFCTVEEQGIYSLLSNYGSLITRLLFAPIEESLRLLLAVLLSKKDS
                     KNLQLSMKVLVNLTKFYLYLSLLVMIFGPNNSSYLLQFLIGSKWSTNSVLHAIRVYCV
                     YIPFLSFNGIFEAFLASVATGDQILRHSYFMMMCSFAFLINSWIFIEYLDLSVNGLII
                     SNIINMSLRIIYSFSFIVKFYRELHTESSIFMNFTNFKATLGAAALVAILNWQMVGYV
                     SSFNGFITSATLALILLSVILIKERATLNELIINRRAANMKSV"
     gene            <415482..>415838
                     /locus_tag="CAGL0J04400g"
                     /db_xref="GeneID:2889635"
     mRNA            <415482..>415838
                     /locus_tag="CAGL0J04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447897.1"
                     /db_xref="GeneID:2889635"
     CDS             415482..415838
                     /locus_tag="CAGL0J04400g"
                     /note="highly similar to uniprot|P13434 Saccharomyces
                     cerevisiae YBL021c HAP3 CCAAT-binding factor subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447897.1"
                     /db_xref="GeneID:2889635"
                     /db_xref="GOA:Q6FPE7"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE7"
                     /translation="MGNTTEDDIDKQIELREQDRWLPINNVARLMKNTLPETAKVSKS
                     AKECMQECVSEFISFVTSEASDRCAQDRRKTINGEDILISLHALGFENYAEVLKIYLA
                     KYRQQQALKNNYEEDS"
     gene            <416515..>419595
                     /locus_tag="CAGL0J04422g"
                     /db_xref="GeneID:2889636"
     mRNA            <416515..>419595
                     /locus_tag="CAGL0J04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447898.1"
                     /db_xref="GeneID:2889636"
     CDS             416515..419595
                     /locus_tag="CAGL0J04422g"
                     /note="highly similar to uniprot|P36775 Saccharomyces
                     cerevisiae YBL022c PIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447898.1"
                     /db_xref="GeneID:2889636"
                     /db_xref="GOA:Q6FPE6"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /translation="MLGTRVTRAVYTRAPLKLQLRALGLHRRYVHNGSKNDEGSSTST
                     TTNKEENDKKLPDVYPQMLALPISRRPLFPGFYKAVVISEPRVMKAITDMVERQQPYI
                     GAFMLKDSNNDTDIIHDISEVHELGVLAQVTSAFPSKDEKTGKETMTALLYPHKRIKI
                     DQLIPPKDVKIEDIVVEKVVDNEVASEETKDEETVDKTESATDKVSEEITEEIAKAPS
                     TEVTEDPDNYENPTDFLKDYNVTLVNVSNLEDEPFDIKSPIINALTSEILKVFKEISQ
                     LNSMFREQIATFSASIQSATTNIFEEPAKLADFAAAVSAGEEEELQEVLESLNIEQRL
                     EKSLLVLKKELMNAELQNKISKDVETKIQKRQKEYYLMEQLKGIKRELGIDDGRDKLV
                     DTYKKRVEKLNLPENVQKTFDEEITKLATLETSMSEFGVIRNYLDWLTSLPWGINSKE
                     QYSIPRARKILDEDHYGMKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGK
                     SISRALNRQFFRFSVGGMTDVAEIKGHRRTYIGALPGRIIQALKKCQTQNPLILIDEI
                     DKIGHGGIHGDPSAALLEVLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSLDTIPRPL
                     LDRMEVIELTGYVAEDKIKIAEQYLVPSAKKTAGLQNATVSMDEEAINALMKYYCRES
                     GVRNLKKHIEKIYRKAALEVVKKMSIEDTEPLVSTSEEPQLSQTNQNISSSSAEDSTT
                     DLEDSVNPDTAKEASKPNNSQEGASVEETKKAVKTEEEEDTSMIVPEDIKVEITPEDL
                     KKYVGPPIYTTDRLYETTPPGVIMGLAWTNMGGCSLYVESVLEQPLHNCKHANLERTG
                     QLGDVMKESSRLAYSFSKMYLSKKFPENRFFEKAAIHLHCPEGATPKDGPSAGVTMAT
                     SFLSLALNKPVDPTVAMTGELTLTGKVLRIGGLREKVVAAKRSGAKTVIFPKDNLNDW
                     EELPENVKEGMEPLAADWYDDIYKRLFSGVKKSEGNNVWKSEFELIDKKKKEND"
     gene            <420259..>422898
                     /locus_tag="CAGL0J04444g"
                     /db_xref="GeneID:2889637"
     mRNA            <420259..>422898
                     /locus_tag="CAGL0J04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447899.1"
                     /db_xref="GeneID:2889637"
     CDS             420259..422898
                     /locus_tag="CAGL0J04444g"
                     /note="highly similar to uniprot|P29469 Saccharomyces
                     cerevisiae YBL023c MCM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447899.1"
                     /db_xref="GeneID:2889637"
                     /db_xref="GOA:Q6FPE5"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE5"
                     /translation="MSDNRRRRRDPEDDEHDSDNENVGMPPSSPQHHGSRNLFGPGSS
                     PIGSPVRDEDQENDDELGMLNPEGDDNEIDDAPDIDEVEEQMNEVDLMDDDMYGDYRS
                     DPTKDRYEGLGVDDTEQKELSLSDRRRIDAQLNERDRLLKNVAYLDDDDEAMGNEQLD
                     EMGLPKQRRRRRRQYEDFEHSDDDLLSDLDADPLREELTLESLSNVKANSYSEWVVQP
                     NVSRTIARELKSFLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALF
                     LAKCPEEMLKIFDLVAMEATELHYPDYSRIHSEIHVRISDFPTIHNLRELRQSNLSTL
                     VRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIKISFCTNCKSKGPFSI
                     NGEKTVYRNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKNN
                     YDGNLNAKNGFPVFATIIEANAVRRREGNLANENEEGLNVFSWTEEEEREFRKLSKDR
                     GIVDKIIASMAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLGDPGTAK
                     SQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLID
                     EFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQ
                     NVSLTEPILSRFDILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQ
                     KNDDDIQLSNRQKRAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSK
                     VYADLRRESITTGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFV
                     DAQKISVRRQLRRSFAIYTLGQN"
     gene            complement(<423298..>424083)
                     /locus_tag="CAGL0J04466g"
                     /db_xref="GeneID:2889638"
     mRNA            complement(<423298..>424083)
                     /locus_tag="CAGL0J04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447900.1"
                     /db_xref="GeneID:2889638"
     CDS             complement(423298..424083)
                     /locus_tag="CAGL0J04466g"
                     /inference="similar to AA sequence:UniProtKB:Q06991"
                     /note="similar to uniprot|Q06991 Saccharomyces cerevisiae
                     YLR414c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447900.1"
                     /db_xref="GeneID:2889638"
                     /db_xref="GOA:Q6FPE4"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="InterPro:IPR017974"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE4"
                     /translation="MRNFVALILALFFALASLVLACIACAGSTKNYYPINQIFCAQLD
                     LSNLDIATVIPAASSFSISDLGLPKFINIGLWSYCVASSSTDVTSCTSPNGIQTFNLK
                     NLLKDNIENNQVLQLVDDVAKIVLPQQLQDKLVYYNNLVKCMFITLIIGIVLTFLNLV
                     INVLRWFLHFSFVNFVGGFVCFLSFASLLISVGTNMGTYIYIRHILNKNYSDYGIHLS
                     LGRKFLALLWAAVVAALLNLFCWMTVRQRKKVVYVHQPYNDKY"
     gene            <426177..>427742
                     /locus_tag="CAGL0J04488g"
                     /db_xref="GeneID:2889639"
     mRNA            <426177..>427742
                     /locus_tag="CAGL0J04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447901.1"
                     /db_xref="GeneID:2889639"
     CDS             426177..427742
                     /locus_tag="CAGL0J04488g"
                     /inference="similar to AA sequence:UniProtKB:Q06696"
                     /note="similar to uniprot|Q06696 Saccharomyces cerevisiae
                     YLR417w VPS36 defective in vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447901.1"
                     /db_xref="GeneID:2889639"
                     /db_xref="GOA:Q6FPE3"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR021648"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE3"
                     /translation="MEYWHYVETTESGQPLLRESEKDILIDHNVGLYQGKERIRNRQN
                     GRIFLTSQRIIYVDSKEPTKYSLGIELDDIDHLDYSSSFLRRSARLIIFMDVHSASSG
                     LHNINNKLTEEVHTTTWVCPICMVTNETEGEFKANTQPPPVCVNCGVPADYELTKNSI
                     TIQGNSTDSNSHSDKKENKNSCPACTFINHPQVRNCEICGTRLNNTKIRNRLALSRRK
                     QDSRLTIELDSISSVKSSRSAEECFIQVSFRKSDGILFSDAVEKTITDLKASTKFNRN
                     TIEKTNKSEENGELNLLETKLSKIGITSLEHSRENQILNNDIIFTSALTDLDKLISLA
                     DSIERLYRKESIDNQSVKKPNLILDRDTFYNKEQFLSEVSREIYDFVKNGFKNNYVMI
                     TLVDLYALYNKSMRIGTGLISPAEMREACEKFGSFGLSDLYLKKINGCVLCVCTDDAF
                     DYIRQKIIDIIDRSPGADLLTLTQKFNDEPNNNWGIGVIQEVLKSCIDEGQLLIDKQI
                     SGIYYYCNNAWKL"
     gene            complement(<427882..>428994)
                     /locus_tag="CAGL0J04510g"
                     /db_xref="GeneID:2889640"
     mRNA            complement(<427882..>428994)
                     /locus_tag="CAGL0J04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447902.1"
                     /db_xref="GeneID:2889640"
     CDS             complement(427882..428994)
                     /locus_tag="CAGL0J04510g"
                     /inference="similar to AA sequence:UniProtKB:Q06697"
                     /note="similar to uniprot|Q06697 Saccharomyces cerevisiae
                     YLR418c CDC73 DNA-directed RNA polymerase II accessory
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447902.1"
                     /db_xref="GeneID:2889640"
                     /db_xref="InterPro:IPR007852"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE2"
                     /translation="MSVLVQLKKQLSSASEFTLVDGTGSTTADITNAEFIQFKEDKLP
                     LDEATEFIVDEQPAKLRVIIQCWLHKDDSAAEYLADCQEKKITNISFLQRNDLLKWLS
                     GESETSEYLDVKNIKTDNSEADVNTKTDVSESQKIIDDPVLQEATQKERILIDHNSML
                     HGSKPVDFGYLIKDAELKLVHSIKATLRSKQGSGKPGAVSKHGSQNQKTQKKDPIILI
                     PSAASSLFAISNIKQFLESSQYINPRDATANTGSDVITVEKKFDRISRPIKFIVVNNT
                     RMFTKPEYWDRVVAVFTTGHTWQFNNYQWNTPQELFQHCKGYYFHFTGDSVPQNVQQW
                     NVDKVELDKTKRFKDVEVVRYFWNTIEKELMARGFR"
     gene            <429277..>433539
                     /locus_tag="CAGL0J04532g"
                     /db_xref="GeneID:2889641"
     mRNA            <429277..>433539
                     /locus_tag="CAGL0J04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447903.1"
                     /db_xref="GeneID:2889641"
     CDS             429277..433539
                     /locus_tag="CAGL0J04532g"
                     /inference="similar to AA sequence:UniProtKB:Q06698"
                     /note="similar to uniprot|Q06698 Saccharomyces cerevisiae
                     YLR419w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447903.1"
                     /db_xref="GeneID:2889641"
                     /db_xref="GOA:Q6FPE1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE1"
                     /translation="MAKKKGKNETPALEKAANKSNSGPTGGKRGKRVLTEEQKAQQQS
                     NRAKVTSTSSWTGKLPHTLLHEFCQKRKWGKVEYDMKKIGSKGFIGIAIISSVDPKTR
                     ETLLVRLNDPTYDKAVGQGALEPQETTMEARHYAATVALYRLAYNTNTHMMLPPNHKS
                     IWYKLDDFRKSLKKDDRAQRYFCDDPFKQLIEERKEKAIKDKQNESRMQQAAKNESTP
                     VIINSVNNNMKDNDGSLTKKVNKPVRKSTKEVTFSRNVWESANFIDLNESSRQQIENC
                     IKRNADWESEMLKSSNNTPERQELKSKLINLGFREAHVNEAMLYKDPLSFLLFNLPED
                     DFPRYFQKRKEDSKNIIEISTLPLQKQITLERLQEFPVSKDEALFALDLYNGSEALAA
                     GYLTQSMIPDLPILGTEEIDNPESKEMWIQELESLKCIFEDKIEVIDEPNCYVISLME
                     KYSLKLKVYRTPNYPQHIPGIVVSTFSKKIKLPNYIKKQVMIKLLHHVKESGIIGGEM
                     IYEIYQWLLDNIKSIIDNPGKLLNIDDMKSSSNFEIIEARKSKMKLNKKNQEASLTKD
                     ELSALLDEYKKRILTNNYKLMQDQRMQLPAWKKKDHIVDLIMKNQIVLITGETGSGKS
                     TQVCQFVLDALFTSNNSNELQKKILVTQPRRISAIGLAERVAAERCVPCGEEVGYTIR
                     GVNKSSKFSKIRFMTTGVLVRILQSSMKSLENCIIIIDEVHERSIDTDLLVALLKQIM
                     EKVKTLKIVLMSATVNVNLFHNYFPGLVSSHIEGRTFPIKDYFLEDILDQLDFKIKRN
                     KYHEYDDDDDDDSISSHDNQFLRPTADSKFFRTGQINYDLLCQLVLHVNDKLTSENNS
                     GSIIVFLPGVAEINRLCRMLENNNLVVLPLHSALSAEDQKQVFKKFSKRKVVVSTNIA
                     ETSITIDDCVATIDTGKAKIMMYNAKDNSTRLIERFISRAESKQRRGRAGRVREGLSY
                     KLYSKRLYEEDMVEMPTSEINRVALDSLYLSVKAMGIRNVKSFLAKGLEPPPLNALEM
                     AEIQLSMIGLLDRKNEELTQLGKYVSMMPLVDPKYGKLLLFGIIFGCVSKCVLIASIL
                     SLSNSPFIGGTENRDNIKQMLKEHGDDGDILAIVDIVEKCLSKTNSSDRGKYMKQHYL
                     SFNKLREIESSISQYYSILSDLGFLPIKYRQSEGSELERNGKSKSILKAILAGTLYPN
                     IARVQLPDMKYLSTSMGSIEKDLEAKQIKYWIRNEELQTELQKLKDEGKEINWRNNDL
                     PPSTKRAFLHPSSVLFQGNEMSVVELQALQDDLHRISKKTSPTSLTSPFVAYVSTQLT
                     SKQFINGLTPVSTLVLLLFGGVLRYDIDSESLSPGIIMDDWIPIRTWCKNGILLNELR
                     LTLDKAIQTVLEKPQYVSGTQNTSKNLEHVFQLVHNLIEIES"
     gene            complement(<433719..>434978)
                     /locus_tag="CAGL0J04554g"
                     /db_xref="GeneID:2889642"
     mRNA            complement(<433719..>434978)
                     /locus_tag="CAGL0J04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447904.1"
                     /db_xref="GeneID:2889642"
     CDS             complement(433719..434978)
                     /locus_tag="CAGL0J04554g"
                     /inference="similar to AA sequence:UniProtKB:P23542"
                     /note="similar to uniprot|P23542 Saccharomyces cerevisiae
                     YLR027c AAT2 aspartate aminotransferase or uniprot|Q01802
                     Saccharomyces cerevisiae YKL106w AAT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447904.1"
                     /db_xref="GeneID:2889642"
                     /db_xref="GOA:Q6FPE0"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FPE0"
                     /translation="MVKISATVYNDVEPIKTDILFATKQRYLKDTRGFKVDLGVGAYR
                     ADNGKPWILPSVRKAERLVQEEDDYDHEYLNICGLDSLTNSAAKVILGEDCPALRESR
                     VISVQSLSGAGALHVAAKFIKKYTPEKKIYLSNPTWPIHQSIFENVDLETDSYPYWDA
                     TNKSLDFEGFIKAIDHAPRGSIFVLHACAHNPTGLDPTQEQWHQIIESIQKGDHIPLF
                     DSAYQGFASGDLERDAYAIRYTINQLRDCAPIFVAQSFAKNVGMYGERVGCLHLVLPA
                     QKEDIVPIKDAITSQLSRIIRSEISTPPAYGAKVVSKIFTTPELKEQWYQDLVTMSSR
                     IISVRTRLRDLLAEYNTPGNWDHIVQQCGMFSFTGLTPEMTKRLETEHAVYMVPTGRA
                     SVAGLNTGNVQHVAKAINEVVNHFMKD"
     gene            complement(<435699..>437354)
                     /locus_tag="CAGL0J04576g"
                     /db_xref="GeneID:2889446"
     mRNA            complement(<435699..>437354)
                     /locus_tag="CAGL0J04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447905.1"
                     /db_xref="GeneID:2889446"
     CDS             complement(435699..437354)
                     /locus_tag="CAGL0J04576g"
                     /inference="similar to AA sequence:UniProtKB:P32461"
                     /note="similar to uniprot|P32461 Saccharomyces cerevisiae
                     YKL191w DPH2 diphtheria toxin resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447905.1"
                     /db_xref="GeneID:2889446"
                     /db_xref="GOA:Q6FPD9"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR010014"
                     /translation="MSNEDILVPAALSTHQDESDFTFQKFDSDSMERSFYLGPLSSQD
                     ELWDKLMQYYSIDKLIAYLQRNPEYVQITLQFPDTLVKDSSFIIRALQDKLDGDGAGR
                     KFWALADTAYSACCVDEVAAEHVKGDLVIHFGDACLNAIQKLPVVYDFGKPFLDTDVL
                     LACFTEEFKDKDQKICLMSNASYTHHIPDLYSRLKSNGYTNVVYSVVNTGLLTETAEI
                     IDNTTPLSDTDELFTLGNRVLMGARQEEDIDEETLRNEYALFHITMPHDPHLLYLTTV
                     FESIHTYDVADQVISNGPYPSLTRRYKNMHKARTAGCIGILVNTLSIRGTRETVNKLI
                     KLIRENGKKHYLFVVGKPNVPKLANFEPVDIWCILGCGQSGIIVDEFGEFYKPIITPY
                     ELTLALNFEVTWTGKWIIDFQKAITEIDNSLAELGIDDSKHGNDSDHDLDAPEFDAVT
                     GKYVSSSRPLRALNHLQLDAPSNEDKQVMARVNGGTVIKGTVSTAVEHLANRAWTGLG
                     SDYKDDEGYEEDGATVEEGISGIARGYEFDQEDAARKSQNQSQ"
     gene            <437730..>438806
                     /locus_tag="CAGL0J04598g"
                     /db_xref="GeneID:2889447"
     mRNA            <437730..>438806
                     /locus_tag="CAGL0J04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447906.1"
                     /db_xref="GeneID:2889447"
     CDS             437730..438806
                     /locus_tag="CAGL0J04598g"
                     /note="highly similar to uniprot|P20051 Saccharomyces
                     cerevisiae YLR420w URA4 dihydroorotase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447906.1"
                     /db_xref="GeneID:2889447"
                     /db_xref="GOA:Q6FPD8"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR004721"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD8"
                     /translation="MSEIDLGITCDMHVHVREGDMCELVTPSIRDGGVSVCYVMPNLQ
                     PPITTLDRVVAYKKKLQELAPETTFLMSFYLSRDLTPELIHEAARAKAIQGVKCYPAG
                     VTTNSSAGVDPNDFTAFYPIFKAMEEEHLVLNLHGEKPSVAKEDIHVLNAEESFLPAL
                     KKLHTDFPNLKIILEHCTTEAAVNAIEEINKNVTNISDVKVAATLTAHHLYLTIDDWA
                     GNPINFCKPVAKLPRDRRALVAAATSGKPYFFFGSDSAPHPLEMKGRHIGVCAGVYTQ
                     SLAIPYVAQVFHEANAMDKLKGFVSDFGLAFYDVPQSEIRSTQHAILYKQEQTVQDTI
                     QGKNNLKVALFKPGEKLDFSVKWQ"
     gene            complement(<438990..>439445)
                     /locus_tag="CAGL0J04620g"
                     /db_xref="GeneID:2889448"
     mRNA            complement(<438990..>439445)
                     /locus_tag="CAGL0J04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447907.1"
                     /db_xref="GeneID:2889448"
     CDS             complement(438990..439445)
                     /locus_tag="CAGL0J04620g"
                     /inference="similar to AA sequence:UniProtKB:O13563"
                     /note="similar to uniprot|O13563 Saccharomyces cerevisiae
                     YLR421c RPN13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447907.1"
                     /db_xref="GeneID:2889448"
                     /db_xref="GOA:Q6FPD7"
                     /db_xref="InterPro:IPR006773"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD7"
                     /translation="MSEVVVRAGICEFDESSKLCDPLPVQGSIKMAPHEEGIELGFWS
                     FEWSPVEKTAKPMEPISLILIPGETKCVRLSSKNGRVFSLVFSSDQKYFFWLQEKNAG
                     SLKLDQFSENDLKFLEKLDSILKGPEEEEEEEAEDLTEKLKHEDVEMKD"
     gene            <439679..>445423
                     /locus_tag="CAGL0J04642g"
                     /db_xref="GeneID:2889449"
     mRNA            <439679..>445423
                     /locus_tag="CAGL0J04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447908.1"
                     /db_xref="GeneID:2889449"
     CDS             439679..445423
                     /locus_tag="CAGL0J04642g"
                     /inference="similar to AA sequence:UniProtKB:Q06409"
                     /note="similar to uniprot|Q06409 Saccharomyces cerevisiae
                     YLR422w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447908.1"
                     /db_xref="GeneID:2889449"
                     /db_xref="GOA:Q6FPD6"
                     /db_xref="InterPro:IPR010703"
                     /db_xref="InterPro:IPR026791"
                     /db_xref="InterPro:IPR027357"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD6"
                     /translation="MVEVKRRWVPLNGLQFGVMVRSYLPLKRHPSLFYHNHQFMNVYA
                     GAEVYVFEESEDGKWCRAYFCCRPFPEEFIASSSSTNEKLPDVKPVVCVFPKCYVALD
                     PNRFVHIISFFKAPDRSDFENEQLAECKSPSLYDTLSESQDHEVAKLANSKPTRPPFP
                     YFRYQKRPFVDEMGPVLSLLCSHIYWMYSLGEFEIHTKLVGLYYELDNIRLRLRLQLT
                     TEIERIKLIRAANSLLAKISKFISSKGRTNRFLIQSKSSNPDPYGFEGIFARDIITGE
                     LLSYHDTELRTLMLSSMLYGLTNNFPNTESSILQFEAPKCEVYDRAKSHILIDFKSIT
                     SDPSVLNPNLENATAITYLMTPNERLTDPIEFQIPNGKRDTSFVTLLFESLFHSVIKK
                     NKIYLVLIITETVDINTNTMKSKAALSSFKEPFIPFKENDESLLHKLKRGIVAGVIDI
                     SPVFSKQKGIAHADTPHRFVINLFGSRFKSGFCPSSASQNSYDDQETLLGWGALVNNI
                     LSDSTMGIAINPRALSVPVTVKEILDEPFADKVRSSNIISVLSVPMKVNRNKIEKKES
                     LYLTLGCVCLCDIGQKETNIKNIAVQVNSKNDKVKFSYSDLGVKRNNWNFISVRPGES
                     IGETVRIDGLEHMAEDESIRVLVFLNGFLMAKSNICIKKNGVFLEYKKFTGFHLMSSI
                     GQKLVNLQLKLKYNGANYNIHPSISKFLVFRDYSDMLAECKKQSVDCIISGLQDAPLP
                     QLIVHFHSLLRKLLQYFKDVKELNHDKEGKKNRLTVFANLVGLLNSLVVDDVNDICFF
                     EEFYENLPLHEPELSMTGIEIVNCMSDVFEPGFECWHKIGRQACKAFVHLLLLSTISC
                     LDYMNEWKQAVKSLFVNITKFLSLTEESIYYDQILILRAYPLCISALHQYFEPYELLI
                     VTDRLFGSCQEKDNKLNFTQKCISPEEEKYLGEKFSSLLSVITHKSLQTYLFDCNDNS
                     NMKLEFFSRCIEWVQQPYFYYSDNNDVISYTRVANTVMMTLLENITNVQILRNLIRLI
                     PRYCEYFILIRKYCKKANFFRTRRIFTKLFPTQTAPFSIPMDSIVNDEVVIEILLEIA
                     TIICKITKMATTLYGKNPSFLEIINECKNDTHFQSSAYIKHCSKETVLLITKTQKYFL
                     KGDFFPCKKWLGVTALFARSCLIMLTMCKQFMIKEFSPYPITRGNDMHFDEQLWADYF
                     SALFMIANHKVSTLTRLAIIPRKAVYLISGNLKKQVSSVLSECWTGLANESFDHDFLC
                     KYGTGDVSSYQLQLLTNHPNIVREIFRFGLNRHLQAVKTSTNIIWTMVLLFWNHYESL
                     QPAINLCIPELFNAYQSGKFYMYDDELERFMICLFYRIHIDEHDVMYNPLIDFLEKIM
                     GFFHIVSETYKIPTQQEFDDDRTAHRIEMFSYLLEADRPELFHKMVYDLFIHFIQKRD
                     NVQAGLCLELLANTYEWDPNDFLSAIAYPPLPEQSSFERKEYLFKEAARNFAKGLKLE
                     KALSIYKDLTKAYDEINYDLNGLAFVHDQIAAIYTELQSVDRLVPTYFRVALLGFGFP
                     NSLRNRMFIFEGLPFEHITSMHDRLLKIYHGSSIVQTLDEVDELLMHPPMGKFIHVCT
                     VEPRFALSEQYSTSRKSELNNKIRMYIENRNLRTFSHFRRLAGSKSVTDLWVEEYTYG
                     TVNTFPTLMNRSEIIEVSRRKLSPLENALRTLQMKIQELYGLENMCYKVIKEQSDYIN
                     VLNELSRSITGTISAPINGGISQYKVFLEEANRDKFDKNDLKLLMSSFDELVHALSKC
                     LVLQSELSGTGSTNKSGHNLLVELFEENFAEEIKRNRIDISTMSVDSIMKDSNKPVHN
                     KSVVHKWHINSHWDRPNFGKSQRVKSDTNDNGVPFGTSMLGRYLSSTRSQSRNASERN
                     TAASSPMPYAIPDF"
     gene            <445793..>446146
                     /locus_tag="CAGL0J04664g"
                     /db_xref="GeneID:2889450"
     mRNA            <445793..>446146
                     /locus_tag="CAGL0J04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447909.1"
                     /db_xref="GeneID:2889450"
     CDS             445793..446146
                     /locus_tag="CAGL0J04664g"
                     /inference="similar to AA sequence:UniProtKB:P32463"
                     /note="similar to uniprot|P32463 Saccharomyces cerevisiae
                     YKL192c ACP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447909.1"
                     /db_xref="GeneID:2889450"
                     /db_xref="GOA:Q6FPD5"
                     /db_xref="InterPro:IPR003231"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD5"
                     /translation="MFSRLVPRLATRALIPSTVIARPMLVTPMLMRQYSVKSKDEISQ
                     KLIEVVKNFVKGESSQNVTADSKFHKDLGLDSLDTVELIVSIEEEFDTEIPDDVADRL
                     TSIRETIDYLASQKN"
     gene            complement(<446347..>447576)
                     /locus_tag="CAGL0J04686g"
                     /db_xref="GeneID:2889451"
     mRNA            complement(<446347..>447576)
                     /locus_tag="CAGL0J04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447910.1"
                     /db_xref="GeneID:2889451"
     CDS             complement(446347..447576)
                     /locus_tag="CAGL0J04686g"
                     /inference="similar to AA sequence:UniProtKB:Q06410"
                     /note="similar to uniprot|Q06410 Saccharomyces cerevisiae
                     YLR423c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447910.1"
                     /db_xref="GeneID:2889451"
                     /db_xref="GOA:Q6FPD4"
                     /db_xref="InterPro:IPR007240"
                     /translation="MPESLAERARSTLLKAQVLCREVESRIAEVKDRLSQWEKNRHTL
                     RFLVSCLEHQLGFLEQCALRQGIGRALIETEWSQVVLVDLVNEMKLWYDKIQLRLERL
                     DQVENILVADNKHLSHYISQEQALVLKKRLDEVPIIRPQIENIQTQYDTMCKRVRQKL
                     INKRLTEIKTIFDSQFGDELTETAELTEVKPRDLDSIELELVDYINSLTDHFDKCQAL
                     EKGLFNDSNEYDELLKIVSADDSQLDDIMKHLLNTIDSTNHQIDKVYEILDIKTKQKT
                     ILHGKINELIANCTKYSEYLAIFKGIATSIEKFKEGCMQDIQLTKELYKFYDEFENSY
                     NKLLQEVQRRRALSQKMLGIIKNCENELKTLHDEDQKLRTHFLSENGAFLPETIWPGE
                     IDDLSPLYALDYHIKEI"
     gene            <447836..>449728
                     /locus_tag="CAGL0J04708g"
                     /db_xref="GeneID:2889452"
     mRNA            <447836..>449728
                     /locus_tag="CAGL0J04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447911.1"
                     /db_xref="GeneID:2889452"
     CDS             447836..449728
                     /locus_tag="CAGL0J04708g"
                     /inference="similar to AA sequence:UniProtKB:Q06411"
                     /note="similar to uniprot|Q06411 Saccharomyces cerevisiae
                     YLR424w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447911.1"
                     /db_xref="GeneID:2889452"
                     /db_xref="GOA:Q6FPD3"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR022783"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD3"
                     /translation="MGLEEQYGFGARLLKKLGYVEGQGLGSDGRGRASPIEVNAEQHG
                     THAGLGMLSKRATAEDIDMHITSSSDEGREVNENARARPLQFKKTDATKPSSDIIYQI
                     EALGLPVDANVLARHPNASTIVEELVTKQRTLDAIVRKVEVVKQELDDVETQLNTLRN
                     LQHSEMSLLDKISEVLKLNNETIIDELAAKILKDELQKYNNLSLKDDRITNTLEPVVE
                     LLQYALESDPGALNKNQTQLYQWLCPRIEAAITEIDFKNSDSVDSIIYILVEYELILK
                     YIMMYDKLIDKFLMPRLLGLIKEWAPERNGIDHHFYDFYILLNQEQRKKLQDALKVIF
                     SDYCSGWYHKDAFHFDCHYFKLIFGETVFYSITEKKLLPIMVKQLYEEHFTLVDDLED
                     WSDINHDREGPAYCFKKVKEFANFLTNTQITTIMKGMFNDIRKLVFQWYLFSEPNDWQ
                     NCQNLIHDFFNIVYAEESKISDFEITELREILRMGTEVGKLSTVCYDREFDILKELHL
                     KKREFIDLERDENDHPNVIQIDDSDEDMRDSDGYTVQDIPIRRVDATFKEILQRYCEE
                     NGYEMIRDTTNYTQLPYGINGTSLVPIITIRKGTKARKVAIKDDILWIEGLSGYRPEF
                     LYNLTL"
     gene            complement(449942..450015)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0J04730r"
                     /db_xref="GeneID:2889453"
     tRNA            complement(449942..450015)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0J04730r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2889453"
     gene            <450562..>454479
                     /locus_tag="CAGL0J04752g"
                     /db_xref="GeneID:2889454"
     mRNA            <450562..>454479
                     /locus_tag="CAGL0J04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447912.1"
                     /db_xref="GeneID:2889454"
     CDS             450562..454479
                     /locus_tag="CAGL0J04752g"
                     /inference="similar to AA sequence:UniProtKB:Q06412"
                     /note="similar to uniprot|Q06412 Saccharomyces cerevisiae
                     YLR425w TUS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447912.1"
                     /db_xref="GeneID:2889454"
                     /db_xref="GOA:Q6FPD2"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD2"
                     /translation="MYRYNTPNTPERSKGGNTRSRDSPGVQGDVILPKLPPLNTRSSF
                     LESDMMQSDVSIGWTPLTENTISTSGQFADEHIGYGNSPQLRSPKSPANRRNSLIYEN
                     FNGDSPMSVKSVGNGKSRRRPPPPSLQHSISQLDSYQSSPGSPATPFITKRRTNDFIT
                     PTKTKPYKSPFVGEQDIEDSMLQQSTHFAGKVYKSPFVGDLDSDIIISPSNANETTKT
                     RKESSRVQSKTISNTELNFYSKPQIPLTSSRNITGISRFSDQVESFYSDSNYTFNNSS
                     ARNSSFNSFLGAKPLQYAPSVTAPTQAFSIDLIDEHKLYQCYSIYRLSDIYEWLLKVY
                     FEWFNEYIFEKLDLFQIVQLLLEFQSPKTYEQEVIDSNVDRIMSSLINQGAIKFEVDN
                     EQEIAVIVAGLTISSIFTDLLPCYSFIDSTFNEFDHSTICYSTTCCNRLSNESRQEIK
                     VSEIINKSVGLWTDYWQLSAEELSEINPKEIQRQSFIFDLIILEERSLSMANAAVEIY
                     GKRFDPDLLPDETNFASLAFDIFLPIIEIHKEFILKPLFWKIKTRGKFIDGIGKIYLK
                     WCHEVRDAYLNYANAMATVHEVISWEKTHHTKFAEWLLETDNLPEITRSKMYHDVIFF
                     GGYFKSLQNMPVTLSSILKNTSPSSEDYGALQLVIKEVTQLSADVDKVHGMAIDRRKL
                     IRFSKQLVYSSGNKGSTTGYINIGNPEKMVKGDKLSLGLADPKRVMINCDTVLKKSDH
                     WLEPYPVFLALLDNFLLITELVSKGLEKKYKLIDRPIPIEYLNLEIKRAPEEFNKDLP
                     LGDSRPTSQIVSDLDNKSSLNSRSSVVGDLNYGHTGISNNLPSSTEFAFKVRNTATND
                     SYTFYVPNSIEWNNWMNAFKCCFKNRNNDDNRHPINLSIITAEFSYQDRNAPVNLPVA
                     PEGSEIDSALKTYKRYLKDEFENIATTVFCSTEFDNEDTKFNLIATNSGVFLRRKNDY
                     TTKFVKVLQNISVSRLQAVPKLGLLFVLDGQKLCYFSISSILAVYYNPERFLNANFVV
                     GIVLKDKVSFFKFADDFGNSKQLFYERKGKIVVSTPEFHSIMNNFNCFKIYKKYYLPS
                     SSKMLASHSISDIVIFKKSFMVFTKKNVFLFNDAFNELGASLPGFYNDKEMIAYIKHP
                     HLNSGRFSSSSSKLDANLSMVTDVKKDIASGKTKPITAFRLQSGDGFLMVYDEAIVKI
                     NSSGMIPNWKNDILILDFYCTGASYHNGYLFLIGENLILVYQLSYEGTPISELTPVQI
                     INSKKIELLNSGGMDYPTVTSSHPKIPNRQLLFSCIPANYQVK"
     gene            <454697..>455792
                     /locus_tag="CAGL0J04774g"
                     /db_xref="GeneID:2889455"
     mRNA            join(<454697..454782,454862..>455792)
                     /locus_tag="CAGL0J04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447913.1"
                     /db_xref="GeneID:2889455"
     CDS             join(454697..454782,454862..455792)
                     /locus_tag="CAGL0J04774g"
                     /inference="similar to AA sequence:UniProtKB:Q06417"
                     /note="similar to uniprot|Q06417 Saccharomyces cerevisiae
                     YLR426w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447913.1"
                     /db_xref="GeneID:2889455"
                     /db_xref="GOA:Q6FPD1"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD1"
                     /translation="MGFDIDFILSYVVFPLLRFPVPIAFACSKLYAIVVFSIWTLIIN
                     GFYWLELWFRSRGEQTWKSLNELHDPIVLITGGSNGLGRCIIHKLLRSYNNIKVINLD
                     LDVQYWSEEARVINIECDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFED
                     TPIDEMQRIMNINTWSTARILQAIIPRDNQRQLYIVTISSVLGILAPSKVASYAASKA
                     AITALHNSMTNDFLVRGIGNIRTLLVLPGQIDTQMFDGFPPPRKFWAPIVCPAALAEA
                     IIDHCENGLRGTLRTPLYSYFPEFLMGIPYLLQRFARNFSKMDNCLPIETISSKRSLA
                     SVDL"
     gene            <456300..>458099
                     /locus_tag="CAGL0J04796g"
                     /db_xref="GeneID:2889556"
     mRNA            <456300..>458099
                     /locus_tag="CAGL0J04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447914.1"
                     /db_xref="GeneID:2889556"
     CDS             456300..458099
                     /locus_tag="CAGL0J04796g"
                     /inference="similar to AA sequence:UniProtKB:Q06436"
                     /note="similar to uniprot|Q06436 Saccharomyces cerevisiae
                     YLR427w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447914.1"
                     /db_xref="GeneID:2889556"
                     /db_xref="GOA:Q6FPD0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:Q6FPD0"
                     /translation="MSSSTNSNSSTRKSRNQGNGKTDTGRPRRRQNNGGSKFTKYDLD
                     KQERFDASIEQELNQGNFKMRGRKTKVSIDHLLDFQLPEVQRENHTHRKVNKRRIDSH
                     TYLHGESFINVNYRLLVSDRYDYKDQENDPNKFVDKEKIVRVIVPRGQNCPICLNEIP
                     VAPRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLCGSIVKPNNVKEV
                     LFEEDYSFNKQAFQEGSDHRPEPGHEASLVLMCKPHGSILALPISLDIDPKKVGDIPP
                     ANIEEISEYSHIMKCGDDYALKYYQLDMDAIENQYEIDKALYSDSGKYVKVALDKIRQ
                     NISTILSKDDFNSSINHITEDFMNKLHFDGNQSYDDTSAYFFYQTNFQSPIKYYLSPL
                     DIKILLTIFGHYSKFPELLEVKIENIHYGNIVTEALIKRYKYLGHLPYGTEIALLDLD
                     WRSVPFIEKDVYNRFASELKQRRRKLIIRKQREDQEKKKYEERLEQEQREFYQRENSN
                     FTGWEPQINKKDIQLTSLPAPVKPPQNTEAKLSKYNEKTIWGTSIEITEDEKTTKENK
                     EFEDMLLQKMRQEKSNKKKKGKIMLFSNTQQHL"
     gene            <458449..>460413
                     /locus_tag="CAGL0J04818g"
                     /db_xref="GeneID:2889557"
     mRNA            <458449..>460413
                     /locus_tag="CAGL0J04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447915.1"
                     /db_xref="GeneID:2889557"
     CDS             458449..460413
                     /locus_tag="CAGL0J04818g"
                     /note="highly similar to uniprot|Q06440 Saccharomyces
                     cerevisiae YLR429w CRN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447915.1"
                     /db_xref="GeneID:2889557"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015048"
                     /db_xref="InterPro:IPR015049"
                     /db_xref="InterPro:IPR015505"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC9"
                     /translation="MSGKFVRASKYRHVFGQAAKKELQYENVRVTNNAWDSNLIKSNG
                     KYLSVNWNSSGGGAFAIVPVSEPGKLPDQVPLFRGHTAQVLDTDFDPFDDNRVASSSD
                     DGKIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLASSSL
                     DYTVRIWNVETGEDIYKLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSE
                     GAAHAGAKNQRVVWLGNSERLATTGFSKLSDRQIGIWDAFNLEKGDLGGFYTVDQSSG
                     ILMPFYDDGNKILYLAGKGDGNIRYYEFQNDELFELSEFQSIEAQRGFAVTPKRLVNI
                     RENEVMKCYKTVGDQRIEPVSFYVPRRSEEFQEDIYPDAPSNKPALSADEWFSGKTTE
                     GPILVSMKSLYDGAEPELHQSHKAEATVKVVPEPAIKIEKKKPAEKPVEKEPTPEPEK
                     PKTVGNANEVLKSDNSIDKLLQKSSDLDMTNNVEDPSKDTSGWDEEDDKPISVNVDST
                     ASSTVDKVDVNIQKEQEPKKSEESSKVPTPVKSSTPEPVKTEMPVSKITPTKENKTME
                     PVRESTPVTEKASTEKESVSTPRSTSSKDEAATPGKSAKSLGLKQSVEKLSELVLKLQ
                     QTVDDLRESNLQKDDRLKALEEKIDSLLKK"
     gene            complement(<460655..>461893)
                     /locus_tag="CAGL0J04840g"
                     /db_xref="GeneID:2889558"
     mRNA            complement(<460655..>461893)
                     /locus_tag="CAGL0J04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447916.1"
                     /db_xref="GeneID:2889558"
     CDS             complement(460655..461893)
                     /locus_tag="CAGL0J04840g"
                     /inference="similar to AA sequence:UniProtKB:P47051"
                     /note="similar to uniprot|P47051 Saccharomyces cerevisiae
                     YJL046w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447916.1"
                     /db_xref="GeneID:2889558"
                     /db_xref="GOA:Q6FPC8"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC8"
                     /translation="MLKLGTRLLPALPARRTSMVRYMATNTPFDLDESDPKYKELNTM
                     YEEMFSGETVPYMSNDATDEVSEVDLLNEEIDSLYNVGMNNPRHIKINTSTELNKLIK
                     GEGPFVLRSISHNPYFNLALEDYLFRNTPIDKNSKSFDSHRLVFYINNKCAVIGKNQN
                     IWEELHLQKLKEKGYEVLRRLSGGGAVLHDLGNVNYSYICSRDEFDTKYFNGRIVSWL
                     KQYNHALPVSLNQRGDILSNGFKISGSAYKVALGKAYHHGTMLIKSNLSDFKGLLKPD
                     IIEGINWETNSVVSVRSPIENLPLPSPDTFIDLCTSQFNKMFHLNNNSYVCNESVMEN
                     NDDIKETMQKLQSNDWKYHSGPKFKVHIRDSKTGKEHSIAVEKGFIVDSTLKGVEAQD
                     FNNFLHNVDKYITVNKANIL"
     gene            <462163..>464562
                     /locus_tag="CAGL0J04862g"
                     /db_xref="GeneID:2889559"
     mRNA            <462163..>464562
                     /locus_tag="CAGL0J04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447917.1"
                     /db_xref="GeneID:2889559"
     CDS             462163..464562
                     /locus_tag="CAGL0J04862g"
                     /note="weakly similar to uniprot|P47050 Saccharomyces
                     cerevisiae YJL047c RTT101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447917.1"
                     /db_xref="GeneID:2889559"
                     /db_xref="GOA:Q6FPC7"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC7"
                     /translation="MNVEASLRELGELFDTAGSIAQSNIHLVSIPDKDRDFLVWRANM
                     LRFQCQYLTQRRDFDINELDNGDSHSSGRKRLKTDSSARLYTAISEFWKFISSRIETL
                     ADQYALMVVDHYNLNQDLDWYAEQHNGVFRYFNVSMEMLLDTFERFISLLAPITEYSF
                     LNYTKIMRDLCCFHSAFDFAFVSLIKKLKLYMGSNFKLILKDSFEVLKDKNYQQEGKV
                     QYSLISLFHYYKIEVDENVTVSEFVNELINHDISELTSRDISDDYFERISSGATAEML
                     LIKCCGFPEQTESRYVSLVLDKQVFFKILACQLDKLDKILKSGNCNIKLRKNDVQYSL
                     CAYYTRHGKKDDYYRLVSVFFNDRFKNCPLERNISEVIFIECTKLMLLFYFDNQILQI
                     LMSSLCEKFGGVLKMYENYEKLLEYKIRKYNRSHELWNKNNSDIEKPYRLSDDIKKHQ
                     YYERFLIMLPSRLKFDSSFLRLHQQKLFRRAVLQGPSIYESISDFSYLEMNILFSLIS
                     EYETSDEFHYLYDLYTSLRKSYVFYQQYSKDHGDQVVPLVIDKKSVPTAFQKEENENV
                     ILPEILQRQWGKLVEYYNSTLKTSASRTLVPAYALQHCDVETEFLVEGTRDKYVTFNI
                     SVYQTCVLNLFNDHDKLDIAKIMQLTGLSERMSKAVITSYLSAGIFKEDKGTYTIDSS
                     FKADPRKLKDGKLRIPMAPGPPSRLRRDTSSSSSTASATVSTSASHNEGYSSLWIQEV
                     IKAAIVRTLKANGKPMNFDTLFEQIKTGINGVSVGECKESINRLVSEKIISQTAEGYT
                     Y"
     gene            <465532..>466518
                     /locus_tag="CAGL0J04884g"
                     /db_xref="GeneID:2889560"
     mRNA            <465532..>466518
                     /locus_tag="CAGL0J04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447918.1"
                     /db_xref="GeneID:2889560"
     CDS             465532..466518
                     /locus_tag="CAGL0J04884g"
                     /note="weakly similar to uniprot|P38349 Saccharomyces
                     cerevisiae YBR273c or uniprot|P47049 Saccharomyces
                     cerevisiae YJL048c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447918.1"
                     /db_xref="GeneID:2889560"
                     /db_xref="GOA:Q6FPC6"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC6"
                     /translation="MDVESLLWLSIRDSRRIIVTVTDEPMGELADECQIVRLSRDSGS
                     FQRFVSVFNSSKTALYYYIEGPTVVEARSLDELKARFPNKNSTRPYESERQRIIDLIN
                     ADKLERNSRSRQLSGYTALSSEVVLKDNIKNNKSDICTLKIRMTNGDYVQYDFDSNTS
                     LGSVRRWLKDYRTDGDFPYLFHQNISRKSIRITEEYKTLAELDLTPRSILMLKQYDLR
                     PRTRVPKPRKRSWYWQFLTVRIKRQLLEGLSEILASHRTTSNIMRSSSMSYLQADDSN
                     MTKITNSLPPNDDNSEDIVKIKQKYNQNTGSIMNTPLEIARPDSPSVLQINT"
     gene            complement(<466782..>468128)
                     /locus_tag="CAGL0J04906g"
                     /db_xref="GeneID:2889561"
     mRNA            complement(<466782..>468128)
                     /locus_tag="CAGL0J04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447919.1"
                     /db_xref="GeneID:2889561"
     CDS             complement(466782..468128)
                     /locus_tag="CAGL0J04906g"
                     /inference="similar to AA sequence:UniProtKB:P47048"
                     /note="similar to uniprot|P47048 Saccharomyces cerevisiae
                     YJL049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447919.1"
                     /db_xref="GeneID:2889561"
                     /db_xref="GOA:Q6FPC5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC5"
                     /translation="MDKLVSQSRLNSLYKDFRPLKELNFDGYVANVNDWQNYLLKKYF
                     PKQDKICVTIGTRFLQDISDKKYGAPASIDVVIDNLIQENILIKLDEFKNSATKRDEK
                     TITRIFSWIHASSIGKLNRYQSRKNDNATNYLKQDTFVIRPLLEEKFTKIYDIIRNNI
                     LAKATTVCDLIFPLEDFIDFSGISYTLPSDSLIEWEVMLNYLEYHKNTITRKENIVKI
                     IDPLVESIYKQFGVEITETDQSIAEIKQCFTNIENAIEKYEIEVYEYKMKLKGDDFKK
                     LTKIAQTEYKRGYFLAQKMLLKLFKFRNNLVEVKYQLDMSVSNLVLYKTLQSSNKIIT
                     TINGKIGPAEKVHDLLEEIRERSTDNEEITKVLSMEISKFDDDELDEELKEMEKELAG
                     QEISKTQSEKNKEDDESKILEQLENLNIKDEQSLNVVNNNSNKKHNEKFMLREEAA"
     gene            complement(<468765..>471962)
                     /locus_tag="CAGL0J04928g"
                     /db_xref="GeneID:2889562"
     mRNA            complement(<468765..>471962)
                     /locus_tag="CAGL0J04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447920.1"
                     /db_xref="GeneID:2889562"
     CDS             complement(468765..471962)
                     /locus_tag="CAGL0J04928g"
                     /note="highly similar to uniprot|P47047 Saccharomyces
                     cerevisiae YJL050w MTR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447920.1"
                     /db_xref="GeneID:2889562"
                     /db_xref="GOA:Q6FPC4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC4"
                     /translation="MDSNDLFDVFSAVPEEVPDVSDEEIENDSAKVPKSNEKHTLTSD
                     EEDGESNKKVKPNKTSGSKKETSKIIPIVADDFEQEASREVDASAGLSTQATTEVEED
                     GKVKLSHQVRHQVALPPFYDYKPIGQHKRTNEARTYPFTLDPFQDTAISCIDRGESVL
                     VSAHTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDI
                     TINPDAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLP
                     DKVRYVFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVV
                     DEKSTFREENFQKAMTSIGNQAGDDPNSTESRGKKGQTFKGGAAKGDAKGDIYKIVKM
                     IWKKKYNPVIVFSFSKRDCEELALKMSKLDFNSDDEKDALTKIFNNAIALLPENDREL
                     PQIKHILPLLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTV
                     VFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKG
                     QADRLDSAFHLGYNMILNLMRVEGISPEFMLENSFFQFQNVIAVPVMEKKLIEYQQQY
                     DNIHIEDESGIKEYYEVKQTLKGYYEDVRKVMTHPAHLLSFLQPGRLIEVVVDGNQRY
                     GWGAVVDFAKRVNKRNPTAVYSDYDSYIVNVVVSSMYVDSPINLIKPFNPAFPEGIRP
                     AQEGEKSLCAIIPITISSITNVGNLRLFMPKDVKASGQVDIVGKSLKEVGRRFPDGIP
                     LIDPVKHMKITDDDFMKLQKKIQVLEEKLKTNPLHGSVKLNELYEAYNSKHELSDAMK
                     KLRAKITDSQAVIQLDDLRKRKRVLRRLEFCTPNDIIELKGRVACEISSGDELLLTEL
                     IFNGNFTELKPEQAAALLSCFAFQERCKEAPKLKPELSEPLKDLRELAAKIAKIMKDS
                     KIEVVEKDYVESFRHELMEVVYEWCRGASFTQICKMTDVYEGSLIRMFKRLEELVKEL
                     VDVANTIGNQALREKMEAVLKLIHRDIVSAGSLYL"
     gene            complement(<472406..>474844)
                     /locus_tag="CAGL0J04950g"
                     /db_xref="GeneID:2889563"
     mRNA            complement(<472406..>474844)
                     /locus_tag="CAGL0J04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447921.1"
                     /db_xref="GeneID:2889563"
     CDS             complement(472406..474844)
                     /locus_tag="CAGL0J04950g"
                     /note="weakly similar to uniprot|P47046 Saccharomyces
                     cerevisiae YJL051w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447921.1"
                     /db_xref="GeneID:2889563"
                     /db_xref="GOA:Q6FPC3"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC3"
                     /translation="MQGSRMLLMLASAVSFACGSMVIALLAQIRSITGALTVIVCATY
                     LYGIAAFLSAVCGAKLAALNGSGLLVSFSLEMITLWASVYVFHRTNQASFMAAINHSS
                     QRVLTSFQSLLVLKLLVSGLSIGAQINKQQPPIGDQENLPLEDSTKLVSDPEKFIPMK
                     NSAQTLTPGMEITTNVPTRDANQNLDGRNALNSVTVVTDPNVTRTRYDSSALSGGSVI
                     RHPLVNIANLNNTSETQMTKRRRKRLLRQFKTLHVRFKGRKTVPKALPLQVENDSQTD
                     LHTTNKRGTILSDISGLSKGLIPFVGNNSDKESKHENSSYSLILDLAHNRNEQLSIQN
                     SPQMEVERSAIGRFDNMLLPPYLRINPSAPKTPEVNSDHVNLLDIPHPQEEMLMKTSS
                     NHSNVLDEFDLHTIEGPNDNVFAHDDYPTTEHVNYPSHISLEMWEKNKEDYLNTSRTK
                     SKSLLLPIFTQDSFMDSSNINLKKLETLQESENNSQLVGLGINTSSGFSFPSKDTVES
                     EDKLYMAPISGSNEESIVETPISPNKVSNEFYNNDDAISALDEYLKEEEHQENIDDSI
                     MEESLNQNLSSSFILDSYGNNEVLARHSPTKSVISIMSGNTSLNHKRSYSKIASFLGH
                     SRGNSLVTQTRLPNNSIHSSPTKSERRQRLSQKLSFSNLSDFGSPTKWENKNSNQKYN
                     NSIGHKLNKSIDFSYIHSLQGNDGNSPTKNNIRRHSTIWDQMTQDQRRHSVATDVMYD
                     FPSNQNSKSSFQVHNINTTRFEVNIPNPELREVSGGTIETSLSDETERYPEQAMSEYD
                     KEKWNTLNEPVPNI"
     gene            <475587..>476606
                     /locus_tag="CAGL0J04972g"
                     /db_xref="GeneID:2889564"
     mRNA            <475587..>476606
                     /locus_tag="CAGL0J04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447922.1"
                     /db_xref="GeneID:2889564"
     CDS             475587..476606
                     /locus_tag="CAGL0J04972g"
                     /note="some similarities with uniprot|Q12100 Saccharomyces
                     cerevisiae YDL025c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447922.1"
                     /db_xref="GeneID:2889564"
                     /db_xref="GOA:Q6FPC2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC2"
                     /translation="MVIAVADQRPRGFRSAFSGIFSKTDKRATGKKLAADALSLNSKA
                     IKFAKGTTCDVVVSLDKKTGQTVAKKVYNTDRDPSKDYRDYMVTVLRNEYDILVTLRK
                     SKYVVNVYDLDISKRTIKMEFLPFSLSRVLSMDLSPSLQEKKCYFLQICEAVQYLHSR
                     GIVHRDLKLENIMLCADACQIKLIDFGVAVNRQDPQSLTTACKGMCGTEALMAPEVLG
                     SISYVGEYADCWSVGIIMFQIFNISNDSVRWKPRYPWESARFSNSIYKIYSEEADTSV
                     VLTNLEDDEDLKELILLFLHIDSLKRLTMKKALESKFLASIKGVKHSHDRTLRVCNKV
                     FQLKH"
     gene            complement(<476763..>477782)
                     /locus_tag="CAGL0J04994g"
                     /db_xref="GeneID:2889565"
     mRNA            complement(<476763..>477782)
                     /locus_tag="CAGL0J04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447923.1"
                     /db_xref="GeneID:2889565"
     CDS             complement(476763..477782)
                     /locus_tag="CAGL0J04994g"
                     /note="highly similar to uniprot|P40335 Saccharomyces
                     cerevisiae YJL053w PEP8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447923.1"
                     /db_xref="GeneID:2889565"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:Q6FPC1"
                     /translation="MFFKSPVDIEIQLDGEETRKHVDVTNTSNSKTLKESYPLFEDGE
                     SISGNITMRVRDGRRVEHLGVKVSVIGSIDMVNGVGSGKSNSQSSFGTSTDVNKKCVD
                     QFLTLSYDLCPPGELQHTKTFPFLFKDINKQYESYTGKNVDVTYAVKVTVIRKSADVS
                     KMKRLWVYLYNDLSKPIIENTNLINTDTSEGENSDKNKVEAFKKPVKLDIGIENCLHI
                     EFEYSKAEFSLKDVIVGRIYFLLTRLKIKHMEISLITRESAGIHTGNTLTDTTAVRYE
                     IMDGSPVKGETIPIRLFLGGYSLTPTMSNNQFNVKNYLSLVIIDEDGRRYFKQSEIIL
                     YRTRQ"
     gene            complement(<478312..>479670)
                     /locus_tag="CAGL0J05016g"
                     /db_xref="GeneID:2889566"
     mRNA            complement(<478312..>479670)
                     /locus_tag="CAGL0J05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447924.1"
                     /db_xref="GeneID:2889566"
     CDS             complement(478312..479670)
                     /locus_tag="CAGL0J05016g"
                     /inference="similar to AA sequence:UniProtKB:P47045"
                     /note="similar to uniprot|P47045 Saccharomyces cerevisiae
                     YJL054w TIM54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447924.1"
                     /db_xref="GeneID:2889566"
                     /db_xref="GOA:Q6FPC0"
                     /db_xref="InterPro:IPR021056"
                     /translation="MNPALKALGLGNFKLPSRNWTIFWTVLAGSLGGVGYDKYQQRQI
                     ISRYCDEVKPLSLQHCDVNKSPRKITVFIAPPPNDYLETSLKIWRRYIKPVLYYAGLD
                     YEVIEEDRQGIIRSEVASRIRQLRRELLEADNEQQGNSGDSLLSIFKKPHAKDPEEEQ
                     KFDPEQARQFKADFDFRNVMGIYTKVPKLDTIVQTDSLVADPVLAGGVVCVGRGAYKE
                     YITGLHEGLLGPLDPPEETTQEVEMGSKLKSMNDGDNVETTVETAVETMVETTLESAD
                     KVEVEGKDTENEEGKDEPDEEKSRVLKPYLLRTAFHDTPIPPEVEPVLEKDALLKDPK
                     TNVPSLLHQPVLVIPVPNLIGFLTIPERIYRFYQRRFFVDEVCREASNLVKQEHIVKY
                     EPDKHINLALEEESDWPKQWVKTGIEKNSEWTQELVQDQRVVSKMHVFELPKHTTKDT
                     KE"
     gene            complement(<479913..>480581)
                     /locus_tag="CAGL0J05038g"
                     /db_xref="GeneID:2889567"
     mRNA            complement(<479913..>480581)
                     /locus_tag="CAGL0J05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447925.1"
                     /db_xref="GeneID:2889567"
     CDS             complement(479913..480581)
                     /locus_tag="CAGL0J05038g"
                     /inference="similar to AA sequence:UniProtKB:P47044"
                     /note="similar to uniprot|P47044 Saccharomyces cerevisiae
                     YJL055w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447925.1"
                     /db_xref="GeneID:2889567"
                     /db_xref="GOA:Q6FPB9"
                     /db_xref="InterPro:IPR005269"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB9"
                     /translation="MKSVCVYCGSASGDKSFVAAAEELGALIHARRWSLVYGGGTTGL
                     MGGVARGAMGPSKDGSVHGIIPDALVAKERSDGGGAGQEQEQEQEEYSEPVNGTTVVS
                     SDYGETTVVPDMHTRKRLMASMSDAFVALPGGFGTLEELLECVTWSQLGIHNKPVVVL
                     NTNGYFDALLRFFRDAIAAGFISEANGSILQVASTPQEAIDLIVNYKVPEGRFNLKWS
                     DEGL"
     gene            <481253..>483394
                     /locus_tag="CAGL0J05060g"
                     /db_xref="GeneID:2889568"
     mRNA            <481253..>483394
                     /locus_tag="CAGL0J05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447926.1"
                     /db_xref="GeneID:2889568"
     CDS             481253..483394
                     /locus_tag="CAGL0J05060g"
                     /inference="similar to AA sequence:UniProtKB:P47043"
                     /note="similar to uniprot|P47043 Saccharomyces cerevisiae
                     YJL056c ZAP1 metalloregulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447926.1"
                     /db_xref="GeneID:2889568"
                     /db_xref="GOA:Q6FPB8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB8"
                     /translation="MVEGVVHGHIHNSERYTYVHGHVHHDSEECEGFEDCRVPGMNML
                     NLNMGMNMGMNMSTNMDLQAMQVQANPHAHPHAHAQAQMFHEYNSASSSGASSPVQCC
                     NPNILEICCDLDHPVSNQIGATGGSAGSAGSTGSTGSTGSAGSAGSAGHSGPGSASMT
                     NNAMSLNTASSVFTNDFSKDMMIFTDNALTQLANTGTATATNTTTTASTSPIGTRNDT
                     AAGNEDEDMKILQDLCNISQLYELPMAKHINHHHHNHGNVVNLLEDTHLCGGGDANQN
                     ANSGDGHACDGSHQTDAPCTGNCTSGKPHHHHRIQVHPHDMKEYKPHRKRRKLVESPM
                     FGSRKLVMSPQPLTSHDRHIPADFNDLNTNTINFNWNFRDDDDIHCQWDDCGETYTTL
                     FDLQRHMLKDHITNEDKHNIFNGESEHLSHCQWKDCEFKGGDICSLVNHINDEHGIHF
                     EINVLENDTSVSNSSAPSCASSIKSSLHFDSPHPDIRSMSSPVMIKAEQENDLNNSNS
                     TRTRARQRVSRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQ
                     YTCEWEGCNKTFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRVHSGEKP
                     YECHICHKRFAISNSLKIHIRTHTGEKPLKCKVCGRCFNESSNLSKHMKTHMKKYFCS
                     QCSRSFDTLEKYKAHELRSHPKTIKDQQIAT"
     gene            <483782..>485743
                     /locus_tag="CAGL0J05082g"
                     /db_xref="GeneID:2889498"
     mRNA            <483782..>485743
                     /locus_tag="CAGL0J05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447927.1"
                     /db_xref="GeneID:2889498"
     CDS             483782..485743
                     /locus_tag="CAGL0J05082g"
                     /inference="similar to AA sequence:UniProtKB:P47042"
                     /note="similar to uniprot|P47042 Saccharomyces cerevisiae
                     YJL057c IKS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447927.1"
                     /db_xref="GeneID:2889498"
                     /db_xref="GOA:Q6FPB7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB7"
                     /translation="MSLVPYKEGSIILNDPSSRSLAIVDPKIGSVAIYKQINARVEHL
                     RSDRRSSVESIASYMCPHCGTEVHLSNDEGYGSSARKARKENTNRRNVSPDFDPDDLS
                     NYNMLSTTTGSSAYFRLLQRNHQFYAIQDGEQTENSHIPDDMFIPGYFHKFFDILEPL
                     GNGARGSVYKVVHKLGSTPLGTYALKKIPIGNDDEWFKKCIREVKILSSLKHTSENLI
                     TYNHVWMEMDASVGHVQSLDGSSTGMVGDVPCMFILQQYCAGGNLEDCINNVVFEKNP
                     ELISIEERKKRFRERHGQKSSGSAKAGLSTLQILSILHDIASGLKELHNSGLIHRDLK
                     PSNCLLLSPYKHNDEERVFPTVVIGDFGESQMKGEYRTATGCTGTMEFTAPELIIENC
                     DSNSNSQYHEFSFQSDMYSLGMIGYFVIFGELPFGSELDIPEIKNCIKALNIDKTYMV
                     KKHREMRLKDIDYRIFDVLQLLLSSKESIRPSAIEVESIFEKLIGLNIKHDDNEKLAY
                     DYSSKDKLEKSDVLYEQPDGINIGKLEEFQSSDKGSASTNEAYFQIASLPATPRLALP
                     NLIDRQQVSDSTKINLTNITLRGLIFVFAALAYYRYALTVNAINPQVMHSFFWSSTFM
                     ALSFVDNQRFLFCIFIIQFIISLRAMFLY"
     gene            complement(<485863..>487098)
                     /locus_tag="CAGL0J05104g"
                     /db_xref="GeneID:2889499"
     mRNA            complement(<485863..>487098)
                     /locus_tag="CAGL0J05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447928.1"
                     /db_xref="GeneID:2889499"
     CDS             complement(485863..487098)
                     /locus_tag="CAGL0J05104g"
                     /inference="similar to AA sequence:UniProtKB:P47040"
                     /note="similar to uniprot|P47040 Saccharomyces cerevisiae
                     YJL059w YHC3 may function as a chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447928.1"
                     /db_xref="GeneID:2889499"
                     /db_xref="GOA:Q6FPB6"
                     /db_xref="InterPro:IPR003492"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018460"
                     /translation="MNSKQRVYAFFWIFGLVNNVLYVVILSAAVDIVGPKVPKTLVLL
                     MDITPSLLIKVTAPFFIKSIPYTMRIYALIALSCIGMIFVSGKSLLLCMIGIAMASVS
                     SGFGEVSFLQLSHFFEENALNGWSSGTGGAGIVGSSVYMLLTSIFKLPIRLSLLSFTI
                     LPFAFLLYFKLDTTQIEYDSISSSGEETLIRNSNSNALQTDTFNESIRLSKTEEQNIF
                     VSSIDHFKSTCVNLKALVVPYMLPLSSVYLFEYLINQAVSPTLLFPLDSRGLPPFFNK
                     YRDMYVTYGTLYQLGVFISRSLAHKFRMHNLYFLSALQGLNLVLTILQAWIYIVHTPW
                     PIMILIFYEGLLGGSSYVNTFLNVLEEVDMDKREFSLGAVSIADSLGVFIAALVGLGL
                     EPTICNHQVSTGRPWCRME"
     gene            complement(<487452..>488753)
                     /locus_tag="CAGL0J05126g"
                     /db_xref="GeneID:2889500"
     mRNA            complement(<487452..>488753)
                     /locus_tag="CAGL0J05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447929.1"
                     /db_xref="GeneID:2889500"
     CDS             complement(487452..488753)
                     /locus_tag="CAGL0J05126g"
                     /note="highly similar to uniprot|P47039 Saccharomyces
                     cerevisiae YJL060w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447929.1"
                     /db_xref="GeneID:2889500"
                     /db_xref="GOA:Q6FPB5"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB5"
                     /translation="MKRTLNRMTKITPNKYFQKNTSKDVWTLTNEFAASAVGKSEGRE
                     LINLGQGFFSYSPPQFAINAAKSALDVPLVNQYSPTRGRPSLIKSLVELYKPVFGDFI
                     DNQNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPP
                     KEMKTRNTTGDEWQIDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVE
                     HNTVVISDEVYEHLYFTESFPRIANINEDIANLTLTVGSAGKSFAATGWRIGWIISKN
                     DQLLNYVSKAHTRICFASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFD
                     KLGLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPP
                     TEFYIKEHEKDAETLLRFAVCKEDEYLAKAAERFQLLKDYL"
     gene            complement(<489747..>494336)
                     /locus_tag="CAGL0J05159g"
                     /db_xref="GeneID:9488022"
     mRNA            complement(<489747..>494336)
                     /locus_tag="CAGL0J05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999525.1"
                     /db_xref="GeneID:9488022"
     CDS             complement(489747..494336)
                     /locus_tag="CAGL0J05159g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999571.1"
                     /db_xref="GeneID:9488022"
                     /db_xref="GOA:B4UN28"
                     /db_xref="UniProtKB/TrEMBL:B4UN28"
                     /translation="MLLNWTITLLWTLLLSRVTAQLVVTTTIPIPQAVTFPTPVAVGT
                     GGDVTFEGSGPYTFNDKVYIMKNGKLTIHNPQSGSLLNISITGDTINNGQVSVLNDGT
                     TNARIKITGDSILNTGTLLLQNNDAAAIVNHDLSIVLSPKDSILNTGTLTLYQAGGVD
                     ITTGDITNNGVLNVYGTALRIHQPIVGNGNINLFSGFLILGFDQTESNILQNITIGFG
                     SLMLFDTRGNTTPRLVTINLASFDPNNFLGFTDPNFTYTYDGNVLNLVSNQVTVKVYI
                     GPGYDINSFIKLDSTQQEYLGTNYIISAIYYGAQPPTTRTFQPLPSPYNTTIYTLDVT
                     EEFTVSYIATSDKGGFPTTIRTSIPWSTPISSPYTTFTIHDSTTESYVVSYFSTVNAK
                     GGPLISSTTYPVLHAPYTTTITEKGVTHEVYYSFTDILKGNSHSTSTFISTIIPPFPK
                     PTTFTSFSGNYEYIGVVTYYSTVNAQGGTYTASSTKTISTITLTQYKVPPVTTVTISN
                     SQYSEVDVISYYLTQDSNRKVFTASTTISSSRAYITPPPLTSKTVDSNGVTIWAIISY
                     YTSAKDGQIIFTSGSSVYSPPPLKTITVLGDHYVEEDVYSYFITVNGQGQIITDSTEI
                     SSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTV
                     TIKSDHYEEEDVYSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLGNGITEY
                     DVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVDSEGNII
                     TDSKLISSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSP
                     PPISTVTIKSDHYEEEDVYSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLG
                     NGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVD
                     SEGNIITDSRVISSSIIDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTY
                     PSPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTV
                     TTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDII
                     SHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPT
                     TILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDG
                     KDKTTVTTDKDGVVHTDIISHITTTDSNGNPTTVATTLALPSSGNNSGNNSGNNSGNN
                     SVNNSGDNNGNSAGNNAGESDHTTVITSNGTPTSVFVSHITTTDSNGNPSTIATTLAL
                     PSSGNNSGNNSGNNSGNNSGNNNGNSAGNNAGESDHTTVITSNGTPTSVFVSHITTTD
                     GNGSPTTIRTLIPSSSEFLSQNIISNTPINSQANISSPTNKSSRTTLQGTHTVPTVSP
                     SSVSSATFTGAGEKLNVSKLYAAVVLSGIVLCIIV"
     gene            complement(<501919..>504069)
                     /locus_tag="CAGL0J05214g"
                     /db_xref="GeneID:2889504"
     mRNA            complement(<501919..>504069)
                     /locus_tag="CAGL0J05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447931.1"
                     /db_xref="GeneID:2889504"
     CDS             complement(501919..504069)
                     /locus_tag="CAGL0J05214g"
                     /inference="similar to AA sequence:UniProtKB:P40368"
                     /note="similar to uniprot|P40368 Saccharomyces cerevisiae
                     YJL061w NUP82 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447931.1"
                     /db_xref="GeneID:2889504"
                     /db_xref="GOA:Q6FPB3"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB3"
                     /translation="MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCH
                     STSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHL
                     CHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSK
                     NSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLF
                     AKSLLLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQ
                     GPFSMTPYPNELYDFMATDINIIQITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISR
                     FPGSNSLALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQII
                     DDSDIKLLANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIEELDMLDGI
                     SSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFT
                     KIPLEIRSAPLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQ
                     IETTYQINKFWDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNS
                     NISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKE
                     WNDLQQLLRTDLKIISEFEKKCDTAVNGINQLKI"
     gene            complement(<504544..>507072)
                     /locus_tag="CAGL0J05236g"
                     /db_xref="GeneID:2889505"
     mRNA            complement(<504544..>507072)
                     /locus_tag="CAGL0J05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447932.1"
                     /db_xref="GeneID:2889505"
     CDS             complement(504544..507072)
                     /locus_tag="CAGL0J05236g"
                     /inference="similar to AA sequence:UniProtKB:P40367"
                     /note="similar to uniprot|P40367 Saccharomyces cerevisiae
                     YJL062w LAS21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447932.1"
                     /db_xref="GeneID:2889505"
                     /db_xref="GOA:Q6FPB2"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /translation="MLFLLVVAHAIAVLIFGCGFFPQKKVLDGHAALDGTHARDPVFD
                     KLVVVVVDAMRSDFLFDASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTG
                     STPNFLDAILNVAEDDTSSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANE
                     DSQTMFDEYEGTNSFFVSDFTQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKD
                     GPYSRFMGPKHEEMDSIIRKLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGM
                     VFLSDKLAAYKPSKEQSSAKEFPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNV
                     AIPKNNVGVIIPEFLQLFKDVSLQKAIVKENWNQLSGLTKGKTQIMEETKNFVIEDVI
                     KNMKDVQENLAKTATDYNYPLLFIGCFLSIVITGTIYYRYARHVAININTSILIAIAA
                     LMGISVFGSSFIEEEHQFWWWIITGLVLLSMVNLNFSSWKSHIIVLFCLRLIRGWNNS
                     GQKYTYDNVIANLLKGNIDALWWLNLITVTVVGLNLKSLRFGNHTVSLLGFSDLLSMG
                     LLSMITFLYKVNWSIVNGERVPDLFYKWVLETASLIVEDATLYREEDLIHTALIPLAR
                     IFFKLFFAVLVSRLMIQKFFQVSDISKSLAVVSRYVTIFLVFQTPSHNIGLFLFFEII
                     NEITVHIIRERYQSDYLLAVIFGIILQFFTFFQSGGTNSIATVDLSNAYNGVSENYNI
                     YVVGLMMCISNFAPTIYWSFYNWRITYANANSSRWQTLVAAKYPFIIIQSTIGCCLLL
                     ACIILRYHLFIWSVFSPKLCYYMVWTIFVGIIVHWIPEILLLLT"
     gene            <507849..>508583
                     /locus_tag="CAGL0J05258g"
                     /db_xref="GeneID:2889506"
     mRNA            <507849..>508583
                     /locus_tag="CAGL0J05258g"
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /transcript_id="XM_447933.1"
                     /db_xref="GeneID:2889506"
     CDS             507849..508583
                     /locus_tag="CAGL0J05258g"
                     /inference="similar to AA sequence:UniProtKB:P22353"
                     /note="similar to uniprot|P22353 Saccharomyces cerevisiae
                     YJL063c MRPL8"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL8"
                     /protein_id="XP_447933.1"
                     /db_xref="GeneID:2889506"
                     /db_xref="GOA:Q6FPB1"
                     /db_xref="InterPro:IPR000456"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB1"
                     /translation="MTAGIARRLSRDKPHREMMLRNLVTSLLEHGSVVSTHEKCMEAS
                     RLADRVIHWSKSAGHSSKYVSLIQSKLFLSGNNSGLLRKLCGEIAPRYVERPGGYTRV
                     MKLEPRLGDRARQSVLELVDTPVVTAGDVAHPQPSIQRGNMKLWLLARATLTDESLAR
                     AHNPQTLLNLKKMLKFRDAGDVARDLLVVRSLLREDMGLEPVDKEQDHAAVTTLIQAA
                     QAATPVSKKKVRNDYKFETARPNGPQ"
     gene            <508860..>509747
                     /locus_tag="CAGL0J05280g"
                     /db_xref="GeneID:2889507"
     mRNA            <508860..>509747
                     /locus_tag="CAGL0J05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447934.1"
                     /db_xref="GeneID:2889507"
     CDS             508860..509747
                     /locus_tag="CAGL0J05280g"
                     /note="some similarities with uniprot|P40366 Saccharomyces
                     cerevisiae YJL065c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447934.1"
                     /db_xref="GeneID:2889507"
                     /db_xref="GOA:Q6FPB0"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FPB0"
                     /translation="MEQPADKPVEMETRNEGAEAVEPAVEAVEAVEVEAAEAAEAAEQ
                     KDAEAMNETVDGDTDQGDESRSNAQVIEIEDSDSSPEGDTEMDIDEDQEMKHDDRDET
                     RPTTQSSAKEESRSSSRVVKSEMDESIAQSRREMEELESELGEEARKEKQRVVDELKK
                     QYKLINREYIRRCSRFPISKMRMIAKNDPEYLECTKDALIATAFATELFVQTLTYETL
                     IVNGSVPYGDGNFQQEPKPEPSTPINSDELLLDYKSLSESIALVDHFQFLADIVPRTK
                     NLRELVKENKVRYTATQKN"
     gene            <510020..>510943
                     /locus_tag="CAGL0J05302g"
                     /db_xref="GeneID:2889508"
     mRNA            <510020..>510943
                     /locus_tag="CAGL0J05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447935.1"
                     /db_xref="GeneID:2889508"
     CDS             510020..510943
                     /locus_tag="CAGL0J05302g"
                     /note="weakly similar to uniprot|P40364 Saccharomyces
                     cerevisiae YJL066c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447935.1"
                     /db_xref="GeneID:2889508"
                     /db_xref="GOA:Q6FPA9"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA9"
                     /translation="MGLFNGDDEKLKELCDSGVKDELNRESLFDDGLIPHGLKDSALE
                     LYDKAGLKDIFESGYGSLWDTLKEIGNYNTNLGSLVSRPQGNDVIQQGITGLYHYGTP
                     NMSQYKECADVDGLSVWDTQGWWRCLFPQGVIRDKLKVDDLSSKEQDSVMSKILTKEA
                     VVNDKDNKYGVFFPEWSLYMKWRVHMNHLIQQRKEEEITKRKNNDLKDWAYGFYDSDD
                     KTPEDIMMKKSLQDFDHKDGPEIIGKSEYVTIQSTNDGKEEVKQLKTFYNNGTTSIES
                     IKKVYPKDGGKPRIERTVRTVPSSRDKGNGF"
     gene            <511210..>512100
                     /locus_tag="CAGL0J05324g"
                     /db_xref="GeneID:2889509"
     mRNA            <511210..>512100
                     /locus_tag="CAGL0J05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447936.1"
                     /db_xref="GeneID:2889509"
     CDS             511210..512100
                     /locus_tag="CAGL0J05324g"
                     /note="highly similar to uniprot|P40363 Saccharomyces
                     cerevisiae YJL068c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447936.1"
                     /db_xref="GeneID:2889509"
                     /db_xref="GOA:Q6FPA8"
                     /db_xref="InterPro:IPR000801"
                     /db_xref="InterPro:IPR014186"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA8"
                     /translation="MKQVKSIAVCGGKLLQLKHASEVLHCEMDVNVYLPKQYNTNSQG
                     KKIPTIYYLSGLTCTPQNASEKAFWQAQADKYGFAMVYPDTSPRGDDVAGDPEGSWDF
                     GKGAGFYINATKEPFQKHYHMFDYVHKELPSELAKFFEEQGQSKIDFLDNVSITGHSM
                     GGFGALSGYLLHYSDNKYKSCSAFAPIVNPSVVPWGQKAFKGYFNDPKEGEHYDPCNL
                     VKQVKNTNNSSILIHVGTNDPFLKEQLQPHLLKEAATGTTWENKIDINLVDGFDHSYY
                     FISTFVPEHAAFHAKHLGLA"
     gene            complement(<513918..>515351)
                     /locus_tag="CAGL0J05346g"
                     /db_xref="GeneID:2889510"
     mRNA            complement(<513918..>515351)
                     /locus_tag="CAGL0J05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447937.1"
                     /db_xref="GeneID:2889510"
     CDS             complement(513918..515351)
                     /locus_tag="CAGL0J05346g"
                     /inference="similar to AA sequence:UniProtKB:P21827"
                     /note="similar to uniprot|P21827 Saccharomyces cerevisiae
                     YGL097w SRM1 GDP/GTP exchange factor for GSP1P/GSP2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447937.1"
                     /db_xref="GeneID:2889510"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA7"
                     /translation="MVKRSASDEAPTAKRVSTKKVLNQLDDYTHRYISVRPLDVFVWG
                     TGSMCELGLGPLAKNKEVKRPRLNPFLPQDKVGIVSIAVGGMHTLALDKDNNIWSWGC
                     NDYGALGRDTSGAKEKLKDANDSSDDEDGDLNELESTPTKLPFKFEGTSEKDAKIVQL
                     VATDNLSSVLLSDGTIYAWGTFRCNEGILGFYQDEIEVQREPWVVPKFAKGKIVQMAG
                     GKDHILFLDEAGIVYAWGNGQQYQLGRKILDRFRLKTLYPLPFGLKKVKYIASGENHC
                     FALTETGKVVSWGLNQFGQCGIGESIEDGGIVAVPSQVMNLPLDNDSIRTISAGEHHS
                     LFLMESGALYTCGRIDMNEIGLLKKELPTYAYKDEHERVRAVPLPTKVVKTLEELDPE
                     DDEDDREYKEMKFKNIAAGSHHSIAISQDGKLYTWGFGETYAVGQGPAGDDIEVPVKI
                     TNTATKEVDMVLAGSGGQFSVSAGYKQ"
     gene            complement(<515847..>516515)
                     /locus_tag="CAGL0J05368g"
                     /db_xref="GeneID:2889477"
     mRNA            complement(<515847..>516515)
                     /locus_tag="CAGL0J05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447938.1"
                     /db_xref="GeneID:2889477"
     CDS             complement(515847..516515)
                     /locus_tag="CAGL0J05368g"
                     /inference="similar to AA sequence:UniProtKB:P53146"
                     /note="similar to uniprot|P53146 Saccharomyces cerevisiae
                     YGL098w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447938.1"
                     /db_xref="GeneID:2889477"
                     /db_xref="GOA:Q6FPA6"
                     /db_xref="InterPro:IPR019150"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA6"
                     /translation="MSSTLIDFLVTSKEACNNKCRREAAIRDGTVEQYEQQYSKTSFE
                     YDSKCYSLLKDMEKEYNKYESSIKHRRYSEDFDGTHGDEDDSKELKINTEDESVAELR
                     KRLLGRLSDKAEQDAGQSVETQIQNHEDMQQNLYEDMSKLVGSLKQGAVAFQNALEED
                     QKVLGAAEIGIQVASRGIVDISGKLKTYDKAKLGYLFYILTFLFMFIGLCVTFIIIKI
                     FPAM"
     gene            complement(<516870..>517202)
                     /locus_tag="CAGL0J05390g"
                     /db_xref="GeneID:2889478"
     mRNA            complement(<516870..>517202)
                     /locus_tag="CAGL0J05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447939.1"
                     /db_xref="GeneID:2889478"
     CDS             complement(516870..517202)
                     /locus_tag="CAGL0J05390g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447939.1"
                     /db_xref="GeneID:2889478"
                     /db_xref="GOA:Q6FPA5"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA5"
                     /translation="MKNYIKSRINCSLFYNHLLLCVFGDFVLNIEISMGSYTHFEVLN
                     PMLSVTPSVQVIYFQKFRFLLVFLFLFEVMRMLGTASVLLVERLLENLPMDLMDGGAL
                     NPHAPYMK"
     gene            complement(<517428..>519347)
                     /locus_tag="CAGL0J05412g"
                     /db_xref="GeneID:2889479"
     mRNA            complement(<517428..>519347)
                     /locus_tag="CAGL0J05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447940.1"
                     /db_xref="GeneID:2889479"
     CDS             complement(517428..519347)
                     /locus_tag="CAGL0J05412g"
                     /note="highly similar to uniprot|P53145 Saccharomyces
                     cerevisiae YGL099w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447940.1"
                     /db_xref="GeneID:2889479"
                     /db_xref="GOA:Q6FPA4"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA4"
                     /translation="MPPKTEPKKWKPPKGPKPIQRKNKNPIGLGRAIMHQRSKENTIE
                     YLPDGEMRFTTDKHEANWVKLRSVTQESALDEFLNTAALADKDFTADRHSNVKIIRID
                     NGDGSATSQGFSLTNEQKSTIDAKQRALANDLIVPRRPYWDESMTKYQLERQENDAFL
                     EWRRKLAHLQENNEDLLLTPFERNIEVWKQLWRVVERSDLVVQIVDARDPLLFRSVDL
                     ERYVTEVDDRKQNLLLINKADLLTRNQRITWAKYFAKKNNSYAFYSALRANQLLEKQK
                     ELGDDYSEEHIEEESDDSEETLEESVREGIKILTIDQLEELFLSRAPSEPLTEPLPGQ
                     ESLLQIGLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTIKLSDHVMLCDCPGL
                     VFANFAYNKGELVCNGVLPIDQLRDYVGPCALVAERIPKYYLEAVYGIHIQTRSREES
                     GDIEPENPTAQELLVAYARARGYMTQGFGSADESRASRYILKDYVNGKLLYVNPPPHL
                     EDDTPYTREECKEFNKELYVFDKLPETRQEQLREAAKAKGIEVLDLARDLSKLTFSAH
                     TAAEANKKASSVTHGGKQAALYNAADDLDREFFNMNKVEGKLTTPFHKQQSQSGSKKH
                     NKKNKKGKVRNLNFE"
     gene            <520083..>520682
                     /locus_tag="CAGL0J05434g"
                     /db_xref="GeneID:2889480"
     mRNA            <520083..>520682
                     /locus_tag="CAGL0J05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447941.1"
                     /db_xref="GeneID:2889480"
     CDS             520083..520682
                     /locus_tag="CAGL0J05434g"
                     /note="highly similar to uniprot|P17536 Saccharomyces
                     cerevisiae YNL079c TPM1 tropomyosin or uniprot|P40414
                     Saccharomyces cerevisiae YIL138c TPM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447941.1"
                     /db_xref="GeneID:2889480"
                     /db_xref="GOA:Q6FPA3"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA3"
                     /translation="MDKVREKLNNLKLEAESWQEKYEELKEKNKELEQEKTDLENQAK
                     ALTVKNQSLEEEVEKLESGADQSRGLEQEKTDLENQVKALTVKNQTLEEEVEKLESEL
                     SELKQTSEESTTLRSNNENFTKKNQQLEEELEESDAKLKETTEKLRESDLKVDQLERR
                     VTALEEERDEAEKKNEELTAKYEEAKKELDEIAASLENL"
     gene            <521362..>522477
                     /locus_tag="CAGL0J05456g"
                     /db_xref="GeneID:2889481"
     mRNA            <521362..>522477
                     /locus_tag="CAGL0J05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447942.1"
                     /db_xref="GeneID:2889481"
     CDS             521362..522477
                     /locus_tag="CAGL0J05456g"
                     /inference="similar to AA sequence:UniProtKB:P53938"
                     /note="similar to uniprot|P53938 Saccharomyces cerevisiae
                     YNL080c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447942.1"
                     /db_xref="GeneID:2889481"
                     /db_xref="GOA:Q6FPA2"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA2"
                     /translation="MATEAGTGQMTKESLRDAYRSIKKMSLNHLSAKQHLLMALCRDV
                     SMLPPVYYTFMSLKKAWQISIQTTIKLYEPQSLRESLIAFWQTYMVANISDSVQFSNL
                     RTMENVTQHNVNNTSAENWESVLFTALTKARASEHLFCALWCLVSLYLTYAILDSLMV
                     RWIVKYSTLAAILRMFSMSMIIITFELMLLASLSPEKNYFLHTWITISCILTAVYIWQ
                     SYLTSDLNYVRNKKLDINDIDVDDEIEGINGQFSYSTTIEATPDNNSEYEVISNEDSP
                     SQINQRRLNTIGSQQSRSSTPTSATSQRRSQKRNTVKSIDFTTKRYIDLYNITVFCVV
                     PVGIASFITMVGLLRNLFIQRLDVEQLGRMLHESYNP"
     gene            <523169..>523549
                     /locus_tag="CAGL0J05478g"
                     /db_xref="GeneID:2889482"
     mRNA            <523169..>523549
                     /locus_tag="CAGL0J05478g"
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /transcript_id="XM_447943.1"
                     /db_xref="GeneID:2889482"
     CDS             523169..523549
                     /locus_tag="CAGL0J05478g"
                     /note="highly similar to uniprot|P53937 Saccharomyces
                     cerevisiae YNL081c"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     SWS2"
                     /protein_id="XP_447943.1"
                     /db_xref="GeneID:2889482"
                     /db_xref="GOA:Q6FPA1"
                     /db_xref="InterPro:IPR001892"
                     /db_xref="InterPro:IPR010979"
                     /db_xref="InterPro:IPR018269"
                     /db_xref="InterPro:IPR027437"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA1"
                     /translation="MVVHILGKAFKGKEVIRIALASKFYGVGKSTAERLCSKLGFYPW
                     MRMHQLSEPQILNITSELSNMTIEGDARAIVRENIALKKKIGSYEGMRHALGLPVRGQ
                     RTRNNAKTARKINRIGVRAFHTAQ"
     gene            complement(<523770..>526493)
                     /locus_tag="CAGL0J05500g"
                     /db_xref="GeneID:2889483"
     mRNA            complement(<523770..>526493)
                     /locus_tag="CAGL0J05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447944.1"
                     /db_xref="GeneID:2889483"
     CDS             complement(523770..526493)
                     /locus_tag="CAGL0J05500g"
                     /inference="similar to AA sequence:UniProtKB:P14242"
                     /note="similar to uniprot|P14242 Saccharomyces cerevisiae
                     YNL082w PMS1 DNA mismatch repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447944.1"
                     /db_xref="GeneID:2889483"
                     /db_xref="GOA:Q6FPA0"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:Q6FPA0"
                     /translation="MPISQISEQDVHRITSGQVIIDLASAVKELVENSLDAQATQIDI
                     TFRKYGIDGLEVSDNGTGISKDDYESLALKHHTSKIKNFDDVLTNINTLGFRGEALSS
                     LCGIARMAVITTTQPPRADRLEYDMAGHLSSKSTTTRNKGTTVIISDLFHNLPVRQKD
                     FERTAKRHFTKCITLLQSYAIINESVRITVTNITSTGKKNNILSTAANQNLNKRIISI
                     FGSTSLRGLSPISLTLDMNPFKKNIKSRYVDDPDFDNMDYKVKVTGLFSQNSFGCGRT
                     SKDRQFIFMNKRPIDYPAVVKCCNEVYRTYNNVQYPMFILNFELTPDLIDVNITPDKR
                     TVVLHNEQSVIDVLYENLSDYFDTQDMALPKEEPQDHISKRRRLLDHPSDSADDGSSS
                     QLEISSTNESSFVTPIEMDITELVETNSFEYDGKESLPASEPDFRNDIEDDNMQCNSS
                     PSKEPHSPDDNYNEIHKEQELSEVYAPQRNLRRPKVVNIEEFANPIHEPESYIAKNGS
                     PKKSQESLILQIDDKVYKQTVTVNNNSDIVSIENITPSKEYDSQHSTARENDSKTESQ
                     ETDSCESCKDDSNIPGLRSNDELLEYDDDKDEDLASFHPTDYNIRSPIKSVTSRTSKR
                     DTFRSMTDNVLSKNNIQLLSQHLVVHNIDDIVNISNLKEIITNNTYMNERQGTSKIIR
                     NSALNDLDKGAQYLSLSVKKSDFKDMKVVGQFNLGFILVTRNMGSNYDLFIVDQHASD
                     EKFNFENLQQTTRFKSQKLISPETIELSVIDELIVMDNLSVFERNGFKIEIDEDAMAG
                     HKVKLISIPVSKRTIFGVADFQELVYLIKEDGGTNKSNIKCSKIRAMFAMRACRSSIM
                     VGKPLNMRTMTRVVQNLSTLDKPWNCPHGRPTMRHLMELQNWKSFSEDYKL"
     gene            complement(<527054..>528613)
                     /locus_tag="CAGL0J05522g"
                     /db_xref="GeneID:2889484"
     mRNA            complement(<527054..>528613)
                     /locus_tag="CAGL0J05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447945.1"
                     /db_xref="GeneID:2889484"
     CDS             complement(527054..528613)
                     /locus_tag="CAGL0J05522g"
                     /note="highly similar to uniprot|P48233 Saccharomyces
                     cerevisiae YNL083w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447945.1"
                     /db_xref="GeneID:2889484"
                     /db_xref="GOA:Q6FP99"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FP99"
                     /translation="MAGSNADDSRYERLFKDLDVDGNGRIDLRALKRAFKEKDHPLSK
                     SDDALHLLFNAMDSNHDSVIDIEDFKKYARKAEEQIELGFQRIDADNDGKIKTSELTE
                     YLHSLSTSADNGVRPEDKQVMKPRFNSFIKWAFLRRKAKSSSDPEYITYDQWRDFLLM
                     MPREQGSRLHTAYSYFYLFNEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCT
                     APFDRLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKS
                     FYVGNGLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCA
                     QFSVYPIDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFP
                     YAALDLGTFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINL
                     LRTRLQAQGTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCY
                     ENLKKLMKLQS"
     gene            <528997..>530043
                     /locus_tag="CAGL0J05544g"
                     /db_xref="GeneID:2889796"
     mRNA            <528997..>530043
                     /locus_tag="CAGL0J05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447946.1"
                     /db_xref="GeneID:2889796"
     CDS             528997..530043
                     /locus_tag="CAGL0J05544g"
                     /inference="similar to AA sequence:UniProtKB:P39013"
                     /note="similar to uniprot|P39013 Saccharomyces cerevisiae
                     YNL084c END3 required for endocytosis and cytoskeletal
                     organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447946.1"
                     /db_xref="GeneID:2889796"
                     /db_xref="GOA:Q6FP98"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /translation="MPKLEQFEIKKYWQIFSGLKPVENKVSHDQVLPILYNSKLDSSI
                     LNKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIDSVPDELPEWLVPGSKAKLIKE
                     RQKAKQQENAEIPRQEVPDVDWYISPEDKTYYEKILSTCGPMADGTVTFAELSLALKS
                     KFFNIGVSDMERTWKLINPRDLPSIDRDPAMYFIHCLRQRNDIGTSIPSELPPALAEV
                     CNKQRVEYDLSSKQADLKRLDTKEPTKNDVTKLGDELDRLEHSLENLTTGSTSSTLQG
                     TIKMSKESLNQFKGLLAFMENDLNHPNPDSNANVKYVTDDLDNIDQQVQMLETYLQQK
                     RQELGSLKAEVGST"
     gene            complement(<530428..>532869)
                     /locus_tag="CAGL0J05566g"
                     /db_xref="GeneID:2889797"
     mRNA            complement(<530428..>532869)
                     /locus_tag="CAGL0J05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447947.1"
                     /db_xref="GeneID:2889797"
     CDS             complement(530428..532869)
                     /locus_tag="CAGL0J05566g"
                     /note="highly similar to uniprot|P40850 Saccharomyces
                     cerevisiae YNL085w MKT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447947.1"
                     /db_xref="GeneID:2889797"
                     /db_xref="GOA:Q6FP97"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR022039"
                     /db_xref="InterPro:IPR022040"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FP97"
                     /translation="MPIKSLESYLFERSLVGSYSIESLANCTLGIDVNHYVSRLLTSK
                     REQYLDAIGGFPTSLKLYLESDLKVYNEYNITPIFIFNGSLTHDQLENEGYFSAASKE
                     SAKAASNGATTSGPNAATNPTMRSNKETVLAQRHRAWTQWNNLVTSNQESYIDQPIQP
                     QEPFRYTTTIDPKAYQADLISYFIEHDIMYQVAPYTSWIQLAYLFENEFIDAIYGPTD
                     CLMLPKVDKFILGMEFPNKEFRFIEKSRVLKEFGITHEELVDISMAVGNDLQPVTLPP
                     LQIYPVPQLFDIALEMVLNAGTNFYTYELTNPIKSEKDQYLIKYQKGYAALKFMPVLK
                     ANGRVELLSENENSDEAQKENSATHTSPGESDNEKKKSIPSASFDDPDAIPADVHDFI
                     AQRLPHEYYFYRSIGLVTGKLFDAITTGVYPEEPPLDGGSSNSYRKLVEKSVDAFKNQ
                     EVNLLTQPINRYYQIKQIKHVKWFAPEESVQLTNRMTPSAFEKINRIIVKTDSEAPFS
                     LLSFLQLLSTSDNLGDKFISNEVIFPASVNHEKKLHSAFDLLATCFLRTLVVLGFFDC
                     NISKKELTPTKWGEVLMKLPELQVSKDYIEPIFILMVFLKLDVLELGKDTVPSTTSAL
                     SEATLRSYPDASQHILIIARILTLFQIKQKPSNYHGPIDKKTLVFRDHLAFVKENLNE
                     LFEAITVSSLTSGEFDRLNLDNFNWKKSVVRSMPFKLDTPNTIMAMMWEFFLQKYLHN
                     GNAKADALSLVATDFSTYKSTPDLDEKFQESLEFLQQVKAVAKELANNNLIKASDASL
                     LSAATDFAISAYSSS"
     gene            complement(<533614..>533919)
                     /locus_tag="CAGL0J05588g"
                     /db_xref="GeneID:2889798"
     mRNA            complement(<533614..>533919)
                     /locus_tag="CAGL0J05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447948.1"
                     /db_xref="GeneID:2889798"
     CDS             complement(533614..533919)
                     /locus_tag="CAGL0J05588g"
                     /inference="similar to AA sequence:UniProtKB:P48232"
                     /note="similar to uniprot|P48232 Saccharomyces cerevisiae
                     YNL086w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447948.1"
                     /db_xref="GeneID:2889798"
                     /db_xref="GOA:Q6FP96"
                     /db_xref="InterPro:IPR020515"
                     /translation="MSDNSEVQGIHPVELSVYSLVSSDLDNLYQAINELRESQALLIL
                     KLRTVRDSLRLENELLFDSNEYKAQFKEVNNLQKRLQKITLRLKDLERRSSQLTTSS"
     gene            complement(<534283..>538503)
                     /locus_tag="CAGL0J05610g"
                     /db_xref="GeneID:2889445"
     mRNA            complement(<534283..>538503)
                     /locus_tag="CAGL0J05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447949.1"
                     /db_xref="GeneID:2889445"
     CDS             complement(534283..538503)
                     /locus_tag="CAGL0J05610g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447949.1"
                     /db_xref="GeneID:2889445"
                     /db_xref="GOA:O93794"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /translation="MSEPKTASERYQKISQLEHILKRPDTYIGSVEIQEQEQWIYDEE
                     TDCMIDKTVNIVPGLFKIFDEILVNAADNKVRDPSMKRIDVTINPEENFIEVRNDGKG
                     IPIEIHEKEKIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTLETA
                     DPKNGRKYVQTWENNMNVCHPPKITSYKKGPSYTKVAFKPDLSRFGMESLDSDILGVM
                     RRRVYDINGSVRDVNVYLNGKPLKIRNFKNYVELYLKSLEKMRKMDNGESDTTPSNIP
                     TILYERVSDRWEIAFAVSDISFKQVSFVNSIATTTGGTHVNYIADQIVRKVSDILKKK
                     KKNIKPYQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCDISSDYINKIMKT
                     DLATKIFEIADENANNALKKSDGSRKSRITDYPKLEDANKAGTKDGYKCTLILTEGDS
                     ALSLAVAGLAVVGRDYYGCYPLRGKMLNVREATADQILKNAEIQAIKKIMGLQHRKKY
                     EDTKSLRYGHLMIMTDQDHDGSHIKGLIINFIETSFPGLLDIPGFLIEFITPIVKVTI
                     TKPIKKVISFFNLPDYEKWREEESHKYSWKQKYYKGLGTSTSPEIIEYFSNLDTHLKK
                     FHALQGDDKDLIDLAFSKKKADDRKEWLRQYEPGTVLDPTLNEIPISDFINKELILFS
                     LADNVRSIPSVLDGFKPGQRKVLYTCFKKNLTTEKKVANLAPAVSDYTAYHHGEQALV
                     QTIIGMAQNFVGTNNIYFLKPNGAFGTRATGGKDAAAARYIYTELNKIARKVFHPADD
                     PLFRYVQEDEKTVEPEWYLPVVPMVLINGAEGIGTGWSTSIPPFNPLDVVNNIRHLLN
                     DEEMDDMHPWFRGWTGTMEKIESQRYRMYGRIEQVGPNTLEITELPARTWTSTIKEHL
                     LLGLGGSEKVKPWIKDMEEQHAETIKFIIKLTDEEMTKTRKLGFYERFKLISPISLQN
                     MVAFDYRGKIKKYDHVHEILKDFYEVRLEYYQKRKDYMTGRLQWEAEKLSFQVKFIKM
                     IIDKSLIVTNKPKKQLISELEELGFPRINKEGKPHFGKIDEEVEAIISEDEDEDLEES
                     EEATRKKDKDDESTVNGPEELFGTYEYLLGLKIWSLTKERYEKLLKQKQEKETELENL
                     LKLSAKDLWNNDLDDFLTAYEDFQKMDLFLRNSAVPKTKGGKRKRKGGDDDDYDPSGK
                     KKPARRIKKIKKEDDFDRILIKPQAKIKAKRPVKVKVEPPSSAASTPSVKEELGVSDV
                     TSNASTPSTTIFDQKVKQENSDESGISAFSSKFNKIASAFDEDAPLDQITSEDTSVKE
                     SSAPAAKKKAPPKRKAKVVESSEDELSDANLSEQDDEEVVPVRRQRSSRQTAKKSYAE
                     PIEISDEEDFIDDDEDEEVDSDESFNDE"
     gene            complement(<539466..>540032)
                     /locus_tag="CAGL0J05632g"
                     /db_xref="GeneID:2889799"
     mRNA            complement(<539466..>540032)
                     /locus_tag="CAGL0J05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447950.1"
                     /db_xref="GeneID:2889799"
     CDS             complement(539466..540032)
                     /locus_tag="CAGL0J05632g"
                     /note="highly similar to uniprot|P06781 Saccharomyces
                     cerevisiae YNL090w RHO2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447950.1"
                     /db_xref="GeneID:2889799"
                     /db_xref="GOA:Q6FP94"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FP94"
                     /translation="MSEKAIRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENY
                     VTDCRVDGIKVSLALWDTAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWA
                     EEAFRYCPDAPVILVGLKEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGE
                     GVDDVFELATRSSLLMHKEPDHFCCSIS"
     gene            <540710..>545416
                     /locus_tag="CAGL0J05654g"
                     /db_xref="GeneID:2889800"
     mRNA            <540710..>545416
                     /locus_tag="CAGL0J05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447951.1"
                     /db_xref="GeneID:2889800"
     CDS             540710..545416
                     /locus_tag="CAGL0J05654g"
                     /inference="similar to AA sequence:UniProtKB:P53552"
                     /note="similar to uniprot|P53552 Saccharomyces cerevisiae
                     YNL139c RLR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447951.1"
                     /db_xref="GeneID:2889800"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="UniProtKB/TrEMBL:Q6FP93"
                     /translation="MTNVLGRLKRLSGQVNDNYFTTRTILTDEFASSWNSKREELIDN
                     YKKLDNDSERKEWLRSFFMDVIRLLKLSEDNNSLQIDTLSELIKLVYNATPSFKQTIG
                     EVFAAVVNTYCPKSVIDKVLRLITLTPILRTEVYKYSWLSTKLMTNDQKILTKHLLKK
                     NRYEIKKYNLIYENPIGFTQITSLLNVLVLDPYAHQKIPYFVSQLYQIMGKYSLDPLR
                     TLDVMITFFAEHVTLHYKLILDFLKCTNYWPRDTQLANPDNIMSLNHGGNKTAAKLIT
                     VRLNSFFQSAVEGKSISSFEDNYLNLSCLLIKEGFVNFSNIWSNLSPLSEEFKSTLDD
                     YMKKLELESTKGLDNPLAMASALTNEDDEADNKELDNKDSDTTMTGTEEEDKELEEAQ
                     KRNFEAAVLNHGKLKLLIKLLAHGTYAPTLWAISEFPEISHLDTDIPILFSKLFEIQI
                     ENLYESMSFRWRNTPAIISGLKKLENGLLSSKPRLYETIYSDDTNECVELNTKRKFYY
                     QDWSSGLPRIADINELVDVCHQYFKYFDVSLGCNSSLIIKLCRIVSAKLRGTEVDGTD
                     QSQTLELAINYTRKFLLPIVGVMSENSTLGSEIFNLLKEFPLEKRYFMYNEMLTKTSQ
                     DNLLVKIGFNKAEREAKSILKSLSTDNIETGSRKFARLLSSNPLATLLPTIKQIENYD
                     KVSELIIFTTKFLNQFGYDVLQYILLLRLTYSRPIMQDDGINQSMWVQRLAVFIAGLV
                     KSCPQMDISELITYIIKQLHVGSSIAITIMKELISTVAGIRDLNHVSRERLILINSSR
                     PLQKYGHKLIFDVRNENKSLGMKLMTLFQNQDAVSEIIVLLYNLNLNINQQDLHYKIL
                     SSKCDEMNTLLWSYIELVKYSNTHDNFPKYVYPFERLINEFHISTPWAFHIWRDYFKE
                     EDEISGDLSNFSSYEKIDFPELSASNFDRSFFLTFWRLSLLHVQFDKNLYNTRKKEIE
                     SEIVPGLTNRQKNQKVGEKKEIMSSCITHEHIFIKTKKYLCENSSSWGNSLDLDNQHI
                     FIKFCIVPRILFSPSDALFTSRFLIETFGNELLFSLMDTFIKSRMMHALIFCSTISEA
                     ANLGIFFADLFEYLEKARISGKLTDDLTATLYNWHDVLVEESIILLKERNYMSIRNGI
                     EFLRNVSDIFPVVDIHIKLCCQALRDILEAETREDIKLPTNALLGHLNSKLKSSIRKS
                     EYCQLTEDEKLLEEKYNEELNEIKDYETSLENEKKQAELRAKIEENKQKRLEAEKQKA
                     ELQKQQQVESSRETRVSEAKLKQKGQSHTWRLTKLFRVMDDVCYFISRNELNRAINLV
                     EDDSEVWNIKHAIKNKGSLGSFRNNIFEIFGRYFKSLILYPQNSDFQVRMDELKAATK
                     YLDRKSNDVEPEKSSRYGGSVKVPPGASAKSEDLRGRSTTPSGPASDKNKQSSNQFRQ
                     APGRNTYNNDRQHSGHSYKTGKDDKEKTPQQRSQLQFPDRPTQGRNDHQIAGQKRGYQ
                     SQQKDSHDDHASKRFRKEDSSRMSYTDRNNRSFNQNLASRFGGPTNKNSNASSDHKPT
                     ALPQGPKGSSGSRYQR"
     gene            <545919..>547193
                     /locus_tag="CAGL0J05676g"
                     /db_xref="GeneID:2889801"
     mRNA            <545919..>547193
                     /locus_tag="CAGL0J05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447952.1"
                     /db_xref="GeneID:2889801"
     CDS             545919..547193
                     /locus_tag="CAGL0J05676g"
                     /inference="similar to AA sequence:UniProtKB:P53901"
                     /note="similar to uniprot|P53901 Saccharomyces cerevisiae
                     YNL152w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447952.1"
                     /db_xref="GeneID:2889801"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q6FP92"
                     /translation="MSEEVWDGNQGTLSVYVSKAKDLPNLDKLDKQDVLLRLRIAHMT
                     RESDTIIRAGQTPIFKYYEKFEITPELRPLMYVEIYSDRRKKAPILIGRCEVDLLNGI
                     RADPKEGYCTWYELKKPNNDFAGTVFIELTFKPTYPTFRRDGESYNSRNQDKSMAARP
                     IPPLPDDMSQFENEPESFRPNHYNSHFSSSSSSRTQSRFGGSESDYLHASAVRQVTPA
                     IVDDNHHRVAQRFATSDNYGNENGPANFMSSVGTSSTVTTQDSSTTTITNNSDTKFHF
                     ANLRKLKEKINIFKNPNNSEEPETKNSNVDIEALQKAIGINNDAQSDDVSSTESFHER
                     YQASRDISKSSSRGHNDALFKYSGGQNNEPPLPPLPKSPSRSPTRDRSPHRTPHSHHY
                     HQHQEMVSPKLPPLPTSRNNSTSPTRRRPPPI"
     gene            complement(<547495..>548199)
                     /locus_tag="CAGL0J05698g"
                     /db_xref="GeneID:2889802"
     mRNA            complement(<547495..>548199)
                     /locus_tag="CAGL0J05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447953.1"
                     /db_xref="GeneID:2889802"
     CDS             complement(547495..548199)
                     /locus_tag="CAGL0J05698g"
                     /inference="similar to AA sequence:UniProtKB:P17890"
                     /note="similar to uniprot|P17890 Saccharomyces cerevisiae
                     YNL151c RPC31 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447953.1"
                     /db_xref="GeneID:2889802"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:Q6FP91"
                     /translation="MSGRRGAGSGGGARSLPFGLGYQDIGPNNIAEFPSLSLPVNGNV
                     SSRDRSIALKYINFNAALRESPFFTGTLEAAEEGDNKNKKKGKRELVNNEGPSDGIAR
                     YSDKYLKKRKLGVSIDEHPFHLELFPKDLYAVMGINKKKLMTLSKFNNEDDIFTGSEQ
                     DEALGLSMLEKYKELAEEVDEEDENKKEEDGTEEPVDDEFDDEDDDDDYNAEKYFSGG
                     DDDDIGEDDYGDEPAF"
     gene            complement(<548712..>549125)
                     /locus_tag="CAGL0J05720g"
                     /db_xref="GeneID:2889803"
     mRNA            complement(<548712..>549125)
                     /locus_tag="CAGL0J05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447954.1"
                     /db_xref="GeneID:2889803"
     CDS             complement(548712..549125)
                     /locus_tag="CAGL0J05720g"
                     /inference="similar to AA sequence:UniProtKB:P53903"
                     /note="similar to uniprot|P53903 Saccharomyces cerevisiae
                     YNL149c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447954.1"
                     /db_xref="GeneID:2889803"
                     /db_xref="GOA:Q6FP90"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="InterPro:IPR016809"
                     /db_xref="UniProtKB/TrEMBL:Q6FP90"
                     /translation="MERISKIFENSIDNILSIEPRKALRIVIIVGAYMLFRNLVTRDQ
                     NRRQLARQVRQEEERKKEEREKTLLERPEDFEVETIAKSSTTEYGWGKKTRQRVKRQQ
                     EVLERAVDDLKRHEQLKLSGTGYDSDEEIEELLED"
     gene            complement(<549568..>550329)
                     /locus_tag="CAGL0J05742g"
                     /db_xref="GeneID:2889804"
     mRNA            complement(<549568..>550329)
                     /locus_tag="CAGL0J05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447955.1"
                     /db_xref="GeneID:2889804"
     CDS             complement(549568..550329)
                     /locus_tag="CAGL0J05742g"
                     /note="weakly similar to uniprot|P53904 Saccharomyces
                     cerevisiae YNL148c ALF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447955.1"
                     /db_xref="GeneID:2889804"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FP89"
                     /translation="MTSDKKIPVTVRLFNGQEPTKMYSDSITVSELREQIYAFSGVDP
                     QDMKLYVAFNRTPMGRASSDERQWDLEVTKETNGDQRILEGHSSCYIIVQDTNKDSLI
                     YQLMKQDEQDEGPLFEYSQKDYENRDNTVLRWKQQEQLGRFDSEYNANMAKDLEQQEL
                     KASQLQLGERCTVKGVSERRGWLRYVGPVEGLTGLWCGVEFDKAEGKNNGVFKEHTYF
                     GPVSDNHGGFVRPQQVETGTQYAPFETSGSDSDEI"
     gene            <550672..>551192
                     /locus_tag="CAGL0J05764g"
                     /db_xref="GeneID:2889805"
     mRNA            join(<550672..550683,550851..>551192)
                     /locus_tag="CAGL0J05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447956.1"
                     /db_xref="GeneID:2889805"
     CDS             join(550672..550683,550851..551192)
                     /locus_tag="CAGL0J05764g"
                     /note="highly similar to uniprot|P53905 Saccharomyces
                     cerevisiae YNL147w LSM7 Sm-like"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447956.1"
                     /db_xref="GeneID:2889805"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:Q6FP88"
                     /translation="MSEQNTQQAEQNNNNRGQQKKKFEAPKREAIVDLGKYKDSKVSV
                     KLMGGRIVTGILKGYDQLMNLVLEETEETLKPEVETGATQQVTRQLGLTVIRGTILIS
                     LSPLDGSEVLYIQTN"
     gene            complement(<551562..>553406)
                     /locus_tag="CAGL0J05786g"
                     /db_xref="GeneID:2889806"
     mRNA            complement(<551562..>553406)
                     /locus_tag="CAGL0J05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447957.1"
                     /db_xref="GeneID:2889806"
     CDS             complement(551562..553406)
                     /locus_tag="CAGL0J05786g"
                     /note="highly similar to KLLA0E23034g Kluyveromyces lactis
                     and YALI0E27720g Yarrowia lipolytica"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447957.1"
                     /db_xref="GeneID:2889806"
                     /db_xref="GOA:Q6FP87"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:Q6FP87"
                     /translation="MGTANKRSLKEILDSEYVENSDDEVQHGDSDHDVSDNEEAPLDP
                     SICEECRDMKFEIICKDCQENFCVICYEMIHRGGKRRKHEFTKVSIDNPGEATETTLQ
                     QLPADSSEQKELQDTINNYDGSEIPAQKQESVEDTNSIDNKLMSILFETSHYIPMRLT
                     YEERHLLRLLEAALQVSEYTDRVDILSNKSKSRRIVEQLKEICSVLSGLVVASNMKLG
                     QKLLDMKNFSDNAKWFQDIFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQICEHME
                     FHLYKPILTVQSFLTTKTEDNGKAMGIFKDKLILAATSHISPVGRTRNQINRSIKQKE
                     TAIETLASKYSSKHYSKEDIRQALYSIGDYNAYVNMNRKPVLRMLSRLEIFRQPEVAA
                     KYNIGIQYGRNGARLTHDHERQWHYVQQSLTLWSIIQREMVKLWYIADLDLFDGSNYR
                     LASTGHGLNRIKPCPRIYKEMHRIIGECRSKTEAWVGSSVVHLGDDAVPNALFFLDKY
                     TQVPSILIPFDQTLIQINDLVKNDEYLLDYIKKEYGSVEDLKMTILQDAFAHMFDGSG
                     ADNFYMSGSCIDGRLTSAWNHCNEISKKKYYNIFLLTSFTGFNGSEGF"
     gene            <553745..>554044
                     /locus_tag="CAGL0J05808g"
                     /db_xref="GeneID:2889807"
     mRNA            <553745..>554044
                     /locus_tag="CAGL0J05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447958.1"
                     /db_xref="GeneID:2889807"
     CDS             553745..554044
                     /locus_tag="CAGL0J05808g"
                     /note="weakly similar to uniprot|P53906 Saccharomyces
                     cerevisiae YNL146w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447958.1"
                     /db_xref="GeneID:2889807"
                     /db_xref="GOA:Q6FP86"
                     /db_xref="UniProtKB/TrEMBL:Q6FP86"
                     /translation="MKTTKSSNGSYYHDLRRALRIGVLFILISLLFTSRLRNIVQQFL
                     NMFGRVRSGYSIEDVNHVPIFSEPDFDGVDVHTVDIKRLIMFLVVFFSLAIPFVF"
     gene            complement(<554231..>556054)
                     /locus_tag="CAGL0J05830g"
                     /db_xref="GeneID:2889808"
     mRNA            complement(<554231..>556054)
                     /locus_tag="CAGL0J05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447959.1"
                     /db_xref="GeneID:2889808"
     CDS             complement(554231..556054)
                     /locus_tag="CAGL0J05830g"
                     /note="some similarities with uniprot|P53907 Saccharomyces
                     cerevisiae YNL144c or uniprot|P38835 Saccharomyces
                     cerevisiae YHR131c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447959.1"
                     /db_xref="GeneID:2889808"
                     /db_xref="GOA:Q6FP85"
                     /db_xref="UniProtKB/TrEMBL:Q6FP85"
                     /translation="MDTEMDMGIELPAYSVHSVDSVHSVHSVDSADSLECAEELPGYS
                     PAVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSY
                     VSAKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKR
                     SNQYDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEE
                     NVYKDAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIV
                     PRRRRRRHSGHSRRRFSSRRRHSSGRTPVRNTEGPSSSTRRRANSFLKHFTGAKSASE
                     PLQIDFKNPFTSEQQPDAALVRQKSHHEPPERTPASDQSRSESSAHGDITPNNSISRS
                     TTTSLHDNESDVMDGLNNLTRSPSECLSLYETLTANSSFCEYDLDKPHAKLARINYNF
                     DYWSPLQFGSSLSSTSSLGLSNSMDCSFDSNESTYPDGMIPELIELEEEIEEDDEDDI
                     DIEDYGLEEFEIFEEGEELETDDMNDCDTKWNPVKKEQTRKRYIRHSLRCIRPLAPDA
                     KWEGETIYVKAGLRNKMYNPSLLKDIKPYLMETKIVGAMST"
     gene            complement(<556527..>557558)
                     /locus_tag="CAGL0J05852g"
                     /db_xref="GeneID:2889769"
     mRNA            complement(<556527..>557558)
                     /locus_tag="CAGL0J05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447960.1"
                     /db_xref="GeneID:2889769"
     CDS             complement(556527..557558)
                     /locus_tag="CAGL0J05852g"
                     /note="weakly similar to uniprot|P40580 Saccharomyces
                     cerevisiae YIR036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447960.1"
                     /db_xref="GeneID:2889769"
                     /db_xref="GOA:Q6FP84"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FP84"
                     /translation="MPAPTQPAPSYSKCYALKEIIYGFWATKVTYTPDKYPDLTGKTA
                     VVTGCNTGVGKEAAKLLYQKNCNVIGVCRTESKGLEAAESIKQEIGNSKGSISVVSGC
                     DFLDFTTVPQAGKRIQEILAGKPLNIIIHNAGLMSSSNAGTSKQGLEAMFQTNVMGPQ
                     LLQHYLDPVFLKEDDTSLKRIVWVSSGAHLLGPSQYGIFWENPGFDGVAIEKRPAATT
                     LYGATKAANILQAKAWATRNKEMVDKIGCVSVSCYPGNLRTDLQRDWHPWTRATVGRL
                     FYPAEYGAYTELYSVLSPSLTTSDQGKYICPFDQVHEPREDVKEGLQNGTDLALWDWI
                     ESEIKEYIS"
     gene            complement(<558678..>559628)
                     /locus_tag="CAGL0J05874g"
                     /db_xref="GeneID:2889770"
     mRNA            complement(<558678..>559628)
                     /locus_tag="CAGL0J05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447961.1"
                     /db_xref="GeneID:2889770"
     CDS             complement(558678..559628)
                     /locus_tag="CAGL0J05874g"
                     /inference="similar to AA sequence:UniProtKB:P53895"
                     /note="similar to uniprot|P53895 Saccharomyces cerevisiae
                     YNL159c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447961.1"
                     /db_xref="GeneID:2889770"
                     /db_xref="GOA:Q6FP83"
                     /db_xref="UniProtKB/TrEMBL:Q6FP83"
                     /translation="MNDQEGDSDSELYEQYLEDRRRLQSREDAHEIQTSEEVLQRNLD
                     ETLSRVLRNWSQEIDNHHVRIRITGRRHENTNSNSHTNNSYNNGAATENRNNNYGNML
                     GINLPSHNSIGSNSNGVNQRTPFAQRPSFFRTLVRNLLVLNYLVLSLLFPFSLYNVLR
                     SGFSTMTFSERDFTREILTYWYAIDTVDVISLIKPSTPETSDSGPGLGLLGKFHNIIV
                     YYSLPIGEALLRRILNIDRSYTDTEEYPVSVGIYRMILGFFFRWYKKSIKIVTILVYL
                     LYGIGGTTYLMIAGFFFSLCVGLTIVRRYKSTQQILSGLF"
     gene            <559944..>560519
                     /locus_tag="CAGL0J05896g"
                     /db_xref="GeneID:2889771"
     mRNA            <559944..>560519
                     /locus_tag="CAGL0J05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447962.1"
                     /db_xref="GeneID:2889771"
     CDS             559944..560519
                     /locus_tag="CAGL0J05896g"
                     /note="weakly similar to uniprot|P53896 Saccharomyces
                     cerevisiae YNL158w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447962.1"
                     /db_xref="GeneID:2889771"
                     /db_xref="InterPro:IPR019433"
                     /db_xref="UniProtKB/TrEMBL:Q6FP82"
                     /translation="MLLYYTVLPVLWLCAIVSANTETLRIRIPRQFKTSELTRQVHDS
                     YSILKNLEDTAIVSGNINSTSPFHVIEVRSNWSGTTLDVRVSWTAADGYSINDLGYLL
                     ITKEHEVVTPWSNETFEGLHEKLYVYFKVVPDSYPLLEDGQVFNVAINIKETFLGLTS
                     DLYVMIAYLIVLASISRLVVVHGWKLLSPLL"
     gene            complement(<560739..>561710)
                     /locus_tag="CAGL0J05918g"
                     /db_xref="GeneID:2889772"
     mRNA            complement(<560739..>561710)
                     /locus_tag="CAGL0J05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447963.1"
                     /db_xref="GeneID:2889772"
     CDS             complement(560739..561710)
                     /locus_tag="CAGL0J05918g"
                     /inference="similar to AA sequence:UniProtKB:P53898"
                     /note="similar to uniprot|P53898 Saccharomyces cerevisiae
                     YNL156c or uniprot|P38837 Saccharomyces cerevisiae
                     YHR133c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447963.1"
                     /db_xref="GeneID:2889772"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:Q6FP81"
                     /translation="MVKGRKKKAVKTVESSESISSLTTPQLYSIYDQDIVKSEDAEIY
                     EELKRSRSKSSSLDTPLYAIDEIIHLKKDNDKVNESPLIDVSEGSHIRPLSQHKKLIN
                     ETLLTPSMSAGGNLGLDATMANTMSFHVTPFQRFTNFVFAIVVLSISGVAYHQLSRNL
                     HDNHLLHEDFASRPLLWGVTIQQKLSCGILPDWFGYALEGIIFGSIIPLMDHITKVKL
                     RPTSYSLSSVIRSINAMLGVTFGIRKIQWASSGQAAGAWGLLNVILWLFFDGTLSMFS
                     NCSVLGLLCCASCFHEITDVSQFLYFMDFYFLGSLMFGKIGRYLYHL"
     gene            <562687..>564147
                     /locus_tag="CAGL0J05940g"
                     /db_xref="GeneID:2889773"
     mRNA            <562687..>564147
                     /locus_tag="CAGL0J05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447964.1"
                     /db_xref="GeneID:2889773"
     CDS             562687..564147
                     /locus_tag="CAGL0J05940g"
                     /inference="similar to AA sequence:UniProtKB:P23291"
                     /note="similar to uniprot|P23291 Saccharomyces cerevisiae
                     YHR135c YCK1 or uniprot|P23292 Saccharomyces cerevisiae
                     YNL154c YCK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447964.1"
                     /db_xref="GeneID:2889773"
                     /db_xref="GOA:Q6FP80"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FP80"
                     /translation="MPHSLTGTPSPGMITSNSSTQGSMSSSKDNGNGGTIAGLHYQIG
                     KKIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGTPGVPQAYY
                     FGQEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAHDLIYRD
                     IKPDNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINT
                     HLGREQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDLAN
                     GYPVQFARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWD
                     LTINKKPNLHGYGHPNPPGDKSHRNRNAAKGGNHANDANHGGLDPTSYEAYQQQTQQK
                     MLQQQQKQSQRNQNTAVDQQNYRLNNNPINNTSQPNNYKGNGGKDTNMMNGNGNGNRY
                     NFQEQPTTTHGQTKNTQQDMHSSSSEKGFFSKLGCC"
     gene            complement(<564491..>565372)
                     /locus_tag="CAGL0J05962g"
                     /db_xref="GeneID:2889774"
     mRNA            complement(<564491..>565372)
                     /locus_tag="CAGL0J05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447965.1"
                     /db_xref="GeneID:2889774"
     CDS             complement(564491..565372)
                     /locus_tag="CAGL0J05962g"
                     /inference="similar to AA sequence:UniProtKB:P53899"
                     /note="similar to uniprot|P53899 Saccharomyces cerevisiae
                     YNL155w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447965.1"
                     /db_xref="GeneID:2889774"
                     /db_xref="GOA:Q6FP79"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q6FP79"
                     /translation="MFAKRAPQSVVNDMNNKEKETGMLDVGTHCQYCRQLDFLPFHCK
                     LCDGDFCSEHRSKESHHCKWLLDHPEELENNGARSPPSSSKSNGGKFFQSLLPEKAHI
                     RVKSPSPSSTTSQSPVKLGSSGVTTKNKPSETTKIRSTLNPAALNKLLNFFKRTKSDP
                     KTKKKVSTSSNRLVELSTLKKTAKGDSKIPVQNRIYIYCQVILGEDETSDTLGLTKVP
                     LYINKIWPVGRALDYLSQQLHVTNVNGNVDTTKGEKLFLYKYDEKLNEYVGIETSGRV
                     NVLVKDLDTLYLVRGQI"
     gene            complement(<565921..>566964)
                     /locus_tag="CAGL0J05984g"
                     /db_xref="GeneID:2889775"
     mRNA            complement(<565921..>566964)
                     /locus_tag="CAGL0J05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447966.1"
                     /db_xref="GeneID:2889775"
     CDS             complement(565921..566964)
                     /locus_tag="CAGL0J05984g"
                     /note="highly similar to uniprot|P53909 Saccharomyces
                     cerevisiae YNL141w AAH1 Adenosine aminohydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447966.1"
                     /db_xref="GeneID:2889775"
                     /db_xref="GOA:Q6FP78"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="InterPro:IPR028892"
                     /translation="MVPESFLLELPKCEHHLHLEGTLEPDLLFPLAKRNNIQLPDHFP
                     QTPEELAVRYTQFKDLQDFLDYYYIGTNVLLKEEDFFDLAWAYFTKVSKQGLVHAELF
                     YDPQSHTTRGVSLETVTRGFERACKKAHEELGITSKLIMCLLRHLPPQDCLQTIEEAE
                     QLIKSGVIHGLGLDSAEKPFPPSLFVECYERAAKINPELRLTAHAGEEGTHQFVSDAL
                     DLLNVTRIDHGVNSKQSEELMARLAEQQTLLTVCPLSNVKLQVVQSVKEIPLQLFLDK
                     NIAFSLNSDDPAYFGGYILDNYYQVNKDFPDWDFKVWERIAKNGINGSWCEQKRKEEL
                     LAKVDAVVAKYTN"
     gene            <567376..>567765
                     /locus_tag="CAGL0J06006g"
                     /db_xref="GeneID:2889776"
     mRNA            <567376..>567765
                     /locus_tag="CAGL0J06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447967.1"
                     /db_xref="GeneID:2889776"
     CDS             567376..567765
                     /locus_tag="CAGL0J06006g"
                     /note="highly similar to uniprot|P53900 Saccharomyces
                     cerevisiae YNL153c GIM3 Gim complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447967.1"
                     /db_xref="GeneID:2889776"
                     /db_xref="GOA:Q6FP77"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:Q6FP77"
                     /translation="MELLPEGKKNNIEVTFADQQKINEFSKLIMRKDALEAELKKERQ
                     EKEYLEDVSLEIELIDEDEEVQYKMGEVFVFLKQSKVVEQLEKDTEIIDEKISQLESK
                     QDDLEDRIKELKTSLYAKFGDNINLER"
     gene            complement(<568124..>569638)
                     /locus_tag="CAGL0J06028g"
                     /db_xref="GeneID:2889777"
     mRNA            complement(<568124..>569638)
                     /locus_tag="CAGL0J06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447968.1"
                     /db_xref="GeneID:2889777"
     CDS             complement(568124..569638)
                     /locus_tag="CAGL0J06028g"
                     /note="highly similar to uniprot|P41948 Saccharomyces
                     cerevisiae YNL142w MEP2 high affinity low capacity ammonia
                     permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447968.1"
                     /db_xref="GeneID:2889777"
                     /db_xref="GOA:Q6FP76"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:Q6FP76"
                     /translation="MSYNFTGTPTGHGTGGDSLTTDLNTQFDLVNMTWLGVCTSGVWL
                     MVPGIGLLYSGLSRKKHALSLLWASLMAACLVIFQWFFWGYSLSFSHETRGNGFLGTL
                     EFFGFRNVLGAPSVVTSVPDIVFAIFQGMFAAVTGALMLGGACERARLMPMMIFLFLW
                     MTIVYCPIACWTWNAEGWLAKLGALDYAGSGPVHTASGHGALVYALILGKRNDPVAKK
                     GMPKYKPHSVTSVVLGTVFLWFGWQFFNPGSAGNASIRAWYSAMNTNLAAASGGLTWL
                     FIDYFRTGGKWTTVGMCSGIISGLVGITPGAGFVPIWSSFIIGVLSAAGCNLAVDLKN
                     VLHIDDGLDVYALHGVGGCIGSVLTGIFAADYVNATAGSYIAPIAGGWLNHHWKQVGY
                     QLAAICATIAWTVTITAILLLAMDQIPFLRLRLRPEEEEQGTDEAEIGEFTYQEEQEY
                     IPEPVRSRSPGMQPKMSSIDDKITGPQQVIDSKLSESESGSNEAGSNMGEKQTV"
     gene            complement(<571225..>572331)
                     /locus_tag="CAGL0J06050g"
                     /db_xref="GeneID:2889778"
     mRNA            complement(<571225..>572331)
                     /locus_tag="CAGL0J06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447969.1"
                     /db_xref="GeneID:2889778"
     CDS             complement(571225..572331)
                     /locus_tag="CAGL0J06050g"
                     /inference="similar to AA sequence:UniProtKB:P38616"
                     /note="similar to uniprot|P38616 Saccharomyces cerevisiae
                     YNL160w YGP1 secreted glycoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447969.1"
                     /db_xref="GeneID:2889778"
                     /db_xref="GOA:Q6FP75"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="UniProtKB/TrEMBL:Q6FP75"
                     /translation="MKFQVALTSLLAAAAVASPVEDLFKHKAKKSSTSSVHPSSTTKG
                     KPTSSAHAKALPSSLASLLANTTGNASNMTNSTVAPQKQQLQVIYTGGQVAIPSTNAT
                     NTTAFSTNSTALFNTTSALNITELYSVAATINQTLADNSTKGAVVVANAKSLESLGFL
                     TSIVLDSKKPIVISADEKMALAVANETAAWNRGPLVVSKEGLVYAGIFTPSSANAVGL
                     PVAVIDDAKKVQWFFSPAPPALINSNSTIRVNYTNFTNTDIEFAATPLVPIVYDGGYS
                     SSLISSLASTVQGLVVVSSGSSNSTTSTIESAQIPVVYANSGAPLTPVSSKDVPQNAL
                     SAGYLTPVKAQLLLSIAAINGVNSDEALMSIFPN"
     gene            complement(<574501..>576822)
                     /locus_tag="CAGL0J06072g"
                     /db_xref="GeneID:2889779"
     mRNA            complement(<574501..>576822)
                     /locus_tag="CAGL0J06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447970.1"
                     /db_xref="GeneID:2889779"
     CDS             complement(574501..576822)
                     /locus_tag="CAGL0J06072g"
                     /inference="similar to AA sequence:UniProtKB:P53894"
                     /note="similar to uniprot|P53894 Saccharomyces cerevisiae
                     YNL161w CBK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447970.1"
                     /db_xref="GeneID:2889779"
                     /db_xref="GOA:Q6FP74"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MFGGEYDHAYDANNGQRFQPPVLDAMEFEKPGSPSVGDHFLRQQ
                     ISNQSLHDQYSSHMEQQQQQQQQQHNAAYGAGFTDIPQLHPSTPPHGLVQKISNGNFH
                     PAMNQGGNIPSTSNMNNMFNTPPPTMGNNPLYSHDNNSTNLLQDNLNQARSQFSPDRY
                     SVDSDFNNGAGNHVMANGNYNINGSQSSSPYHQPQTFYTNSNLSSGQLSAHRSSPQRQ
                     PAQPLQQTTFTQLPQPSLPPQQQQQQQQQQQQQQQQQPKFQSMVPPQQTQLQQQQQQE
                     LQNAGSYMYFERRPDLLSKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELG
                     SHNWSEERNARQLASLGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDT
                     GKIYAMKTLLKSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFL
                     PGGDLMTMLIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIK
                     LSDFGLSTGFHKTHDSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMS
                     NRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPP
                     FCSETPQETYRKIMNFEQTLQFPEDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKS
                     HPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMK
                     NGVNPNQNQVKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<577278..>577484)
                     /locus_tag="CAGL0J06088g"
                     /db_xref="GeneID:9488023"
     mRNA            complement(<577278..>577484)
                     /locus_tag="CAGL0J06088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999526.1"
                     /db_xref="GeneID:9488023"
     CDS             complement(577278..577484)
                     /locus_tag="CAGL0J06088g"
                     /inference="similar to AA sequence:UniProtKB:Q3E7A8"
                     /note="similar to uniprot|Q3E7A8 Saccharomyces cerevisiae
                     YNL162wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999572.1"
                     /db_xref="GeneID:9488023"
                     /db_xref="GOA:B4UN29"
                     /db_xref="UniProtKB/TrEMBL:B4UN29"
                     /translation="MDARVCPQCGELLHRFMIRMKHAVVMCANDKCMYPFNTPGGIES
                     NLVYVEGSELLEASTKIEKPPSRH"
     gene            <577719..>581045
                     /locus_tag="CAGL0J06094g"
                     /db_xref="GeneID:2889780"
     mRNA            <577719..>581045
                     /locus_tag="CAGL0J06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447971.1"
                     /db_xref="GeneID:2889780"
     CDS             577719..581045
                     /locus_tag="CAGL0J06094g"
                     /note="highly similar to uniprot|P53893 Saccharomyces
                     cerevisiae YNL163c translation elongation factor eEF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447971.1"
                     /db_xref="GeneID:2889780"
                     /db_xref="GOA:Q6FP73"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FP73"
                     /translation="MVRVLPETFKRLQSDPTCVRNICIVAHVDHGKTSLADSLLASNG
                     IISQRLAGRVRYLDARPDEQLRGITMESSAISLYFRVLHKQEGKDEPLVNEHLINLID
                     SPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPVLVLNKIDR
                     LITELQLTPMEAYIHLNKTIEQVNSVIGSFFAGERQLDDLSWRERLETNANAEFIEKD
                     DSEIYFTPTDNRVIFASAADGWGFNIGQLAKFYEKKMGAKRENLQKVLWGDFYMEPKT
                     KKIITNKNLKGRNLKPLFVSLILDNIWKIYENVIMEKDLDMVEKFTKILDVTLTARDL
                     RTKDDKQLLRQIMGQWLPVSTAVLLTVIEKLPSPLESQSERLDVIIGKEYEKEDVDED
                     LIKDMKECNRNGQLCAYVSKMLSIPRDELPLEDNKNMTADQIIERNRRAREVAMNAAK
                     RAEMLEKSKDNSTEEDLYARAKETIITPELDSGTENKTKNDTFQIVTAPAAPLDLGFE
                     YEEDPEAVSDDDSDTNGDAIPEFVPGEIDPNDPLSSMFEYEEEDPFSTGATLAETHFE
                     PVSLEELKDDDIFDEKDEVLIGFARIYSGTLEVGQEISVIGPKYDPKNPTEHIHTTTI
                     TKLYLFMGKELVSLNSCPSGNIVGIGGLAGKIIKNGTIVGNSAKGLNLAGVNLHSTPI
                     VRVAIEPSNPMEINKLVRGLKLLDLADPCVNIEVEDSGEHILCTAGELHLERCLKDLK
                     ERFAGIDITHSEPAIPYRETFLNVSGMNPPKNPELGRSVIELKLGKYRMSFRSIPLSD
                     EITNFLTHHERTIARIVSSKSANENIEEQILDEDTFWKKLGSLFEESEGTEELVSYMD
                     KIAAFGPKRIGANILVSNNGILGNVKQHEAPQFEYSDSIINGFLLSVNEGPLANEQVQ
                     GMCVVLEDIHEMTENEISEIDDPHYQVDEPNLSGRLITTTRDCIHKSFLDWSPRIMWA
                     MYTCDIQTSVDVLGKVYAVVQQRHGKIISEEMKEGTPFFQIIARIPVVEAFGLSEDIR
                     KKTSGAAQPQLVFDGYESIDLDPFWVPTTEEELEELGETADKENIARAHMNNIRRRKG
                     LFIEEKVIQNAEKQRTLKRN"
     gene            <581464..>582420
                     /locus_tag="CAGL0J06116g"
                     /db_xref="GeneID:2889781"
     mRNA            <581464..>582420
                     /locus_tag="CAGL0J06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447972.1"
                     /db_xref="GeneID:2889781"
     CDS             581464..582420
                     /locus_tag="CAGL0J06116g"
                     /inference="similar to AA sequence:UniProtKB:P53892"
                     /note="similar to uniprot|P53892 Saccharomyces cerevisiae
                     YNL164c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447972.1"
                     /db_xref="GeneID:2889781"
                     /db_xref="GOA:Q6FP72"
                     /db_xref="InterPro:IPR026231"
                     /translation="MSSNNQNTNNTSIELISENGPISLNLMMEEGVKALTRILSNQLN
                     DTPGTQPMHFIIKKNDKDNKAIDINGDDEEVVELGNESNYHMSDGVQNEAEIILNDQL
                     NDILKNHESQLRLDGEEAEIIFDYETQGTVDGSDSIGEKITQMIESVLPNGLGPNTTG
                     KLQAVLNGKELNITEEIHKSDRIEEEEHIEGGLTTAEGNFEVEFETEPLPEDHKHTEE
                     NIDGHENYNDCCPHHHNNQDNRRRAPKYKNYNYHDYEYTVQHPKTEPNFSALINQKKP
                     VCLFCEYYMVFGEPPKNMIKWYNMHYGYNHLPQRNDRHHRNR"
     gene            complement(<582568..>583785)
                     /locus_tag="CAGL0J06138g"
                     /db_xref="GeneID:2889577"
     mRNA            complement(<582568..>583785)
                     /locus_tag="CAGL0J06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447973.1"
                     /db_xref="GeneID:2889577"
     CDS             complement(582568..583785)
                     /locus_tag="CAGL0J06138g"
                     /inference="similar to AA sequence:UniProtKB:P53891"
                     /note="similar to uniprot|P53891 Saccharomyces cerevisiae
                     YNL165w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447973.1"
                     /db_xref="GeneID:2889577"
                     /db_xref="GOA:Q6FP71"
                     /db_xref="UniProtKB/TrEMBL:Q6FP71"
                     /translation="MDRVRSLLNSRRVVRVPEDEGERVLLPPQNSVSVESTAEHLYRP
                     HVGGDDDDQMTMIDGDRDDMTMHTLLSESSTIGDFQRLGFVNRCPNFDNERVVPFVSV
                     LLSRGFYAFASEESYKAYLGNKRKIEKFDVQSELGIPLFHALPSNVVKSMFGSRSTPV
                     MRIFKFIVVRTCDANDNEGSTRADVLDFAPQGSELVSELQGTPYSVYKYQFCTIFKAV
                     DTKTGKVEHKFAFSKLTSDVKDTVITENVNMTNYMQSRNADTNYAGLNLRWYGSTGFA
                     SPFGSNNIKLLVLDDSMPSYMTQDTLNDYEQARRAERLRPLGYLPVWARYSDDKVSVI
                     PKKRTLRVATLDIKEQNRELSSDNPNTAFGLPWDTQVLTCMCMLLHEYESRKDKRHNA
                     TLRSQLVGPGMLM"
     gene            <584111..>585373
                     /locus_tag="CAGL0J06160g"
                     /db_xref="GeneID:2889578"
     mRNA            <584111..>585373
                     /locus_tag="CAGL0J06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447974.1"
                     /db_xref="GeneID:2889578"
     CDS             584111..585373
                     /locus_tag="CAGL0J06160g"
                     /inference="similar to AA sequence:UniProtKB:P53890"
                     /note="similar to uniprot|P53890 Saccharomyces cerevisiae
                     YNL166c BNI5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447974.1"
                     /db_xref="GeneID:2889578"
                     /db_xref="GOA:Q6FP70"
                     /db_xref="UniProtKB/TrEMBL:Q6FP70"
                     /translation="MLDQEDVKKRMSQIELDINQMNKMIDENLQLGENDGHDSGTEGV
                     EGAVGEGVDGQAGPVEPVVTTAAEETSETKDIEHEQVTNEGMAKEVEDASESSVQATE
                     QAQDQQAGTNEETNTFKTESMPEPETQAPEVNDLEMKEPEMKEPEMKEPETVEPETVE
                     PEMKEPETVEPEMKEPVIKETDALEPEMKHAEIPPQATTEEQPTRHDEWEDVEEEEFN
                     EIDTSTESNNVIGDTKQVEGSSVLAAGDLRGNVADNGNLTPVTDIDDAESTIFIPKKQ
                     NQNSELTEQMKETLRNTRRTTNPFRVISVSSSNSSTNSSRKSSGHDMGLEQTPSEQLK
                     RYEQRHYYLTTKCGKIQKEIDYLNKMNSQGTLSIDDSRKLTRAIAKLQEYLDKKNKER
                     YEVGVLLSRQLRRDINRGENGEFWIGTK"
     gene            <586031..>587572
                     /locus_tag="CAGL0J06182g"
                     /db_xref="GeneID:2889579"
     mRNA            <586031..>587572
                     /locus_tag="CAGL0J06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447975.1"
                     /db_xref="GeneID:2889579"
     CDS             586031..587572
                     /locus_tag="CAGL0J06182g"
                     /inference="similar to AA sequence:UniProtKB:Q02100"
                     /note="similar to uniprot|Q02100 Saccharomyces cerevisiae
                     YNL167c SKO1 cre-binding bzip protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447975.1"
                     /db_xref="GeneID:2889579"
                     /db_xref="GOA:Q6FP69"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="UniProtKB/TrEMBL:Q6FP69"
                     /translation="MQNTSSRPSGSLGTVSSFDLEPNPFEQSFASTKKTESGGDGGNI
                     GNTNDSAANGDGLDNAKGMASLSYLDSQNNGSSGSLNIDPQIAGDQKRAASLIYGNQR
                     GPMQSPPLLTPGGSKKLPPLLMSPSYLQGQSQSGQNGSSHNGSATGGQTPLGGSQGVA
                     NGSETDGQLPGFLMNLFKSGLTPNESNLRANFTPGILGSQFNQGSLPSLMNNNVSISR
                     ANSNSVVPTNGDKDESGSGRKMNGQIDIPNKALTALGGLPAGQLTPGLSSLLASSAKQ
                     LNLDNNTRESTPNISVSQPVVQGVTKSNSVPTNSYFPLADTTIEKDSGADGADNQSGT
                     QKKRGRKKSVSTKATEPKRKRASTSSASKKSEGNTGTATVTNPEANNAVNTGNDDLDE
                     QERRRQEFLERNRVAASRFRRKKKEYIKKIETDLGILQTEYNDMSKIIGHLAGITPEG
                     SDDRVSASILLMLEQSLMNNDIKAALQIIESTKQILTSSNFVKRNGANPVAKNTSHDS
                     SDSGK"
     gene            <588083..>588868
                     /locus_tag="CAGL0J06204g"
                     /db_xref="GeneID:2889580"
     mRNA            <588083..>588868
                     /locus_tag="CAGL0J06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447976.1"
                     /db_xref="GeneID:2889580"
     CDS             588083..588868
                     /locus_tag="CAGL0J06204g"
                     /note="highly similar to uniprot|P53889 Saccharomyces
                     cerevisiae YNL168c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447976.1"
                     /db_xref="GeneID:2889580"
                     /db_xref="GOA:Q6FP68"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:Q6FP68"
                     /translation="MSYTYLKDAKKIICIGRNYAAHIKELNNATPKQPFFFLKPMSSV
                     VTPVDEKHAIKELPKQASYHGLNDDGTNPGTIQIPKGTVVHHEIEVALVMDKYISNAN
                     ESEFTAADVYDSIRGVALALDLTARNVQDEAKKKGLPWSIGKGFDTFLPMSHMIPKTK
                     FEANKENLQEAFRVTCDVNGTRRQDGNTNLMLYPLHKIIQHISTMMTLEPGDIILTGT
                     PAGVGPIAAGDNISGQLYYTDDLLIDFNFDCVVRPGPYEYKET"
     gene            <589288..>590814
                     /locus_tag="CAGL0J06226g"
                     /db_xref="GeneID:2889581"
     mRNA            <589288..>590814
                     /locus_tag="CAGL0J06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447977.1"
                     /db_xref="GeneID:2889581"
     CDS             589288..590814
                     /locus_tag="CAGL0J06226g"
                     /note="highly similar to uniprot|P39006 Saccharomyces
                     cerevisiae YNL169c PSD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447977.1"
                     /db_xref="GeneID:2889581"
                     /db_xref="GOA:Q6FP67"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:Q6FP67"
                     /translation="MIPVKTVLLKSKTLLSGRMPVRLSNGMQLRNRTAILKRGITNRL
                     SNPQRKSNEIVRKARSYASVTTKQKEKYIVSVNMKWAVLTGVTIVLGTLLLTSRRIEE
                     DEDSKKDSEGQGKRYKKIRILDNNWLFFCYSTLPLNAISRLWGQVNSYTLPIWLRPSG
                     FKFYSYLFGVNLDEMENPNLEDYANLSDFFYRNIRPETRPVAPGDEVIVCPSDGKVLQ
                     IGIINSETGEVEQVKGLTYSIKEFLGTHSHPLLCKSESTLDLSGHEERHQEFARANKF
                     KVSYSSPDLNATKDEEATDVIKFENEGDKTVDEYNTPSISKTMKLLTEVSPNFPSYTS
                     SMTGPEETNLYFAVIYLAPGDYHHFHSPINWVCRLRRHFPGDLFSVAPYFQRNFPNLF
                     VLNERVALLGYWRHGFFSMTPVGATNVGSIKLNFDEELKTNAKRRKIKPHTCYEAVYE
                     KASKVLGGLPLTKGEEMGGFMLGSTVVLCFEAPKDFQFHIKTGEKVKMGQKLGSIQKD
                     "
     gene            complement(<591163..>596457)
                     /locus_tag="CAGL0J06248g"
                     /db_xref="GeneID:2889582"
     mRNA            complement(<591163..>596457)
                     /locus_tag="CAGL0J06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447978.1"
                     /db_xref="GeneID:2889582"
     CDS             complement(591163..596457)
                     /locus_tag="CAGL0J06248g"
                     /inference="similar to AA sequence:UniProtKB:P53886"
                     /note="similar to uniprot|P53886 Saccharomyces cerevisiae
                     YNL172w APC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447978.1"
                     /db_xref="GeneID:2889582"
                     /db_xref="GOA:Q6FP66"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:Q6FP66"
                     /translation="MNFKEDFSLFKKCFECSDDDLGDLWVSPDRRTVEWLVGKGTECR
                     RRFTFNSSAVVRAGFTKFENLQTKCLIIVLRELAYVYYIANESSESAKSDSSTICFPF
                     PIKDAFMYQNGIILERDDMLSLEPGSGGKSIFSEENSGRTSIEQQFISLSDPLAPFGT
                     LVFINEDDTILTSSGKRRNTREIDTVDGNILFKKKRRTCSPNEYTKELENSEQTCLAS
                     SRVRHPLKMMTFPKNSGLSITVLYDSEELNLQFYYTRILGDNARTENTLSDYKNSNSA
                     GQNSHLQISKPRTISKLEASQQLENRHQYSNDLRKLSLMNRKVTPNAGLPVDVQLKSP
                     ADFFQEVNVSHQQLSSSTLKRNDSSTMDRLGINGNESLLKNHPNSSVRVSSSTMATTD
                     TMSSETSIKDVVLTKISTVKLPESLRNGEGGINIKCLPLKYENMEGVLIFDTEKGYYK
                     LWFIDMIPEVINSNSFLLYGTFPQLMIQLKNLPKVDFGNILDFQPTNSSEYRLDGCVF
                     AITEEKTYIMNPYLDIYYEENIMAIRRMEMVSKEQLIVHQFPSTFVRYFTLYDRCPKR
                     LLLREIFLSFRYICDSKFYQLLVFFWFQISLEYVNSKENLDVFDCEWECFKVLISSLM
                     SPDSLTSLPSLRNSRILNSLERMDVGVTFPKMVMGLHLLREETILNIYRRRDTDDMGS
                     LIGAITTILEWPSQWDDYYQDYKGLKAIPCCLNLSSNIVNGYVKPLDAPTSILGSLSS
                     LSDKDVNTIVPFIEFSRLVEMDNKVNELITPRTFKVTRLFESLNNISPKSHFLKVLTK
                     FKMNREDLQSYPPGLFKPMVEALQLFENNFAEIEEDVDVGLISRADLARYSSILKEKM
                     TWKGSNESALKTDIKASPLLNAKSTKSILSVLSDIVLSSESQLSKDILLDQNASEDID
                     DGVNLKKNSSLIFSEDRRFNDAMTLLSFSKVQKVPFFSTDSEYSKILSKKKKIAEIIA
                     LRSCAQGIGWAMVVFATEKPLSTQKWVLRPINFSVSFPDETVINVDKDLIPSDIIEWG
                     EFHAGVSSGLKISRKTKGVNGSWIVFNKPKDVSASHAGFLLGLGLNGHLKELEEWHIY
                     NYLSLKNTHVGVGLLLGMTASMRGTMDLTLTKILSIHIASLLPKGANDLNIDIRVQTA
                     GLVSLGLLFLKSQHKKMTNILVDQLESLVLINEEYVANEGYRMAAGIAIGMINLGAAD
                     NFTKSCGTEEHKKSRSNLVEDDLDSSYNLPEIQDSAYFTSLTDGLLNKLKFHSEAEKS
                     ELPQNSYIGRLLAIMLIYLKSENADVADQVKPKIIFGFERSSCRPEFYMFSEFAYRMI
                     MWDSIHDSVEFLMEELGVDILDSCLKSDHMQIYYILSGRILSLGLKFASTGNLRIKEF
                     LLSLFDQLLPFYQYPGRDSVDFKLVVTSINVLLNVIMVSLSMVMSARGDLDVFKRIRY
                     VHEVVFGSSSDIYHRKESKSQNNWDHSDANTINNQAVGSSRRSSLNGFEEVVEGGSAG
                     EDTVPPNFDQPDTDNHYAKYIATSLSIGFLFLGSGQYALKNTDKESVAYLILSTLPLF
                     LPPYYLQELRHFWSLAVESRCLLVKDATTDKMVSGVDIRVLTKSANSQKLNEQILRTP
                     CLLPEINAIKAISLISNDYYPLHIDFSKNISASKLFKNGTILYVQSKKESSYPNGASD
                     YRTRNNTDVVDLSLSKKIEKRLRFDKIMVQPASSILSLLHIKGKDLQDPLNEFEDSSI
                     CSRNSKFDLELIQNNRRVSSISNDDLAIWWKLYEEAQH"
     gene            complement(<597098..>599275)
                     /locus_tag="CAGL0J06270g"
                     /db_xref="GeneID:2889583"
     mRNA            complement(<597098..>599275)
                     /locus_tag="CAGL0J06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447979.1"
                     /db_xref="GeneID:2889583"
     CDS             complement(597098..599275)
                     /locus_tag="CAGL0J06270g"
                     /note="weakly similar to uniprot|Q12027 Saccharomyces
                     cerevisiae YDL176w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447979.1"
                     /db_xref="GeneID:2889583"
                     /db_xref="GOA:Q6FP65"
                     /db_xref="UniProtKB/TrEMBL:Q6FP65"
                     /translation="MSRTITLAVSTPSNKKGNTSTYCILDNKDGKFTRIRRSSNFGDE
                     SVDSSVLAFCYLVPKDRSLYGNQKPSQRAEKTNNPVEGDCTSNINSEVEENETNFPNF
                     DLKDDSDYMLICRSNGIIEVVKDYRQKIYQNSSLCPQFLWKCFPDDIDPTGDFDFSIA
                     NLSYFKGLLYCCTTSGKVYIFILNLPEDYIQVENLISNSDSNKIKDMKNDGNGGTTAA
                     RNISPDEDEFFKLTQYRYCGKTDDICYFLIPIDEDTRNSILGQQKYTASYSGAIMYKS
                     SGYNRLDQGIANFQINPLDRLSFIVSAQRSPLMIRKVVMTRIFVIFLRTYLKKKLECQ
                     SNQYLQSSSLIFNLDNDIANMPQIDHRLWNSIIQLSGTAPLQSIIVWKQKFGGRKDEI
                     DKLLHNIADNQNVELAENLSISTRPLSRGNLMVNRSQDSLFRRINYMSRQLTEKKVDT
                     LLKSLKKNTFPIDFCAVQLRQESQQHIFNGSYTFNDEPPSDVEDDVIVSFLTDKYRNL
                     DIYSIEKFLKFHVFRPRLMNEPLVEINVYPNHQYSEFSNTKDSRERFDEILSQVCSFK
                     KLFVLTEKIILIIGSGGVLLLDRSLLKYMNHLSDNPIESICIIKIDLGLLNDAILLVD
                     RFETCKDCSGVLLNFQLITTNLSGEINSYNCMMRPHSRIGSYECTDSIQLTKVGKFVD
                     KLIFITDFKEQVSSRKRSQSDIEMGQSRKKQRSLSDNFVISSI"
     gene            <599887..>600336
                     /locus_tag="CAGL0J06292g"
                     /db_xref="GeneID:2889584"
     mRNA            <599887..>600336
                     /locus_tag="CAGL0J06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447980.1"
                     /db_xref="GeneID:2889584"
     CDS             599887..600336
                     /locus_tag="CAGL0J06292g"
                     /inference="similar to AA sequence:UniProtKB:Q12257"
                     /note="similar to uniprot|Q12257 Saccharomyces cerevisiae
                     YDL177c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447980.1"
                     /db_xref="GeneID:2889584"
                     /db_xref="GOA:Q6FP64"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:Q6FP64"
                     /translation="MDWNVSDVVTDKKSKFQARCCFLRDQKDIPDILQGMIQSDKHIA
                     KASHMHMYAWRTGTEELKGNEKQTKKKNNKKQDEVVQLKNVQQGSSDCGEAGAGQRLL
                     TLLERSNAFNVIVIVTRWYGGTPLGPARFRHICSAALQSLRIGGFVP"
     gene            complement(<600516..>602147)
                     /locus_tag="CAGL0J06314g"
                     /db_xref="GeneID:2889585"
     mRNA            complement(<600516..>602147)
                     /locus_tag="CAGL0J06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447981.1"
                     /db_xref="GeneID:2889585"
     CDS             complement(600516..602147)
                     /locus_tag="CAGL0J06314g"
                     /note="highly similar to uniprot|P46681 Saccharomyces
                     cerevisiae YDL178w AIP2 actin interacting protein or
                     uniprot|P39976 Saccharomyces cerevisiae YEL071w DLD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447981.1"
                     /db_xref="GeneID:2889585"
                     /db_xref="GOA:Q6FP63"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:Q6FP63"
                     /translation="MMLKCGRQYRIVSKNASRVLNSTAVSGRNRLGLYMQPLLTMAAY
                     TRTYSSKLPPRLTAETYPEVKRDGRFKSLAKDDIDYFKSILSETELLEGNDSNDSLAA
                     YNEDWMRKYKGQSKLLLKPKTVEQVSKIIKYCNDNRLAVVPQGGNTGLVGGSIPVFDE
                     IILSLANLNKIREFDPVSGIFKCDAGVILEAANEYLEKNGYIFPLDLGAKGSCHVGGV
                     VATNAGGLRLLRYGSLHGSVLGLEVVLPNGKIVNSMHSLRKDNTGYDIKQLFIGSEGT
                     IGIITGVSILAPPKPKFTNVCFLSLEDYESVQKVFVKARQELSEIISAYEFMDNKSLS
                     LTKDHLEGVPFPLEDEHPFYVLIETSGSNKEHDDAKLEAFLELAMEEGLVTDGVVAQD
                     ETELANLWQWREMIPESSQSNGGVYKYDVSLPLKSMYSLVEAVNDRLTQHGLLGEAPK
                     PVVSAIGYGHIGDGNLHLNVAVREYTKEVEKCLEPFVYEFIQRHHGSVSAEHGLGFQK
                     KNYIQYSKTPEEIEMIKSIKNQYDPNSILNPYKYI"
     gene            complement(<602954..>603898)
                     /locus_tag="CAGL0J06336g"
                     /db_xref="GeneID:2889533"
     mRNA            complement(<602954..>603898)
                     /locus_tag="CAGL0J06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447982.1"
                     /db_xref="GeneID:2889533"
     CDS             complement(602954..603898)
                     /locus_tag="CAGL0J06336g"
                     /inference="similar to AA sequence:UniProtKB:Q12477"
                     /note="similar to uniprot|Q12477 Saccharomyces cerevisiae
                     YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
                     YDL127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447982.1"
                     /db_xref="GeneID:2889533"
                     /db_xref="GOA:Q6FP62"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q6FP62"
                     /translation="MFETPPYCGLNPVEYEILVRFLKRNVTYEMLTFLISKTNSMIKI
                     KKTNSPKPVELSLFVEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMF
                     LGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDINIQIEELYN
                     TLEPILKPIREEMVTRRYTLYLPTPSSSPGKIDGRIKLSSHPVLQKQIAEEISTYLDD
                     ASPVSSISTFYDSESPTSMQSGHNGRLYLCDNCSTPALGNSTVSSEYVLDSSNQRKRG
                     HSSDLKSTKSEEEESNLEYLFKRDKKLVRWNNRWSMVF"
     gene            complement(<605140..>606867)
                     /locus_tag="CAGL0J06358g"
                     /db_xref="GeneID:2889534"
     mRNA            complement(<605140..>606867)
                     /locus_tag="CAGL0J06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447983.1"
                     /db_xref="GeneID:2889534"
     CDS             complement(605140..606867)
                     /locus_tag="CAGL0J06358g"
                     /inference="similar to AA sequence:UniProtKB:Q12301"
                     /note="similar to uniprot|Q12301 Saccharomyces cerevisiae
                     YDL180w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447983.1"
                     /db_xref="GeneID:2889534"
                     /db_xref="GOA:Q6FP61"
                     /db_xref="UniProtKB/TrEMBL:Q6FP61"
                     /translation="MVRISSAASYFMPLLCSKKPSVVVSAVFVVTLIYSLAYLSSTIL
                     PNAYDDPNMFAPNSQDYFRTFLLGFFSPCLLYLTRSFLLSVNPNQRFINLILDFPIND
                     SFLLLIIIGLAYPQIQDGHGIHTKNDGDDASAVQWHIIPKQSYIFGISWSLSEFIICA
                     ISNLFEFQEVSIAGQLNSKEDSEIDVLNRKNSLNRENITLSKCIGVRRKSSTISNNVY
                     TNDADPEVSTSKYGTLTYMDYTSWDKFRKSNFNSDEYGREANKNITTDKTGRDPLIII
                     NPKDNSLRITSLNREGNHLEFEESEPIFKDKRGFTWVRWKEDNYLENQGNMLDSDTTS
                     IRHANVIERLTSNGGQKSYFTLKGYGHLGKNFFIMSVVIFSNIWMTIGQSLLMSIYFI
                     YVRGHEKLFSDTVIFFGSKDITYFLLVVFIPFVSMNFLINTYIYLQDTLVEWFIDPYF
                     NMNGGIGASLNNQYPYYPIVENSLLFPNKKRVSTANSKPTRQDLTSSYDSALLMESAM
                     LYGSHNNADDYDANDPKPLKLAKRMIIKWKEISASDQFVLSAMFIWGLSVFVCGLFAT
                     IPSFNIPSR"
     gene            complement(<607459..>608292)
                     /locus_tag="CAGL0J06374g"
                     /db_xref="GeneID:9488024"
     mRNA            complement(join(<607459..607665,608179..>608292))
                     /locus_tag="CAGL0J06374g"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_002999527.1"
                     /db_xref="GeneID:9488024"
     CDS             complement(join(607459..607665,608179..608292))
                     /locus_tag="CAGL0J06374g"
                     /note="highly similar to uniprot|P10622 Saccharomyces
                     cerevisiae YDL130w RPP1B"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_002999573.1"
                     /db_xref="GeneID:9488024"
                     /db_xref="GOA:B4UN30"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:B4UN30"
                     /translation="MSDAAISYAAFILADAGLEITSENLQTLTKAAGANVDNVWADVY
                     AKALEGKDLKEILSGFHTAGPAVGGAAAAGGAAAASGEAAAEEKAEEEAEESDDDMGF
                     GLFD"
     gene            complement(<609450..>609731)
                     /locus_tag="CAGL0J06380g"
                     /db_xref="GeneID:2889535"
     mRNA            complement(<609450..>609731)
                     /locus_tag="CAGL0J06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447984.1"
                     /db_xref="GeneID:2889535"
     CDS             complement(609450..609731)
                     /locus_tag="CAGL0J06380g"
                     /note="weakly similar to uniprot|P01098 Saccharomyces
                     cerevisiae YDL130wa STF1 or uniprot|P01097 Saccharomyces
                     cerevisiae YDL181w INH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447984.1"
                     /db_xref="GeneID:2889535"
                     /db_xref="GOA:Q6FP60"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="UniProtKB/TrEMBL:Q6FP60"
                     /translation="MLRLNAINTLKQSKSVTPACQTAMRRYSNIPPPVGGFSSTGQSD
                     TFNKREKAAEDYFIKQHEKEQLKNLREQLKHHKEQLQDLEEKIEKITKN"
     gene            complement(<610975..>612270)
                     /locus_tag="CAGL0J06402g"
                     /db_xref="GeneID:2889536"
     mRNA            complement(<610975..>612270)
                     /locus_tag="CAGL0J06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447985.1"
                     /db_xref="GeneID:2889536"
     CDS             complement(610975..612270)
                     /locus_tag="CAGL0J06402g"
                     /note="highly similar to uniprot|Q12122 Saccharomyces
                     cerevisiae YDL131w LYS21 or uniprot|P48570 Saccharomyces
                     cerevisiae YDL182w LYS20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447985.1"
                     /db_xref="GeneID:2889536"
                     /db_xref="GOA:Q6FP59"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FP59"
                     /translation="MTANNNPYAPSPTDYLSNVNSFQLIDSTLREGEQFANAFFDTEK
                     KIEIAKALDDFGVDYIELTSPVASEQSYKDCKAICNLGLKAKILTHIRCHMDDAKVAV
                     ETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEIRFSSEDSFRSD
                     LVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSCDIECHFHNDTGC
                     AIANAYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRD
                     IENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIH
                     FANRLTGWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAE
                     ITTPQLRSINGQARTSAIDLQSLDTVEENEPAQKKARVD"
     gene            complement(<614059..>616977)
                     /locus_tag="CAGL0J06424g"
                     /db_xref="GeneID:2889537"
     mRNA            complement(<614059..>616977)
                     /locus_tag="CAGL0J06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447986.1"
                     /db_xref="GeneID:2889537"
     CDS             complement(614059..616977)
                     /locus_tag="CAGL0J06424g"
                     /note="highly similar to uniprot|P53091 Saccharomyces
                     cerevisiae YGL201c MCM6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447986.1"
                     /db_xref="GeneID:2889537"
                     /db_xref="GOA:Q6FP58"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008049"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FP58"
                     /translation="MSSPFPHDEETRGGPSSQPASSLGGFGSSSGFDESQVGSRLQFP
                     SSSQPHVPDSVGSNIPGIRDSSARDSSQFSSQRPYENEPEHEENEDMPMQGWRKRTFN
                     HIKKVEDVTGEKVREAFEQFLDEFTIQSSDTGELQKVYRAQIEFMKLYDLSTLYIDYQ
                     HLSMRENGALAMAISEQYYRFSPFLIKGLKRVVRKYAPELLLTSDSVKMQNEDDDLST
                     IDPSSMPRDSENSQQATKSTTTNSPEQTERLFQISFFNLPTVHRIREIRSDKIGSLMC
                     ISGTVTRTSEVRPELYKASFTCDMCRAMVDNVEQSFKYTEPTFCPNPACENRAFWTLN
                     VSRSKFLDWQKVRIQENTNEIPNGSMPRTLDVILRGDAVDRAKPGDKCQFTGVEIVVP
                     DVSQLMLPGVKPSSSLDTRGIARSSEGLNSGVTGLKSLGVRDLTYKITFLGSHVVSVG
                     SNMNPNENSSAETNLQFISKLQNNDIYSDREKDQEIFLSSLSPDEINELQDMVKDDHV
                     YDKLVRSIAPSVFGHEAIKKGILLQMLGGVHKTTVEGIKLRGDINICIVGDPSTSKSQ
                     FLKYVCRFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEF
                     DKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYNRKTSLRANL
                     NMTAPIMSRFDLFFVVLDDCNEKIDTELASHIIDLHMKQDEAITSPYSAEQLQRYIKY
                     AKTFKPVINKEARKFLVEKYKALRKDDAQGYSRSSYRITVRQLESMVRLSEAIARANC
                     SDEITPEFVAEAYDLLKQSIIRVDVDDIEIDEDPEEPEEIATDVQAAIVQENTDQQKS
                     DKQKVVVTYEKYVTMMNMIVRKISEVEKNEGAEMTATDIIDWYCVQRENDISSEEEYY
                     AERKLAYKVLKRLVKDRILMEIHGTKDNLDDDEDHDGNGKIVYVIHPNCEMFDTAQDA
                     "
     gene            complement(617289..617360)
                     /gene="tRNA-Gly (TCC)"
                     /locus_tag="CAGL0J06446r"
                     /db_xref="GeneID:2889538"
     tRNA            complement(617289..617360)
                     /gene="tRNA-Gly (TCC)"
                     /locus_tag="CAGL0J06446r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2889538"
     gene            complement(<617932..>621129)
                     /locus_tag="CAGL0J06468g"
                     /db_xref="GeneID:2889539"
     mRNA            complement(<617932..>621129)
                     /locus_tag="CAGL0J06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447987.1"
                     /db_xref="GeneID:2889539"
     CDS             complement(617932..621129)
                     /locus_tag="CAGL0J06468g"
                     /inference="similar to AA sequence:UniProtKB:P38426"
                     /note="similar to uniprot|P38426 Saccharomyces cerevisiae
                     YMR261c TPS3 or uniprot|P38427 Saccharomyces cerevisiae
                     YML100w TSL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447987.1"
                     /db_xref="GeneID:2889539"
                     /db_xref="GOA:Q6FP57"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR003337"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FP57"
                     /translation="MTIIVASLFLPFQPQFEVNADQEQTAELVDSKLVKISGEQEAHA
                     NKNLPDVRVQETDAYATAATQPFLNSRTPLALSSAASQLNVKQGPLSSEQFLENLTAN
                     ATTAGTPVNPNLGVHGHASAEDFFTTNNSTAINNNASSPPFSVSSIAPEINANVDGTD
                     TMDVTADLLDNVNKSLLLHSVLNSGQGVSSPNAVEGHTATHLTNPNTTVITPKSRAVP
                     ESNPGVVNFDNYKERRDSQSNSAFPSMKRVASGSHGPSHLKYSQNAIDAALESDVIDD
                     ADDRQNSEAESDYETDRKVHYNVPGFGGYSSTSKRLKNSLEIFSRVPWKIVPSRKGNG
                     ALKNAINTSILEKDIKDGVKWVGTLGIPTDEIPVETTKKIVKDLNENYQSSAVIADDV
                     TFKGAYKNFCKQILWPTLHYQIPDNPNSKAFEDHSWNYFQRLNQYFAEKIVSIYEDGD
                     IVWVHDYHLMLVPGMVRQKLPNAKIGFFLHVSFPSSEVFRCFAQRENMLEGILGANFV
                     GFQTAEYARHFLTTANLLLTADVSGDHLRYKGKVVSVKSTPIGIDAFDLANQLLTDPV
                     TKWRQLIRQRWAGKKLIVCRDQFDKIRGLHKKLLAYERFLRENPDYIEKVVLIQICIG
                     KSSDPELERKVMVVVDRINSLSISISVSQPVVFLHQDLDFAQYLALSSEADLFLINTF
                     REGMNLTCHEFIVCSREKNSPLLISEFTGSAELLKDGAILINPWDTRHLAKCIKMGLE
                     MPLDERKRRWKIMMKSLINNDSTNWIMSNLQAIEHCWEFSKESSTLFSLSSEELASEY
                     QSASNKLFILKISEPPSPRMLAILRELSSRCTVYIMNTFSKTTLENLYGRVGNLGLIA
                     EGGAYVRLNGTWYSIVDHVDWLEEVTKILDTKIERLPGSYYKLADSMVRFHTENAEDQ
                     DRVASVIGEAMTHINTLFADRGIHAYVHKNILFVQQKELSLETTKFILKFHNSGKVYN
                     TGHSTPSKHNNEMSAMFSGQSDTIDFICVAGSTSPTIEPIFKLVKDATLAGNLRYGHT
                     IVYGDAPSTYAREHTSGWNELFNIFQDLAKSNERQ"
     gene            <621951..>622415
                     /locus_tag="CAGL0J06490g"
                     /db_xref="GeneID:2889540"
     mRNA            <621951..>622415
                     /locus_tag="CAGL0J06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447988.1"
                     /db_xref="GeneID:2889540"
     CDS             621951..622415
                     /locus_tag="CAGL0J06490g"
                     /note="some similarities with uniprot|P38428 Saccharomyces
                     cerevisiae YMR264w CUE1 or uniprot|Q04201 Saccharomyces
                     cerevisiae YML101c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447988.1"
                     /db_xref="GeneID:2889540"
                     /db_xref="GOA:Q6FP56"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:Q6FP56"
                     /translation="MDLSTKVFLGLLVAFILVVKRYLNQPTHKNINKTVDISNDGEEI
                     DKDVLVSGKDQKTVKRRRKRRVTEGMIEIVSTLAPHLDVEQIKYDLEKTGSVELTVER
                     LLKGEEFEFPPKEDESSTANNSKSNEEPQNEEDYYEDYHTETDSSDSEDDDD"
     gene            complement(<622640..>624277)
                     /locus_tag="CAGL0J06512g"
                     /db_xref="GeneID:2889541"
     mRNA            complement(<622640..>624277)
                     /locus_tag="CAGL0J06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447989.1"
                     /db_xref="GeneID:2889541"
     CDS             complement(622640..624277)
                     /locus_tag="CAGL0J06512g"
                     /inference="similar to AA sequence:UniProtKB:Q04199"
                     /note="similar to uniprot|Q04199 Saccharomyces cerevisiae
                     YML102w CAC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447989.1"
                     /db_xref="GeneID:2889541"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FP55"
                     /translation="MEATNLQIYWHESQPVYSITFRGSQADDDNDDENFNEKGELFTA
                     GGDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASAGDDG
                     QVLLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLRGTANDLDNMPGGGASEIYDLSW
                     SPDDKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSI
                     NIYEIELRDSKDITSSTTSTELIKRLKLKNRIFKSELPFIDEDASSRKIDYSVQKSSY
                     LYHNETLPSFFRRLVMSPCGSLLVVPTGLIKNHPTSTSIGTKDDGEESSQSNSINTSA
                     SSDFNNAVFIYTRAAIKQNLGKPSICLPFFKKPAVAVAFSPIFYERTSNKPYVDLPYK
                     LVFAIATINQVIFYDTENIEPISIVSNLHYTPLTDLTWSPRGDMVMVSSTDGFCSAIS
                     INTAVFGRRTKKPSFTNTIVKEEISLNREDASEVKQPKRSHDIINILPVRKKSKVDTN
                     KSTTDSASTPDATGNDKENKDDAKTLEIIKNTETENS"
     gene            <625604..>630616
                     /locus_tag="CAGL0J06534g"
                     /db_xref="GeneID:2889542"
     mRNA            <625604..>630616
                     /locus_tag="CAGL0J06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447990.1"
                     /db_xref="GeneID:2889542"
     CDS             625604..630616
                     /locus_tag="CAGL0J06534g"
                     /inference="similar to AA sequence:UniProtKB:P52593"
                     /note="similar to uniprot|P52593 Saccharomyces cerevisiae
                     YML103c NUP188 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447990.1"
                     /db_xref="GeneID:2889542"
                     /db_xref="InterPro:IPR018864"
                     /db_xref="UniProtKB/TrEMBL:Q6FP54"
                     /translation="MMAMTMEYRDVAGFLNSIEDDAINKEHINAVSAFLEKNKRQLLE
                     LQLGSNESTKHNDNNDTKRIIARKILGYDYDFEGSNEYNLNEFLEKELLERNSMVDIM
                     VDLNTRRHICDRYIPDLNVNNAKNEDSLTGRISTVIDVLLNTLTATNSVDECVLQCMD
                     HLEELHLDNEDTIQDIIDLIINYNILYCFKLLKLLTLYIINRNVAVSLTQKWFSNFSE
                     IVNQVTLISSTHSNRRFLDNTERSMVDTLFIAKLESTISIVSIVFLGLSSAREDSNLN
                     MDTDFLHDVATFELVHSVLLDEMHKKRMPIVLYMWSFILCAKSIIAEDDSDEITSINE
                     LDFIRKCFPQDSIHSMSILFAKNAEDIGLLAKFLETSNCIRNDNIFTTLFASFMTLSV
                     NFIPFTASTTKIIKSVLNDLPRGVIENFISNNAFITKFDTIKAKLPLIDEGLLPFINL
                     TSINEELAEFNWEAFGSYAVKMPLGSIDYDVADRSNSNDSSTLEQIQLSSEVLVKPPF
                     EQDDDVLMPLPKSTKAFIVADVPAITSGKEHTKDSIVKYNSEDGSSNFTTNNVTNETL
                     LVFDYQYNGWSLLGRILQNLSILYTVKGNDINYEQKEFMIAAISLLSNIMSSTIPVDH
                     SIKILESLSSQLSKPRDDDIISVVFKIFERALHKRNYELLCICASFTNVLVRRFPHFV
                     WAYLSTSDLLDHYGKSGLVNIILGSIELTNGEYDFTISIAKMTVGLIDDAVTTSLYSD
                     SGVPLKTKKSILSNLIVHLLNVYESFQFWKYSKSIEQRFELSLELTKAFSKILYFVHG
                     IDSETPPENKITNVLSKAADTITNAFLVPDSYDPPVVISLINTITSPKNKTIYIFGNG
                     LFDELYDHVVQKAYDLANLLVSIRGVSKLNASSLERMLFCQSPKLIDIYLTKPTLKIS
                     IVKLLNSLVGVPWSSEYPFLYSYLGHTYSEKFLSSIIKDLTTTLQDYQLAKTLYVFFG
                     TLIRSKQDGLSILFLTGRAPDKAISSSLKNTSKDNQISILNVLKNNAKKMDQYPETTC
                     CYLLEAISYAFNTWSNARNLDEDNDFIVSLLNKLENLMDATVGTNSSDDSQVTHDKEL
                     KRRYKLIARIVEIFALYIFTSKNPNSDLMSLLESDKIVPHLQKFFLIEGYQSDLQTNL
                     EKNISEIWNKAELSMFALSPIAKTFINFDDNIFDISILDQCLGNDSSWTGTDSIRNQI
                     IDASSNLQSTVAQVAAAKSWGALITAFIKRKNSIVPECYMSLLSDLLQYNIEYGVEAP
                     IFTDVYMERLELVFFFLYNIHNNGQQLPDKNIQKLLAQLLEILKSPEVNFLTNIPENT
                     GSLLYRPILRSILLLLSMVKDGPQFVELNADLLIQTNEESFCKGLYLLFSNILSEINS
                     MKATSGQYSIANIDEKIQDISLLLNIVVKTQELNPSSEFNSIFASSLYEVGTLQVMLN
                     LYSSSHLYLVNDEPILGQLSLSIIAELCMIREVAEKLITNGLFTVLVESPLSVALQRN
                     AIKTSSQPRIHYIWSNGLLSITLILLSNFGSKILPETYLFISYFSNQIGNVLSSWFDS
                     NMSVSTALVNETKQIILLQKMLEAINKVNSVSTSRNNSTVQNPDNVKQIPGLVSEQDY
                     KQLNSALKKLLTHPKYLNSRIVASTTDEQHMLEEISRRNELSTIISNQIKEIQDLLFE
                     TL"
     gene            <630978..>634214
                     /locus_tag="CAGL0J06556g"
                     /db_xref="GeneID:2889543"
     mRNA            <630978..>634214
                     /locus_tag="CAGL0J06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447991.1"
                     /db_xref="GeneID:2889543"
     CDS             630978..634214
                     /locus_tag="CAGL0J06556g"
                     /note="weakly similar to uniprot|Q01846 Saccharomyces
                     cerevisiae YML104c MDM1 intermediate filament protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447991.1"
                     /db_xref="GeneID:2889543"
                     /db_xref="GOA:Q6FP53"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR003114"
                     /db_xref="InterPro:IPR013937"
                     /db_xref="UniProtKB/TrEMBL:Q6FP53"
                     /translation="MQKLPSVFGFAILLFVPSLFRNGLLILCILSLAIIFLLCSIIKL
                     QNFITGSHFKSKRINEIVSCHKNILPNNVATYKSKFITIDKYPRTASEIREIIEFIVT
                     DFIQSWLLRIEKDNDQSLPNLIQSLLENTTDKIATIQADKNIVDIISTKCIPKITKHI
                     NIYKRCVTTEANLKRQTTLHKNSLHLAVEFNKYQKFHRNVSLRNHILDDSVKNYCLDK
                     AQLIQKRILNENEASSTIVSSLVKEILAGSVLYPLINKLINPYDINLQIISMSERILK
                     ETKQVSRIRQLLNEETDTSGTTEELINNAKVWWLFKELPINNKQYELSLRYITTCGQI
                     VPLHNIGYVLLLCFGILDDNIDKKASKQRLLLMLNLVEMRLKTFNSKLIYGPSLSSKV
                     LNSKNSWRESTQFVKNFISTITFADIVQQNELILFFEEFLANENNINLKPLLSFICES
                     NLILTPLDDSYEEDQSIVEPLAFYRQLKQFITETMIHALRNINAERTDNIMNFMSQNE
                     PDMNIYFIDCLKSIRFLNNLVENILKQYFEQFKSSASFLNMITSSKFFQTNVYIKGIL
                     EFSLRQKSEDYSQENATNMGTKNSRIDQKLESIIFENGILANDLPKRNVEDSTLANAL
                     LDNYDKDKSIDDIQLSVPQESKELLFRPGLKSFKDIKEAIADLTLKINQTEKEDEILD
                     HLLLKAELINDKEQLRILSKSKRAMKKDIERMDVARQLLLIQESSNALYGTTEVSISS
                     FYEDVDEGGKKLITFYLVNVKRQNGDKSTSWEVSRRFNEFAVLYKYLHANYSKKLKKL
                     DLSFPSKIPITENYNIAKVDICNERRIKFELFLNQLLQIQEICEDDLFRTFLTNPLSF
                     SINRNPEELPLINNSQSYECIPELSLMDEGLRSTDDLVYDNKYLTSHYAKVPTSNETK
                     STVKIISEFFIAIFSSRTNSRWLRGRAIVTLLQQLMGSTIDKYMKEQGDKWSSDSHVS
                     DLLASLKFLLWGPNGTFRRPKVDKKEISSNEKRKVEIKAFQMMQTLFIEQFGTFIGYQ
                     RSKEASKSLHEMLQNQYLNCNLVFELFDDIIDEFLLRKEELETNKITM"
     gene            <634596..>635390
                     /locus_tag="CAGL0J06578g"
                     /db_xref="GeneID:2889544"
     mRNA            <634596..>635390
                     /locus_tag="CAGL0J06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447992.1"
                     /db_xref="GeneID:2889544"
     CDS             634596..635390
                     /locus_tag="CAGL0J06578g"
                     /note="highly similar to uniprot|P29478 Saccharomyces
                     cerevisiae YML105c SEC65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447992.1"
                     /db_xref="GeneID:2889544"
                     /db_xref="GOA:Q6FP52"
                     /db_xref="InterPro:IPR002778"
                     /translation="MPKLEEIEDYDDIDNMDMDLAELDPTLNTPIAPKITPTVVRSQD
                     IEEEERKKQYAGSNKEMISFINPQTGKVEESAPITKQELDEVKKFQVLYPCYFDKNRS
                     HKEGRRVPIEMAVENPLAKTISDAVREYGLLSIFEGDKCHPQDFGNPGRIRVLLKEEG
                     KLVPSASKFSGGKRQLMKLVAEYLQKHPTTVESLRELPYGPDFDNIEFKKIPKVKGFK
                     MNDIVPLHSPYLWGHPMTKSIYEAPKIEAPEKQFKAPKNKFKVVRR"
     gene            complement(<636175..>636846)
                     /locus_tag="CAGL0J06600g"
                     /db_xref="GeneID:2889546"
     mRNA            complement(<636175..>636846)
                     /locus_tag="CAGL0J06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447993.1"
                     /db_xref="GeneID:2889546"
     CDS             complement(636175..636846)
                     /locus_tag="CAGL0J06600g"
                     /note="highly similar to uniprot|P13298 Saccharomyces
                     cerevisiae YML106w URA5 orotate phosphoribosyltransferase1
                     or uniprot|P30402 Saccharomyces cerevisiae YMR271c URA10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447993.1"
                     /db_xref="GeneID:2889546"
                     /db_xref="GOA:Q6FP51"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FP51"
                     /translation="MPLEDYQKNFLELAIESQALKFGSFTLKSGRQSPYFFNLGLFNT
                     GKLLSNLATAYAIAIIQSDLKFDIIFGPAYKGIPLAAIVCVKLAEIGGSKFQNVQYAF
                     NRKEAKDHGEGGNIVGAALEGKKILIIDDVMTAGTAINEAFEIIAANQGQVVGSIIAL
                     DRQEVVGSPDSTDSMSATQAVSKRYNIPVLSIVSLSHVINFLDGRITAEEKQKIEDYL
                     QKYGA"
     gene            <637316..>638311
                     /locus_tag="CAGL0J06622g"
                     /db_xref="GeneID:2889545"
     mRNA            <637316..>638311
                     /locus_tag="CAGL0J06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447994.1"
                     /db_xref="GeneID:2889545"
     CDS             637316..638311
                     /locus_tag="CAGL0J06622g"
                     /note="weakly similar to uniprot|Q03760 Saccharomyces
                     cerevisiae YML107c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447994.1"
                     /db_xref="GeneID:2889545"
                     /db_xref="GOA:Q6FP50"
                     /db_xref="UniProtKB/TrEMBL:Q6FP50"
                     /translation="MQANKLMDLEARLLRLSRELDSYHGHLVHRNEAVPRTAERIVKR
                     RKYRSCGPLKSNRFLSSKNMKFRKLYENLVETEKEKTHLQYTLAEILEKYQHLLDGTK
                     YLDIEWSKLTNPLTLVANGWSMHRIVDRKAPDAGETHNSLICTCSNCHQLISFNCDKT
                     SMDLSDKLALRGWLTDSHLKDCSWRHYQFPLERDYYLNKHNLLAEFLCLQKLNLRATI
                     EVDIFYRNSIDQIRYCFNIKDENNLKLFLRGFWSSNPSHTIKDFVTCQYCCCRSALTS
                     LSKNDHVGHYPWCRYQDQDQLYHLIEDAIHDSSYIVKELPIVARLNKLEKTLEKL"
     gene            complement(638437..638508)
                     /gene="tRNA-Gln (CTG)"
                     /locus_tag="CAGL0J06644r"
                     /db_xref="GeneID:2889548"
     tRNA            complement(638437..638508)
                     /gene="tRNA-Gln (CTG)"
                     /locus_tag="CAGL0J06644r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2889548"
     gene            complement(<639077..>639415)
                     /locus_tag="CAGL0J06666g"
                     /db_xref="GeneID:2889549"
     mRNA            complement(<639077..>639415)
                     /locus_tag="CAGL0J06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447995.1"
                     /db_xref="GeneID:2889549"
     CDS             complement(639077..639415)
                     /locus_tag="CAGL0J06666g"
                     /inference="similar to AA sequence:UniProtKB:Q03759"
                     /note="similar to uniprot|Q03759 Saccharomyces cerevisiae
                     YML108w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447995.1"
                     /db_xref="GeneID:2889549"
                     /db_xref="GOA:Q6FP49"
                     /db_xref="InterPro:IPR015080"
                     /db_xref="UniProtKB/TrEMBL:Q6FP49"
                     /translation="MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQI
                     DEIDLLNKWFDKFDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQN
                     NVEDEDEEDA"
     gene            complement(<640041..>642527)
                     /locus_tag="CAGL0J06688g"
                     /db_xref="GeneID:2889547"
     mRNA            complement(<640041..>642527)
                     /locus_tag="CAGL0J06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447996.1"
                     /db_xref="GeneID:2889547"
     CDS             complement(640041..642527)
                     /locus_tag="CAGL0J06688g"
                     /inference="similar to AA sequence:UniProtKB:P54786"
                     /note="similar to uniprot|P54786 Saccharomyces cerevisiae
                     YML109w ZDS2 or uniprot|P50111 Saccharomyces cerevisiae
                     YMR273c ZDS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447996.1"
                     /db_xref="GeneID:2889547"
                     /db_xref="InterPro:IPR013941"
                     /db_xref="UniProtKB/TrEMBL:Q6FP48"
                     /translation="MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLS
                     IGSIDLITDPELNVTVTGTEREDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASID
                     RTRVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNL
                     KKPKNEEQSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEE
                     EVSNKENINENGRLRGSIVRRPSKLRKSYTEFSSEDLELLDKALSNNRIISTRNTTNS
                     KRLSLKEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQ
                     SEDADDDTFATAVVGNSHSLASNTSSLRRSKFNTYRVKAGQQRGISRSNYIDSTNRTD
                     NLIARHTWETPLKDSYDEHSTSYHNKQHSILDSNIPVVTTVSDDNHDISGSSFSQDSS
                     MVSSDSTSNSILNRPEHSYSYVSEKLDREIEKTDQFSNLGSSENKIDEPTVDTKRPSL
                     EHRITGATEIKDKNLEQSAISNHQTIQKNTFIEKKERLDKKISNLFKRKKGKKTDNVL
                     EADVPLEKDNCYDIISSESQEEIGNVIPRTTSPESIRGGSLISFTNSADDIDVKSYQS
                     DNQQRRLSDEVVEYVQELEEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSINQS
                     YSLHTDEPNKVGKPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRL
                     GINVERAIYRLSHLKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSS
                     PDNKVVELEGSNYNTAHNQSDGTILIPELQ"
     gene            <644531..>645397
                     /locus_tag="CAGL0J06710g"
                     /db_xref="GeneID:2889552"
     mRNA            <644531..>645397
                     /locus_tag="CAGL0J06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447997.1"
                     /db_xref="GeneID:2889552"
     CDS             644531..645397
                     /locus_tag="CAGL0J06710g"
                     /note="highly similar to uniprot|P49017 Saccharomyces
                     cerevisiae YML110c DBI56 ubiquinone biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447997.1"
                     /db_xref="GeneID:2889552"
                     /db_xref="GOA:Q6FP47"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR023576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FP47"
                     /translation="MFLTRRSAIAARRLTSNIKLCAWNSTQSNNTTHFGSKTVPVEEK
                     EKLVGDVFSSVASKYDLMNDVMSLGIHRCWKDHFIHKLDAGKRPNSTEPLNFIDVAGG
                     SGDIAFGLLDYAEEKFHDTESTMDVVDINPDMLKEGEKRAMENKKYYNDPRVNFMVQN
                     GEVLDKIPSDSKDVYTISFGIRNFTNIQAGLNAAYRVLKPGGIFYCLEFSKIENPVMD
                     LAYQQWAKLLPVMGSIVANDYNSYEYLVESIERFPDQETFKSMIEKAGFKSVGYESLT
                     FGVCAIHWGVKV"
     gene            complement(<645658..>648627)
                     /locus_tag="CAGL0J06732g"
                     /db_xref="GeneID:2889550"
     mRNA            complement(<645658..>648627)
                     /locus_tag="CAGL0J06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447998.1"
                     /db_xref="GeneID:2889550"
     CDS             complement(645658..648627)
                     /locus_tag="CAGL0J06732g"
                     /inference="similar to AA sequence:UniProtKB:Q03758"
                     /note="similar to uniprot|Q03758 Saccharomyces cerevisiae
                     YML111w BUL2 or uniprot|P48524 Saccharomyces cerevisiae
                     YMR275c BUL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447998.1"
                     /db_xref="GeneID:2889550"
                     /db_xref="GOA:Q6FP46"
                     /db_xref="InterPro:IPR007519"
                     /db_xref="InterPro:IPR007520"
                     /db_xref="InterPro:IPR022794"
                     /db_xref="UniProtKB/TrEMBL:Q6FP46"
                     /translation="MQSPEKPGRRRRPPLFTLSTDSSINTSNRSNRAENESSNHVKFP
                     LSPPRAHHHETELGNARLSEEQERRRASTTNIANMRRKHIKEINVYNTPNPNDLDALC
                     VAKSSTELNQMNTDSKDPNMIIDVLPSFEFYNVLHKHIPQGNVDPDIHDFPPTYQEVQ
                     TQRLPALQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSS
                     LQPYSTRHYSLNPNQNNPLHPTVSGSTAVNDNTNIEDDVNDADNIAIDKLYSLPKFST
                     PLEIDIRITKHVPKPHEKPEEESVLKEFTSGDIIHGYCVIENRSTQPLKFEMFYVTLE
                     AYISIVDKQKGKRTIKRFLRMVDMSASWSYSSMQVSSGIEYVPGDVDFDDSILGLSNS
                     RTFLPKTKYKKYFMFKIPDQLLDVTCRQEIFPHCSLPPSLGIDKWKDNGKYSIIKVNN
                     VLGCGHLGTKGSPILTNDITDENLSINYTIDAKIVGKEKKTSKLNIMREREYNLRVVP
                     FGFNTPSPVQSNLRSKSQLKELKRLLNERIAALERVFERLKKNEPIQNADIYGTDISG
                     TIDSETDLDVREHLERKLNQLHVRNRIEESDSWSGLKRMSQPDNLVESELRYQIKSRK
                     LNSGTNIANSLFSGFKSSSSMSSLKSSSSSSNSETGKILDGSSSHLKKHLKHSDKTGL
                     ITLSTTIPTKAVKYWSPSLFRKTNTFESKNKHDQENWVRLIDLLSEEEKTPLENVNVK
                     LKCFVSNNGPIHQPPGIQIITTSLICITASSDNSIPIQLSSKLLYNEENVTTLKKTFT
                     DYNKKITEYKALFEENEEKLNILYHGNSMLSQTNRGLKFTDFIPTNLHNDVESLMELH
                     VDVTELHQVFRKQSFFTKSTSSNDSYFNFSLSSSETIGNNASSPSEIIDANNSPKPTK
                     SETSASGWRSTGKFTFERDVNVHLSLDPHMKETLPPNFESCLCTRFYVVRVCIKFDHH
                     IGTATLDIPVSVKRITT"
     gene            complement(<649591..>650640)
                     /locus_tag="CAGL0J06754g"
                     /db_xref="GeneID:2889551"
     mRNA            complement(<649591..>650640)
                     /locus_tag="CAGL0J06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_447999.1"
                     /db_xref="GeneID:2889551"
     CDS             complement(649591..650640)
                     /locus_tag="CAGL0J06754g"
                     /inference="similar to AA sequence:UniProtKB:P46963"
                     /note="similar to uniprot|P46963 Saccharomyces cerevisiae
                     YML112w CTK3 carboxy-terminal domain kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_447999.1"
                     /db_xref="GeneID:2889551"
                     /db_xref="GOA:Q6FP45"
                     /db_xref="InterPro:IPR024637"
                     /db_xref="UniProtKB/TrEMBL:Q6FP45"
                     /translation="MDSFEARLQFIQVIKNLQKSLNVSKEDTDGTLGIGLGSGQSSGA
                     NSVSHSGSYSNIQELDDTTIGTQVSKSMSDPLQFYLKHYAHHYEDFHQCLFDTGLKMD
                     PLHRLNIVIFYYQIILALVAEMKKRKLDTSSLQATVVYEHLIPSMPRIFEICLPKDDW
                     KALSNLKSCTDIYYNLLRLLKTLPGYQLEMSPEEMTLSEYTMDSEEVIQAMTQPTSEL
                     DWKTIANDDKPQNVSQSILWTRELLNDRMIKKYVVFKTFVTNGVCNLKNSHNSSTSNN
                     NVSNILHRMENDRERHKRQKENNWVVERVSQSMLDENEFKAAWNSITSLPSLSRSDQK
                     DIRQLHTIARGSYLI"
     gene            <651309..>654392
                     /locus_tag="CAGL0J06776g"
                     /db_xref="GeneID:2889554"
     mRNA            <651309..>654392
                     /locus_tag="CAGL0J06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448000.1"
                     /db_xref="GeneID:2889554"
     CDS             651309..654392
                     /locus_tag="CAGL0J06776g"
                     /note="highly similar to uniprot|Q02932 Saccharomyces
                     cerevisiae YPL125w KAP120 nuclear transport factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448000.1"
                     /db_xref="GeneID:2889554"
                     /db_xref="GOA:Q6FP44"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FP44"
                     /translation="MSGIMLTELNLVEVLQQASDMQHMGTERQRMAESQLKAWETQPG
                     FHFLLQSIYLDLSNGLHVRWLAVIQFKNGVEKYWRATRINSIGKDEKASIRKRLFDVV
                     DEQNNQLCIQNAQATARISRIDFPVEWPNLFESIEQLLNINHRKEIQTHNILMHLNQI
                     IKILGSARIGRCRPAMQSKIPLIFSLVVRIYLESFDEWTHSNVADGDILSKLQISYLA
                     LKVLRRMVSDGYEYPQRDETVCEFMKLSITHFDVLIANHENFKKFDLYEKFIKCFGKL
                     YFNLVTASPANFILIPSSSQILISYTSFLLNKAQFVYQENPDVTGDFWEQVAIRGIMI
                     IKRVINFVSKKGAVTIKARSDKPNIDAAITKINNEYLNENLIKKMVDTLMEWYLKLRA
                     TELDNWFMDPEEWINEQMASSYEYQIRPCAENFFQDLINTFPELLASYLLNKIETSAS
                     TLSDSLEDFLRKDAIYAAFQLSASAVSEMVDFDRLLPTVFLPEAAGSNTPGERLKIIR
                     RRVALIINEWSIVKCSEESKNLCYKFFAEMLATEEDKVVLLTVVQSLRTMLDDWNFNK
                     DNFEPYLNSVASLLLRKILPSVSLTETRLYVLNTMSDLIIQTKSLIGQDMLIEILQIV
                     PNLWNVATNETTESILCNSLLRLLRHLATSLGAFSYMTWEISIPIVMTSCNPSSKDYQ
                     LLNEDGFELWSVLLQNYSPEKQQLDTRFTEFLPYVSSAVECHTEILPTLLEIIKSYAL
                     LLEPSQFFAHPSVAEVFRKLSQYLLKLREDSFQLVLEIWEILTLCNESNNESLLIENF
                     YSNGIFIALFDAVLLEEALSSYQCLQVLQVISRITYVNPSAVMNFLTSYHSNLPLMEQ
                     NMQLPVTERKLVSSDMSYDDVVRKFISVWVVCFKDVYDPKQKKVHILGLSSLLRTGLV
                     SVIGEFPAIASIWIEMLEEIKETNDGDCEKYHLNDIVTEQSLEFYPISCEQLRYHQLV
                     KNNDPTHNISLRDFISQTMQFLETQMGSQEYQAFLNSNNPTLLENLQLFLSIQQQ"
     gene            <654817..>655521
                     /locus_tag="CAGL0J06798g"
                     /db_xref="GeneID:2889553"
     mRNA            <654817..>655521
                     /locus_tag="CAGL0J06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448001.1"
                     /db_xref="GeneID:2889553"
     CDS             654817..655521
                     /locus_tag="CAGL0J06798g"
                     /note="some similarities with uniprot|P33419 Saccharomyces
                     cerevisiae YPL124w NIP29 nuclear import protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448001.1"
                     /db_xref="GeneID:2889553"
                     /db_xref="GOA:Q6FP43"
                     /translation="MVVGPISNLRDDALKDDTLNHIRKEYLESKKQISNLLSQETNTN
                     EFSRKPYPNSSPIRKFDHFANERPTTIDAKLREQLRTGASDVAIEQSLRTNSDESRNQ
                     MIYDDMKVMKRIIDGQQESIRELRRALEQERYMNSELQRKYNEMERRFDRLEWFINSH
                     DKFQAYQDIRSNTTKKDFSDPIFNNGLKRRWDEYPIRSFEPDTNINRNNRIFSNYDDS
                     TTRLMQITDPHYRSVG"
     gene            complement(<655589..>656890)
                     /locus_tag="CAGL0J06820g"
                     /db_xref="GeneID:2889620"
     mRNA            complement(<655589..>656890)
                     /locus_tag="CAGL0J06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448002.1"
                     /db_xref="GeneID:2889620"
     CDS             complement(655589..656890)
                     /locus_tag="CAGL0J06820g"
                     /inference="similar to AA sequence:UniProtKB:Q02933"
                     /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
                     YPL123c RNY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448002.1"
                     /db_xref="GeneID:2889620"
                     /db_xref="GOA:Q6FP42"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /translation="MILASVLKAFQGLQTGLQHSYQDGSPSCPINLPLSCGNETAISD
                     LCCFEYPGGILLMTQFWNYAPSKPNLNRTELEEELGPVDSFTIHGLWPDDCMGGYPQF
                     CKRDLFIDDVDYLLKSDAFNNDDTLPIQGEELLNNLNKYWKSNNGNHESLWIHEYNKH
                     GTCLSTLQPQCYSRWNPTTSQKGPKYYKKKAVYDYFRISYDLFQKLNTYEMLAKHNIT
                     PSNDTSYTKSEILSALSSEFQGTQAHINCNSQNALTEVWYYHQLNGSILNEDFIPLDP
                     LRSMSRCKDQGIKYYPKGYQRRDNRGPNKKPISRGTIRISQYGGFLIKTGRWMKRGTP
                     ANFELIESKYGNYLLKSRMGYCTVHNDKSQLDCSSRSPDYATQFDYNEEKGILGYSGS
                     FEWGAESAPKNGRTSRSVVFAVSNEKNSNLKYKFQLKFNRK"
     gene            complement(<657226..>658740)
                     /locus_tag="CAGL0J06842g"
                     /db_xref="GeneID:2889621"
     mRNA            complement(<657226..>658740)
                     /locus_tag="CAGL0J06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448003.1"
                     /db_xref="GeneID:2889621"
     CDS             complement(657226..658740)
                     /locus_tag="CAGL0J06842g"
                     /note="highly similar to uniprot|Q02939 Saccharomyces
                     cerevisiae YPL122c TFB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448003.1"
                     /db_xref="GeneID:2889621"
                     /db_xref="GOA:Q6FP41"
                     /db_xref="InterPro:IPR004598"
                     /translation="MSFSGLKHSITQYLEEIPSQVQTRLYKSPATCLAIYRLLPTLAK
                     FFIMTVIFNDKDISLRDLDRWVKSNGKLQFQEAIKSMKSLHLLIPTRVNGQLLINLNP
                     TFRESFRNALTGGEVNNSFGIVVDEDRLDTVVNLAVLDEYAATKWETILHFMVGTPMA
                     KMPSENVLNLLKHSKLMEEVPDSSEFMITNEGFQFLLQEVNSQIWSLLLQYLKLAESL
                     HMDPVHVLNFIFMLGALETGKAYSTENLSETQLKMLLDMRDYGLVFQKTSNPNIFYPT
                     RLAQMLTSDTKSMRTASGAMESVLNKPDDAAKSTDDKYDSLEGKAEDIQDGALIIETN
                     FKLYSYCNSPLQIAILSLFVHLKSRFANMVAGQITRESIRRALINGITADQVIAYLES
                     HAHPQMRRLAEEKLQKKLELDPNCKDPLQVLPPTVVDQIKLWQLELDRVLTYEGSLYI
                     DFDTAQDFNMLCKYAQDIGALLWKDDRKRKLFVSREGNAQVLEYAKRKIKKKEE"
     gene            complement(<659025..>659657)
                     /locus_tag="CAGL0J06864g"
                     /db_xref="GeneID:2889555"
     mRNA            complement(<659025..>659657)
                     /locus_tag="CAGL0J06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448004.1"
                     /db_xref="GeneID:2889555"
     CDS             complement(659025..659657)
                     /locus_tag="CAGL0J06864g"
                     /note="weakly similar to uniprot|P32489 Saccharomyces
                     cerevisiae YPL121c MEI5 meiotic protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448004.1"
                     /db_xref="GeneID:2889555"
                     /db_xref="GOA:Q6FP40"
                     /db_xref="InterPro:IPR018468"
                     /db_xref="UniProtKB/TrEMBL:Q6FP40"
                     /translation="MEDTFIGDDTTLLESASQPGEKPSVKTVNNGKVLKPRNENIKRH
                     RLILSEYRRKIRDEEKDIRELKQAIKIIEEKKLEHLMSLIEKWREVSQKTLSYMQYST
                     VLKIDKMGGFKKYMERELENKLLEIEDEYTRFEEEMGSFLESDEFERLSEEQQEEYKD
                     QINSRRYDLEKLKLQKAKEIEKEYENVDDVFTLQELTKLLKIDYKLIFPH"
     gene            <660284..>661822
                     /locus_tag="CAGL0J06886g"
                     /db_xref="GeneID:2889623"
     mRNA            <660284..>661822
                     /locus_tag="CAGL0J06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448005.1"
                     /db_xref="GeneID:2889623"
     CDS             660284..661822
                     /locus_tag="CAGL0J06886g"
                     /inference="similar to AA sequence:UniProtKB:Q02948"
                     /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
                     YPL120w VPS30 involved in vacuolare protein sorting and
                     autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448005.1"
                     /db_xref="GeneID:2889623"
                     /db_xref="GOA:Q6FP39"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:Q6FP39"
                     /translation="MNDLQFDSLKVFKCQNCHLPLQVDPTMLHLSKSQRELLLPREDR
                     RPGVEEFNLRQESQDMLKKVKTGKEAKQLLKEDFQSSDFLFLRDIDDSIAEKDLKKGL
                     EGDNDDRKSNEDSMVSELDVEDTAKTLSTQIERLSKLFEIMSTSESNIDYPICQECCN
                     IMMKRLKTDYEKAVKERDLYFQFVKRIEKQQLDESDSSQLSLRQKEYTDQTKKINQER
                     ERLLLELTKKEQVEEELDAEIAELTRQISEKKANERATRKIDNAKQWDKMKLLNDISS
                     LQYQYETELNKLDQLRKTNIYNESFRISHQGPFATICGLKLGSYEDHKVSYSEINAAL
                     GQLVLLLMTISSSLNIKISGYRLQPIGSTSKVSKFLADKEDWETYELYFSSNFSLEKI
                     FKRETDFDKGMESLLDIVKQISLSFSTVVSSDTDINIQDERTRSNDSMLNGGANRNAN
                     LRADRLFTESELPYMIDGDRINGISVKLYGAEPNLEWTTAMKFLLTDAKWLLVFCSSK
                     LSLQ"
     gene            complement(<662041..>663855)
                     /locus_tag="CAGL0J06908g"
                     /db_xref="GeneID:2889622"
     mRNA            complement(<662041..>663855)
                     /locus_tag="CAGL0J06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448006.1"
                     /db_xref="GeneID:2889622"
     CDS             complement(662041..663855)
                     /locus_tag="CAGL0J06908g"
                     /inference="similar to AA sequence:UniProtKB:P24784"
                     /note="similar to uniprot|P24784 Saccharomyces cerevisiae
                     YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
                     YOR204w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448006.1"
                     /db_xref="GeneID:2889622"
                     /db_xref="GOA:Q6FP38"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSDGSGRYVPPHIRRGGGNSHESAAADGLSGSRYSGNGFFSSPN
                     RGNHKSSGGFFGSRPFNDRRTGQGSRASGSGGFGGSGGRYGWVNGKHVPYPKNPRLEM
                     ELFGNATDHVTSGINFDNYDDIPVEASGDNVPEAITEFKSPPLDELLLENVELANFSK
                     PTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSELFLNGPAPLPEHTRHSYMR
                     KCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGAPIGQQMRDMDRGCNLLV
                     ATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPSVNDRQTL
                     MFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNSALLDILIN
                     EIDGLTLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILV
                     ATAVAARGLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFNSNSMNIAK
                     ELMDLLTEANQEVPQFLVNMVQDSMRFGRGGRNSRTGSNRGRGSNTRDYRHSNKDDWG
                     SLGSSRRGFRSNDNRGFGNNWGSSSGDGFTNKAANSWW"
     gene            <664270..>665289
                     /locus_tag="CAGL0J06930g"
                     /db_xref="GeneID:2889625"
     mRNA            <664270..>665289
                     /locus_tag="CAGL0J06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448007.1"
                     /db_xref="GeneID:2889625"
     CDS             664270..665289
                     /locus_tag="CAGL0J06930g"
                     /inference="similar to AA sequence:UniProtKB:Q02950"
                     /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
                     YPL118w MRP51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448007.1"
                     /db_xref="GeneID:2889625"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:Q6FP37"
                     /translation="MSLSNMLRASRLAQVYKSSKPLSTGLKIAPTHQVIETKPALLKF
                     HEWGLKSAIPSKVKTQYLMYKELDTLERLTDFEPRGGANWNRIRVQEFGLSPRYNANT
                     KNPLFNKEHYDFSSLNEVFTKFFFEKQQHGSMKYGSLSESRKLFIKNVRQEFKEWLVA
                     KYPEAILNQSFTKPDNMLTYGKEFLQSYNNRSSSKLNSPDTMIGTGGLTYALKGRLRN
                     SPNGVIQKHIVPGRFVAPTNDNKIAAIGGFVANAASSVISAQPQKWVSNRDKIYPFEV
                     SNLSVNNGQITLDAKGTMLNKPEQKRLRRNHYPKPLYGNRYSTGERKSDVAESLKAIL
                     EFNKS"
     gene            complement(<665599..>666426)
                     /locus_tag="CAGL0J06952g"
                     /db_xref="GeneID:2889626"
     mRNA            complement(<665599..>666426)
                     /locus_tag="CAGL0J06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448008.1"
                     /db_xref="GeneID:2889626"
     CDS             complement(665599..666426)
                     /locus_tag="CAGL0J06952g"
                     /note="highly similar to uniprot|P15496 Saccharomyces
                     cerevisiae YPL117c IDI1 isopentenyl-diphosphate
                     delta-isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448008.1"
                     /db_xref="GeneID:2889626"
                     /db_xref="GOA:Q6FP36"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6FP36"
                     /translation="MSEYRKLVEGLDEAAILENFPEIIPLQSRPNTHSSEDASRGKDD
                     VFAGHDQEQIRLMNENCIVLDWEDNAIGAGTKKVCHLMDNINRGLLHRAFSVFIFNTE
                     GKLLLQQRATEKITFPDLWTNTCCSHPLCVDDELGENGSLPAKVLGAKTAASRKLEHE
                     LGIPEAETATRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKIDEGKQLTVQPNLNEV
                     RDFRWVSADELKAMFNDPQYKFTPWFKIICDSYLFQWWEQLQDLSKVENDSQIHRML"
     gene            <667811..>669847
                     /locus_tag="CAGL0J06974g"
                     /db_xref="GeneID:2889624"
     mRNA            <667811..>669847
                     /locus_tag="CAGL0J06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448009.1"
                     /db_xref="GeneID:2889624"
     CDS             667811..669847
                     /locus_tag="CAGL0J06974g"
                     /note="highly similar to uniprot|Q02959 Saccharomyces
                     cerevisiae YPL116w HOS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448009.1"
                     /db_xref="GeneID:2889624"
                     /db_xref="GOA:Q6FP35"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:Q6FP35"
                     /translation="MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSP
                     YSLSHEFSRDWVAKSYKKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLL
                     SPHVLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIG
                     AVETGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY
                     GVTHAVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMH
                     DINSFPTESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLF
                     AKADEFFKNSKNEMNELGKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTK
                     DALKLAQMHCQGKVLSLLEGGYSDKAITSGVFSHLIGLQNQDWINEWGSEQVVKEIVR
                     GCKPSWKPYKTKKARDVIRIWAEEVIRLGRAMIPEFEDILFKEGLQSNPGLGDVPTST
                     IAQRLRKTHVKEEPTKTKELTEPPKTSTNTRKSRNDDTKKDVPFIQQELSSEDEGEDE
                     DYVYDEELNKTFNRTVEDITIDDISRHLETLELEQIDENEPQELFIKKDENKQQRHLQ
                     SNGMYKIPSSKTQRFKNSQQPQSNSPPTYDDSDISMISHVSVARKHNTRSGRKW"
     gene            complement(<670212..>673529)
                     /locus_tag="CAGL0J06996g"
                     /db_xref="GeneID:2889629"
     mRNA            complement(<670212..>673529)
                     /locus_tag="CAGL0J06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448010.1"
                     /db_xref="GeneID:2889629"
     CDS             complement(670212..673529)
                     /locus_tag="CAGL0J06996g"
                     /inference="similar to AA sequence:UniProtKB:P32873"
                     /note="similar to uniprot|P32873 Saccharomyces cerevisiae
                     YPL115c BEM3 GTPase-activating protein for CDC42P and
                     RHO1P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448010.1"
                     /db_xref="GeneID:2889629"
                     /db_xref="GOA:Q6FP34"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FP34"
                     /translation="MAGNFGAGSSALQLLEQYNDQRLEKDKKLEHIERNKPTEQKNYL
                     DPDKRASWRRGSLDGGNNDWKSLYDDMFQDNLRMNKQLQDKDKEIALLEKVVVYLRDN
                     IGVVNAKYNVNKNSTLEDLKKVVTEIDNAKHEHQFALPPRSTERTNNQRTTDPLDDFE
                     NEMKLKKVSENTPRPTPSATGSFQSNSTKTQSSEEPTLPSSYANKLNISPIRITEAPQ
                     NFTSPATSVTYTTSRITISSPRSVRHEPKQDTTAQVPESPSRRIVSQTIRKQQNGPLE
                     SCSNSQSGRNTPTKHLEKDQSVDRSFAPMSPPRTDFQKPKGQDFSPSSKEKIDNFAEL
                     LEASFGEEEVSKHDTQNGHQDLKKSNAIKSQGLPNVTINASITSTPVSAQQLGSPIIV
                     NKKKDVLVNHDSQMSTPGTSSIVSSIVPGSLPNETPLGRADNLRHEREYLPSNEQRQE
                     TPSHISPQKPPANSQQGLRVDLTSVNRDNSLRSNPSLKPVTSDIPLFVQPEDLGTIQI
                     QILSTLYKDPEINFQGEENSVLFSVIDRSSSQEMFKFSKSLKKLRELDVYLKSHIPSV
                     SIPDLPSEQLYKSLLPVRVDQRREMLNGYFSSLVSIPNFPVNVGLKIAEFISTDTVMT
                     PLTLGDTLYEGRLLMRKPKALGGGNTWKLRYGALNSKTLQLLENDQIMEQVKVRQVSL
                     EILPNLPDDKFGTKNGFLLTEHKKSGLSGSNKYYLCTETAKEREGWISALHGLLDPNS
                     SNLAPSTSSIRSGSNHTDNISFGRPDSSKPDPHYVTDLSNHRNSYNIETASNYSGISS
                     PSGISEQNEGADDERESRRMKMRSIFPFKKIAGGVFPHDEDRDTENDSLNKSVETFVT
                     SNNDNYSQRLVESTPLPVSLNTVFGAPLQKSMQLSSKTYQRQYHLPSIVYRCLEYLYK
                     NHGIQEEGIFRLSGSSTLIKQLQEKFDREYDVDLSNFNNKLEGAGNEDDSNGGQFISV
                     NTVSGLLKLYLRQLPHLICGDDEYGYFKGVVDMNHDNPAKIALGFRDIIASGKIPHQN
                     LSLMYALFELLLRINENSRYNKMNLRNLCIVFSPTLNIPIGVLQPFIVDFACIFKGAD
                     PIPDSSREQIDIHIPNV"
     gene            <674365..>676644
                     /locus_tag="CAGL0J07018g"
                     /db_xref="GeneID:2889627"
     mRNA            join(<674365..676154,676461..>676644)
                     /locus_tag="CAGL0J07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448011.2"
                     /db_xref="GeneID:2889627"
     CDS             join(674365..676154,676461..676644)
                     /locus_tag="CAGL0J07018g"
                     /inference="similar to AA sequence:UniProtKB:Q02981"
                     /note="similar to uniprot|Q02981 Saccharomyces cerevisiae
                     YPL109c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448011.2"
                     /db_xref="GeneID:2889627"
                     /db_xref="GOA:Q6FP33"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FP33"
                     /translation="MLLNLIKSRAKVTTALAKVRVVGRQRRFLISPLTTASIATGAIS
                     LSIYHNRREHLLNETLEPDPTGDTFEMGLYIASEKERETLAASGKLDVIRKSRSLLVR
                     SILKLWVVLDDNIIEPVLTVCRFLELMGLFLPVFSLYPICWLGRRIKLNDDITDTRGS
                     IIWCKLIRIALELAGPSFIKLGQWAGSRTDIFSETLCYELGKLHSKVRPHSIEYSKKM
                     ITSSFEVDDFDEIFDSFGEKPLGVGAIAQVHVGKLNDAFYNKYSNKTPENNKWCAIKI
                     IHPRVRNQIYRDLKIMKFFACVIDGIPTMEWLSLPNEVEQFSILMKLQLDLRIEALNL
                     KRFNENFKDATQVKFATPYLELSNRDVLFEEYLHGFPMEDFLKVKRHIKDDDLCRRVS
                     DPFVEAFLQMLIRDDFVHADLHPGNVMIRFVKTNKYGTQIISSEESSYNISHTLREKW
                     RNKDSDLIPYLKSALTTYTPQICYIDTGLVTELNDRNRVNFIALFNALAQFDGYRAGE
                     LMIERSRTPETAIDKDLFALKVEKLVDKVKQRTFTLGNVSIGDLLDQMLRMVRSHHVR
                     MEGDFVSVVVAILLLEGIGRQLDPDLDLFESSIPLLRDFNFMKETNNKFLTEIGTYKI
                     LKLLVGLEIRKLMTVSVRELYNLVKTDQLCPNY"
     gene            <677513..>681250
                     /locus_tag="CAGL0J07040g"
                     /db_xref="GeneID:2889628"
     mRNA            <677513..>681250
                     /locus_tag="CAGL0J07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448012.1"
                     /db_xref="GeneID:2889628"
     CDS             677513..681250
                     /locus_tag="CAGL0J07040g"
                     /inference="similar to AA sequence:UniProtKB:Q02979"
                     /note="similar to uniprot|Q02979 Saccharomyces cerevisiae
                     YPL110c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448012.1"
                     /db_xref="GeneID:2889628"
                     /db_xref="GOA:Q6FP32"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FP32"
                     /translation="MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQEN
                     SANGEGDKPLWKKEEDGMTSDRKTFAENKKIQQLIISFFFNLDRDIEKVDSFYNSQFS
                     EYEKRLQKLLQSSQFQDVTYLIENREGEKELTPVGNGSIPPRYATPHHIDDVNEVYNI
                     LSELKTQFRNLKNYSELNKRAFVKILKKFDKITGLSRKDIFLQNRIYPLPFANETQIS
                     KDLGTINEIWSKLSSRVGVIGALNPSVDELLQSTENLIPQIKLNDSPSVKGQVTSIND
                     ITPFIDEDNGKGIIAQLIQLYGTITAVPTRSLINILNKSALKKSYNCVDSILEVIPSF
                     NDVTDINNRNFFHHFIISLSKKLPSNDQQEEIPFVLKSQPSFAKPTEDVILSSNLEVI
                     YNTYMNRGTTGTVLEKQKLDENYLDPFRHIIQKLPVRLRPCILQVDNYSRTPLHYAAK
                     FGFTGIAAEIIEMLKAWGYWKDDISLDDKDFWGDSEGLSPVHLAVLGRNTDTLKMLLD
                     SMNNNLLLTSPTLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVAANLF
                     EATACLLINGASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPM
                     EHAVLRGHLEVAKIVEVKDWPEVCHPVYNSTKNQDSQSRDNSEIIKGNSNSSEQMNDT
                     KVKRIKSFGHSYLKEEEAIMLITLGGTDTRITTPAISLNLKKLLQSADIDTALSLVIS
                     CDDDVSSVPVVLDLPLDASMANINFKVPFKDNGVYTVFFDIVYTYGSYSPDNGNSLVR
                     PNLDRNASVDSVILSSASDRDQNDSPPPVEYLKDRLVARAVALLNKTNSAAGTNRRLL
                     NDNVTIPIQSKYGMDLVGTISFEYSIVTPFSHPKMGVYATDTYWKSLVSTRVIGHRGL
                     GKNYQSSKSLQLGENTVESFIAAASLGASYVEFDVQLTKDNIPVVYHDFSVAETGVDI
                     PMHELTLEQFLDLNNYGGSRELLKSRRKSMDDSDFKNLKKDWDLGEPDDGRKSPYYQS
                     RSKLMEERMKLTKAYKSNNYKGNSRGHSIASSFVTLKELFKKIPQNVGFNIECKYPML
                     DEAEAEELGQIALEMNHWVDTVLQVVYDNFNGRDLIFSSFHPDICVMLSLKQPNFPIL
                     YLTESGTTKMADYRAISLQNAIKFAKSWNLLGIVSAAYPIVKAPRLAKVVKSNGLVCV
                     TYGVENNDPNNAAIEIDAGVDAVIVDSVLAIRRGLTKIQTK"
     gene            complement(<681641..>682606)
                     /locus_tag="CAGL0J07062g"
                     /db_xref="GeneID:2889631"
     mRNA            complement(<681641..>682606)
                     /locus_tag="CAGL0J07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448013.1"
                     /db_xref="GeneID:2889631"
     CDS             complement(681641..682606)
                     /locus_tag="CAGL0J07062g"
                     /note="highly similar to uniprot|P00812 Saccharomyces
                     cerevisiae YPL111w CAR1 arginase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448013.1"
                     /db_xref="GeneID:2889631"
                     /db_xref="GOA:Q6FP31"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:Q6FP31"
                     /translation="MTDYKYYKDRQLSLVLAPFSGGQGKLGVEKGPKYMLKHGLQKDL
                     EELGWGTEIQSPLDEEEYVKKVKENTQDQFGIIKRPQLVGEATELIYKSVTDVLSRDR
                     FPVTLGGDHSIAIGTVSAALDKHPNAGLLWIDAHADINTLESSPSGNLHGCPVSFLLG
                     LNKGKHESLKSLDWVPGKLKPNKIAYIGLRDVDSGERKILKELGIKAFSMYHIDRYGI
                     NTVIEMALEAIKDPESENTPIICSYDVDSIDPLFVPATGTPVRGGLTLREGLFLAERL
                     AETGNLISLDVVECNPDLAIQDIHVSNTISAGCAIARCALGETLL"
     gene            <684122..>685252
                     /locus_tag="CAGL0J07084g"
                     /db_xref="GeneID:2889630"
     mRNA            <684122..>685252
                     /locus_tag="CAGL0J07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448014.1"
                     /db_xref="GeneID:2889630"
     CDS             684122..685252
                     /locus_tag="CAGL0J07084g"
                     /inference="similar to AA sequence:UniProtKB:Q02961"
                     /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
                     YPL113c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448014.1"
                     /db_xref="GeneID:2889630"
                     /db_xref="GOA:Q6FP30"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FP30"
                     /translation="MRPKVLIPYQQTWEVASHIPEWEKLKDKLDFIEYKMTNADDFRE
                     YLHSNDIAALWVTEEFFRVLGGPTPYIEDYPSSLRVIAVPWVGCDFIDGKMLLEKYNI
                     YLCNIGPHAVDNVTDLAIHLVVSCFRLTSFWEYCFRFSEPGSIDECKKYVGGTSKDQI
                     TKDGALYPQKLDDDQSRFLNLAKDFNVAGKKVDSPTKKTALILGFGSIGQNIGSKLKF
                     SFDMKIKYYKRSGEVPREQLGYDAIYCSDLQSADTWQDVDVIVLALPGSPSTDDIIND
                     SSLGMCKDGVRIVNVGRGSCIDEDALISALDSGKVNSCGLDVYKNEETLINEKFLKRW
                     DVTLLPHIGSAVADMMVRQTIITLDNIEDILLKNGEGIYRAN"
     gene            complement(<685582..>686331)
                     /locus_tag="CAGL0J07106g"
                     /db_xref="GeneID:2889569"
     mRNA            complement(<685582..>686331)
                     /locus_tag="CAGL0J07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448015.1"
                     /db_xref="GeneID:2889569"
     CDS             complement(685582..686331)
                     /locus_tag="CAGL0J07106g"
                     /inference="similar to AA sequence:UniProtKB:P32773"
                     /note="similar to uniprot|P32773 Saccharomyces cerevisiae
                     YOR194c TOA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448015.1"
                     /db_xref="GeneID:2889569"
                     /db_xref="GOA:Q6FP29"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:Q6FP29"
                     /translation="MSNLEASKVYELIVSNVINEVREDFESAGIDEQTLQDLKRVWQE
                     KLTETKVTHFSWDPVTDAVPATNETNQQETSTTETNGLQLPGGAVISAPSTGNDMSPQ
                     DENTNNADDGDATAGMLAGGDDDLNNNENNVSDNNVQVKQEGDVKFEMTIENADTSDL
                     ESKNKDHKEAKRSALLDADEVGSELDDSDDNYLISEGEDEGPDENIILCLYDKVTRTK
                     ARWKCTLKDGIATVNRKDYSFQKAQVEAEWV"
     gene            <687628..>688371
                     /locus_tag="CAGL0J07128g"
                     /db_xref="GeneID:2889570"
     mRNA            <687628..>688371
                     /locus_tag="CAGL0J07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448016.1"
                     /db_xref="GeneID:2889570"
     CDS             687628..688371
                     /locus_tag="CAGL0J07128g"
                     /inference="similar to AA sequence:UniProtKB:P39721"
                     /note="similar to uniprot|P39721 Saccharomyces cerevisiae
                     YAL049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448016.1"
                     /db_xref="GeneID:2889570"
                     /db_xref="GOA:Q6FP28"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FP28"
                     /translation="MASNPPGKCCFEGFYHEGQAKGTHKDVCGVDTYVTGAENSSDRV
                     IVILTDIYGNRLNNVLLTADQMATDCYQVYIPDILFNDPVVALDGSTDFNAWLAAHPA
                     EKVQELVTKYLTDLRAQLKPKFLAVVGYCYGAKFAIQQIGANPLADCCAIAHPSFVSI
                     EEVDAISKPVLISAAEEDPIFPEELRHQTEAKLKENKARYQLDLFSGVSHGFAARGDT
                     SNPVVKYAKEKVLVDQLYWFNYFSGCCQK"
     gene            complement(<688858..>691926)
                     /locus_tag="CAGL0J07150g"
                     /db_xref="GeneID:2889571"
     mRNA            complement(<688858..>691926)
                     /locus_tag="CAGL0J07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448017.1"
                     /db_xref="GeneID:2889571"
     CDS             complement(688858..691926)
                     /locus_tag="CAGL0J07150g"
                     /inference="similar to AA sequence:UniProtKB:P39720"
                     /note="similar to uniprot|P39720 Saccharomyces cerevisiae
                     YAL051w OAF1 peroxisome proliferating transcription factor
                     or uniprot|P52960 Saccharomyces cerevisiae YOR363c PIP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448017.1"
                     /db_xref="GeneID:2889571"
                     /db_xref="GOA:Q6FP27"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="UniProtKB/TrEMBL:Q6FP27"
                     /translation="MKYVDEGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCL
                     KHGIRCVYDLTSQKAPKNPNKDAMIARLEKELSYWKKKTLKLTKTLPPVSRHLISTNE
                     PAMDIELSSLRANCTNVEVNLFKVHPRLIVSGVIKREVNPLSENYLIIQDKFTTTAIA
                     SVFLNYQGSALLSALASDMSITKTSTNVQNNISIIKENLLKQCRNDLQGKRIKLFVNK
                     LAQNIEPPPDLFQKGEEAKNFLTSLDNSFVEDYCPKGAPYSELLQSLIDSIESLLPPY
                     DIIIAYKKWYYDNVYYIAPFVHKSIFEDDLAQILVRDDKDPQKVKVVFGNSKLRSKLE
                     TMSMLLLVMKLAYTSIILTDDDIRKYSSVLTMDIVRKYPISSEVAHVVQNCLSAENWC
                     ATPNENIISCLLLLWAFFVFSPDEGDFFYEQPTGVLASIAMMLGVSIGLHKDPSDYPV
                     FSNDTLGDKRVCNQRRLLWIAMICVLTFETNTKGSTVDKHDDLFDIFIDLRDPSSVYE
                     LMDRVKKDCDHNDEGSIEVMNVIENLFRRTQTSYALYDLNALLLSPDGRFTLSEYEIL
                     SSKVHIMSKEYIDLVSSYSPKHGPSGDKAKLPLFYMLNCCDVLSGIIFQLMNLRISIA
                     LFLHFEERLVTEENVKNHYIYFFTKLCLDLIALGNTMEKFFDGTFDAVIAKASDFIIK
                     KAIQVAINTVLFGLLAVIMRFDLAASILFNELQSLQTQGVYKEQIYSEMNSKIQLLND
                     MKVIFETQLKNIYHVCSTSLRFEYFTIFKMLTLFDALLDRIEKNELWIGILRMAHLDN
                     VDPKIAKVLAITLRIQLIRKTGLVEDMQLRSHLAHFELEKITKLHKSMTNYKSRLNLI
                     NTYNVDLESTPESSLEPLIPMKEEPLVVIKEETVTPNFSNRTVSPNLPRIKSEEPVEI
                     MATPATGLTQLSNAALLSSQPLSIPVLPIQSQQPASQSNSDNQGPVNENIPTAFPILG
                     STNQQNQMINNNGVANVNLNNTEEPLADFFGISATLGVLDFEFLLGNQFQ"
     gene            <695093..>695707
                     /locus_tag="CAGL0J07172g"
                     /db_xref="GeneID:2889572"
     mRNA            <695093..>695707
                     /locus_tag="CAGL0J07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448018.1"
                     /db_xref="GeneID:2889572"
     CDS             695093..695707
                     /locus_tag="CAGL0J07172g"
                     /inference="similar to AA sequence:UniProtKB:Q08873"
                     /note="similar to uniprot|Q08873 Saccharomyces cerevisiae
                     YOR367w SCP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448018.1"
                     /db_xref="GeneID:2889572"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR003096"
                     /db_xref="UniProtKB/TrEMBL:Q6FP26"
                     /translation="MEKVYGVKPDVTTLDDDLKQLRSGKFSKEAVDEIKNWIFSSILK
                     ERPENSDSSLLELLKDGSVLCKVANKLGELEHGFSPIKWKVSNMPFVQMEQISLFLAF
                     SRQYGVPEDELFQTVDLFEEKDPASVYQALKSLSRYANKKHPDKFPVLGPQLTEKKPR
                     PPVKAKPKHLQTESPGWSTYEYGYMKGASQKTENIVFGQKRDIA"
     gene            complement(<695807..>696331)
                     /locus_tag="CAGL0J07194g"
                     /db_xref="GeneID:2889573"
     mRNA            complement(<695807..>696331)
                     /locus_tag="CAGL0J07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448019.1"
                     /db_xref="GeneID:2889573"
     CDS             complement(695807..696331)
                     /locus_tag="CAGL0J07194g"
                     /note="weakly similar to uniprot|P39718 Saccharomyces
                     cerevisiae YAL055w PEX22 peroxisomal matrix protein
                     import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448019.1"
                     /db_xref="GeneID:2889573"
                     /db_xref="GOA:Q6FP25"
                     /db_xref="InterPro:IPR024359"
                     /translation="MSKRRKNQGYLAIIAAVSIGAAAYLWWRNHSEDDSVSKFNQQDD
                     GTAQDNQIKEKPAIKLGKKRLHRSLCVIISNKLSNLVELDWDEILQEDIVFLILPSVN
                     DFQNSNDIKTDTHKIINCDTELGLWACVRTLKKNELLVCADDIKVPDDIGRYCDKISQ
                     IKSSQQLMNYLDET"
     gene            <696814..>697986
                     /locus_tag="CAGL0J07216g"
                     /db_xref="GeneID:2889574"
     mRNA            <696814..>697986
                     /locus_tag="CAGL0J07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448020.1"
                     /db_xref="GeneID:2889574"
     CDS             696814..697986
                     /locus_tag="CAGL0J07216g"
                     /inference="similar to AA sequence:UniProtKB:P48581"
                     /note="similar to uniprot|P48581 Saccharomyces cerevisiae
                     YOR368w RAD17 DNA damage checkpoint control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448020.1"
                     /db_xref="GeneID:2889574"
                     /db_xref="GOA:Q6FP24"
                     /db_xref="InterPro:IPR003021"
                     /db_xref="InterPro:IPR016587"
                     /db_xref="UniProtKB/TrEMBL:Q6FP24"
                     /translation="MVKSRFSATTVHLEHITTALNCLTPFGSKDDILIYIDHDGLSFV
                     KDNNGVIRISLLLAKELFSSYHFATTESNQTDNDGDDLDYMKLCVKINHILDSVSVVN
                     KNLDDVVECILSYDGRGSPFSLTFEDSMISERVDYSTYLIKEMDTSALELDRQKIILE
                     CILKGEVMHSALKDLKEINCKDIYLYANVTSNGDSTLAFISRSQLGLSKIKFPSNKNV
                     IEKLEIYDNNSTTMCYDKPVIGYFNYTSFNKIILSTKIASKILLRMDVHGILSINILS
                     HTDNVMMSEDKFTKQSSSTSSKRYNSMQLPKDYPGIVIDVCMIEKEPLDMYAQEEIHQ
                     FMGSGAITGVPNSKDSAADVPQHNLLSHPVTEYESNSNTKDTSSSSNMNEDLPIFF"
     gene            complement(<698356..>698784)
                     /locus_tag="CAGL0J07238g"
                     /db_xref="GeneID:2889575"
     mRNA            complement(<698356..>698784)
                     /locus_tag="CAGL0J07238g"
                     /product="40S ribosomal protein S12"
                     /transcript_id="XM_448021.1"
                     /db_xref="GeneID:2889575"
     CDS             complement(698356..698784)
                     /locus_tag="CAGL0J07238g"
                     /note="highly similar to uniprot|P48589 Saccharomyces
                     cerevisiae YOR369c RS12"
                     /codon_start=1
                     /product="40S ribosomal protein S12"
                     /protein_id="XP_448021.1"
                     /db_xref="GeneID:2889575"
                     /db_xref="GOA:Q6FP23"
                     /db_xref="InterPro:IPR000530"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6FP23"
                     /translation="MSDVEEVVEVQEEVVEQTAEVSIEDALKVVLRTALVHDGLARGL
                     RESTKALTRHEAQLVVLVSSVTEDNIIKLVEGLANDPNNKVPLIKVADAKQLGEWAGL
                     GKIDRDGNARKVVGASVVVVKKWGAETDERNMILEHFSQQ"
     gene            complement(<700532..>702448)
                     /locus_tag="CAGL0J07260g"
                     /db_xref="GeneID:2889576"
     mRNA            complement(<700532..>702448)
                     /locus_tag="CAGL0J07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448022.1"
                     /db_xref="GeneID:2889576"
     CDS             complement(700532..702448)
                     /locus_tag="CAGL0J07260g"
                     /note="highly similar to uniprot|P32864 Saccharomyces
                     cerevisiae YOR370c MSI4 geranylgeranyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448022.1"
                     /db_xref="GeneID:2889576"
                     /db_xref="GOA:Q6FP22"
                     /db_xref="InterPro:IPR000632"
                     /db_xref="InterPro:IPR017230"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:Q6FP22"
                     /translation="MLSPERRPSMAERRPSILVPHIDHNRDGSSVVHTLMVPHLAGIE
                     DPLPEATPEEVDVVIIGTGMVESVLAAALSWQGSSVLHIDKNDYYGDTSATLTVDQIK
                     KWVNGINSGEVKGYTNAKLYVSTLIGPNRYASRDFGIDLSPKVLFAKSDLLSILVKSR
                     VYQYLEFQSLSNFHTYENDSFEKLTNSKQEIFTDQKLPLMTKRNLMRFIKFVFNWEQQ
                     PEIWQPYQDRTLEEFLTEKFKLEKAQISELIFSIGLCYNMNAKMPAVFQRIRRYLSSF
                     DVYGPFPVLYSKYGGPGEVSQGFCRSAAVGGATYKLNEQLVSYNPSTKVATFSDGSNV
                     KVTEKVIASPTQAPPDSQNIPQQKYEVHRLTCIVDKPCLEWFNEGESAAVVVFPPGSL
                     KSNNTEVVQALILGPGSETCPAGTCIWYLSTSQQGSKAELDLDAALEAMEISILRESS
                     SDLENNDDIVQFSVNGQTIINSVKLGQSFREYIPREKLQFLFKLYYTQFTSTPPFDVV
                     NPALFATNTSSKELMIPGASDNGIIYSPMPSVEISYDEVITAAKVLYEKIVGSDDDFF
                     DVDFEDEDEMREIAANAASNDMTNNKVGSQQTNAGIANPMIYENAIVDEDDDSQDVEM
                     DRNDDSEFVGEMEI"
     gene            complement(<703034..>705907)
                     /locus_tag="CAGL0J07282g"
                     /db_xref="GeneID:2889586"
     mRNA            complement(<703034..>705907)
                     /locus_tag="CAGL0J07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448023.1"
                     /db_xref="GeneID:2889586"
     CDS             complement(703034..705907)
                     /locus_tag="CAGL0J07282g"
                     /inference="similar to AA sequence:UniProtKB:Q08886"
                     /note="similar to uniprot|Q08886 Saccharomyces cerevisiae
                     YOR371c GPE1 or uniprot|P39717 Saccharomyces cerevisiae
                     YAL056w GPE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448023.1"
                     /db_xref="GeneID:2889586"
                     /db_xref="GOA:Q6FP21"
                     /db_xref="InterPro:IPR011043"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FP21"
                     /translation="MEGIVNDGSVNINSNHEKPTLISVPGSISKFMKSDSPSRYETFE
                     PLSFATNYVSIFAEPLEKNNNDKICLENEKLLKCYYEYRSAFSNIMNHTVNSATNSYT
                     NLSSMNDIQFNPDQHRHGSITSSIETSILQNERQSIYKVLNDFLIHKEHKLNPSILQK
                     IMKMDRSQFYRDSPFRPHFDNNDNKSDKNMENLNNEAGDNNDTYFNSTKPYLLYYKKP
                     LSVKFRDSEVIHRHNLWMPVVKRKYHYILKPEKLQQTLDYREPSEEAAAIYRDYFTSK
                     ACPLFIKGLDFVPKNYDTYSGTSIVPSIFADYKMPGLVYHCSVHLNNNIYIIGGLTAC
                     YRFDEEAPDLSDFYVDPIKNLPPPLLSKLINNPSLISNPFLYVYSTLQSRFGKPDFSG
                     NAPPPLICAKGSIINDRYIFYYGGFEIKTETKKDENGKYYLKKRAFVNNLGYILDTET
                     LKFSKVEVINPGQGSERNNKFYPRFGHIQLSANIDLTNNSVTSSSENVSVLSSRRTSS
                     HQLYYGSHHHYKTNHGNGQNNIRQPEELSSIAKKMPHSLGSDSKVTNDSETKIHNKTN
                     LSPYKSIHSIFVFGGYTQTEDDQYKALDDMWRIDLPVEIRGKRGFIKFASKAELINLP
                     KKEVWPSARAFSAFTISEVFPPIKESLESNLLKRLEEQYSIDTKNLTGNTSNLFGTTV
                     GVKSDLGEAYHDLGPSIHSQFSSHISLNSLNKPSQQGSAVNLGAPTEHSNVISNSMTA
                     FETRMQILYNSKGINIIMHGGSDHDEIYGDLWMFDIKNEVWSRSNLFAKEIKDKPRHE
                     CQGDISLAAPDEPRTIVEEVPVDLKLTGHDMAYEGHMLVLLGGITQTDLPSMYHDGPI
                     DADSEPRPLLGQNTVNIFDMETSTLQGYKIRKNAQGHYEYIYEQDKPKKSHSVMTTAG
                     ATVHINGSLFVVGGILALRSNLKDLKLRATVLQFVIPPISLSY"
     gene            complement(<706716..>708167)
                     /locus_tag="CAGL0J07304g"
                     /db_xref="GeneID:2889587"
     mRNA            complement(<706716..>708167)
                     /locus_tag="CAGL0J07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448024.1"
                     /db_xref="GeneID:2889587"
     CDS             complement(706716..708167)
                     /locus_tag="CAGL0J07304g"
                     /inference="similar to AA sequence:UniProtKB:P53867"
                     /note="similar to uniprot|P53867 Saccharomyces cerevisiae
                     YNL223w AUT2 essential for autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448024.1"
                     /db_xref="GeneID:2889587"
                     /db_xref="GOA:Q6FP20"
                     /db_xref="InterPro:IPR005078"
                     /translation="METIHNISNRLQEVLATNKSVNVDTDNDSLSSNQEDNEVEKVRH
                     LVVILGEKYSYAVDRNTGINALMQWFTTNSEIPEEILNAIRSKLNFTYRTNFEPIERA
                     PDGPSPINPLIMLRINPIDAIENVFNNRECFFTDVGWGCMIRTGQSLLGNALQRVKST
                     VKDQPYIYEMDDTKEITDLFKDNTKSAFSLQNFVKCGRIYNKIAPGEWFGPATTATCI
                     RYLIQENPCYGIEACYISVSSGDIFKENIQGMIDRYPNGNILILLGIKLGLDSVHERY
                     WGEIKTMLESPFSVGIAGGRPSSSLYFFGYFDDTLLFFDPHNSQTALIDDFDESCHTE
                     NFGKLNFSDLDPSMLLGFLLPCSKWDEFQEFTSLLTIVNVLDGMDQYRDPDLNSNDIG
                     NVELSPQLKLSQTPDAITDDDYVDIGALIQGNSMNINDRDNGYQEVQCKNQQIVIMDS
                     LNETKPLEIEKVLVGQGTNLVNATTPCREAFPK"
     gene            <708554..>710980
                     /locus_tag="CAGL0J07326g"
                     /db_xref="GeneID:2889588"
     mRNA            <708554..>710980
                     /locus_tag="CAGL0J07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448025.1"
                     /db_xref="GeneID:2889588"
     CDS             708554..710980
                     /locus_tag="CAGL0J07326g"
                     /inference="similar to AA sequence:UniProtKB:P53866"
                     /note="similar to uniprot|P53866 Saccharomyces cerevisiae
                     YNL224c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448025.1"
                     /db_xref="GeneID:2889588"
                     /db_xref="GOA:Q6FP19"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR001374"
                     /translation="MAKRHKHFESRGGFRKKRGGGRGSQRGRGSKRGRGGRFRGFEET
                     ERSASEPGAWLNSSVPLGDGDLSNPDMMVDNYRPRKHISQDTITDHYFGRKSSLKLNS
                     MRMAGLRHNDWRDPNNGNSASFRKRPIEFIKANCTYDPSRDLILQLANRSKNQESKEP
                     EEDANKCSEYAEHSEKDMEIDTAATENDANISYDESDTDQEIGNFNHSIENSKHNNNI
                     SECDITAVTDQELFFVDEEGMDISQKPTKVVHITEHEKKMGSNVEFHNVLTVGKVEIS
                     LNQDENDEVYVDRKPTAKYHPFHNYISNVIERMQEEENIDSDDFEDEDDIYLDNSGND
                     MPETELDQDEIIDLQRHDDKDHAVQTCAIPTNTLSNDLDTLHITESNDDRITINNHNM
                     DSTVETDKEKDPEFGFLEEDYAVNTSEVIVDNIRLGLNDNSYFLKCYRFFGDYSFHWI
                     DQEAFVSFLTEDLELPMNRVGAYLAYVKNSLVPDETPPSPTYSDIPFSDTSNESDEDN
                     ALPNVDAVSSCSNDDEDEELGDDVDDLVSYSLKYANSRNIDYETRALEFTGKGKKKKL
                     LVNEQLDLDNETMETLQAKLSKRMENKAKKRRLKEDFIDKENMNSDDLFLKYPYGFHV
                     QNIRDEFELFLTRNKDRMSFPPLDPHGNKVITKFATCYNIKSSKVGKGNHTHIMVEKV
                     KKTKWSRPNYNMVLQLTRQRPVFMRIDVRRPKEDAIKENSGRRGPTAKFHVKEGEVVG
                     ENAPEIGQDNIGRRMLEKLGWSSGEGLGAHGNKGISIPVMARVKKSKSGLRHSKEDED
                     TGRSSSFRKK"
     gene            <711496..>713091
                     /locus_tag="CAGL0J07348g"
                     /db_xref="GeneID:2889589"
     mRNA            <711496..>713091
                     /locus_tag="CAGL0J07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448026.1"
                     /db_xref="GeneID:2889589"
     CDS             711496..713091
                     /locus_tag="CAGL0J07348g"
                     /note="weakly similar to uniprot|P53865 Saccharomyces
                     cerevisiae YNL225c CNM67 involved in cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448026.1"
                     /db_xref="GeneID:2889589"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:Q6FP18"
                     /translation="MSLSVEDQRAEHMRKEAALVALQYAYDEEDKENHPLRETNGHFL
                     NHPKTTIPHSTPLVKIDDFNSKYEKEIETLKDQLFSIKNLLGIEDPDSEHSDYELIET
                     SIKKMKGQIENALKENRMLKDQAVENASVTSSRISELETKMNELTAQNQTQNELIQSL
                     KKDNQLKEEELQQSSKAAEQLTLELDTSKEEIKNLTNERMSNREYIKTFILFGRPIGE
                     IITDCLDSSINVLDDSIKKTHADIVSFKTNQDINYTSIQSKAVERLDEIKAILSQLPQ
                     QIKDNENLNSEKLNELVSKYNEQNLETIEKVNKTNKISTGINNETLNLITQVNELKSE
                     IQQLHSEVEQINNQQFNLQEILQEKEQLQKTVFELQLQLNTERESKMELQQLNDSKDN
                     KLLSITGNTNNMLSFEKLKQLDNSFCKEEYVSLKISEIEDISLVQLQNMAKMICMYFR
                     TPFDKLDIKLPLAAIQIIHERKILIHFANILNEYFMSKPLSMKKCTDSAYCEWQLSHN
                     IFRIEHPLKFKLEELYTTILRST"
     gene            <713487..>715358
                     /locus_tag="CAGL0J07370g"
                     /db_xref="GeneID:2889590"
     mRNA            <713487..>715358
                     /locus_tag="CAGL0J07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448027.1"
                     /db_xref="GeneID:2889590"
     CDS             713487..715358
                     /locus_tag="CAGL0J07370g"
                     /inference="similar to AA sequence:UniProtKB:P53863"
                     /note="similar to uniprot|P53863 Saccharomyces cerevisiae
                     YNL227c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448027.1"
                     /db_xref="GeneID:2889590"
                     /db_xref="GOA:Q6FP17"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q6FP17"
                     /translation="MKTCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEAT
                     TIFAEIRAAYEVLSDPQERAWYDSHKEQILSDTPLNPNDEDDDYVVDSTVTGVTTEEL
                     MMFFNSSLYTSIDNSPAGFYQIAGKVFAKIAKDEVSWGLRLGLDGYKNYKDMEFEEHI
                     NSRGYILACDSSKANLSNLLFPIFGYSSTSYEELKLFYTKWSSFNTLKSFTWKDEYMY
                     SRNYDRRTKREINKRNEKARAKAKEEYIKTVKRYVNFIKKLDQRMKEGAKKAAEKRLA
                     DERLRKENEMKLRKERLNNEQGAQFHLQSWQTIDQENWKELEKQYEKEFEKRNVDKDD
                     ELIGHEFTKNQFQTNNNSQHEDVDEIIIYDCFICKKSFKSEKQLENHIKTKLHKRNLD
                     RVQKEMKKDSMALGLDELSDYNDFDSAESETEKLYSGMDLNDIDAELKKIEEQLAQSS
                     VTDSEDFTDDNNDTEDQNSLVDKLSNTNYDIEIDDEINDDTNEEVQISGADNSETQNA
                     EQDHDSNGDSEEEKEDELTRILRELEESKTSRSNFSDSDEEWSNKKKTKAKKKKNKAN
                     TPDKQPVTANKNDAKEVCGECRAEFESRNQLFSHIQTEGHVSPLSKVKKGKRSKKNK"
     gene            <716085..>717152
                     /locus_tag="CAGL0J07392g"
                     /db_xref="GeneID:2889591"
     mRNA            <716085..>717152
                     /locus_tag="CAGL0J07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448028.1"
                     /db_xref="GeneID:2889591"
     CDS             716085..717152
                     /locus_tag="CAGL0J07392g"
                     /note="highly similar to uniprot|P23202 Saccharomyces
                     cerevisiae YNL229c URE2 nitrogen catabolite repression
                     regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448028.1"
                     /db_xref="GeneID:2889591"
                     /db_xref="GOA:Q8NJR5"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017298"
                     /translation="MGDSRNTGTISNLSSALRQVNIGSGQDQKNINYEFSNGLNNNVN
                     DNGNHNLVNTNEDNVNKDGSINTNMMSRQVPIQHTHGSQLLQQERMNEQQFNPMEYSR
                     ISKFFQNQPMEGYTLFSHRSAPNGFKVSIVLSELGLQYNTIFLDFNLGEHRAPEFVSV
                     NPNARVPALIDHGLENLAIWESGAILLHLVNKFYKETGNPLLWSDDLADQAQINAWLF
                     FQTSGHAPMIGQALHFRYFHTQKIESAVERYTEEVRRVYGVIEMALAERREALIMELD
                     TDNAAAYSAGTTPLSQSRFFDYPVWLVGDKLTIADLSFVPWNNVVDRIGINIKVEFPE
                     VYKWTKHMMRRPAVIKALRGE"
     gene            <717856..>718944
                     /locus_tag="CAGL0J07414g"
                     /db_xref="GeneID:2889592"
     mRNA            <717856..>718944
                     /locus_tag="CAGL0J07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448029.1"
                     /db_xref="GeneID:2889592"
     CDS             717856..718944
                     /locus_tag="CAGL0J07414g"
                     /inference="similar to AA sequence:UniProtKB:P53861"
                     /note="similar to uniprot|P53861 Saccharomyces cerevisiae
                     YNL230c ELA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448029.1"
                     /db_xref="GeneID:2889592"
                     /db_xref="GOA:Q6FP15"
                     /db_xref="InterPro:IPR010684"
                     /db_xref="UniProtKB/TrEMBL:Q6FP15"
                     /translation="MKSLSEICQIHLMRHCNRIEGVNNVPYRLISGILEKLKLDQLRK
                     LESTNVLLLLEDEELWLKLLTNNFPTNVHEIYISKKDKIINYYISYFEEHDPLLVHDN
                     EELLRNWIQQCIKKNPDNGKYRLPYRMLYDKYESDMIEKQEESARRLRQQMRQIEEQR
                     QKKQTELIEGKSLAFGTSRRSGSNNERSELFRKSLKDHKDRLQHFKSGGFDVTRRLDD
                     SKRKVYNNRVAFGGGSGSINTNRSSIKVSAGNKDERIDTSNQAKPALSPGKETPKENK
                     PIVKKRRSEREEPSIFLKNKRPNMIRRVFDTRPSRPEHSNRNTEINTSPVRHRNDTAN
                     TSPVRHVNVSTETPKIGKRKKSSFFNLK"
     gene            <719991..>721025
                     /locus_tag="CAGL0J07436g"
                     /db_xref="GeneID:2889593"
     mRNA            <719991..>721025
                     /locus_tag="CAGL0J07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448030.1"
                     /db_xref="GeneID:2889593"
     CDS             719991..721025
                     /locus_tag="CAGL0J07436g"
                     /note="highly similar to uniprot|P53860 Saccharomyces
                     cerevisiae YNL231c PDR16 protein involved in lipid
                     biosynthesis and multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448030.1"
                     /db_xref="GeneID:2889593"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6FP14"
                     /translation="MFKKLTGKKEVKKVDESKLISIDKPIKSLPEEIKRPEEEKLTAE
                     QQAKYDEVYKYLTNAELKVGNKEKNPTESSGLIDEERAWLTRECIIRYLKATKWHVKD
                     AIDRILGSLAWRREFGINHLGEENGDEVTSDLVAVENESGKQVVLGYENNARPILYLK
                     PGRQNTKTSHRQVQHLVFMLERVIDFMPIGQGSLALLIDFKEYSDVPKVPANSKIPPI
                     GVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPMTREKLVFDEPFTKY
                     VPMDQLDAIYGGHLNFKYKHEVYWPALIEYSKEKREHYMKRFQKFGSKIGLSEYDLRG
                     THETPLYPVN"
     gene            complement(<721367..>722224)
                     /locus_tag="CAGL0J07458g"
                     /db_xref="GeneID:2889594"
     mRNA            complement(<721367..>722224)
                     /locus_tag="CAGL0J07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448031.1"
                     /db_xref="GeneID:2889594"
     CDS             complement(721367..722224)
                     /locus_tag="CAGL0J07458g"
                     /inference="similar to AA sequence:UniProtKB:P53859"
                     /note="similar to uniprot|P53859 Saccharomyces cerevisiae
                     YNL232w CSL4 3 -5 exoribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448031.1"
                     /db_xref="GeneID:2889594"
                     /db_xref="GOA:Q6FP13"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q6FP13"
                     /translation="MSEHLPIDQTVFPGDLICPEIGSEKQEDKLIIYKYTPGRGCSLQ
                     KYKYNQHSLDAIVSTVVGVVETQEIEPETTETKENNTVTTEGDTDRTVKYVEVRVVPI
                     PKDLEVEYKSNKDNNFANNLPKEGDVVLARVTRISAQKVNVEILAVENEPIPLDSGVG
                     SNGAGKVAPGGGSGASTFSVSQASSDLGETFRGMIRSQDIRATERDRVKVIESYKPGD
                     IIRAQILSLGDGNNYYLTTARNDLGVVFARSDNGAGGLMYAVDWQTMVSPFTGVQERR
                     KCAKPFEYE"
     gene            complement(<722608..>725538)
                     /locus_tag="CAGL0J07480g"
                     /db_xref="GeneID:2889595"
     mRNA            complement(<722608..>725538)
                     /locus_tag="CAGL0J07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448032.1"
                     /db_xref="GeneID:2889595"
     CDS             complement(722608..725538)
                     /locus_tag="CAGL0J07480g"
                     /inference="similar to AA sequence:UniProtKB:P53858"
                     /note="similar to uniprot|P53858 Saccharomyces cerevisiae
                     YNL233w BNI4 bud neck involved"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448032.1"
                     /db_xref="GeneID:2889595"
                     /db_xref="GOA:Q6FP12"
                     /db_xref="UniProtKB/TrEMBL:Q6FP12"
                     /translation="MSQGQMRSKNDLLNSTFYSSTSINTMDHAKTFRNSLILNVLSDN
                     SIANSTDKDEGNYSTIADDGGDVTYVEDNESDIAVKRDEDSNSSTLSNNESQPNRSNL
                     LKKNEIQTINMTTSPSLSALANILQEKSKNADKKMRNSGLLNISEDNEVVENNYTNIT
                     NSKTVGNSLQQKPQIDLINSPNLIDIDGSQTVNYTQINSNDYDQPDFLTTPKIQPDLG
                     NKPTYASNLDCIQESPVQETSNLKQFEHVEIQSMPKQSRSASLPKLEPVSAEQSTITN
                     LKIVEAQPQIHVQPISESEVKQESQNDGGHLLEKHRDNHNGDDSNTNFANNGNKYPLT
                     ENRNFSTTSLPYTTIHSAGQPIKRSVTNEQIKNNLLRKGPRVDPKTRATRTVSTGPVL
                     EQISDYKEKKGFFSFLKRKNKSSSASGDKRKNNNKTVHQQENKRAFSNSNNSVVSSPN
                     DVNSGRKKEPIKSQSSNTLFSNFRKKKSERNQISNDFDNNELNISKTRIVHAETESQS
                     LLKDGSHFTGTESEVNIRKPTPLNIDLQIKNDPELIESTTRQNDEKNDNISEYRESPA
                     FSLPRPDAGEALFPKFLNSFEVDSIVSLERTRSMKSNKRSSITSHRRSLTDTLSINAQ
                     NEGMFIKEVGPMVISTPDLTKSPASSILRNGMFEPPTISSTIESSPQPAGVVELDHSH
                     DDYGRTQYEYEEEQYDTNAFNVENMEAQFNQLISTDDTITNREPIPNLTKKEDLIYEE
                     DEQLITDIMDFANIIDFGDELDVGLGINYNSQELLPNNNKLVESMYDQGTEKETTQQI
                     ETRAAEQKSSLTEENEDVFKYKIPQDRIETSLPSPPASTPGNYQVLDNKVIDPNEFEN
                     EDFNEIDDSQLEYEQNLHQIDENWATKLRKYEGLGLQEPALNLLQIPETGSHGIPQLK
                     VCFSSEILLFETYGEEEYDRRPDIATCNQLTPQLAQMIKAELNEIKDEMEIHEESKCY
                     THYY"
     gene            complement(<726663..>727961)
                     /locus_tag="CAGL0J07502g"
                     /db_xref="GeneID:2889596"
     mRNA            complement(<726663..>727961)
                     /locus_tag="CAGL0J07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448033.1"
                     /db_xref="GeneID:2889596"
     CDS             complement(726663..727961)
                     /locus_tag="CAGL0J07502g"
                     /inference="similar to AA sequence:UniProtKB:P53857"
                     /note="similar to uniprot|P53857 Saccharomyces cerevisiae
                     YNL234w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448033.1"
                     /db_xref="GeneID:2889596"
                     /db_xref="GOA:Q6FP11"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="UniProtKB/TrEMBL:Q6FP11"
                     /translation="MMSSETSISFMKENSSNMSDSEKNKVLEDIIGESQSLVKGSSKK
                     STTSSSLMDPRMLKLELHLTEREIELIRDSWFIMLNDDLSPQTMAAFYGKLRQNKKIS
                     LTANLITNEKFNVMNQQYEENRKRLIKDKSIPYQISNTSTIEGSLFCAQFYENLIAMD
                     QNVERMFPSIRHQAVSFSGVLNTAVDNLENIHVLDSYLRGIGKRHSRILGIKPAYFET
                     MGKAFIRTFQDRFGIFFTIELEDIWSRLYSYLANGMIAFGVDPVLPQSIKSTRANSLD
                     TLRTTSSGDASLRNSSFSKAQESDTSDFKTYMAQFNCDIVEEDDLDFPIPEILTTETS
                     INENDNDVDDVKDMIKNFGFNMNKAEMTHKDSIQVKKTPLDSVNPKSSASSSKDNMST
                     ASSISEKTRKKAVLQNKMKKKISAPIETPYKMSKRDCIIM"
     gene            complement(<730066..>732987)
                     /locus_tag="CAGL0J07524g"
                     /db_xref="GeneID:2889597"
     mRNA            complement(<730066..>732987)
                     /locus_tag="CAGL0J07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448034.1"
                     /db_xref="GeneID:2889597"
     CDS             complement(730066..732987)
                     /locus_tag="CAGL0J07524g"
                     /inference="similar to AA sequence:UniProtKB:P32259"
                     /note="similar to uniprot|P32259 Saccharomyces cerevisiae
                     YNL236w SIN4 global regulator protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448034.1"
                     /db_xref="GeneID:2889597"
                     /db_xref="GOA:Q6FP10"
                     /db_xref="InterPro:IPR021665"
                     /translation="MCELNNKRVSWSKTGLIAYADEQSTYGNLCISFLETINGVNCRF
                     HPPQRYVIHPQLHEVPLKTETGNGINGASGSSTAQSNIHGTTSVPGSAGKHQHQFFYD
                     ISSIHWNNWFSLPGDMLAVCDELGNMTMLIAGQSPDGPTTLDKLTMLFQDNVYKIHNH
                     VMQLEPERENTDSKLERKKTKKEYNTTILDFHWLSSSKPVIVSQFCAFDSSINMYRNK
                     AQQLSPHGIFHPPFMKYAGLAIRRNGQLDFWYQFSNSKDHKKITLQLFNPHNERSKGL
                     DFLQYAKITSVNNDNSILITTYSRLTGKLSFYKLFVDWNVNTAKPVVLNDPSLKIKHI
                     LDATVDQTDDEGRILDFTHVHVLAKVVAEKDAAPEVLLAYDVVGTPESLIKRFKLGQV
                     RLPLDYLGILKPELNTSNENHNQALRSNRSNLRFLGVLNLHHKVASISSEVLDGFVSF
                     YYRNGEIEIYNQNDWKLETERLLNQGPQGKFSNIITSILSAGFKYPTIKNLGTVEWIR
                     VSPAMAGILYKYRHDDLPQFQPMNIDDVSDKSKDEINAATMAFGYVTSAHRQLSGEDI
                     ALACKQHILKIAKIDEKRAKDFTTTLMFNLYNFFNFSPGAPKELMDKIISSRPLQKVM
                     LLQLELGSIFTDENTCEMARVILYLKNVSFAFNGVARNLQFAIEQMTNSTNSSNPPLS
                     GDKFFQTAFSKQDLVHSLIPVTKWFVKFITYLIQQILILTNDPENPDNRLVLGVFGAK
                     IPRTLILTILKEIKNVTAIITKFPETNYPILNESSTYLKMLLIESPINFEKFETFLMD
                     VNNKLSAFSEQQPSIMREPTLLVRSSVPNELNKITEFLLQYSSNTVISHADASAIYFS
                     DTSGLRISCDEFFEPGVHRLLQPIEDGIVIDEKNMPATFRDSKTFTKLTYDGITYDRF
                     SKEELSDNKLKRCNRCGAVTKAGYPIPTNKTIVPTSISTRRWPTMYTRMCICLGMLYE
                     L"
     gene            complement(<733686..>736055)
                     /locus_tag="CAGL0J07546g"
                     /db_xref="GeneID:2889598"
     mRNA            complement(<733686..>736055)
                     /locus_tag="CAGL0J07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448035.1"
                     /db_xref="GeneID:2889598"
     CDS             complement(733686..736055)
                     /locus_tag="CAGL0J07546g"
                     /inference="similar to AA sequence:UniProtKB:P13134"
                     /note="similar to uniprot|P13134 Saccharomyces cerevisiae
                     YNL238w KEX2 endoproteinase of late golgi compartment"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448035.1"
                     /db_xref="GeneID:2889598"
                     /db_xref="GOA:Q6FP09"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:Q6FP09"
                     /translation="MKWWNKGCIYLAYIALISKNSNAELIPAKNFTSRDYFAVESHLS
                     AAELSKLHPDWTFEHLVRGLDNHYVFSVAKSENEDDIDSGNSLRKRAIENEDHILSSE
                     FLTPSNKLQKRMPVPAPPLDSSMLPIQEIKDKIGINDPLFPKQWHLINPAFPGNDINV
                     KDVWLQNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDNHG
                     TRCAGEIAAIRNNNYCGVGVAYDAKVSGIRILSGPLTAEDEAASLVHALDVNDIYSCS
                     WGPTDDGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNS
                     IYSITVGAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAA
                     PIAAGIYALVLEANPNITWRDMQYLSILSSETIENNLEDGDWQTTKLEKKYSHKYGYG
                     KLNAHNIVALAKDWENVNPQVEFATDIKEVNEETDKEDKPIESTIEITASDLEKAKFR
                     SVEHVTINVDISTENRGTTTIDLISPFGVVSHLGVVRRKDDSNEGFRDWTFMSVAHWG
                     ELGSGEWKLIVKTTSDDDKVEFHSWSITLFGLSEYSEQKLKEGDIPSENDDDNRKEDG
                     PETDNNNVTEETGSDQQPETENPENDGDNGTDKNTGHHMTPTIPTGVHLIVSIFIIGC
                     VFLLLHFMFFVRTRRRIKRVRASNYDYDVIDTDAEYDSTNESSSTPLPDTFRLSDIDD
                     NEFDISDEENTQYNHLFNNDESLDQRLLDSDNPEQNPTGEQAQTHSSDT"
     gene            complement(<736677..>738077)
                     /locus_tag="CAGL0J07568g"
                     /db_xref="GeneID:2889896"
     mRNA            complement(<736677..>738077)
                     /locus_tag="CAGL0J07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448036.1"
                     /db_xref="GeneID:2889896"
     CDS             complement(736677..738077)
                     /locus_tag="CAGL0J07568g"
                     /note="highly similar to uniprot|Q01532 Saccharomyces
                     cerevisiae YNL239w LAP3 member of the GAL regulon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448036.1"
                     /db_xref="GeneID:2889896"
                     /db_xref="GOA:Q6FP08"
                     /db_xref="InterPro:IPR000169"
                     /db_xref="InterPro:IPR004134"
                     /db_xref="UniProtKB/TrEMBL:Q6FP08"
                     /translation="MYRLRSLIRPIRKYSMSRSLAIDEIASWDKELSKDLHHQLATTV
                     LKNINADDALLNKTRLQEQDVRVFNTKLSVDCTPVTNQRASGRCWLFAATNHLRVNVV
                     KELQLKDFELSQAYLFFYDKLEKANYFLDQITQSHEEPVDSRLVQYLLTDPTQDGGQY
                     SMFLNIVKKYGLIPKDLYNDAAYSTTASRKWNSILTSKLREFAETIRETLKTKDVESK
                     EFKELRTSMQKEIFRLMTLFMDLPPVKPDEKFTWTYQDKDKKVHTIESTPLEFASKYA
                     KLDAAKPVSLINDPRNPYGKLIKIDRLGNVIGGEETLYLNVDNKTLTDLIVKRLKNDK
                     PVFFGSHTPKYMDKKTGVMDIDLWNYHAIKYDLKQSKASRIEYHESLMTHAMLITAAH
                     VDDDGNPVRFCVENSWGKDSGKDGMYVMTPEYFEEYCYQIVVDIDELPTDLAEKFDDK
                     EPIVLPIWDPMGALAE"
     gene            <738538..>740193
                     /locus_tag="CAGL0J07590g"
                     /db_xref="GeneID:2889897"
     mRNA            <738538..>740193
                     /locus_tag="CAGL0J07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448037.1"
                     /db_xref="GeneID:2889897"
     CDS             738538..740193
                     /locus_tag="CAGL0J07590g"
                     /inference="similar to AA sequence:UniProtKB:P23503"
                     /note="similar to uniprot|P23503 Saccharomyces cerevisiae
                     YNL240c NAR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448037.1"
                     /db_xref="GeneID:2889897"
                     /db_xref="GOA:Q6FP07"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /translation="MSALLSEDYLNDYISPALACTKPTEIKKEKFVTEDGEFQVGVEP
                     QELEKVTISLSDCLACSGCITSSEEIMLSQQSHSVFLDAWRELGFDKCGSAGDAQCTN
                     KLVVSISPHCRASMARYYGVDVDAADYAILRVFKEVFHATSVIGDGAGRLLSVKRVVE
                     ELMERRKASQGTALSSICPGFLIYTEKTKPKLVPMLLNVKSAQQVTGALFKEIALEEG
                     YDVDTSLKDGKRTNVQYHLTIVPCFDKKLEASRPDGEGEVNCVITPREVLAMLGEMGV
                     SFRKYLGDWASLDKQLQQSQLGMLRAEMSPAGWDPLLHWSIPANGDGYSDGYAYQYAC
                     TVRDAHVASGCAAQVVSVPGKNADVLEYRVVEPSSEGGKVIARACVLSGFRNIQNLCR
                     KLDPSGHKKRSVRRVAALRSRGRKDSSSEDSTGTPSAISNALGGTANPAECDYVEVSA
                     CPSGSINGGGLLMELAPEREEMGETPLPSSTIGGNARRRQQQLQELQAMYKAQIRITD
                     ETPTSLPPAALPPLPPQYTMQYTFYIQEEDPAKPDIVTVGNTW"
     gene            <740949..>742451
                     /locus_tag="CAGL0J07612g"
                     /db_xref="GeneID:2889898"
     mRNA            <740949..>742451
                     /locus_tag="CAGL0J07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448038.1"
                     /db_xref="GeneID:2889898"
     CDS             740949..742451
                     /locus_tag="CAGL0J07612g"
                     /note="highly similar to uniprot|P11412 Saccharomyces
                     cerevisiae YNL241c ZWF1 glucose-6-phosphate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448038.1"
                     /db_xref="GeneID:2889898"
                     /db_xref="GOA:Q6FP06"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:Q6FP06"
                     /translation="MSEPVKFEKNTVVVVFGASGDLAKKKTFPALFGLFREGYLHEST
                     KIIGYARSSLTVEELTERIKPHLKTPRGKEDEAKIPQFFKLLTYVSGPYDQDDGFIRL
                     REQIETFEGAKCSTVPHRLFYFALPPSVFLPVATNIKRLVYAENGVTRLIVEKPFGRD
                     LETARKLQADLSPLFKEEEIYRIDHYLGKELVKNLLVMRFGNQFLNSAWNRDNIQSIQ
                     ISFKEPFGTEGRGGYFDNIGIIRDVMQNHLLQVLTLLTMERPVSFDPEAIRDEKVKVL
                     KAMAPFDPKDILIGQYGKSEDGSKPAYLDDETVKPGSKCVTFAAIAFQIENERWEGVP
                     IVMRAGKALNEGKVEIRLQYKAVASGVFKNIPHNELVIRIQPNEAVYMKFNAKTPGLS
                     NATQVTDLDLTYSSRYKDFWIPEAYEALIRDALLGDHSNFVRDDELDVSWSLFTPLLN
                     YLEGPDAPQPEIYPYGSRGPSGLRDYLKKHNYMIEEKHPYTWPVTTPDED"
     gene            complement(<743067..>747830)
                     /locus_tag="CAGL0J07634g"
                     /db_xref="GeneID:2889899"
     mRNA            complement(<743067..>747830)
                     /locus_tag="CAGL0J07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448039.1"
                     /db_xref="GeneID:2889899"
     CDS             complement(743067..747830)
                     /locus_tag="CAGL0J07634g"
                     /inference="similar to AA sequence:UniProtKB:P53855"
                     /note="similar to uniprot|P53855 Saccharomyces cerevisiae
                     YNL242w SPO72 required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448039.1"
                     /db_xref="GeneID:2889899"
                     /db_xref="GOA:Q6FP05"
                     /db_xref="InterPro:IPR015412"
                     /db_xref="InterPro:IPR026849"
                     /db_xref="InterPro:IPR026885"
                     /translation="MAFWLPQNIQRRLILYVLQQITLFSNVDITKLDVSLGSHSKFTF
                     QDVDLNISEMNISGCEVNSGMLGKLMLGLTVSGDVHISGDNIDFMITMINEDDFNDMN
                     SFSLAKSFYDLTSSIMQFKPDAHLKNEISGSGSDSPRIPDDYTNPSSAGGNPTTNTYD
                     IIVDDTASSTTESDDSSPIDSIPTSRFNIMQQKVIATALAKLKITLQSVRIRINLGKR
                     KDCNCLDVVVKRIDMSTSEGHVRNFDANGISIAYINNEPSVVPPNNMDMAESLYFSQA
                     DASSIYMSALSDANTDIKSLDASVFNSERYELLSINGMSFSFVGISSIDDFAISRIKI
                     NLGTLQVNIPFLLKVREDIILTMIFKLISPRHTDKVDVKNSPAYKRFQNELHSNDTNL
                     FSNLAIEEILIGLSSNQKIILRAVDLESNEINGINLSVGDIDLVGLDMDWISETRPCF
                     NASFGKSNTIIELANTIIRVSEHDLILFLKIYYEIMDFIDFVLSKWKILGVKQVSQLR
                     NDEKFSLNVGSLVIEIPLDNSILEINIPNIEHDSLNQDLKLYEVNMTHIVESIKISSL
                     KLKEVSIDLSSARKKMKCYNEHFSQYFVFTHYKVQITGIDSQINLKSLWIIGAVIEQF
                     YIASPVQEYPEATNKNSVRFHDNNKRLLSTSLMINKRAILAKYIIELDDIKVCISGFD
                     ADQIRHCKFSLQRLLFLNQIDKGLLFNIFQPHVEIKFFSGSLNDIIRSTNIGVSGQPH
                     LILCIFADKKIKVSIKDIMIFYQAKWLDSVQRNASLDQEKGQNVEYSELPEFSISIRD
                     SAINFLPFRINPSLVILFESIIVTKSGNDALINMHSKVGRFYLTDNYDHLKTTQVMNK
                     TICDSLIKSGYSQIGKFEGLSMTLNKKHKIVNCNGCLEKVILSVCSDSFHTLVQLCMD
                     LKVPVTFPDDKKYQPVPSVAVDLFETIEENEFNLSNLDNKDIDKSIGSDSDSLHIVNS
                     FLDEVEDFQFHEDYNSGTVWSHTTSDTHSSSDILPISLKEEYLDSRRTEVQKHSQSND
                     RNIISEIDFDIKNADIRLYDGYDWRYTRKNVSSAISELEEGLLSGIQRQEQTESELSR
                     TTVFDSICIATKQKDLGNLKQIISEQVQGKHDHLNSDKVYLYPSKHYKSLIKANELIF
                     KIKIYDSNSPRNEEFNNHAAKLFQITASISTYEVLDNLPTSTWNKFVTLLKKEAWPKS
                     EPMLYFDFMLFKPINSLEATEATINIRSAPLRIHADQYMVDFLLRFFQFNDKRFELID
                     EYPEILFLQKFKSNTIKLRIDYKPNKTSSGMYSGKISDLINLFVLDESKVTLKGVVLH
                     GINGFNELSEQLVKIWGNDVTSKQIFNILQGFAPVKSFIALGAGAQTFITVLLAEYKR
                     DRSISRSVKKSGNIFIKTTTGDFIKLGAKLAVGTQALLENTEGILSGNATQNRTLADV
                     SQTNKVLDLDSLLQQDQVLIGRNPKIRNKSPSAIIIDAADLEESGRPKVVSLYSEQPL
                     DLHKGLEEAYHALEKHIQIAYNTIWQTNQELRGEESRSAKAAAVTIAKAAPVAVIRPM
                     IGATEAIAKTLQGIYNQLDKSNIEEINDKYKKEDN"
     gene            complement(<748336..>751194)
                     /locus_tag="CAGL0J07656g"
                     /db_xref="GeneID:2889900"
     mRNA            complement(<748336..>751194)
                     /locus_tag="CAGL0J07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448040.1"
                     /db_xref="GeneID:2889900"
     CDS             complement(748336..751194)
                     /locus_tag="CAGL0J07656g"
                     /note="highly similar to uniprot|P33338 Saccharomyces
                     cerevisiae YNL243w SLA2 cytoskeleton assembly control
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448040.1"
                     /db_xref="GeneID:2889900"
                     /db_xref="GOA:Q6FP04"
                     /db_xref="InterPro:IPR002558"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:Q6FP04"
                     /translation="MSRKSSEADLQKILKKACSIDESAPKRKHVRACIVFTWDHASAR
                     AVFSALKSMPFTDHEIQLFKLLIVLHKVIQEGHPSALAQAIKDREWIRSLGRINIGHS
                     PYTKLVKEYVRFLMLKLDFHATHKGFKNGTFEYEEYVSLINVSDLDEGYETVLDLMTL
                     QDQLEDYSQIIFASIHSERDSSELRIAALIPLVAESYGIYKFITSMLRGLHAQLNDAE
                     GDAALQPLIEKYDLQHARLFEFYADCSSIKFLTTMVTIPKLPTKAPDVLVDNSNDIET
                     TRKTPTPQPKKTPTPEVRKPSPGPREQLKPTRTASTANTLSPMFTANVMIPTVTGAVQ
                     QAFPQQQQQIQPDFWVNQQAQLAQEQQRLAQERQQQLALQQQQQEEFQRQLQQTQQEM
                     MNMQMQQQSQHQNDLIALTNQYEKDQALLQQYDQRVQQLEEEISNIDKNANEQIDNKN
                     EQIGSLQDQLEMWEKKYESLAKLYSQLRQEHLQLLPRFKKLQIKVGSIQEAVANKEVL
                     EQKLKKKDLQLIDAIKERDRLRLDNERLISNKSEDLNSDGVEKFADDRVLPMLDAVLL
                     SGINTIQESVFNMDNSLSWSGPLAPASFLLALADNTSERATEFATNFNNLIVDGLVNG
                     DQTAVIHSVSDFSVSIATLVTYVNAYTTSLLGENDSESIASMAKKCAREAEFFFEDLL
                     SENLMPYDDEGKTDVVINSNVNFQEKLQHLTTTIEKVLQSAPQNKNKEQDPHSQLIAT
                     ADAIVKSSQPLRITPNVPKPLLTLALAIIDAVVALVQAAVQCQNEIATTTNTPLSQFY
                     KKNSRWTEGLISAAKAVGGATDILISTAGELVTDDKEGSPERFAVAAKEVAASTIQLV
                     AASRVKSGVHSKAQEKLEECSRAVTEACKELGHTVLVKYNSEAQDDQPMEFTSEHQLK
                     TVEMEQQVEILRLEQSLNIARKKLGEIRKHAYFTEQDE"
     gene            <752132..>752458
                     /locus_tag="CAGL0J07678g"
                     /db_xref="GeneID:2889901"
     mRNA            <752132..>752458
                     /locus_tag="CAGL0J07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448041.1"
                     /db_xref="GeneID:2889901"
     CDS             752132..752458
                     /locus_tag="CAGL0J07678g"
                     /note="highly similar to uniprot|P32911 Saccharomyces
                     cerevisiae YNL244c SUI1 translation initiation factor 3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448041.1"
                     /db_xref="GeneID:2889901"
                     /db_xref="GOA:Q6FP03"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005874"
                     /db_xref="UniProtKB/TrEMBL:Q6FP03"
                     /translation="MSIENLKSFDPFADTGDDETAASNYIHIRIQQRNGRKTLTTVQG
                     VPAEYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQGDQRAKVCEFMISQLGLQKKN
                     IKIHGF"
     gene            <753062..>753592
                     /locus_tag="CAGL0J07700g"
                     /db_xref="GeneID:2889902"
     mRNA            <753062..>753592
                     /locus_tag="CAGL0J07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448042.1"
                     /db_xref="GeneID:2889902"
     CDS             753062..753592
                     /locus_tag="CAGL0J07700g"
                     /inference="similar to AA sequence:UniProtKB:P53854"
                     /note="similar to uniprot|P53854 Saccharomyces cerevisiae
                     YNL245c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448042.1"
                     /db_xref="GeneID:2889902"
                     /db_xref="GOA:Q6FP02"
                     /db_xref="InterPro:IPR019339"
                     /db_xref="InterPro:IPR022209"
                     /translation="MGTGDLNLLKSWNPKLVKNRKKVWEKEQRLLEEDEKIRKRQLEI
                     AKEKEEEELLAGRDSTKGRKTGLEWMYQDDPTAKEDYLLGKKKLDTTVIKKAEVMEEN
                     QTPLTKINKTTVIPDAIYSKEDPMARFGTKVKRNKVVKKEPVKPLRGKTTNEPRTDNI
                     KPKSDYKKRLQEELDY"
     gene            complement(<753637..>754425)
                     /locus_tag="CAGL0J07722g"
                     /db_xref="GeneID:2889903"
     mRNA            complement(<753637..>754425)
                     /locus_tag="CAGL0J07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448043.1"
                     /db_xref="GeneID:2889903"
     CDS             complement(753637..754425)
                     /locus_tag="CAGL0J07722g"
                     /inference="similar to AA sequence:UniProtKB:P53853"
                     /note="similar to uniprot|P53853 Saccharomyces cerevisiae
                     YNL246w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448043.1"
                     /db_xref="GeneID:2889903"
                     /db_xref="GOA:Q6FP01"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q6FP01"
                     /translation="MSDKEIVGKAFLDLAKYEEDVAKVEDDIEHYRLKMMQPMVERRD
                     NIIKNIPEFWKIVLSQHTSFADFIRASDFKYIDLIDKVKVDWLIIEDPKQYSVGDFRI
                     TLHFNSIDDDFNEQTVSKVFKLIKGDINEGDTDDETEEERLVSEPVDIQWPKSYDSIN
                     PSLIEDKHSKEGKKSYRQGMKSFFGWFKWTGKKPGKEFPHGDSLATLFSEDIYPYCVK
                     YYTEAQRDLEDEEEDDSEDNSSEEPLDLEVESESEESDKKRRKI"
     gene            complement(<754822..>757188)
                     /locus_tag="CAGL0J07744g"
                     /db_xref="GeneID:2889904"
     mRNA            complement(<754822..>757188)
                     /locus_tag="CAGL0J07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448044.1"
                     /db_xref="GeneID:2889904"
     CDS             complement(754822..757188)
                     /locus_tag="CAGL0J07744g"
                     /note="highly similar to uniprot|P53852 Saccharomyces
                     cerevisiae YNL247w cysteinyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448044.1"
                     /db_xref="GeneID:2889904"
                     /db_xref="GOA:Q6FP00"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015803"
                     /db_xref="InterPro:IPR024909"
                     /db_xref="UniProtKB/TrEMBL:Q6FP00"
                     /translation="MVNWSVLKRTVMSAANSKVVQPKWINPAQCSERTQAPVLKLYNS
                     LTRSKEVFAPSSGTKTVSWYSCGPTVYDASHMGHARNYVSIDINRRLIQNYFGYDIQF
                     VQNVTDIDDKIIIRARHNYLFEEFVKQNDSETPLNESDEIVKKANDATISYINKNLAD
                     VLGSSQESVNTFLVAAEKVNHEEAKLKDPKFPMHMTSVQNAISALSNVSKLPRRKFFD
                     GVKDVLVPVLDKELGSTINDPEIFRKLPAYWEKQYDSDMAALNVIPPNVTTRVSEYVP
                     EIVSFVEDIINNGYAYATNDGSVYFDTVRFDQNEKHDYAKCQPWNKGKLDLINDGEGS
                     LSNFDNNGKKSANDFALWKGSKPGEPAWDSPWGKGRPGWHIECSVMASDILGSNIDIH
                     SGGIDLAFPHHDNELAQSEAKFDNKQWINYFLHTGHLHIEGQKMSKSLKNFITIQEAL
                     QKYTPRQLRLAFASVPWNNQLDFKESLIHEVKSFETSMNNFFANVRAHYNDYKSSLED
                     DSIIVSKKLTNLEKDLLEEFKKSQEKVHAAFCDNLSTGQALKTLSDLVTTTNTYITNS
                     GKDLKIEPVISICKYITKILDIVGFPGRPDGLGWVAQASSVSSGSESANQISGSIEEI
                     AMPYVKCLSTFRDSVRSMAIAKAQPQEFLKLTDTVRDNDLLNLNVSLDDRNGQSALVK
                     FLTQHEKDEIIKLNAEKKQREEEKLKKKLEQQKIKEAKEKERQEKAKVSPLEMFKDTT
                     LYSAWDEQGLPTKDKDGNDITKSMTKKLKKQWEQQKKLYEEFNGPLSS"
     gene            <757665..>758888
                     /locus_tag="CAGL0J07766g"
                     /db_xref="GeneID:2889905"
     mRNA            <757665..>758888
                     /locus_tag="CAGL0J07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448045.1"
                     /db_xref="GeneID:2889905"
     CDS             757665..758888
                     /locus_tag="CAGL0J07766g"
                     /note="highly similar to uniprot|Q01080 Saccharomyces
                     cerevisiae YNL248c RPA49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448045.1"
                     /db_xref="GeneID:2889905"
                     /db_xref="GOA:Q6FNZ9"
                     /db_xref="InterPro:IPR009668"
                     /db_xref="PDB:3NFF"
                     /db_xref="PDB:3NFG"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ9"
                     /translation="MGEKRSIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQD
                     QFVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSKFSKN
                     LKGPEIKSKGDTRYGAMRNALGEAFGTKKAKKAIADLERNRVDSDKLTDVAIDIVDSV
                     KTASKDLPTRAELQENVSASNRPTPVANLDATDVEQIYPVENIIPKKELQFIRVGPIL
                     KEKDQEKKLELFPYTSSKYVAKKLETLTQASQMEKLQLLYYLSLLLGVYENRRVSNKD
                     KLLERLNSPPELLIDGILDRFTIARGGHFGKSKNRSYFIDPQNEDKLLCFILTIVMHL
                     DNFLVEISPLAQELGIKPSRIVNLFRILGAIVKGATVSQAEAFGIPKSAAATYKIASL
                     KVPFKLPELTRRGRR"
     gene            complement(<759175..>763092)
                     /locus_tag="CAGL0J07788g"
                     /db_xref="GeneID:2889906"
     mRNA            complement(<759175..>763092)
                     /locus_tag="CAGL0J07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448046.1"
                     /db_xref="GeneID:2889906"
     CDS             complement(759175..763092)
                     /locus_tag="CAGL0J07788g"
                     /inference="similar to AA sequence:UniProtKB:P12753"
                     /note="similar to uniprot|P12753 Saccharomyces cerevisiae
                     YNL250w RAD50 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448046.1"
                     /db_xref="GeneID:2889906"
                     /db_xref="GOA:Q6FNZ8"
                     /db_xref="InterPro:IPR004584"
                     /db_xref="InterPro:IPR007517"
                     /db_xref="InterPro:IPR013134"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ8"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTII
                     ECLKYATTGDLPPNSKGGVFVHDPKITGEKDVRAQVKLAFTSTNGLSMIVTRNIQLLA
                     KKTTTTFKTLEGQLVAINKSGERTTLSTRSVDLDSHVPLYLGVPKAILEYVIFCHQED
                     SLWPLSEPSNLKKKFDEIFQAMKFTKAIDNLKAIKKEMAVNIKLLTQSVEHLRIDRDR
                     SRATKMKVKQLNEKINDYQSQVDDVEQELESINGSLDSLFKSNQNFQSVLSRIETLNA
                     SISAASTQIERLSNSIEKLDMPKVDLENLLKNFSESIEQKELDVKRLESKIASDRQKL
                     ENCQKQSNRLMLQQGELTAKKLQNENTLKSFQDTIRQIKDEHKLDLNAEEPPQRNVDH
                     ILKKKADMESSVNEAISKLEETKMNLKEKSDSIRNSINLEEQKLSYYESDIKQLATKL
                     DQKQKQISSIPADIEEQLKAKKAVWSKLSKELQEFEKENNITDINNQIKSNNEELSKS
                     ELLAQQIETDLQNYSKKSELSTKLSVLIENMDEKQNEINKITTALLNDTMIKEWGLDD
                     VKQLSFEFKTHYIALQKNIATNLKAFNEISKSQTELEYELNTCKGKVNNLQHKKEKLI
                     LNINSVLPEDCSIEDYDDVLLETEVSYKTALENLKMHQTTLEFNRKALEVAINNDCCY
                     LCSRSFENTEFRSKILKELKEKTDTKFEESLKTTLEDEKEYLNNLRLAEKDIYNLNSI
                     SSESKALQDRISQLSKELDNKKSEVAEANTTIEKLKEKRDHCDNYIKPKMDKIDYLQK
                     EIYNHEEEKNSLNDVIRSSAENGDSVTMEQLQDNQKSTRELIWKIRSEIESLQEQREN
                     ISSKNNTLINQIRQANDDVAEIEKQFDMKVTIQEQIANDKKHIEELTNSKESIKLHIN
                     DLSKSVEMLNKENSEKISTLDKDAKRKKGEFQSFNELVLQVNQLHHQLMQYNTSDEQH
                     LQECERSIKELEKEMNILKNGLEADNHVLNEQSQKLYDSTGEKRNLLQNIELIDLKEQ
                     LLSMNNELSSLNAQNAEAERDKYQQESARLRTQYERLSAQNAGKLGEIRQIQNQIDSL
                     TQQLRSDYKDIDDKYQKEWVELQTRSFANDDIDTYSKALDSAIMKYHSLKMEDINRII
                     DELWKRTYTGTDIDTIKICSDEVGSTTKGKSYNYRVVMYKQDAELDMRGRCSAGQKVL
                     ASIIIRLALSETFGINCGVIALDEPTTNLDEENIESLAKSLHNIIEFRKHQKNFQLIV
                     ITHDEKFLNHMNAASFTDHFFRVKRDDRLKSLIEWVDINKVTE"
     gene            <764042..>765856
                     /locus_tag="CAGL0J07810g"
                     /db_xref="GeneID:2889907"
     mRNA            <764042..>765856
                     /locus_tag="CAGL0J07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448047.1"
                     /db_xref="GeneID:2889907"
     CDS             764042..765856
                     /locus_tag="CAGL0J07810g"
                     /inference="similar to AA sequence:UniProtKB:P53617"
                     /note="similar to uniprot|P53617 Saccharomyces cerevisiae
                     YNL251c NRD1 involved in regulation of nuclear pre-mRNA
                     abundance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448047.1"
                     /db_xref="GeneID:2889907"
                     /db_xref="GOA:Q6FNZ7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ7"
                     /translation="MSGDSEHQEFVETLESFHDLKTGISGSRIKKLTTYALEHVASEE
                     QLISLIINYSRTCESSHKLGSLYIIDSIGRAYLDEARSGTVDTPAPAGTAAHAVATLG
                     EVIQELLSDALEKSNQDHKEKIKLLMDIWDRSALFQKECINSVRNKFFPTPTSSANKS
                     IDDDMVQLPNDPSERADKILETLKPIDIVPAVSLPSGLFSDVEHDQKRALVQLLVSIQ
                     KQYEEDPRLSKQDSAAQPVPQSRRDENRQSRHVITEYGSRREREREREKNNRRNRSRS
                     PKRDTMNYGGDSAPSRYQNMPPVNNSNYNLGAPNMNFGVNNHHLYPDEVNVPANPHYR
                     NKTVTFEPSIPPDHIKVYSRTLFLGGVPMNMKEWDIANVLRPYSEVQSVILNNARKHA
                     FVKVYSRQEAENALLNFNKDGSLPLRTRWGVGFGPRDCCDYQHGFSIIPLHRLTDADK
                     KWSVSAQWGGTGGQPLTSGIAFEEPDIVVGEGVSSKAISQKMPTDSGRNGPRSNKAKN
                     MAPQYGPPQAAVISPSQGYAGMQQGYPQQQQQQQMGMYGQPMMQQPINAYASPAQQQP
                     IMQAPPPPAPPSQQQQSSNYDPTAQLNSLMNILNQQQQ"
     gene            <766589..>767386
                     /locus_tag="CAGL0J07832g"
                     /db_xref="GeneID:2889908"
     mRNA            <766589..>767386
                     /locus_tag="CAGL0J07832g"
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /transcript_id="XM_448048.1"
                     /db_xref="GeneID:2889908"
     CDS             766589..767386
                     /locus_tag="CAGL0J07832g"
                     /inference="similar to AA sequence:UniProtKB:P36528"
                     /note="similar to uniprot|P36528 Saccharomyces cerevisiae
                     YNL252c MRPL17"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL17/YmL30"
                     /protein_id="XP_448048.1"
                     /db_xref="GeneID:2889908"
                     /db_xref="GOA:Q6FNZ6"
                     /db_xref="InterPro:IPR021757"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ6"
                     /translation="MLSVRGLATAAKATGSPAVKVGLILSRVPLVSPEKSELESSYYK
                     YMSELERRLMWTFPAYFYFKKGTLSEHRFYAAQKGPISKQEGVWFPKGVPDIKHGRER
                     SQKQTINLPKSKQQEGQASDDISRPIIANSIVTEADKNNDLTSLERSLRRTLYLLIKD
                     KKGIWKFPNFDIGEEKSLHRAAEKGIREIGGENMNTWTVSRTPAAVLKDDPKSSQFLI
                     KSHILMGRFDIQDKRILSDFAWLSKDEIKGKVEKNYYEKISFLLSDI"
     gene            complement(<767587..>768885)
                     /locus_tag="CAGL0J07854g"
                     /db_xref="GeneID:2889856"
     mRNA            complement(<767587..>768885)
                     /locus_tag="CAGL0J07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448049.1"
                     /db_xref="GeneID:2889856"
     CDS             complement(767587..768885)
                     /locus_tag="CAGL0J07854g"
                     /inference="similar to AA sequence:UniProtKB:P53851"
                     /note="similar to uniprot|P53851 Saccharomyces cerevisiae
                     YNL253w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448049.1"
                     /db_xref="GeneID:2889856"
                     /db_xref="GOA:Q6FNZ5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ5"
                     /translation="MPATAIDSFNNISSKSHEYVNVVENVAVKFLQSAFENEHINAIE
                     DDRYNHVITRIQSRFKNSLTPNEILAFEFHPAGHSLAYSRIDGSITIWPSIQATFIPG
                     KMIHIKDACGTDKLVTSISWNPNEITQLITSCNSDELDIWEYDELNLKASKVRSISVD
                     HKTKLNNALFDPTGEYILAITKSDSIYLFSAKDDYRLLHTIKLKSIMSSDTLYSVTWD
                     SSGSNIFLGTKNGSIIAMSINKENNEMFKVLEVTAHRFSVTCLKIDPLGRYLFSGSKD
                     GSCSIWELRTLICIKEISGLESNILSMDICHLGKMLGLCLEDERVCFCDVTTGKIIYE
                     SSLSGSNSEPLLRFFPDKTMFILSGKNDTLEKHFYGSGKLSLLSVLSTESRKNGDSKG
                     HSKGISKKSSKKSNTDREKSQGPRSTRPNRKSRFLASKRR"
     gene            <769398..>770417
                     /locus_tag="CAGL0J07876g"
                     /db_xref="GeneID:2889857"
     mRNA            <769398..>770417
                     /locus_tag="CAGL0J07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448050.1"
                     /db_xref="GeneID:2889857"
     CDS             769398..770417
                     /locus_tag="CAGL0J07876g"
                     /inference="similar to AA sequence:UniProtKB:P53850"
                     /note="similar to uniprot|P53850 Saccharomyces cerevisiae
                     YNL254c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448050.1"
                     /db_xref="GeneID:2889857"
                     /db_xref="GOA:Q6FNZ4"
                     /db_xref="InterPro:IPR028094"
                     /translation="MEDSIDLQRESLNKLIPESGSDDTSSSDEVNGLPTSSDGADDVS
                     LINSEDLNSSLLKSDPGGTNKSDQTKNDETDSNDDQRIVLSGGVELEEVQETVKVYNN
                     VKQALLEVETTDESQLILDKIKRDSQYSSDTECESRDADSELEDIQLEFRSKYPQLQI
                     PYSDELCVKIIPYLDIVYDILSGVVTSMYYTRAKRAAMDSKKAFLSAEDFRNLDINLF
                     TAGYFGLRRQLKVGNIIYEKFRDELARSKSPKIQWWGPIDFANYVLAPEVLVSFVLDT
                     CQNKRSVQLTSRQDVYELFDNTTYYGNTVTDNEPLESWELSRKKRKYGPTNNQKTHKT
                     RKKKS"
     gene            <770997..>771464
                     /locus_tag="CAGL0J07898g"
                     /db_xref="GeneID:2889858"
     mRNA            <770997..>771464
                     /locus_tag="CAGL0J07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448051.1"
                     /db_xref="GeneID:2889858"
     CDS             770997..771464
                     /locus_tag="CAGL0J07898g"
                     /note="highly similar to uniprot|P53849 Saccharomyces
                     cerevisiae YNL255c GIS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448051.1"
                     /db_xref="GeneID:2889858"
                     /db_xref="GOA:Q6FNZ3"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ3"
                     /translation="MSQKACYVCGKIGHLADDCDSERLCYNCNQPGHVQSECTMPRTV
                     EHKQCYNCGETGHVKSECSIQRCFNCNQTGHVSRECPEPRKGRFGAASKNVSCYKCGG
                     PNHVARDCMQTDTKCYSCGRFGHVSRDCPNGPNEKVCYNCNETGHISRDCPVL"
     gene            complement(<771900..>774323)
                     /locus_tag="CAGL0J07920g"
                     /db_xref="GeneID:2889859"
     mRNA            complement(<771900..>774323)
                     /locus_tag="CAGL0J07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448052.1"
                     /db_xref="GeneID:2889859"
     CDS             complement(771900..774323)
                     /locus_tag="CAGL0J07920g"
                     /inference="similar to AA sequence:UniProtKB:P53848"
                     /note="similar to uniprot|P53848 Saccharomyces cerevisiae
                     YNL256w FOL1 Dihydroneopterin aldolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448052.1"
                     /db_xref="GeneID:2889859"
                     /db_xref="GOA:Q6FNZ2"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="InterPro:IPR016261"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ2"
                     /translation="MSTLVVDKHASDRDHVHVIKLEASAHMGPDMWGQPTEQRCNITM
                     NMGTDFSKSSETDDLKYSLNYAVICKDMLKYIGLKNNRWGSVGAMTRDVAQFAMDSWL
                     GINNLNLEVNVPSVHIRSKDIACEVNRSRAAVTEDLQDFIKIQNLRLLTLIGVFTFER
                     KEKQFVDLDIKIPWPRNREHHISIKKIVDKIVQHVENSNFKTVEALAENICGIIGHDS
                     YFGHNLKDLPISVKVIKLNAITDTEGVGVSCVRKPSELPHYDQKPFSNRSDPKSLDDS
                     FNLPVGTNVPLIEGAWNTAFLAFGSNIEPRRQQVERAINLLRENPNVKVKGFSSYFES
                     EPMYFKDQSPFLNGCIGIETTLSPHELLELCKDIEYTKLGRVKKFNNGPRTIDLDIIF
                     YLSESGEHVLVNDTDLTVPHPRMLERTFVLEPLCELLHPEFTHPVSAEPVFNHLENIY
                     DNENPEDILWKLIPLPSKDGESEKFLKFKNVKVYDEILGISRWRTQSSALAMGVVNTT
                     PDSFSDGSESYLDVNEKVEKVKKMINDGLRLSEQLIVDIGGCSTRPGSTQVSEEEEIE
                     RTIPLIKAIKACSDIPFDKVLLSIDTYRSKVAQSAIECGIDIVNDISAGSFDPTMFDV
                     IANNPQIAYVLSHIRGDIATMSTKTTYGEPDGTHYVNGRKNTSESTVLIRNIGKEMAD
                     RYCLAMKKGVQRSQLILDPGIGFAKNAKQNLQIIKQTSLLKNYSYVQDNLSVNFRNIP
                     VLVGPSRKKFLGTITKEDDPSKRDSATSSIAATCVGFDADIIRVHNVRECIQSIKLAN
                     ELYRSATLT"
     gene            <774882..>778616
                     /locus_tag="CAGL0J07942g"
                     /db_xref="GeneID:2889860"
     mRNA            <774882..>778616
                     /locus_tag="CAGL0J07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448053.1"
                     /db_xref="GeneID:2889860"
     CDS             774882..778616
                     /locus_tag="CAGL0J07942g"
                     /inference="similar to AA sequence:UniProtKB:P38717"
                     /note="similar to uniprot|P38717 Saccharomyces cerevisiae
                     YNL257c SIP3 SNF1P or uniprot|P38851 Saccharomyces
                     cerevisiae YHR155w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448053.1"
                     /db_xref="GeneID:2889860"
                     /db_xref="GOA:Q6FNZ1"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ1"
                     /translation="MAPLEEHHNQRQLRLISVAFKEASIDSPSFRATVNFFHTRVDIF
                     EEWIDKSMAFYEKKYTHSYDDFKRTQNSLLSQLLPSPSMLSSGLVSNQGYTPSLVSNF
                     LFDFTEYSERIIKALKGNDILNSTPLSELISVAIDPYKACRKSFDYYQTKYDSMLSTF
                     QAANIREVSIDPETTKNDTIHIFTLQKSYIQASLDLIEAIYTLRLQIDKFLLDTMNNM
                     KSDSIYSPKDGSRPLDLMPSMNEYMKDYTMWVQNAIDGARALERDIENAKKQAYEYTL
                     SHITPSEDINDYDIRTISTNTFVDQNIHINKTPEKSGWLFMKTYVGTPSREIWVNRWC
                     FLQNGVFGTLLLSPSKTYVEETDKFGIFLTNIRYKPEEYRKFCFEMKIFNGNNSASQD
                     KRKMIELVFQASSLKELKSWINAFETTRKVVSQLDKNSLNYEIAYKRFSPKYIEFASS
                     TTTKIDQQITTFDDTTESLFQKYKCAFSEYEVLSVGSEKIFNFQTIITPISTKMTNLA
                     FLADNSVYGSYCTNAVVANIWGTTYWSDYSLILSTVPMNEERTTSKPTTRLVSPHDKI
                     IYPKFYPNAMKFYDLQFKNLFFSIDQRLSKITEEFLLFKFDAFWCPNKKQKFASTCYL
                     TQYNLYSFINSVGFICLTKVNLDDLVSIEKDKATRTLIRIYDSSGLQLRVNVLFTDPE
                     AVALKLQYLLEKKASGTNDSIMEIFARFSEIDKEMEEKRNLERANSDSSESVYDSQLV
                     GSKHDHELTFWNITKESAELLNKRKMLQKESSVYFSHNYDIPCKGLMHLLFGDESQAF
                     PKSLFLARKNGTQHVNWYWKQKRTNKTGDVILSRKIEFVVDMTDNFLTTSKYSDNNVE
                     ELSLEQNIVKAIDNKYYEIDQTPVRIKLPFARIMKITTKYIISEAYDPEKSTSENKSK
                     SPRNGSCFQLFFNIDFLDCKSGNPVKDLHFLERVYLDWAIHFAGTEFFLFRKVIRFYL
                     EKMGKHGKVIKAMRLCGLIGVSDEATNETEKHEVITEKDIGTNKDVNVDPIVDRKQYD
                     ARYTLNIISKVLLKRLVYRVSNLFFFLFRVIISLFLGSSTVVQSLNRYLLFGLLLSII
                     VNLYLSGRSTLNFWSVHNAEKKFNNFMSDSGKFTMQRSIKIDDLDLLTEYLAIDENNR
                     AYNKFQEYLHDIDHDFKYKTTRKDLAVKRNELLVELRILQNMERELVQGEYKRFLLEE
                     VDRCEQALREVPDLFTNDENIKSYCENCNDELTRVSRLLL"
     gene            <779482..>781719
                     /locus_tag="CAGL0J07964g"
                     /db_xref="GeneID:2889861"
     mRNA            <779482..>781719
                     /locus_tag="CAGL0J07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448054.1"
                     /db_xref="GeneID:2889861"
     CDS             779482..781719
                     /locus_tag="CAGL0J07964g"
                     /inference="similar to AA sequence:UniProtKB:P53847"
                     /note="similar to uniprot|P53847 Saccharomyces cerevisiae
                     YNL258c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448054.1"
                     /db_xref="GeneID:2889861"
                     /db_xref="GOA:Q6FNZ0"
                     /db_xref="InterPro:IPR021875"
                     /db_xref="InterPro:IPR021876"
                     /db_xref="UniProtKB/TrEMBL:Q6FNZ0"
                     /translation="MTYADKDHVITELLKDPVYLSRHNSLATHPKDENDLYALETKLE
                     EELHDLKDLKIVSSLVKETQVNLDLMELENCYYSLYNLSKKLKSSRSFLKQSLHFQRS
                     VAVHVDELRIKLLSTIYDILATKFWSISESSFEFHPDIKWKEEEFMMKYEEFKSFVSK
                     SFFPDNAINNSHWLITDIIHSEEQERMRNKLKDIYINYIDFASLTKAVKDALFSDEYE
                     FEWSDNNYTKLLITKRGALCIQKRIESFNNLLSFLEKGISNSDKFKLLTNLGKAIGIE
                     FLRFVKSNATGIIDKNANSIKQQTLLLNDRLKTISEQSGAWNFDSDQISKLLNDEILY
                     KSLLLDGVLGRAISDVRKLIANESWKSKTKITLKNSEMLNDSKEKEISQDNVGDEWEW
                     NEEEMDDDVHNSTSKVPNSKSEDLNDDEDGWADEIDVDLEDEINTKETEPEDDAWNDE
                     WDVEEDIKSTHSNKNSKSKHFINTTEEVTITELPKKFLNIMEKLLEDARAIDVNLPLT
                     EDFKYKANLLQTVFFSISSTKYGNEWWQFYNDMKFTFDQNNDMKRLQELIYNYMETNL
                     QNTKKISKRILSSQLQQFQRNENNPSWNDTLDNFLPFLEEELANITTHITQEDSFRYI
                     TRLFSFIFEDVIIQNILSWDIISEKNSENISELLKLIITSTQIDSLNTYPKYRELYER
                     VNIVAKLLPLHLKEIMEMFYNGDFYLFATEEIITWIKLLFAETPLRKDAIDDIYEIRN
                     TPTED"
     gene            <782059..>782283
                     /locus_tag="CAGL0J07980g"
                     /db_xref="GeneID:9488025"
     mRNA            <782059..>782283
                     /locus_tag="CAGL0J07980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999528.1"
                     /db_xref="GeneID:9488025"
     CDS             782059..782283
                     /locus_tag="CAGL0J07980g"
                     /inference="similar to AA sequence:UniProtKB:P38636"
                     /note="similar to uniprot|P38636 Saccharomyces cerevisiae
                     YNL259c ATX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999574.1"
                     /db_xref="GeneID:9488025"
                     /db_xref="GOA:B4UN31"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="UniProtKB/TrEMBL:B4UN31"
                     /translation="MSENQNHYQFDVVMTCSGCSSAVERVLKKLEPDVSHIDISLPQQ
                     TVDVYTTLPYETILEKIKKTGKEVKSGTTL"
     gene            <782640..>783128
                     /locus_tag="CAGL0J07986g"
                     /db_xref="GeneID:2889862"
     mRNA            <782640..>783128
                     /locus_tag="CAGL0J07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448055.1"
                     /db_xref="GeneID:2889862"
     CDS             782640..783128
                     /locus_tag="CAGL0J07986g"
                     /inference="similar to AA sequence:UniProtKB:P53846"
                     /note="similar to uniprot|P53846 Saccharomyces cerevisiae
                     YNL260c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448055.1"
                     /db_xref="GeneID:2889862"
                     /db_xref="GOA:Q6FNY9"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY9"
                     /translation="MNTDELLFLEEQFYQEGYEEGRNENLKNNLIEGKEFGLQVGFQR
                     FVLLGQMVGMCDVLDSLQLKNNSLFKNIANVRELISSIELNNKEENVESLEKTLVKLK
                     NKFRLILLSFQREFKHNDRKPINFDNFEDLSRAIAGEIKGFVEDEDATDAKTTQDQAQ
                     AW"
     gene            complement(<783310..>784728)
                     /locus_tag="CAGL0J08008g"
                     /db_xref="GeneID:2889863"
     mRNA            complement(<783310..>784728)
                     /locus_tag="CAGL0J08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448056.1"
                     /db_xref="GeneID:2889863"
     CDS             complement(783310..784728)
                     /locus_tag="CAGL0J08008g"
                     /inference="similar to AA sequence:UniProtKB:P50874"
                     /note="similar to uniprot|P50874 Saccharomyces cerevisiae
                     YNL261w ORC5 origin recognition complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448056.1"
                     /db_xref="GeneID:2889863"
                     /db_xref="GOA:Q6FNY8"
                     /db_xref="InterPro:IPR020796"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY8"
                     /translation="MSKSNLVVLFRDYQLELLDSLIDVDSTLTTPNLILQGYSGTGKT
                     LTLRKVFELKPDIINVWLDPIEVVSWKPLFQAIARSTQQRLMQKYPGLQDKEYDPMAV
                     EEPSFLVKYLIKLFSHYKELPEKIPLYIVYDGFDSLQDLDSQILYKLLKLHELLPNDN
                     AIVMKSIYTVRDLNFVNRYSSNAIPMVVFPRYNLDEIIKILILTRAQELVGSSFLVMQ
                     LELLDECEYTNESLEKVAVNFIQLIVQAFHSYTGNDIYALNDLIDFKWPLYLKNLDKN
                     NILDPLALYRANVRLFITTDDSLKNDFNDTYEDYSDTAMTQTYELSNISKYLLIAAYF
                     CSYIETKFDIGIFSKRGSKAANSKRKKKEQNPRYLQPSFFYIERLLAIFQSIYPLEIE
                     VPKGSLAALKVDDLMKSNVEVFQNLAELFSLKLITCSSSKNLDVLGNKIKWRVNIPWE
                     IISEIASSVSFDISEYFSGVHD"
     gene            complement(<785064..>791717)
                     /locus_tag="CAGL0J08030g"
                     /db_xref="GeneID:2889864"
     mRNA            complement(<785064..>791717)
                     /locus_tag="CAGL0J08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448057.1"
                     /db_xref="GeneID:2889864"
     CDS             complement(785064..791717)
                     /locus_tag="CAGL0J08030g"
                     /note="highly similar to uniprot|P21951 Saccharomyces
                     cerevisiae YNL262w POL2 DNA-directed DNA polymerase
                     epsilon catalytic subunit A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448057.1"
                     /db_xref="GeneID:2889864"
                     /db_xref="GOA:Q6FNY7"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013697"
                     /db_xref="InterPro:IPR029703"
                     /translation="MSTARFKRGNGQAGSLSNGYAVTAQQLLQAAKVDDIDAMMGFER
                     YVPPQYNGRVDPDRLDQVPGRTGWLVNMHPTLISEEIASGGGSDYNPSAAGIAGVDFY
                     FLDEEGGSFKSSITYDPYFFVTVTDDARLNDVEEFLKKYLETCLKDISTLKKEDLKLD
                     NHLLGLQKSLIKLSFVNSNQLFEARKLLRPILAENESNKQQRNVFKHSNISNGNGMLS
                     SNVNRFASSSVQDKKDAKQYIEDIREYDVPYHVRVSIDKDIRVGKWYKVTHEGFFVWP
                     DKVAFADPVVLAFDIETTKAPLKFPEASVDQVMMISYMIDGDGFLITNREIISEDIED
                     FEYTPKPELQGHVTIFNEVDELAVLQRFFEHIRDVRPTVISTFNGDFFDWPFIEKRAS
                     VRGLDMFEEIGFAPDSEGEYKSSYCVHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYN
                     PIELDPELMTPYAYERPQQLSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVL
                     RKGTGTLCEMLLMVQAYQGNILLPNKHTDPLERFYDGHLLESETYVGGHVESLEAGVF
                     RSDLATEFKIDTSAIDELIEDLPHALKFAVEVENKAKMEDVTNFEEIKEQIKEQLLEL
                     KENNKRHEKPLIYHVDVASMYPNIMTTNRLQPDSIKTEKDCASCDFNRPGKSCARRLK
                     WAWRGEFYPAKSDEYNMIKRALQNETFPNKNKFSKKPYLTFDELSYSEQVAHIKKRLT
                     EYSKKVYHRIKVSEIVEREAIVCQRENPFYVNTVKSFRDRRYEFKGLAKKWKGKMSSI
                     DRNDKHGKDEANKMVVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGAT
                     IIQMARALVERVGRPLELDTDGIWCILPKSFPENFFLKLENGKKLFVSYPCSMLNYRV
                     HQKFTNHQYQELVDPVKHKYETHSENTIFFEVDGPYKAMILPTSKEEGKGIKKRYAVF
                     NEDGSLAELKGFELKRRGELQLIKNFQSDIFKVFLDGKTLEECYASVAAVSNRWLDIL
                     DNKGSMLEDEDLVSLICENRSMSKSLKEYEGQKSTSITTAKRLGEFLGEDMVKDKGLQ
                     CKYIISSKPHGAPVTERAIPVAIFSSDINVKRSFLRRWTMDHSLDNFDIRTILDWGYY
                     RERLASVIQKIITIPAALQNVPNPVPRVEHPDWLKRRIAVKEDKFKQSKLERFLSKSS
                     QEPQNRRIKDIEELFHEDDDIKRIKLAKVTSRNKNKRNRDVQKNDEESLVLPATMPSM
                     EEDYVSWLSYQKIKWKIQRRDRIRRTQLFGKSGETNSRSVLGSMIRKQAEMFANGSWE
                     VLQYRDNYEAGAVDAYVIINGKVQVLKIYVPRTLYINFKTDSVPLKKIKNCEVERSNA
                     ILPNDARINNDSASPLFKLTLSEQVYLDELEDSGSVLNDESVLGIYESHISPAQKALM
                     DLGTTISFKSKKVGSLGKSLQDGFHLKDLTSVGNDRYLSHFDLNVCYLLHIDTNIDYE
                     FFVIFRSWENKLSIFVKKPSNNAQELLESTIIGIFKEQYHKRKDRITKFNKYINLSDN
                     VDMNSNHYTDKKKLFKAINQEFAMIKEQKGQQVLLLMQSPFPSLIKKNIRYSTQIPII
                     ELSMNILALPQLNWQNVMINKLCSYIISTSYWVSHLVSLSQHSNVPICNINLEKMDFV
                     IDVIYARRLKLDNIILWWNEQSPLPDHGGMENDFDQNTSWIMNDLDFPNINVPDVYDN
                     VVLEVSIENLVVNTILCSTLINEAEGSDLVDMNTVDVSDKPVGNNQGIVQDSFSHDAL
                     AVLKSLLKEWWDRALEKNITADLLVNSLVSWVYSTDSKLFDGSLRYHIHNLTKKSLFQ
                     LMNEFNELGSFIVSADRNRLLIKTNKISPETCYAYSHYMIKSIRSNPMFTYLDLNIER
                     YWDLLIWMDKYNFSGLSCSQIEEREKQDYTAYSNWQIKYYLPRIYQSEFEDWAMIILD
                     SMVKTKRAFLESSYGTQRATQIVTGLTPQSDTEDISPLSSFSKEIGKPLLQRVNKLFR
                     NQREFILDPGFSEDYAFPILPGSHIKMDDPLLEFIKSLFQILLLSKSTTLEVRQLRKE
                     VLKFLEIREFAKEAEFQNPSDSLVINGILCEYCSYVSDLDLCRDGLDGKFQCPRCDKS
                     INDSLLQEHMIQNLAIEYQTYITQDLRCEKCHTVKRDLMSTNCNCSGNWVCTTKPEKL
                     SNIVKIYKQVAEFYNYSLVKNALESLY"
     gene            <792654..>793583
                     /locus_tag="CAGL0J08052g"
                     /db_xref="GeneID:2889915"
     mRNA            <792654..>793583
                     /locus_tag="CAGL0J08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448058.1"
                     /db_xref="GeneID:2889915"
     CDS             792654..793583
                     /locus_tag="CAGL0J08052g"
                     /inference="similar to AA sequence:UniProtKB:P53845"
                     /note="similar to uniprot|P53845 Saccharomyces cerevisiae
                     YNL263c YIF1 SLH1P Interacting Factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448058.1"
                     /db_xref="GeneID:2889915"
                     /db_xref="GOA:Q6FNY6"
                     /db_xref="InterPro:IPR005578"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY6"
                     /translation="MSYNPYSFQGEATANDRFRHGSQPSMEQGQPLFGAQQASQQQMP
                     PQQQQQQQQPGFNFQNPTQSMAFQLGQSAFSNFIGEQNFSQFQETVSKATSANGSLSL
                     YFQVTTNYVINKLRVILIPFTNKNWQRIPEAQQGSNGALSFMPPKDDINSPDMYIPIM
                     GLVTYILIWNTQQGLKGSFNPENLYYKLSSTVAFVLLDLVILKLGLYLLVSTNSRTTN
                     IVELICFVGYKFVPLILALFLPSSPIYLKMIVQVYLFIAFGVFLLRSVKFNLFTNTNS
                     DMVTFNKATVRKCNYFLFVYGFIWQSILMWLMG"
     gene            <794667..>795710
                     /locus_tag="CAGL0J08074g"
                     /db_xref="GeneID:2889916"
     mRNA            <794667..>795710
                     /locus_tag="CAGL0J08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448059.1"
                     /db_xref="GeneID:2889916"
     CDS             794667..795710
                     /locus_tag="CAGL0J08074g"
                     /inference="similar to AA sequence:UniProtKB:P53844"
                     /note="similar to uniprot|P53844 Saccharomyces cerevisiae
                     YNL264c PDR17 involved in regulating phosphatidylserine
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448059.1"
                     /db_xref="GeneID:2889916"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY5"
                     /translation="MGIFSRKKKEATPVNRGDLIPCETMIEAPPKGSPPPKKPADLDA
                     EQTKKLAQMLEHFNKPDLVLPVSSTDDTGKTRPISSWEKFFLTRDCFLRYLRAQKWDV
                     PKAIKMLTETLVWRREVGITHGEEDEHPLKPEDIAVENETGKEILLGFDYDRRPLFYM
                     KNGRQNTESSFRQVQQMLFMMECATTLTPQGVEKMCVLVDFKHYKEPGIITDKAPPIS
                     IAKMCLHIMQNHYPERLGKCILINIPWFIWAFLKMMYNFLDPATKEKVIFDEPFTNHI
                     DPSQLEATYDGRLDFKYNHAVYWPDMNAKIEAIRNKQYERFQKFGAVMGLSEWDLKGD
                     HDELVYPVDSIKA"
     gene            complement(<796151..>797149)
                     /locus_tag="CAGL0J08096g"
                     /db_xref="GeneID:2889917"
     mRNA            complement(<796151..>797149)
                     /locus_tag="CAGL0J08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448060.1"
                     /db_xref="GeneID:2889917"
     CDS             complement(796151..797149)
                     /locus_tag="CAGL0J08096g"
                     /note="highly similar to uniprot|P53044 Saccharomyces
                     cerevisiae YGR048w UFD1 ubiquitin fusion degradation
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448060.1"
                     /db_xref="GeneID:2889917"
                     /db_xref="GOA:Q6FNY4"
                     /db_xref="InterPro:IPR004854"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY4"
                     /translation="MFSGFGFGNTGSVPIPQEFEDFFRCYPIAMMNDRIRKDDANFGG
                     KIFLPPSALNRLSMLNIRYPMLFRLTSNESGKVTHGGVLEFIAEEGRVYLPQWMMETL
                     NAQPGSLMKINSTDVPLGQFVKIEPQSTDFLDITDPKAVLENVLRNFSTLTIDDIIEI
                     SYNNKTYRIKVLEVKPESAAKSICVIETDLVTDFAPPVGYVEPDYKALKAEQDAKRKS
                     AAIDPVKHSQGSMATRINYSNILNSTDSETIRFAGEGQKISGKPNKTSKGKQDISEIK
                     ISLDSEPARLDLPEGQLFFGFPLVLPKDENADEEENDKKVFIGEGQSLRKSKKSKK"
     gene            <797953..>798978
                     /locus_tag="CAGL0J08118g"
                     /db_xref="GeneID:2889918"
     mRNA            join(<797953..797985,798106..>798978)
                     /locus_tag="CAGL0J08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448061.1"
                     /db_xref="GeneID:2889918"
     CDS             join(797953..797985,798106..798978)
                     /locus_tag="CAGL0J08118g"
                     /inference="similar to AA sequence:UniProtKB:P53843"
                     /note="similar to uniprot|P53843 Saccharomyces cerevisiae
                     YNL265c IST1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448061.1"
                     /db_xref="GeneID:2889918"
                     /db_xref="GOA:Q6FNY3"
                     /db_xref="InterPro:IPR005061"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY3"
                     /translation="MSKAMQQAPYNIRLKTCLKMCIQRLRYAQDKQQALAKQGRREVA
                     QLLGNSKEQKARYRAESLIHDDLHIELLELLELYCELLHARVNILSNIENEVSLIESH
                     TDDGINEAVRALVYCTLAAPEVRELTQLRDLLILKFGHEFAKVIIDEKVGVPPKVLKK
                     CDINLPNQDLVDLYLKEIARTYDVPFSLLTDSEDSSSGSDSENESDGGNFKVEEENKK
                     GETDKDGKPILAVNNGEEFTGDSEHPIKIRKPRKNSDTLKSELKIPKDVKKSVEVKHS
                     KPKSIAKKKDDELEALKKRFDALRR"
     gene            complement(<799207..>802329)
                     /locus_tag="CAGL0J08140g"
                     /db_xref="GeneID:2889919"
     mRNA            complement(<799207..>802329)
                     /locus_tag="CAGL0J08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448062.1"
                     /db_xref="GeneID:2889919"
     CDS             complement(799207..802329)
                     /locus_tag="CAGL0J08140g"
                     /note="highly similar to uniprot|P39104 Saccharomyces
                     cerevisiae YNL267w PIK1 phosphatidylinositol 4-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448062.1"
                     /db_xref="GeneID:2889919"
                     /db_xref="GOA:Q6FNY2"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021601"
                     /db_xref="InterPro:IPR027003"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY2"
                     /translation="MNIIENRPKNQNQASEEVIEAVNSPTFNVHRCIELLCKNANNIG
                     IHFFLCQRLENFPHSELQFYIPQLVQILLTIETESMALEDLLLKLRTENPHFALLTFW
                     QLQALLTDLSTDPESYGFQVARRVLNSLQANLFSTDVSEIEKKTKMHENVAPALVMSS
                     MVFSCMALPQLAESIEPLVRSQGRRQKSYVFKLAKNLMKDFTRNMTLKNTLHNKSHKK
                     KTKHITQAAPVDIINPTTTKEDVMFRKSKSTEINLDFDMVDNVGQKVFEERISTSIRM
                     PKRKTRPTDGMQRTSTDTSIRTLGTSKPQRLRGFDAVSSPEESPRVSQTNTGQNSDES
                     DEETDSESRIPMKTDRFISSMPDLIGNKPRNSGSSYTSLAKSSGGLSRSHSQSVKHDA
                     TRNYTNTDSRFKELDPSKIPTTVKIKMLKANYFRCETQFAIALETISRSLAQVPTEAR
                     LSALRAELSLLNRDLPACVDIPTLLPPNKKGKLHKLVLITANEAQVLNSAEKVPYLLL
                     IEYLRDEFDFDPTTPENEEIIKKGNNHSNLIFDLNYITKNRKKFDEDTIFSSTDAIPS
                     KNSRHASSTPGEDTSKSNSSVNLLKEEDLGDMSMIRVKNLSDAEAYRSSLVLKRASNV
                     PVLPTDSHDRTPELNFSSTMQEFINQGNNLSDSFKSQTDDLADQMRVSAVMLAQLDQS
                     PQQLSETTNQIRAQIIASMKEVQDRFGYKDVENLHGKAGERKLENDLITAGISSSYLG
                     EDWATKKERIRKTSEYGHLENWDLCSVIAKTGDDLRQEAFACQLIQAMAQIWTSERVD
                     VWVKRMKILITSANTGLVETITNAMSVHSIKKALSKKMIEDGELDANGGIATLKDHYL
                     RMFGDPEGFKFKRAQDNFASSLAAYSIICYLLQIKDRHNGNIMIDNEGHVSHIDFGFM
                     LSNSPGSVNFEAAPFKLTYEYVELLGGLDGAPYKKFVQLTKDSFKALRKYADQIVSMC
                     EIMQKDNMQPCFNAGQQTSIQLKQRFHLELTEEETDAFVDNFLIGRSLGNIYTRLYDQ
                     FQLLTQGIYS"
     gene            complement(<803679..>805472)
                     /locus_tag="CAGL0J08162g"
                     /db_xref="GeneID:2889920"
     mRNA            complement(<803679..>805472)
                     /locus_tag="CAGL0J08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448063.1"
                     /db_xref="GeneID:2889920"
     CDS             complement(803679..805472)
                     /locus_tag="CAGL0J08162g"
                     /note="highly similar to uniprot|P32487 Saccharomyces
                     cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
                     cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
                     cerevisiae YNL270c ALP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448063.1"
                     /db_xref="GeneID:2889920"
                     /db_xref="GOA:Q6FNY1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY1"
                     /translation="MKFRNILKNEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSAT
                     EATHKKKTGSTGFDDTISLTHTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGM
                     IALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEMATFIPVTSSI
                     TVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVL
                     ITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRYWRNPGAM
                     GAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFR
                     IVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVVLVT
                     VISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVNH
                     NANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYY
                     ASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDI
                     DIDSDRREIDAIVWEDDEPQNLWEKFWAAVA"
     gene            <806631..>808349
                     /locus_tag="CAGL0J08184g"
                     /db_xref="GeneID:2889921"
     mRNA            <806631..>808349
                     /locus_tag="CAGL0J08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448064.1"
                     /db_xref="GeneID:2889921"
     CDS             806631..808349
                     /locus_tag="CAGL0J08184g"
                     /inference="similar to AA sequence:UniProtKB:P04817"
                     /note="similar to uniprot|P04817 Saccharomyces cerevisiae
                     YEL063c CAN1 or uniprot|P38971 Saccharomyces cerevisiae
                     YNL270c ALP1 or uniprot|P32487 Saccharomyces cerevisiae
                     YNL268w LYP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448064.1"
                     /db_xref="GeneID:2889921"
                     /db_xref="GOA:Q6FNY0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FNY0"
                     /translation="MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTS
                     VSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPV
                     GALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWC
                     FTFALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVL
                     ALMGFLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAA
                     FTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTS
                     TDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLA
                     PKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLIS
                     CSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRD
                     FVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDK
                     FWDFVA"
     gene            <809506..>815202
                     /locus_tag="CAGL0J08206g"
                     /db_xref="GeneID:2889922"
     mRNA            <809506..>815202
                     /locus_tag="CAGL0J08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448065.1"
                     /db_xref="GeneID:2889922"
     CDS             809506..815202
                     /locus_tag="CAGL0J08206g"
                     /inference="similar to AA sequence:UniProtKB:P41832"
                     /note="similar to uniprot|P41832 Saccharomyces cerevisiae
                     YNL271c BNI1 regulator of budding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448065.1"
                     /db_xref="GeneID:2889922"
                     /db_xref="GOA:Q6FNX9"
                     /db_xref="InterPro:IPR010472"
                     /db_xref="InterPro:IPR010473"
                     /db_xref="InterPro:IPR014767"
                     /db_xref="InterPro:IPR014768"
                     /db_xref="InterPro:IPR015425"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX9"
                     /translation="MLKGSNSKSSDGSGSGSNSGLFQNLRRLTTKDRDNRNKSPKRTS
                     LDNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPES
                     GSNHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSI
                     TNLSRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKW
                     LIVKQDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVT
                     STAPSTYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIV
                     DDKLSKDEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLL
                     DKENAFFKCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEK
                     KNKKRFESVLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQT
                     LDGRGKMGSLVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLE
                     NCGILRIMNKIKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKN
                     LLDACKGTENEKTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTE
                     EGSNVNMAIQRLYDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLV
                     GQLEMEVKERDRILAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPA
                     KTKEQKKKIGSIEASEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQ
                     MESIENEARKLEMTNFAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRR
                     IQMESNDVSKFNVDERVNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDS
                     SNEGYSSLDPKVYQDKLDEITKISEELLQQKNELETTQTSSSESNSDSESSSDSDDSM
                     EDALTNNKDINGTSSNVSDLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVD
                     RMKRNSRVPSYVEELSKKMRGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLLAT
                     SAVSPTTSAPPPPPPPMPAGLFGANNDNNTGDSDAISVSGTPAPPPPPPPPPFLKDSS
                     PIPPPPMPTMLTPSESTTSLSSIPPAPPMMTKDSKKKVVSSPLLPQSPSLFENYPRPQ
                     KKLKQLHWEKVESTDNSIWGSQKAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKE
                     DLQKISFLSHDISQQFGINLHMYSNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIV
                     EVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPNELQRADQIYLQLMVNLQSYWASRM
                     RAIRMITSYEREYNELLAKLHRVDKAVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAK
                     GFKLSTLQRLTFIKDADNSMTFLNYVEKIVRSNYPEFNNFLIELEPVLEVVKVSIEQL
                     VNDCNDFVQGINNVERSIEIGNLSDSSKFHPLDKVLLKVLPNLSEARKKGELLADEMK
                     LTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIAEYKKAQAQNIKVEEEEAAYERHK
                     KMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRRAVMDKLLEQLKNAGQVKTDPT
                     SARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDAKEQIELEIHMASPTPKTKE
                     DGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSDALMDRNTALDEHKERLRA
                     RRKRTDSNKIPSSNRLKFVDEKSPDEEQEEVSSSSISTTGIVTAQESPVQIDENED"
     gene            <815653..>817911
                     /locus_tag="CAGL0J08228g"
                     /db_xref="GeneID:2889923"
     mRNA            <815653..>817911
                     /locus_tag="CAGL0J08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448066.1"
                     /db_xref="GeneID:2889923"
     CDS             815653..817911
                     /locus_tag="CAGL0J08228g"
                     /inference="similar to AA sequence:UniProtKB:P17065"
                     /note="similar to uniprot|P17065 Saccharomyces cerevisiae
                     YNL272c SEC2 protein transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448066.1"
                     /db_xref="GeneID:2889923"
                     /db_xref="InterPro:IPR009449"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX8"
                     /translation="MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIIN
                     KQKHVMHEFETLKQKNKELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEV
                     EDLTASLFDEANNMVSDARREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQ
                     TVDSESSINANIRSPISTENSTTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYD
                     QSLYNEFLKFLAVLPSSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSL
                     LTSMMEGQVVVEPLSGINEAYQLGYETKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPC
                     AFCAEQRDDIIEHARMYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRS
                     LKLGTWHLEKVTLNTISKGESLSKFSEVTKSTNGSTSNEEKKSNRKSFIPSLPKGSPK
                     KSSPVVETHIDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPIT
                     DHPTHSQELLLPVLSESESLNMLEEYVPANDSESFNLKKTETSNTFDFEKSSNDAVDI
                     SSNQDINSQTKVAPDVNENLKGQPSTGEASTIEPVNIKVDPATIGANVDAKKKNAISG
                     NTLDTAKDTDNLSKDKMEAKMIEKDTTEDSKKTTKSSKRTSEIIDQLNDIGSDAKELF
                     GTVEESGKESQSDDKQSDKHLNSDETKNGDATMPNEDDMTLDAKEVMRGLNDDDADSS
                     SLDNFDDSKEFQ"
     gene            complement(<818234..>821764)
                     /locus_tag="CAGL0J08250g"
                     /db_xref="GeneID:2889924"
     mRNA            complement(<818234..>821764)
                     /locus_tag="CAGL0J08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448067.1"
                     /db_xref="GeneID:2889924"
     CDS             complement(818234..821764)
                     /locus_tag="CAGL0J08250g"
                     /inference="similar to AA sequence:UniProtKB:P53840"
                     /note="similar to uniprot|P53840 Saccharomyces cerevisiae
                     YNL273w TOF1 topoisomerase I interacting factor 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448067.1"
                     /db_xref="GeneID:2889924"
                     /db_xref="GOA:Q6FNX7"
                     /db_xref="InterPro:IPR006906"
                     /translation="MSDTESPLTVLKARIALLATAIGGPDYTSQIDPPPYQIGDDCLA
                     CLKDLKRWFRLVDDNQRRWDVAMAVAEYKILTDDLLPILIDWENKCYLATKLSKGNSD
                     ISAHFKNKQYYDKIALNCLQLMVLMTWPLILTEQSSTNQINLYSELKKHQLTYKKAIL
                     SVENGKVLKAAIRIAIDVIKLDRLARTPRDNMVLKMVLNFIRNILAIEPGELTITARK
                     NIASKGINSVDTLPPNVTQDDISQSTVISCFKKNKVFPFLLTLGSSMTKEFDQDFINI
                     PLMEVMFFLTKDISQDSLLFKSGELDTAQSENHLSKAGQELNDLLQKESQLKKKVIMN
                     TSTRHSRFGAMLSIQTLDQKRLTVSGSQNLLDNSKALQKIDDSKKSKGRRPMIRNETD
                     NESLPTNLLNVHKKSGTYLPLTISKYLNDFINDFIDSSFNYLLKSVTNYFVTEEDKII
                     SLEKIEYLLFFAWFNKYQILRCQVDKDADIMMISESIKETTFILVSSLLRSSYDSKAW
                     AVVHSSMLAFNELLKLVNSLKKFEDNEDIEYVLSRLFSDERIQLLSNLPRIASTHSLS
                     FMKTSIELTHTVLKILEMYSGDNSLVVESKRRAKKMKSISKEDYERLVNEEGYDPDEA
                     IEILNPGHKTIVINFKRVQSSFFHRNTIDLYINTLKRFNELEYSHIKMIISFLYRLFV
                     ENNEETLFYRLDFIILLKDMLKQDGLPRTSKARTHINDFAKYYLSRLKRKLKSSPAWH
                     VGILFPPLNDGVVGYFQKYGEHKMTKESEIYAVQPSQFIPFEQQEMMSENMILDMQIG
                     VLVSTLIDEGSQNLVELVRENVQHLIAVFTSHLEVAGENEKTPNNEAFILKEEYDVNP
                     LHYNRHIRALLQLVGFEIPILKSDPCFYRGTTEFSRLVKCEESITKYLNIPFETPNGL
                     PSSSYLKQQSEKNNSLESDGWKGNEDYDYTDPNIVPDNEVDDNDYFKDLDKSTNIRKE
                     KRTVGIASKKTQSKNKTSRNRKKASFRLPNAIEGKDKQPQENLEVFSKEYISDSDEDD
                     EEILNPVFFENEMYMRWLLDKYNGQLPNDKFLSFGRFVNERLSNNGKVVSDFTSLFDG
                     PVPPIDALPLEGITRKGPDKTLLTLSRVEINESNQDNENTQVNEQVDETSENLTINKN
                     ARNIGISHGHVESEADDDEPITKKRRTSAN"
     gene            <822590..>823642
                     /locus_tag="CAGL0J08272g"
                     /db_xref="GeneID:2889925"
     mRNA            <822590..>823642
                     /locus_tag="CAGL0J08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448068.1"
                     /db_xref="GeneID:2889925"
     CDS             822590..823642
                     /locus_tag="CAGL0J08272g"
                     /inference="similar to AA sequence:UniProtKB:P53839"
                     /note="similar to uniprot|P53839 Saccharomyces cerevisiae
                     YNL274c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448068.1"
                     /db_xref="GeneID:2889925"
                     /db_xref="GOA:Q6FNX6"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX6"
                     /translation="MAKPIILRLGSLTFAQPQWKEVEEIADVITVDDSMTREQFLKEL
                     KNPESKLSKVSVITRTVGSASQTGLFDEEIAKALPDSVIAICHTGAGYDQIQVQYFKE
                     RHIQVANVPEIVSNATADTHVFLLLGALRNFAYGHHNILAGKWQEVTSAAETPFGYDP
                     DGKTVAILGLGRIGRAIVDRLKPFGFGKFIYHNRHRLPEDEENGCEYVASIDDFYQQA
                     DVISINIPLNTHTKHLVNKEAFDKMKEGVVIVNTARGPVVDEKALIAALKSGKVRGAG
                     LDVFEDEPHIPKELLELPQVLTTPHMGTHSVQTRWRMEKLVLDNAISALKTGKVITPV
                     PEIQNDNWIEEIQPVI"
     gene            complement(<823820..>825613)
                     /locus_tag="CAGL0J08294g"
                     /db_xref="GeneID:2889926"
     mRNA            complement(<823820..>825613)
                     /locus_tag="CAGL0J08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448069.1"
                     /db_xref="GeneID:2889926"
     CDS             complement(823820..825613)
                     /locus_tag="CAGL0J08294g"
                     /inference="similar to AA sequence:UniProtKB:P53838"
                     /note="similar to uniprot|P53838 Saccharomyces cerevisiae
                     YNL275w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448069.1"
                     /db_xref="GeneID:2889926"
                     /db_xref="GOA:Q6FNX5"
                     /db_xref="InterPro:IPR003020"
                     /db_xref="InterPro:IPR011531"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX5"
                     /translation="MIIKRHSNMVKQPANLQATSINSMESSLRQPADGPYDLSSTPSD
                     IDGEKSALDSDEDSHKSKRRFPKPGIGIWLDLKDRLPWYWQDWTDSWDYRVIPSVVET
                     YFNNLLPAIAFAQDMFDRTDNAYGVNEVLLASAMGGIVFGALSGQPLCIVGVTGPISI
                     FNYTVYDIIKPLNTNYFGFMFWVYIWSMIFDLILAFGNAVCLLQYVTTFPCDIFGLFI
                     NIVYLQKGVQILTHQFKDKNGNDDPAAGFANVIVAMAMTVFGTFFKLIKMTPLLTPKL
                     RTIISDYSNALSVLFWSSFIHFGGYLNNVDFQKLPITKAYHPTSGTYRDRSTWLAYES
                     IPVRDVFIALPFGIILTLLFYFDHSVSSLMAQKEEYKLKKPSSFHYDFALLGLTTGVS
                     GVLGIPAPNGLIPQAPLHTETLLVHDKDEKVIRCVEQRFTNTAQGGLMLVTMSRGLLV
                     CLGQIPQAVLSGLFITMGIQGLTGNQIIHRLIWLFTEERKKDKSKLLQNVPKKKLILF
                     LTFSLIGFAGEFAITDTIAAIGFPIILLLTVVACLLFPYMFTKEELDILDSNVAQEFT
                     IKNLLMKNIRNANFFSNKDEVETDVEHVSSI"
     gene            complement(<826640..>828139)
                     /locus_tag="CAGL0J08316g"
                     /db_xref="GeneID:2889702"
     mRNA            complement(<826640..>828139)
                     /locus_tag="CAGL0J08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448070.1"
                     /db_xref="GeneID:2889702"
     CDS             complement(826640..828139)
                     /locus_tag="CAGL0J08316g"
                     /note="highly similar to uniprot|P08465 Saccharomyces
                     cerevisiae YNL277w MET2 homoserine O-acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448070.1"
                     /db_xref="GeneID:2889702"
                     /db_xref="GOA:Q6FNX4"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX4"
                     /translation="MGRRATNMLKEVDIAELSKTNPFVKLVKGQKIVEVPELVLESGV
                     VLNNFPIAYKTWGHLNSRGDNCMVICHALTGSSDVSDWWGPMLGNDLGFDPSRFFIVC
                     LNSMGSPYGSFSPLTINEETGRPYGPEFPLCTVRDDVRAHKIVLESLGVKSVACVIGG
                     SMGGMLALEWASLYGHGPEKYVHNLVALATSARHSAWCISWSEAQRQSIYSDPKYMDG
                     YYTFDEPPVTGLSAARMSALLTYRSRNSFENKFSRRKPSIEQAQKSNRKASAGEGQEA
                     TIPSSVSEQSLRIHNDGYRSSTPQPRIEFNRNGRNGSVVSDVSSAESIKSASSLTSVS
                     SVTGEAKEVKPAQTYFSAQSYLRYQGAKFVNRFDANCYIAITRKLDTHDLARDRPEYD
                     EDIERVLESIDIPSLIIGIKSDGLFTYSEQEFLAEYLPNSRLEKIESPEGHDAFLLEF
                     KLINQLILEFLNKNVKDIMTAPPRQWTGEIGQDEHAGSVFGEAEEVTNW"
     gene            complement(<829222..>832233)
                     /locus_tag="CAGL0J08349g"
                     /db_xref="GeneID:2889704"
     mRNA            complement(<829222..>832233)
                     /locus_tag="CAGL0J08349g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448072.1"
                     /db_xref="GeneID:2889704"
     CDS             complement(829222..832233)
                     /locus_tag="CAGL0J08349g"
                     /inference="similar to AA sequence:UniProtKB:P53836"
                     /note="similar to uniprot|P53836 Saccharomyces cerevisiae
                     YNL278w CAF120 and similar to uniprot|Q06315 Saccharomyces
                     cerevisiae YLR187w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448072.1"
                     /db_xref="GeneID:2889704"
                     /db_xref="GOA:Q6FNX2"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FNX2"
                     /translation="MKRIFSGSKSPDGLPKSPINSPNIGKSILKTSGTFNQDNLTSKS
                     AVSPELVPILTLLTAHTHRRYHEGVLLFLQDLKGDGSVGGRKWKEVYAVLIGTQLALW
                     DAQELAELNQAERLDVNKVSAKLKEAVSKPTYINFTDSTIKPLGAGDRAVTESGKKLE
                     NVLIVSSTLKNRYFLQFSNKDSFNEWHAALRLSLYECASLQMAYTGAFLSSRGAKLSD
                     IKVLLADVKYDYEDWVSVRFGAGMPWKRCYAVISQPTKKNSLGEINFYESDKKIKKSN
                     SMAKVISAEFLYAIYPSAVQLIDDSTIIKLEGKISFNKKEDPQDTTVFIMPEKHNAVP
                     GYDTVIRFLLPAFNAFKLYGRPKKLKADKRDQDSLIFALPVLPHIYYLEVSDLIQLSS
                     SMSSIGWDNREWWNQIRGVLQRKLNEGSSGCGSIVEASTFLGSPLLGSNDLFDTSKSI
                     ASPRSVSQPLMSGKPGSASNSSESLTNSKDRSRGSPSKGSNQRRIVSEKASSQAKPAN
                     YVPTIPPLPNNQNQRNFQPSVPAQHINNARDTNKSGKPRDLNIVDSNFNAYGKDHLTV
                     KQDDSKKLSVASDLASLIEKYSDDELEHMTGNEVQGRNYNKLDRRFNDANPRQRGEND
                     ASSDEISEMARSINEFGFEHPQKVMKGNFGSSGTLPIQDGPDESNLFDPDYLVQDEAM
                     SIGHNDAYGDFNNPYSSKFKGELVSPKIGNNPLPYPAEGGDTPTKQEKTSNNHLNAME
                     NTNLPVNPYDKPKNIVPNKQAGYPSQSVQRPSNDLGNSAPVKPGYANTRPNMHTPPPQ
                     GVRTGAPSGSYVSPNNKMGYANGPNPQQMYRPPAREQFNSGSPNVRGNSSSPVIGQQS
                     PMNPQQHNMRPPPGPGTNQMRMSPGSPNMPGQGYPPQQPPYPQNMPMQRPMGGHPQNM
                     PMPPYGYNNAPPNQMGGYGYNQRPGFGSPQYPMPNGGMPTGVQSAMGRGPMPQWGQGQ
                     APGGKQRAKVKGGFSQFMPPSNTATNPYSNQ"
     gene            complement(<833113..>834981)
                     /locus_tag="CAGL0J08371g"
                     /db_xref="GeneID:2889705"
     mRNA            complement(<833113..>834981)
                     /locus_tag="CAGL0J08371g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448073.1"
                     /db_xref="GeneID:2889705"
     CDS             complement(833113..834981)
                     /locus_tag="CAGL0J08371g"
                     /inference="similar to AA sequence:UniProtKB:P53835"
                     /note="similar to uniprot|P53835 Saccharomyces cerevisiae
                     YNL279w PRM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448073.1"
                     /db_xref="GeneID:2889705"
                     /db_xref="GOA:Q6FNX1"
                     /db_xref="InterPro:IPR026777"
                     /translation="MRNYLLLRDRLTQVWLNKYSITVTILTAKIVLFNYFIIRILRYT
                     EKYAISSCNGLDQVNRKVYDDLPIFVNTLGNYMIRKSMLESVEASLRGLEILIDASEG
                     LLGFLVDLYLGTYACLLISAVDGAVDVATNTTEHILEAVNNTLIEATRGLDDGLNDLT
                     SLINKGGNRLSSIFKSDNSVAASLSKVNFTVKGLRNIHLSSKINDQLQYMADKVPSFD
                     DLKSETKDLISIPFYHVKREITKVNAESLLPDTKILYLRNNTDTTLYPICGQYIPNIK
                     KVYEHLIHILKVGNILVAILGIFIALFMAIPSIQKEYQESKRLNNVQDEVSQYIDNKE
                     FMSSGDNSSLNYSPFNDSKFNLAESYQRNFNPIARWMTIKMGKYFGNDETEYSERLQF
                     CMLYIFSSRSSTIMAMGLIGLITVAIQLIVIQIISNYLSNTGKVHIQLQASNDEINKM
                     IKSDINLWTSLANQYVNGTEANLNTQVFGWITNTTASVNATVAHAVDKIEYILASSFN
                     NTPLYKPMKTVVGCAILRKLISVENAMTWINNEAHIKLPRINTTELINIAGHTKMLPS
                     SNESHMFDQVEKIVNIARKTALNELYVPLALIGIWLTQIPMALLLSWRRCDTTGKT"
     gene            <835623..>837626
                     /locus_tag="CAGL0J08393g"
                     /db_xref="GeneID:2889706"
     mRNA            <835623..>837626
                     /locus_tag="CAGL0J08393g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448074.1"
                     /db_xref="GeneID:2889706"
     CDS             835623..837626
                     /locus_tag="CAGL0J08393g"
                     /inference="similar to AA sequence:UniProtKB:Q04377"
                     /note="similar to uniprot|Q04377 Saccharomyces cerevisiae
                     YDR499w LCD1 cell cycle checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448074.1"
                     /db_xref="GeneID:2889706"
                     /db_xref="GOA:Q6FNX0"
                     /db_xref="InterPro:IPR018622"
                     /translation="MLRDKLKLLQAQIEQERSKSNYRVNEVKEEFDKEIQKLRQQLQS
                     LEDEKKFLVLESRGINAVNQRIKTSPPEAFSRVSSQHRALNTPDSSHIQEHIPKKRKT
                     EISTQPSIVLNPNRVIKDEVSAFFDCLYVHRIVGVELSTIEILNCIKFEHIDEFNYKL
                     LKINKDTSIGSGIVDFLQSCKKNMKLNELVDSVLEHLATLIKAIIINDQELNFSVPFL
                     VALMVQTILFRPSAVSVNSLKDLFIFTCDLIRKFQIVLKKPLHKSPLEVDLGPQIFQY
                     ELIDNLILVYSFDLLESTTKVIRIQQLSETLYMEFFDESLMKSLEAVYKLTLTISFKP
                     VINVIYSMVAVFVTITNIMNNDNLSKPFGSSKWWSDLLTRLYQLLGKRILNFHVFDDT
                     NTNNMHIDRFFDFYSLLRNMGTNSVSPLLAQLVTRGEIKGIPNIVLKDDIIDKYESKK
                     EKGVLSDNLELEKWFVYLKDDILSIIENLMGYFKKDSKITNGEILINLTKLISVEQSQ
                     FMDHLIDQDTDVFAVRMNLVEHALSIIYRMWKYYEENITQESIKEVESELVMSLWRII
                     VCKHASKKICKDDLMEHRILINQMENLHLQDTIDLYEDAFEDMPEYIKEELECSINNG
                     TQQKMQVQYDDIYIEMARYILESKLTNFISVENTDSLYLSMGF"
     gene            complement(<837967..>839118)
                     /locus_tag="CAGL0J08415g"
                     /db_xref="GeneID:2889707"
     mRNA            complement(<837967..>839118)
                     /locus_tag="CAGL0J08415g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448075.1"
                     /db_xref="GeneID:2889707"
     CDS             complement(837967..839118)
                     /locus_tag="CAGL0J08415g"
                     /note="highly similar to uniprot|P19358 Saccharomyces
                     cerevisiae YDR502c SAM2 S-adenosylmethionine synthetase 2
                     or uniprot|P10659 Saccharomyces cerevisiae YLR180w SAM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448075.1"
                     /db_xref="GeneID:2889707"
                     /db_xref="GOA:Q6FNW9"
                     /db_xref="InterPro:IPR002133"
                     /db_xref="InterPro:IPR022628"
                     /db_xref="InterPro:IPR022629"
                     /db_xref="InterPro:IPR022630"
                     /db_xref="InterPro:IPR022631"
                     /db_xref="InterPro:IPR022636"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW9"
                     /translation="MGNNRFLFTSESVGEGHPDKICDQVSDAILDACLEQDPLSKVAC
                     ETAAKTGMIMVFGEITTKAHLDYQQIVRDTIKKIGYDDDEKGFDYKTCNVLVAIEQQS
                     PDIAQGLHFDKAIEELGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGS
                     LEWIRPDTKTQVTVEYEEKDGRWIPLRIDTIVISAQHAEYISTEDLRSQLKTEIIDKV
                     IPSDMLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGAAAVGGGAFSGKDYS
                     KVDRSAAYAARWVAKSLLAAGLCKRVQVQFSYAIGIAEPLSISVDTYGTSSKTDEEII
                     EIIKKNFDLRPGVLVRELNLARPIYLPTATYGHFTNQEYPWEKPKKLQF"
     gene            complement(<839669..>840472)
                     /locus_tag="CAGL0J08437g"
                     /db_xref="GeneID:2889708"
     mRNA            complement(<839669..>840472)
                     /locus_tag="CAGL0J08437g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448076.1"
                     /db_xref="GeneID:2889708"
     CDS             complement(839669..840472)
                     /locus_tag="CAGL0J08437g"
                     /inference="similar to AA sequence:UniProtKB:Q04396"
                     /note="similar to uniprot|Q04396 Saccharomyces cerevisiae
                     YDR503c LPP1 lipid phosphate phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448076.1"
                     /db_xref="GeneID:2889708"
                     /db_xref="GOA:Q6FNW8"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW8"
                     /translation="MKVSFGLALEYTRMYSPQLLATVFCSILFLFTEFKLVPRLENKR
                     FRLDDKSIGKSHISNELISGFEVITMSALISGLIVVWFCTFGKDSLRKFHGNWTNMKP
                     ESSSTRGHFFFISVLCLYLILSLNGAVTGCLKLVIGNFRPDFIARCEPALDKASDLTK
                     YYGLDICQQQNKRLLYEGLKSTPSGHSSFITSGLGFAYYWQKQFVSSHHTRHIWCIVL
                     ILLVMMSRITDHRHHWYDVVSGCIIGIAMIAASWRWVFSPRSSTYELPA"
     gene            complement(<841369..>843774)
                     /locus_tag="CAGL0J08459g"
                     /db_xref="GeneID:2889709"
     mRNA            complement(<841369..>843774)
                     /locus_tag="CAGL0J08459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448077.1"
                     /db_xref="GeneID:2889709"
     CDS             complement(841369..843774)
                     /locus_tag="CAGL0J08459g"
                     /inference="similar to AA sequence:UniProtKB:P50896"
                     /note="similar to uniprot|P50896 Saccharomyces cerevisiae
                     YDR505c PSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448077.1"
                     /db_xref="GeneID:2889709"
                     /db_xref="GOA:Q6FNW7"
                     /db_xref="InterPro:IPR007557"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW7"
                     /translation="MELPSISSTTSISDNADLRNYYEKLLFKNSSGKSLTDLQNRAHR
                     SNEDDENKERKFDFINGFKSNKNGIKLEQGRNRMPTFSGLKMTSMDTERKIPTSNFFN
                     SQGQLQQQNHPSQNNNQNNLDPNSNGNYQDIFSNYNMSDKMGNGNDVSNSNSHSSPFS
                     EFALPTLHKYQSNPGQDHMDYSNGNQSAGAWNNPKTALSGFEAQQDRNDGRRSSYISD
                     TLIHGQYDIHNNPIPNGIAALRHHSSAAGAMDPFMQVNPSQIYGQMPNQTATVQNTMP
                     YGYKNTSNIIPLLNNLNLKGENNYNPQNRSLNNQRFPHQNNPGSRQGQKDIQQYPYNA
                     SKQQQDQYNSRFNHYNNGSNFENVKSSHLNDGAHQNTSKNHISESSLDFSICKDNYEE
                     LQNETGLLLLAGRQIVSTPKLHQFYLECGANYFSSKEVFKFADFIKEQLVITNDNENT
                     SSSVLSFLDFLKSRNSNYFNKGSKQSNGEENGNLNENGNDPTNGGNASYKPLVLVALK
                     NGKLELLSTPQTTNLLMKRGDLVIIDGDRGKDLVLVVEPSVDLNLALFVNFLKKKIHF
                     DSLITNRNQHISNDNFIGLLEASKSGETPDINPKLYDVVELTELIIPSKQVLRFATPW
                     EVSTNLHNKFQDELRAMHIARSKLSSLNETINGSQQGEKENDNSNQRSKMALNIKILN
                     AEFQFDRKKLTFYYLCEERNDFRDLIKELFKYYKTRIWLCALPNNLEVDTKYYDKDHK
                     ELNMYQNMIDGENQMEVQDAPLKSDNSSVLAPPLNKLELDNFQIGVYKELVNQLFKTH
                     FDY"
     gene            complement(<844215..>845966)
                     /locus_tag="CAGL0J08481g"
                     /db_xref="GeneID:2889710"
     mRNA            complement(<844215..>845966)
                     /locus_tag="CAGL0J08481g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448078.1"
                     /db_xref="GeneID:2889710"
     CDS             complement(844215..845966)
                     /locus_tag="CAGL0J08481g"
                     /inference="similar to AA sequence:UniProtKB:Q04399"
                     /note="similar to uniprot|Q04399 Saccharomyces cerevisiae
                     YDR506c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448078.1"
                     /db_xref="GeneID:2889710"
                     /db_xref="GOA:Q6FNW6"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW6"
                     /translation="MLMYFWFLVNLYVCVASTTHELVFNVASATNRDGRRIISINGRR
                     NTYGPQIRVKSGDTINLKVVNNICSAEELVSMETDEQLREYCHTALHFHGLIGIGNEL
                     DGVPGITQDPIAPGEEFWYNITIPETICGTYWYHSHSSVQYGDGLRGVLLVDCDRYHT
                     YLDRILATIDGDPSVLDTNGVMTLSDAKKKLRTGMTEQIITLSDWYNSWNLDINSKIV
                     LSPDGTRDPRLDDSLINGKRSTFQVIDIPESTKYALIRFVNSGMSGTQIVNFPNHKIV
                     VFETDGVLIKPYVLDTLSMAVGQRYSVVVVKGENEALQMINGCNKMMGYYAKQAWLAS
                     KHVAGTLTAETSIPRINSLPGLDKLEKYRDFQPVEDEVKGLEVAEKANTTVELSYDYY
                     RDPEIQEKYGTGMFLLNGKALSDYFKEPIELPEGKGNVVDIVLNSVEHMRHPWHLHGH
                     RFQVISIGKGGEGKFDSREAQQKYREDMEYWETHPEQSPMFRDSINLPGRSFVVLRIR
                     TSEPGDWLLHCHVDWHVSKGLGAMFRVKGNAKSDPTTEEATEYANPIKHNKTKVLLIY
                     ISIMVCVDILMYYTIMR"
     gene            complement(846218..846337)
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0J08503r"
                     /db_xref="GeneID:2889711"
     tRNA            complement(join(846218..846262,846299..846337))
                     /gene="tRNA-Leu (CAA)"
                     /locus_tag="CAGL0J08503r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2889711"
     gene            <846742..>847881
                     /locus_tag="CAGL0J08547g"
                     /db_xref="GeneID:2889712"
     mRNA            <846742..>847881
                     /locus_tag="CAGL0J08547g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448079.1"
                     /db_xref="GeneID:2889712"
     CDS             846742..847881
                     /locus_tag="CAGL0J08547g"
                     /inference="similar to AA sequence:UniProtKB:Q12405"
                     /note="similar to uniprot|Q12405 Saccharomyces cerevisiae
                     YOR084w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448079.1"
                     /db_xref="GeneID:2889712"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW5"
                     /translation="MEARVNEKYEREVKTTAAVWPRSRNAVLNPDVDRLCVVYEVFTR
                     CTGNGGSKKKKVNLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSA
                     LLNKGRLGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLF
                     QLAIVIEPVIIKDPSQLEPKTEYLFFPPNFYRALTAKMTDNFDSMQEFEEFMEKKSFY
                     VKVHPEIRKRLTEFEAIQRPDGSVVTKMKKVHNFMCYATDNTSAKRMVQLMPFIGIPV
                     VSLVGASSRWTPPVNNEYVRTRIPNCKEVSVANGDHLMNLEMPDTIVDYISKHISQYV
                     ANPPQRSEGDYVLDHNGSLAERNQFLDNSYKHFLNKIRLPQKSKL"
     gene            <848348..>849391
                     /locus_tag="CAGL0J08569g"
                     /db_xref="GeneID:2889713"
     mRNA            <848348..>849391
                     /locus_tag="CAGL0J08569g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448080.1"
                     /db_xref="GeneID:2889713"
     CDS             848348..849391
                     /locus_tag="CAGL0J08569g"
                     /inference="similar to AA sequence:UniProtKB:P48439"
                     /note="similar to uniprot|P48439 Saccharomyces cerevisiae
                     YOR085w OST3 oligosaccharyltransferase gamma subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448080.1"
                     /db_xref="GeneID:2889713"
                     /db_xref="InterPro:IPR006844"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR021149"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW4"
                     /translation="MQMFNFSRLVALLLVLVNVSLALSPKQFNKERLKYKDSIIDLND
                     RNWGRLLANPKESYLVTVFTATGRQYGCTMCTELAEHYETVVRSWFADHPDGISKNDG
                     SKSLFFAKVDAVDQNVPELFQKFNVEQVPRIIIYEPGKGDPQYKFLDIQLSGENVVET
                     LIAGIKESTDVQDFEIHEEINWSSVTITGVATFATVLLVKKQSTLALKIFTSRYVWGF
                     GTIFFIIAMLGGHMFNRIRNTPEAGMDKLKNVIYILPGQISGQYAIETQIVGLLYAVL
                     CALIVALVMVVPNVSKKLSGPENAKETAQVIVTILTAVFIYMFFAAFTKVFEVKYTGY
                     PYTLLKLFNFFGK"
     gene            complement(<849629..>853219)
                     /locus_tag="CAGL0J08591g"
                     /db_xref="GeneID:2889714"
     mRNA            complement(<849629..>853219)
                     /locus_tag="CAGL0J08591g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448081.1"
                     /db_xref="GeneID:2889714"
     CDS             complement(849629..853219)
                     /locus_tag="CAGL0J08591g"
                     /inference="similar to AA sequence:UniProtKB:Q12466"
                     /note="similar to uniprot|Q12466 Saccharomyces cerevisiae
                     YOR086c or uniprot|P48231 Saccharomyces cerevisiae
                     YNL087w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448081.1"
                     /db_xref="GeneID:2889714"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW3"
                     /translation="MVDEASTSGYKSSQHDEGIMFKGIGEITMSSSRETQDDMLKADK
                     KEADGDIKEIAAKQELKVSKNIQVSAGDLVDEFERQRKRAAYVGWKQMGGWEEKDELT
                     LEDELMDANSDTLLNNVLPEPLYGDWYHNVAIYFLAGVLSFAVGHFKFSLAPVFFITL
                     FSALYYRTSAKKNRASIRELVQKEFTVQKIEDDYESLEWLNTLLDKYWPIIEPAVSQM
                     VCEQVNDILATNDSIPAFIKALWIAQFTLGIKPPRVDYAKTFPNTDSDVVVMDWGLSF
                     TPHDLSDLNAKQMKNYVNQKILVKAKLFGMTIPVTVANVAFKAKTRIRFKLMTPFPHV
                     ETINIQLLEIPDIDFVANFMGNNLFGWEILAIPGLMPLAKALARKYAGPILLPPFSLQ
                     LNVPQLVSESPLSVGVLEITVKNATDLKRVNNMIDTSVDPYITFQMGGKEVARTRTVR
                     DTLNPVWNETIYMLLPSFTDPMTITVYDRREKLKDKILGRIEYNANSLHDKPTQRNVS
                     QQFLRNSKPVGKMTMDLRFFPTLSSKKLPDGTVEDAPDLNTGLAKIIVDEGSSIVDKD
                     GSASVEVYFNSTMVLSTAKGSPKRGVITWGDMYEAIITDRRKARFRFVVKDKNGENIN
                     STLQSLSDLIDRTQIGQKNIPLAHGNARLTVTTYWKPVMLDVGNKSIAYTPPIGALRV
                     FVNKASNLKNLEKIGKIDPYAKILVNGIQRGRTDFDAQTTNPVWNTGVYVALTSPNQR
                     ITLECMDVETSNKDRTLGQFDIKLNDFFQKNSLDRYDTKVDSTQRQGRLTAKKFSKGV
                     VTYSISFYPTLPVLTLEEIQDIESAEKRKAKLDEKRKLLTDGKLSKEEKQKLEEEELE
                     IKEIEEMHNNKRKLSLDQLLEHKIGILAISVLSGDVPDIGVYVQSFFDGNAHARFISP
                     KLTSRTINSGWTGDVMIKELDNSVVTFKVTRDKFSGKTSDKLCDVTLSTIDLLRESYY
                     KPSILTLSGQHTAKLMLQVQWFPMDIEDLPPEDLMSNSGDLTIIAKNAENLLSADTNG
                     YSDPFLKFYYNDEDDACFKTKTIKKTLNPTWNEKGVIEVRNRVYDVLYLKVMDWDAAS
                     ADDVIGRATIPLSKIDPHNTTTLDVPVVDDEGRDGGIVHLEFQFSPRFVTLTDSEQKT
                     VADAPVKSIGSGLKAGTTVVSSGLGSVGKIGKGIGRGLGLKKSKKHNEDD"
     gene            <853530..>855743
                     /locus_tag="CAGL0J08613g"
                     /db_xref="GeneID:2889668"
     mRNA            <853530..>855743
                     /locus_tag="CAGL0J08613g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448082.1"
                     /db_xref="GeneID:2889668"
     CDS             853530..855743
                     /locus_tag="CAGL0J08613g"
                     /inference="similar to AA sequence:UniProtKB:Q12324"
                     /note="similar to uniprot|Q12324 Saccharomyces cerevisiae
                     YOR088w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448082.1"
                     /db_xref="GeneID:2889668"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW2"
                     /translation="MLKYNPPHSTVLYHTLPVLYTWGLLEQLMSEQLPVDNEGCQPAN
                     SGYNVEAPTSRQVLRVALNLKYLVDKVVPVTYGCDEIESDHSSVVTPAVVQLALEACG
                     GDPEDKKNRDKYRAVVVFALLKVYGWYSQLAATELHNAELYESRGVAAQQLCKIIIDQ
                     EEMNDLHFMFMQMLLRRYTINENDEDSEPANAIELASDMHCTIVIGSGGFQRCLTWLW
                     RGWIIQNRRDPTTFIRDETVSSPYFIDHFNPDRIKTPKYQNLLNIFFSILFLVLYTVV
                     VNGKNSVTVSPIDLPELVFYLFTLGNILEEMTKMYYIGAAYFSFWSSFNLTMYSIISV
                     SFVLRILSVAPLKLHNPSEYWDKISYRILSCAAPFVWSRMLLYLESEPFVGVMLVVLK
                     HMMKESAVFFVLLVLIMVGFCQGFLGLDSADGHREITGTIMENLTIAVLGLGSFDKFK
                     RFAPPYAEILYYSYYFIVSVILLNILIALYANAYQRVVDNAADEYMALMVQKTLRFIR
                     APDEDVFVAPLNLIELLFSPVFAFLSKAKKSQLSYYVMMVIYSPTLVLVALSEVRTSK
                     RIKYNRLKNLPDDANEVDTAWDLTDGYVDEEDTLFTRSHTSGIRATNKKNKFSLQVQR
                     EAEAKDPKFSVPREWYSKVKHICHKHEQEKCASDDGSNDLSEKVSELLVKLSKVGLSV
                     NSSGSSTLPDEVFKEFKTDVEKLGNMVQELNDLKRELKDISDMKSLLKEIVNQKK"
     gene            complement(<856102..>856728)
                     /locus_tag="CAGL0J08635g"
                     /db_xref="GeneID:2889669"
     mRNA            complement(<856102..>856728)
                     /locus_tag="CAGL0J08635g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448083.1"
                     /db_xref="GeneID:2889669"
     CDS             complement(856102..856728)
                     /locus_tag="CAGL0J08635g"
                     /note="highly similar to uniprot|P36017 Saccharomyces
                     cerevisiae YOR089c VPS21 GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448083.1"
                     /db_xref="GeneID:2889669"
                     /db_xref="GOA:Q6FNW1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW1"
                     /translation="MNNNITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAF
                     LTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWV
                     KELQEQASKDIIIALVGNKIDVLENGTERSVSREEAEKLAEEENLLFFETSAKSGENI
                     TDVFLAIGEKVPLKTANQANVPNNANENQRVDLTSVVNNPAANSSCSC"
     gene            complement(<857192..>858865)
                     /locus_tag="CAGL0J08657g"
                     /db_xref="GeneID:2889670"
     mRNA            complement(<857192..>858865)
                     /locus_tag="CAGL0J08657g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448084.1"
                     /db_xref="GeneID:2889670"
     CDS             complement(857192..858865)
                     /locus_tag="CAGL0J08657g"
                     /inference="similar to AA sequence:UniProtKB:Q12511"
                     /note="similar to uniprot|Q12511 Saccharomyces cerevisiae
                     YOR090c PTC5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448084.1"
                     /db_xref="GeneID:2889670"
                     /db_xref="GOA:Q6FNW0"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6FNW0"
                     /translation="MSSLSRIVNLKKSSKLAKGALRVGSRGLHMRPMARLGSSTLLLR
                     ELNLALVSGGLMYLTYSYFSEKRNPLEVFKAFKEYSTIHNDGGKLISSSGGSQNSNAD
                     FKILSQEEVDRRLRAREQSFFVKRNKGLVRYDVAQLPSNNPIEDNHVEKLITFPSPDG
                     SKPLKDREDEAFDNDLYFFGIFDGHSGAFTSAKLSTDLVPYVAHQIADVYQQHNKALT
                     SDYTHNMNFDVALEKGFVQLDNDIVYHSLGKLLKEPTNDNMLAALPAISGSCALLAVY
                     NSYESTVKVAVTGDSRALIGGLDSNGEWYVKSLSTDQTGDNLEEVQRIRSEHPGEDNV
                     VRNGRVLGSLQPSRAFGDYRYKVKEIDGKKLSDLPDHLKLYFRKEPRDFKTPPYVTAK
                     PVVTTAKVNDNTKFMVLASDGLFELLSNTEIAALVVKWMEKHSDDTKVKSLSFKKQLP
                     KVKDLSTDSESQRPAFRYRKDQSLENMSYFLEDANVATHLIRNALSAGGQNEYVSTLV
                     SIPAPMSRKYRDDLTVTVAFFGENNSSVVPDTQTILPNLDATTPVQSKL"
     gene            <859191..>860210
                     /locus_tag="CAGL0J08679g"
                     /db_xref="GeneID:2889671"
     mRNA            <859191..>860210
                     /locus_tag="CAGL0J08679g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448085.1"
                     /db_xref="GeneID:2889671"
     CDS             859191..860210
                     /locus_tag="CAGL0J08679g"
                     /note="highly similar to uniprot|Q12000 Saccharomyces
                     cerevisiae YOR091w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448085.1"
                     /db_xref="GeneID:2889671"
                     /db_xref="GOA:Q6FNV9"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV9"
                     /translation="MPPKKKQQQPAKKKDNVDKTFGMKNKNRSTKVQRFIKQVQAQAD
                     PAKEEMKRKKLEEKKMREAAEAERRALFGNVADQRIRAGVDPKTVVCALFKMGNCNKG
                     AKCKFSHDLNVGRKVEKKDLYQDTRDEKEKDTMDDWDEEKLRKVILSKHGNPRTTTDK
                     VCKYFIEAVENGKYGWFWVCPNGGDKCMYKHSLPEGFVLKTKEQRRLEREALENQPKI
                     TLEEFIETERERLDKSKLTPITMQNFAEWKKKHVIERLNAMKEENSKKKPSGREVVQK
                     LLADNKSFDDSSVAETAGTEGTAWDLTEFTEALRKADHADDANIKDYGDGSNPTFEIT
                     KKIEA"
     gene            <860867..>862108
                     /locus_tag="CAGL0J08712g"
                     /db_xref="GeneID:2889673"
     mRNA            <860867..>862108
                     /locus_tag="CAGL0J08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448087.1"
                     /db_xref="GeneID:2889673"
     CDS             860867..862108
                     /locus_tag="CAGL0J08712g"
                     /inference="similar to AA sequence:UniProtKB:P31381"
                     /note="similar to uniprot|P31381 Saccharomyces cerevisiae
                     YAL022c FUN26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448087.1"
                     /db_xref="GeneID:2889673"
                     /db_xref="GOA:Q6FNV7"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV7"
                     /translation="MNHDAIDSLENVGLWKKLSNLEYFTFCMIGIGLLWPWNCVLSAV
                     LYFKHSFFQDVTNWAKVFASSMMAVSTITSLVFNVWLANRQRNYTQRVVRGLVWQVMA
                     FVVLAIICMVHNMLPMWFSFLFIMVVILFSSVATALTQNGILAIANVFGSEYSQAVML
                     GQAVAGVLPSVVLFGISYIGDSTAAETGEQSQAGIIVYIITTAIVCGISTTLFKFTGI
                     GGQFMAIMREESIDVDDNDEQIPFRVLFDKLRLLVLSILLTFVITLIFPVFASTVRST
                     GLGMKDEHYMPLIFTLWNLGDLYGRVLADLPYFQSPSFTPLKTFIYALLRFLHIPFFF
                     YFSSRNDGHSVALDIGYMLLQFVFGLTNGHVISLSFMKVPQVLDNDLEKEAAGGFTNI
                     FVSVGLALGSLVSYIFVFLIN"
     gene            <862513..>864741
                     /locus_tag="CAGL0J08734g"
                     /db_xref="GeneID:2889674"
     mRNA            <862513..>864741
                     /locus_tag="CAGL0J08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448088.1"
                     /db_xref="GeneID:2889674"
     CDS             862513..864741
                     /locus_tag="CAGL0J08734g"
                     /note="highly similar to uniprot|P31382 Saccharomyces
                     cerevisiae YAL023c PMT2 or uniprot|P47190 Saccharomyces
                     cerevisiae YOR321w PMT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448088.1"
                     /db_xref="GeneID:2889674"
                     /db_xref="GOA:Q6FNV6"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV6"
                     /translation="MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVS
                     QSPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVH
                     PPLGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAK
                     AIGFSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFS
                     RKWWKWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWL
                     ARIVALICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIG
                     SSVSIKNQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINE
                     TDIEYVVDGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEI
                     VDQKGSENTTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDK
                     RTWWNVESHENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASS
                     AWEWPTLHVGLRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYN
                     DFSNKDDFNLFLMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDA
                     TTKRWMKSKCGSIMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHI
                     HD"
     gene            <865291..>867792
                     /locus_tag="CAGL0J08756g"
                     /db_xref="GeneID:2889675"
     mRNA            <865291..>867792
                     /locus_tag="CAGL0J08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448089.1"
                     /db_xref="GeneID:2889675"
     CDS             865291..867792
                     /locus_tag="CAGL0J08756g"
                     /inference="similar to AA sequence:UniProtKB:Q05787"
                     /note="similar to uniprot|Q05787 Saccharomyces cerevisiae
                     YLR207w HRD3 involved in degradation of HMG2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448089.1"
                     /db_xref="GeneID:2889675"
                     /db_xref="GOA:Q6FNV5"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /translation="MLLSTYLNWASVLLTIAGAESNIDPWDEVSSFLQGKLRKLDVTN
                     PNAYDMNDNEQDATFYVSMDYHEEEERSEYESVWQYYNENSDQDWHKSVYDKLQVSAD
                     QFNNTEAMYKLSQINLWGQYGYPHNKSVAFQYLQKFNDMTSYENSSALFDLAVAYSTG
                     LFGTLPVDVARGLLYFQRSARLGDLKAKQVLAYRYFSGYSVARDVDKALLLYKEIAEE
                     IKKKYSEEQWNMVFPYIESYIVRIPDFDEGLLGKGLSTVPQSVRRKKTTRPPFAGSSN
                     LKPIGDVGYGEVVMQFKFNAGNGNPGSFVISDSEHEDRLVELFYTAWDLYKGTYTRGR
                     DCDKAKRLLLQVYKTYDAEVKYMDNLQKFFYVKSLDLLAHMYFTGEGFERPNVQAALD
                     LFDRSEKILEGAEISRTASEVDKGLISQYYFNNTLGALKHYKKAKESGNAHGILFYQL
                     GKLSEKNPELKIGDPYLYMQEASSQQYLPAQYEFAKMVESNELRKYSVEDITRLYKAF
                     VEENENIMAPHLRLGFSELLGGSSEVSLYAYAQAAEQGYEAAQISAAYLLYQLPYKFD
                     DPPETTIERKTMAISYYTRAFKQGNTDAAVVAGDIYFQMKNYTKALSLYQSAALKFSA
                     QALWNIGYMYEHGLGVEKDFHLAKRFYDQILEHNQKLYFAVKASVMKLQLKSWFMWLN
                     GKELDNISIDQEQESTVVRPFFDRLVQLLKNLSRETRGDNKKKNQHRILKEKKTPSQG
                     IMERFGLQTEDLLTMVCVLIIFAISMFFRTVAPRGQWNVRINGVNIAGGNALGEEGNP
                     ENENEEDDENDDEGRARARNNFGFGNNFDVQVFAI"
     gene            <868299..>869195
                     /locus_tag="CAGL0J08778g"
                     /db_xref="GeneID:2889676"
     mRNA            <868299..>869195
                     /locus_tag="CAGL0J08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448090.1"
                     /db_xref="GeneID:2889676"
     CDS             868299..869195
                     /locus_tag="CAGL0J08778g"
                     /note="highly similar to uniprot|Q04491 Saccharomyces
                     cerevisiae YLR208w SEC13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448090.1"
                     /db_xref="GeneID:2889676"
                     /db_xref="GOA:Q6FNV4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVEGESHK
                     LVDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASV
                     NSVQWAPHEYGALLLAASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEG
                     GNNPGEAPKEVRRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSVL
                     LRSYIASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGD
                     NKVTLWKENLNGKWESAGEVNQ"
     gene            complement(<869388..>870335)
                     /locus_tag="CAGL0J08800g"
                     /db_xref="GeneID:2889677"
     mRNA            complement(<869388..>870335)
                     /locus_tag="CAGL0J08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448091.1"
                     /db_xref="GeneID:2889677"
     CDS             complement(869388..870335)
                     /locus_tag="CAGL0J08800g"
                     /inference="similar to AA sequence:UniProtKB:Q05788"
                     /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
                     YLR209c PNP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448091.1"
                     /db_xref="GeneID:2889677"
                     /db_xref="GOA:Q6FNV3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV3"
                     /translation="MNTNWDLGEERVKIEKASEYLSERFQERFQNEKFEPRALIICGS
                     GLSGIPDKLNKDKLEPLVIPYELIPGFKRSTVPGHSGNLVFGIMNDYPVVLMSGRLHG
                     YEGNTMQETVFPIRVLHHFSKGGIKTLIVTNAAGGINSEFKPGDIMCIYDHINFPGLA
                     GLHPLKGPNFDDIGPRFLALSDAYSHDLRKLLFQTHNELKMDRPLHEGTYFFASGPTF
                     ETRAESRMIRILGGDSVGMSTVPEVIVARHCGWDVLALSLITNVAVIDHPPSGKIDTP
                     VPMDYGKASHAEVLENGRIASKDVETLISTFVGKLHYRE"
     gene            <871867..>873198
                     /locus_tag="CAGL0J08822g"
                     /db_xref="GeneID:2889678"
     mRNA            <871867..>873198
                     /locus_tag="CAGL0J08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448092.1"
                     /db_xref="GeneID:2889678"
     CDS             871867..873198
                     /locus_tag="CAGL0J08822g"
                     /inference="similar to AA sequence:UniProtKB:P24871"
                     /note="similar to uniprot|P24871 Saccharomyces cerevisiae
                     YLR210w CLB4 cyclin or uniprot|P24870 Saccharomyces
                     cerevisiae YDL155w CLB3 cyclin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448092.1"
                     /db_xref="GeneID:2889678"
                     /db_xref="GOA:Q6FNV2"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV2"
                     /translation="MNNTEDMFRDVENASQNMASTVNTSRMDQRQRRALTDLTSQKVN
                     RIHTSKTIKDIPAYLSNYTADGENKNIDQAFNHSNDQDIGLVNQINSGYANVENEPGK
                     ETDHIFIDQDDLSDLDIVQEDSLREQLEEFEHDFENFVEPLSPIFNDEIQDTLDRAFK
                     EYYRATPDMEDDDTFDAVMVTEYGSDIFRYMRKLELKYRPNPYYMAGQPELKWEYRKT
                     VIDWIVQVHERFQLLPETLYLTINIIDRFLSRKNITLNRFQLVSATALLIASKYEEIN
                     CPTIKDIVYMVDNTYSRDDIIEAEKYMIDALDFEVSWPGPMSFLRRISKADDYEYRTR
                     NLAKYLLETTLMESSLISALPSWLAAGAYFLSRIILGYEEWTLKHVYYSGYTHEQLYP
                     LATLILDNCQNYEESHQAIWTKYSQPQYHQVSILVTKFLGRVSSDDMSEIY"
     gene            complement(<873456..>875855)
                     /locus_tag="CAGL0J08844g"
                     /db_xref="GeneID:2889679"
     mRNA            complement(<873456..>875855)
                     /locus_tag="CAGL0J08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448093.1"
                     /db_xref="GeneID:2889679"
     CDS             complement(873456..875855)
                     /locus_tag="CAGL0J08844g"
                     /inference="similar to AA sequence:UniProtKB:Q99207"
                     /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
                     YDL148c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448093.1"
                     /db_xref="GeneID:2889679"
                     /db_xref="GOA:Q6FNV1"
                     /db_xref="InterPro:IPR007276"
                     /translation="MAGSQLKELKATLKAHGLTGQTNVKKSKKGKREAKKYDHEEKAR
                     TIAKIRDRFNPFEVKTTKNKRKGGDPGLLNSDRVAVGKPGISKQIGEEARRRAFEAKK
                     LMKKRKGGVIDKRFGERDKTLTEEEKMLERFTRERQAGSQRKKNLFNLEDDDEDGPIE
                     LDMFGNKLTHLGESLSLADDLNVQAEDTEDLEEGQPQRKKTKLEVMKEIIAKSKFHKQ
                     ERQAAQRKLEDNIDELDEDFDDVMAELMTTQTLKQDDIEVPAEEKDYDIKVKELNLEK
                     RAAPADRTKTEEELQKEAEERRQKLEEQRLNRMQGMLEDEEGEERGVEDLDDGFWGSD
                     SEVEEGENIANSDEDIEVESSSEEAISYKSKKLVAISCPQTHPEFLNDLKGLSLLEQP
                     IHVKAIIKAYQPKLAEGNKVKLANFSKVLLKHMIYLANQRYDKDLIKFDKTQNEFLII
                     LKRLSEKYNQAISEVSREYILDIQERFKKQNFHALNNGDILFFIIVGVLFSTSDQYHL
                     VVTPAQIILCEFLEQIRFKSLKRIAVGSVLLRIILQYQRLSKRYIPETVYFLQKALLS
                     LVVNPDDIESDMTLPIRLDTFDCGLKLKEPSLPDDAVVHLHELFTKSTTNEEDLKINV
                     LSNLFEDLEKLIGSHWNNEAAFPEICEIFEPILSVYKVRYPSITTVESIEEKIKRMKK
                     LNKHYPLALQAHRPTAIPSYAPKFEENFNPAKKSYDTDVARNEVNKMKAQLKKERKFV
                     MKELRKDTKFEARQRIDEKKKEAEAYHSKMSNIINTINTEEGAEKNKYEREKRLRAGK
                     K"
     gene            complement(<876226..>876906)
                     /locus_tag="CAGL0J08866g"
                     /db_xref="GeneID:2889680"
     mRNA            complement(<876226..>876906)
                     /locus_tag="CAGL0J08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448094.1"
                     /db_xref="GeneID:2889680"
     CDS             complement(876226..876906)
                     /locus_tag="CAGL0J08866g"
                     /note="some similarities with uniprot|Q05789 Saccharomyces
                     cerevisiae YLR211c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448094.1"
                     /db_xref="GeneID:2889680"
                     /db_xref="UniProtKB/TrEMBL:Q6FNV0"
                     /translation="MSDLNTVYEHIRRAEQKCRSGDLSDALDLYVSALEGLDLKSPNF
                     DLQGLDDTIIEAVKLLRDDIQLRIKELQICVIESSKDEKDSKNNKASMALVQSSAGNN
                     NNLAASKYWDSTRNITDITSSTFIDPYTSSMLSKLQNSMVDLIKEAKNQKTDVNDLVS
                     TALFQIDQFKKEMLIYEQRRTREYQIKVEHLNKDVKKLSSQNSKLKERWDSLVESARQ
                     RKNRQQGL"
     gene            complement(<877386..>878783)
                     /locus_tag="CAGL0J08888g"
                     /db_xref="GeneID:2889469"
     mRNA            complement(<877386..>878783)
                     /locus_tag="CAGL0J08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448095.1"
                     /db_xref="GeneID:2889469"
     CDS             complement(877386..878783)
                     /locus_tag="CAGL0J08888g"
                     /inference="similar to AA sequence:UniProtKB:P53378"
                     /note="similar to uniprot|P53378 Saccharomyces cerevisiae
                     YLR212c TUB4 gamma tubulin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448095.1"
                     /db_xref="GeneID:2889469"
                     /db_xref="GOA:Q6FNU9"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /translation="MTGEIITIQVGQCGNHVGKYFWNQLLKEHGIDKDGYSKYNDDLT
                     HIREDDTNPFFKQITNNRYVPRAIMIDLEPAAVTDVQSSFNDLFNPRNTWVSSEGLGA
                     GNSWSTGYDRGVQNQDRIMDIIDRELDSTDNFEGFQLLHSVAGGTGSGLGSSLLEALT
                     DRYSKSFITTYSVFPSKQSEVVVGPYNTVLTLRRLCEDADASIIFDNNALLNLTARTF
                     RDPNTSYEHTNQLISSALSSITNSLRFPSYMYNSMASIFSTLIPTPELHFLTPNFTPF
                     TPDYIIGGQRYKKNTAYDVLLDLLDPFNSLVTQRSDMVTHFNVFSTVIGEVDQNHILR
                     ALPKMQQRLNMPSWSTSALNVNIGRRSPYLPPLESRENSVSGLMLSNTSAITSVFERS
                     ASAFDKLFYKGAFLNQFESGQLFQNGLDEFVESREVITRMMEEYSNAEQDTYLDDILN
                     EDDIMIGGFDNEGDS"
     gene            complement(<879267..>880751)
                     /locus_tag="CAGL0J08910g"
                     /db_xref="GeneID:2889470"
     mRNA            complement(<879267..>880751)
                     /locus_tag="CAGL0J08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448096.1"
                     /db_xref="GeneID:2889470"
     CDS             complement(879267..880751)
                     /locus_tag="CAGL0J08910g"
                     /inference="similar to AA sequence:UniProtKB:Q05790"
                     /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
                     YLR213c CRR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448096.1"
                     /db_xref="GeneID:2889470"
                     /db_xref="GOA:Q6FNU8"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU8"
                     /translation="MAKQLKLLIIIRFLLSINFSRGIDLHKPETPVRCSIRDGSCPAE
                     WPCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRIASG
                     NLQKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMTQ
                     MDPTTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDEL
                     DFEFVGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDG
                     VVVRTLYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPP
                     DMLEKGYFSANVKVIRIEPSANRHLPRIYHCLTRKSHKDINDLTSRDLSMATFYYNSS
                     RDNRYNENSLEWDCFNDIYLSNSSSSGTDLYYGNKGKQTNSLEKSPNSEYSNENDSEE
                     INVEEWYRRSMMFRPKRQKSSAAHKTKSSTLPLIIFLIISLFIK"
     gene            complement(<881038..>882105)
                     /locus_tag="CAGL0J08932g"
                     /db_xref="GeneID:2889472"
     mRNA            complement(<881038..>882105)
                     /locus_tag="CAGL0J08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448097.1"
                     /db_xref="GeneID:2889472"
     CDS             complement(881038..882105)
                     /locus_tag="CAGL0J08932g"
                     /note="highly similar to uniprot|Q05791 Saccharomyces
                     cerevisiae YLR215c CDC123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448097.1"
                     /db_xref="GeneID:2889472"
                     /db_xref="GOA:Q6FNU7"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="InterPro:IPR016525"
                     /translation="MSEEYAVLSELPVTCSQIDNCAFSFWYEKFKKHVPKSRVIKPLP
                     EQFIQYLEQDGIKLPMSSTELSTYTDDVARTEDNEYSDWEGDEDTATEYEPGIEPLND
                     FPELHNQIKEIIVELGPVTPKLNWSAPKDATWILPNNTTKCNEVNEIYLLLNASNYIV
                     HDLNHAYDECIDKKEGFSTPEYELVLRQWFAINPALEFRVFVKDGKVAAVSQRDLNYY
                     DYLDKLTDTFKDLIDEFVEDEMVPQFPDKSFVTDLYIPRPFNRVFLIDINPFSRKTDP
                     LLFTWNEIININAQPDRDYELRLITENNIGRFASKEHSQNHVPKDVVDASLDPERIRE
                     LSQKWSELLLQQEKESSDEEK"
     gene            complement(<882437..>883552)
                     /locus_tag="CAGL0J08954g"
                     /db_xref="GeneID:2889473"
     mRNA            complement(<882437..>883552)
                     /locus_tag="CAGL0J08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448098.1"
                     /db_xref="GeneID:2889473"
     CDS             complement(882437..883552)
                     /locus_tag="CAGL0J08954g"
                     /note="highly similar to uniprot|P53691 Saccharomyces
                     cerevisiae YLR216c CPR6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448098.1"
                     /db_xref="GeneID:2889473"
                     /db_xref="GOA:Q6FNU6"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /translation="MTRPKAYFDISIGGTPKGRIVFELYKDVVPKTAENFLKLCEGKS
                     GMAKSKPDVPLSYKGSIFHRVIKDFMIQFGDFTNFDGTGGESIYGEKFEDENFEIKHD
                     KPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIEGKRLVRLIEKQQTEDGT
                     DKPMHDVKVEGCGLLPDDYEVPADAEQTPTDEFGDNYEESLKDDAKVDLKKVETVIKA
                     IETVKDIGTKQFKEQNYEVALAKYKKCDKFLKEYFPDDLNEEDMKKINDFKVTVPLNI
                     AIAALKSKDYRSVMVACSEVLYAEAADAKAKAKALYRRGLAYYHVNDTDMALADLEMA
                     TTFQPNDAAIAKAINDTIKKRKQETEKQKKSLSKMFG"
     gene            complement(<883894..>884154)
                     /locus_tag="CAGL0J08976g"
                     /db_xref="GeneID:2889474"
     mRNA            complement(<883894..>884154)
                     /locus_tag="CAGL0J08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448099.1"
                     /db_xref="GeneID:2889474"
     CDS             complement(883894..884154)
                     /locus_tag="CAGL0J08976g"
                     /inference="similar to AA sequence:UniProtKB:Q05809"
                     /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
                     YLR218c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448099.1"
                     /db_xref="GeneID:2889474"
                     /db_xref="GOA:Q6FNU5"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU5"
                     /translation="MSESRYYKEALEQYKEMVEEEQDGSERDSWDKRITDTGCYVENL
                     ALQLCHAETNDWRQCFPEMAKFKECWESNGNRDRVKTVDRDS"
     gene            <884779..>888624
                     /locus_tag="CAGL0J08998g"
                     /db_xref="GeneID:2889475"
     mRNA            <884779..>888624
                     /locus_tag="CAGL0J08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448100.1"
                     /db_xref="GeneID:2889475"
     CDS             884779..888624
                     /locus_tag="CAGL0J08998g"
                     /note="highly similar to uniprot|P38968 Saccharomyces
                     cerevisiae YDL195w SEC31 component of the COPII coat of
                     ER-golgi vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448100.1"
                     /db_xref="GeneID:2889475"
                     /db_xref="GOA:Q6FNU4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR021614"
                     /translation="MVRIAEYSRTATFAWSNDRIPYLVSGTASGTIDADFSNESKLEL
                     WSLLGTDADKPSHSVSTDAKFKDLDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQG
                     SFKNHSTVVRTVKFNSKQNNVLLSGGNSQEIFIWDLNKLLDSKANYQPLTPGVSMSPI
                     DEIHSLSWNKSLAHVFASASNSSFASIWDLKAKKEVIHLSYTSQNTGLKSDFSAVEWH
                     PLNSTRVATATSNDNEPLILVWDLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDE
                     NLLLSSARDSSVMLWNPQSGEALTEYNTTGNWCFKSKFAPQAPDLFAFATLDGKKIEV
                     QTLQNYETTLDEEVSKTKQQESETDFWNHVSEEKAEIKSTVVHLQAPSWYGNKSASAQ
                     WAFGGKLVQVTKDGKGVEVNKPEITDLKSDDTLKNALASKDFQPLINQRLVKVVNETN
                     EEDWNLLEKLSMDGKEEFLKEALELDEEEDEEKDQEGKDGDEFFQKIESNFQPSGSFK
                     IDSNEESVINNILSGNNSKAVSELLKSGSILEAFVVAVTCNDEKLKEDVKDAYFAAHG
                     KESSLSRVLFSSSKKNSDDIVENLDISQWKYITKSIYNFHANDEVERTNKLLQLGDRL
                     LANKNRQDALVIYIAAGSLDKIATVWLNEFSTLENKIKDQEKTIYEAHIECLTEFVER
                     FTILSNFVGKKQKITNESLISKFLEFINITSATGNFDLALLFLDILPEDNEYVIAEKK
                     RVMVASGKVVDQSQSRKGKYGSHANLASAGFSGHAKQPVNLPPTAAPFAAQTMGGYAP
                     QAVGAVPTPAVPVPQTRNASVSIKSNPYGPAGTNVGTSDNKFNAYAPPTHTQVPVATP
                     VTSSFIPPANPYSNVAAQSLAMAAEQNAMSPNLAGSAPPVKSPSVYSGQTPHLNKKAN
                     DGWNDLALPVKEKPQRAKPVTVAPSPILAPATNGAAAAVPTKSIGTVFPPTGGNSRVP
                     SSMVSPPPPQKRASRTPSLINIDDVVNARPKAHTSIYAPQTTQAGPAPVAPQSDIPLA
                     PTANPYAPNQSVGSTPLQKPVNPYAPPAQQAGIPSAANPYASQIPSKAPVNAPPPMSS
                     KKAPVGPPPMSSRKKAHEGKTLSHEAASVLDSSKPVQTQPIASELSREPAPVPTSASQ
                     TQVPPPVQETPARNTISPIDMAAPAVEQGISAAQQPIRDFFSSELARVTPLTPKEYNK
                     QLKDCDKRLKILFTHLEKNLLSQPTVDKLLHIIELLKEKKYHEAMEVHKDIATNHAEE
                     GGNWLTGVKRLISISEATA"
     gene            <889269..>891839
                     /locus_tag="CAGL0J09020g"
                     /db_xref="GeneID:2889476"
     mRNA            <889269..>891839
                     /locus_tag="CAGL0J09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448101.1"
                     /db_xref="GeneID:2889476"
     CDS             889269..891839
                     /locus_tag="CAGL0J09020g"
                     /note="highly similar to uniprot|P10870 Saccharomyces
                     cerevisiae YDL194w SNF3 or uniprot|Q12300 Saccharomyces
                     cerevisiae YDL138w RGT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448101.1"
                     /db_xref="GeneID:2889476"
                     /db_xref="GOA:Q6FNU3"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU3"
                     /translation="MTIISEDEKSVARDREGVLARAIKVVNRKFRRKDVRREKLERAL
                     SCDNQMTLNSTNLYAAQQQEYQRREENDIEENQEPEGGNDDIDYDISILSDEMSTVDD
                     ASLLFAEPPQKQSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDMRYVRENIAPNHVGF
                     TAQQLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHNIQ
                     LLIAGRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGT
                     HNRNDASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPI
                     HDSGLLEELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSG
                     INFIFYYGVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIM
                     TLSNFIIAIVGSSTQSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKC
                     TAICAAANWLINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVYET
                     RGLTLEEIDELYTKSPNGIVSAKWNRRIRHREKTYGHKEQQNRDRNQQTTKENLRKNV
                     VNEDMLSDDLTPRNDSINTHHSVDSNEKYQSENTDNTLAPAVNDRSMMDFGNDMILHI
                     CNRGPPSISTAASVEEFGGNSTQMENLSYNESNSVEKKKVGLFSKFKLGSRKSSINGT
                     EEDSKPKSPQLGQAEFSPSPLDVKVSDDDHNDFVDLGNGFGLYSVTRRLSSGVPDTSD
                     EESAYDLGNAPSSTNTYRNRGNLDSINTYMSQLIQSNTYTSQNTGYSQNDNDQTQHHQ
                     "
     gene            <892829..>893920
                     /locus_tag="CAGL0J09042g"
                     /db_xref="GeneID:2889940"
     mRNA            <892829..>893920
                     /locus_tag="CAGL0J09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448102.1"
                     /db_xref="GeneID:2889940"
     CDS             892829..893920
                     /locus_tag="CAGL0J09042g"
                     /inference="similar to AA sequence:UniProtKB:Q12063"
                     /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
                     YDL193w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448102.1"
                     /db_xref="GeneID:2889940"
                     /db_xref="GOA:Q6FNU2"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU2"
                     /translation="MVEIRDDLVEDIVELTRRIPILHIEESGPLLVDLAPEKECLTNG
                     SANTKIRYAQAILDSVLTEFGGGNSGSSFYEIQVPDGDVKKGRLIFRQFSKLEKFVYK
                     ILLAIIFFVFGMLRYALYQYNQMRLSLLHLIYNPSRIPHLIRRDTLRLKKMPTRVAFI
                     LEAKPIGQVGGGLYGLLSNAAEVVSWSVYAGVKEVILYDMDGYFQKNIFHLEDEIYSS
                     LTNYSSRNSIPNFTIYVPHSGKTYKRYHTGNNESREHISITVLSHIDGRPTVVNVVKS
                     IIQLCKESKMSVGEISMELVNSVLTRLVCDEPDLLVYFGPTLDLQGFPPWQIRLTELF
                     WEQDNNRVSYSVFIRALNHYSNCKINLGK"
     gene            <894680..>895225
                     /locus_tag="CAGL0J09064g"
                     /db_xref="GeneID:2889941"
     mRNA            <894680..>895225
                     /locus_tag="CAGL0J09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448103.1"
                     /db_xref="GeneID:2889941"
     CDS             894680..895225
                     /locus_tag="CAGL0J09064g"
                     /note="highly similar to uniprot|P11076 Saccharomyces
                     cerevisiae YDL192w ARF1 or uniprot|P19146 Saccharomyces
                     cerevisiae YDL137w ARF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448103.1"
                     /db_xref="GeneID:2889941"
                     /db_xref="GOA:Q6FNU1"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU1"
                     /translation="MGLFASKLFSNLFGSKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCA
                     TSGEGLYEGLEWLSNNLSNQS"
     gene            <897205..>898194
                     /locus_tag="CAGL0J09086g"
                     /db_xref="GeneID:2889942"
     mRNA            join(<897205..897207,897835..>898194)
                     /locus_tag="CAGL0J09086g"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_448104.1"
                     /db_xref="GeneID:2889942"
     CDS             join(897205..897207,897835..898194)
                     /locus_tag="CAGL0J09086g"
                     /note="highly similar to uniprot|P39741 Saccharomyces
                     cerevisiae YDL191w SOS1 or uniprot|P39741 Saccharomyces
                     cerevisiae YDL136w SOS2"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_448104.1"
                     /db_xref="GeneID:2889942"
                     /db_xref="GOA:Q6FNU0"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="UniProtKB/TrEMBL:Q6FNU0"
                     /translation="MAGVKAYELRTKSKEQLENQLLSLKKELAELQVQKLSRPSLPKI
                     HTVRKDIARVLTIINEQQREAVRQLYKGKKYQPKDMRAKKTRALRRALTKFEATRVTE
                     KQKKKQIAFPQRKYAIKA"
     gene            complement(<898456..>901299)
                     /locus_tag="CAGL0J09108g"
                     /db_xref="GeneID:2889943"
     mRNA            complement(<898456..>901299)
                     /locus_tag="CAGL0J09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448105.1"
                     /db_xref="GeneID:2889943"
     CDS             complement(898456..901299)
                     /locus_tag="CAGL0J09108g"
                     /note="highly similar to uniprot|P54860 Saccharomyces
                     cerevisiae YDL190c UFD2 ubiquitin fusion degradation
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448105.1"
                     /db_xref="GeneID:2889943"
                     /db_xref="GOA:Q6FNT9"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT9"
                     /translation="MELIIEDIFQVKLPGSETNNPQYTVLSDEIDRNIDGIILAQLTE
                     NEQLLEPFAYLNNCYNRTLTRRRKNKNAKELQSSFDEIETLLVGYGLVAFQIEEFCMN
                     GNFKNYIKKIIEKVDDYTNFIPKIIERANQEGSLLEFLTNVFTNLQFYLTKDMAMFDI
                     NDSMTYNNTLSIYEMFLTFKPVAAIFTKVEGFFADYNCKANEFEKVTILGPILTLSPL
                     NPNVALRNYGDNLERSKQQTMIIHESLQAEHKVIIERLFFVIDKIIRGSEESRSDMIS
                     YFAQIVNKNHLRRGDHANQNKLASNAFMTNITLILVKFSQPFLDVSYKKIDKIDVNYF
                     NTLNLYLDLSQETRLNSDFKEADEFYDRNKKDAEMKPNFISDCFFLTLTYLQYGLGGT
                     LLYDEKITPQLKRLREEIERVKEAANSQDMFASFANMQLKQMEKTLKITQSIRSALQG
                     FFTHRNMQLEVFDFICGASTFLMRVIDPNHQYPAQAFKLPLIPDQVGFENVDNAEYLR
                     KNAPVPFKYYPEFCVEGPINYALYIAQYSTSPLFRNPRLQSFLEFGTTILRCPELVSN
                     PHLKGKLVQLFSVGAMPLTDGSPGFMMEIFEHDELIKENLLYALLDFYVIVEKTGSSS
                     QFYDKFNSRYSISIILEELYSRIPLYKNQLIWQSQKNSDFFIRFVARMLNDLTFLLDE
                     GLSSLADVHNIQNEIENRAKGNQPTREENDQELQSKLMSAERQAKSSCGLAGKSLKLF
                     EIFTADIPSAFCSSEIVDRLASMLNYNLVSLVGPKCGELKVKNPEKYSFHPKQLLKAL
                     TTVYVNLAGEDEFISAIARDSRSFDTALFERAVHILQSKIGLVSPEFCDKLMNLALKA
                     EERKNAEEEEDMEYGDAPEEFLDPLMYTIMKDPVTLPTSKVNIDRATIKAHLLSDSTD
                     PFNRMPLKLEQVIPNTELKQKIEEYKKNKKMKK"
     gene            <902880..>904658
                     /locus_tag="CAGL0J09130g"
                     /db_xref="GeneID:2889944"
     mRNA            <902880..>904658
                     /locus_tag="CAGL0J09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448106.1"
                     /db_xref="GeneID:2889944"
     CDS             902880..904658
                     /locus_tag="CAGL0J09130g"
                     /note="some similarities with uniprot|Q05672 Saccharomyces
                     cerevisiae YDL189w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448106.1"
                     /db_xref="GeneID:2889944"
                     /db_xref="GOA:Q6FNT8"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT8"
                     /translation="MEEKPNVSNSESSSKNVNDLDCEELGLSPAMITALFKRPHDRQF
                     IIDKEQAIINFIDSNQNSLELRPMNSYYRMLSHQIAEYHHLRHVIARSNDVSVILFKV
                     EDTHKFRNKKPLLKSLEPLYVTENKSTVSEEESKPANNSAGNTKKFKILKRSKSKDDA
                     ITDNSSQENIQLTSETPETPLQESNNSSSSALLEEQRLKKEEEYNQIRQNLFENVNGD
                     EVIDDNSLNDEDDGVHTDLSEVFGDVKTNNDSENQDTANGKDESTSAPYYRVKIVQEK
                     FGGINDSKNGASPQPDEFQTSRNSLLTNQEYQYHYKGYQNRNSRRSFHSSNSASSLGN
                     DMNPGYKSKNRSGSFTRRSSNSSINSRRSSYNNNSEYGGLHYGKYMQQIPQGTPAGFP
                     MPYMMYPPHQMMQYQQIPHLGMFAGAGTIPIDGAGVPFSTSAPYMYPIPIPPTTDGIN
                     VPGNAAGSMTANFTPFSPSLPNGVHMSPIMVPSVPRYNLNSTNHRSHYSSNNSESKGY
                     TRNNKYQKNSYRNKITTEGGSNESFDGSESEKSIDNGSNNNDREGNAPSYRSRGNEKG
                     NSVSGDNSPKGEDILSLNQNLKTLSI"
     gene            complement(<905105..>905707)
                     /locus_tag="CAGL0J09152g"
                     /db_xref="GeneID:2889945"
     mRNA            complement(<905105..>905707)
                     /locus_tag="CAGL0J09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448107.1"
                     /db_xref="GeneID:2889945"
     CDS             complement(905105..905707)
                     /locus_tag="CAGL0J09152g"
                     /note="highly similar to uniprot|Q12434 Saccharomyces
                     cerevisiae YDL135c RDI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448107.1"
                     /db_xref="GeneID:2889945"
                     /db_xref="GOA:Q6FNT7"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT7"
                     /translation="MSEPDFNDFEESTNDDKYKVSEKKTVDEYKKLDAEDESLAKWKE
                     SLGLSSDVLPLEFPGDTRKVVIQKIQLLVDTEKEPITFDLTNETTIKELASKRYKVKE
                     KSIYKLRITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKQKPFYEVELP
                     ESEAPSGFLARGNYSAVSKFIDDDKTTHLTLNWGVEIVKK"
     gene            <906232..>907293
                     /locus_tag="CAGL0J09174g"
                     /db_xref="GeneID:2889946"
     mRNA            <906232..>907293
                     /locus_tag="CAGL0J09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448108.1"
                     /db_xref="GeneID:2889946"
     CDS             906232..907293
                     /locus_tag="CAGL0J09174g"
                     /note="some similarities with uniprot|P48568 Saccharomyces
                     cerevisiae YDL186w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448108.1"
                     /db_xref="GeneID:2889946"
                     /db_xref="GOA:Q6FNT6"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT6"
                     /translation="MSKFARINLETASPLDLVFNLDSNDSQRGVDGTLDHGLSKNKYF
                     LPQDANVSSVRELVIDSQSKRKLRLGNRFVEKMEDNLVKWRPPLSSNRGTVMAIEGKH
                     PYQIAAEIYAPNCDPELFRTADQNNGNATQRQMSHTMFDSFTHWWKENARGALELRRQ
                     QFEEEILGLSDLQDMDQVVEVTVAPAIKEEPQLEDTGMNTETQSALTNNTAELARLIS
                     QEDERRLEISDLSNSGISSGVSSQGTFLARPIVKTPPAAVVRRRQQLQQELKRTGAVP
                     QIYEEVYNAPVPVAYLPVSNNDPRYSQQLSQRQREHVSQNDGPLWSCSQTDIVSKLNE
                     WSVAIMNCLTPITQDHINP"
     gene            <907869..>909281
                     /locus_tag="CAGL0J09196g"
                     /db_xref="GeneID:2889947"
     mRNA            <907869..>909281
                     /locus_tag="CAGL0J09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448109.1"
                     /db_xref="GeneID:2889947"
     CDS             907869..909281
                     /locus_tag="CAGL0J09196g"
                     /inference="similar to AA sequence:UniProtKB:Q12516"
                     /note="similar to uniprot|Q12516 Saccharomyces cerevisiae
                     YDL133w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448109.1"
                     /db_xref="GeneID:2889947"
                     /db_xref="GOA:Q6FNT5"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT5"
                     /translation="MERMVKDVVGHPQDPDERSDNSVSDQPRVDGGKQSNKGNVGHGN
                     GVSDHKRQMVSLNPYGLYPSTVPPFVLESDFRRLHGINDDFNDREVRWANFIGNVGSN
                     VAYSTEQRLPSRGIANNATLRHNYSVGNIKDQPNRHIEDIIDPLVSTGNNSINESASL
                     DHEEMERKRKIQEEILYDLDSEWKGGERLDAVFNFSVNKDFEFKNEKDRIDWVNYISK
                     VKNAYYAPNKESSGINDESSSSLSQQQEGNRGDRQNYDWIEELNKEKEKWKKLKQRKI
                     QKWKPALSNLLFYNQYLPLGFRIVIGILCLISLGLSVRIYQNSDSSIEQVEGGGADLD
                     TGIPQQASTIMAICVNTIAIAYTFYIAIDEFSGKPLGLRNPLGKLKLILLDLLFIIFA
                     SANLALAFNTRFDKEWVCTGLGVTIAEEEVYYPKIPYICRKQKALASFLFVLLFAWVV
                     TFSVSIARVVDKVHSSATRD"
     gene            <910167..>912635
                     /locus_tag="CAGL0J09218g"
                     /db_xref="GeneID:2889948"
     mRNA            <910167..>912635
                     /locus_tag="CAGL0J09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448110.1"
                     /db_xref="GeneID:2889948"
     CDS             910167..912635
                     /locus_tag="CAGL0J09218g"
                     /note="highly similar to uniprot|Q12018 Saccharomyces
                     cerevisiae YDL132w CDC53 controls G1/S transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448110.1"
                     /db_xref="GeneID:2889948"
                     /db_xref="GOA:Q6FNT4"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT4"
                     /translation="MSENLPRSDDLDATWNFIQPGIDQILGNDSTEVTNKKVQKILSP
                     TMYMEIYTAIYNYCVNKSRSSGHFNADRQQSGSSGQSSILVGSEIYERLKKYLRHYIS
                     NFKKDSNETFLQFYVRRWKRYTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLC
                     LMTWKEVLFDPHSDELITEILDQITAERNGEIIQRDHITTSIKSLVALGIDPQDLKKL
                     NLNVYIQVFEKKFLKKTETYYQQYSEDYLTTHSVTEYIFKAHEIISREEKGMAMYWDD
                     HTKKPLSETLNEVLVKSHIEKLESEFIVLLDSRDNSKISALYSLILRDFSLLPRLANV
                     FEEYIRKSGENEVSQLISAHKAAVMEASADGNGTKKMAMATTQSLPPKDYIKALLKVY
                     NTFKNIDRECFPTDPLFAKALDNACRAYININEFALPSGSSRSATSKTSEMLAKYSDQ
                     LLKKSTKPEVANDMSDDDIITIFKFITDKDAFESHYRRLFAKRLIHGTSTSSDDEESI
                     IKRLQTENSMEYTGKITKMFQDVRLSKMLESDFDVMIKSQSDYSREKFPELQPFVLAE
                     NMWPFSYQEVDFRLPEELVASHKKLESMYIGKHNGRILKWLWPLCRGELKADIGKPGR
                     VPFVFTVTLFQMSILLLFNDKDVLTFEEIQEGTNLNIQNIASSMVPFIKFKLVQQLPP
                     GLDNLVKGDTQFKLNRPYKAVKTQINFAAGVKNDILGTISKSSNSVSNGVSGISDEKL
                     SESEKIEKELNAERQMFLEACIVRIMKTKRNLPHSTLVNECIAQSHQRFKAKISMIKR
                     AIDSLIQKGYLQRGEDGESYTYLA"
     gene            <913793..>915106
                     /locus_tag="CAGL0J09240g"
                     /db_xref="GeneID:2889949"
     mRNA            <913793..>915106
                     /locus_tag="CAGL0J09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448111.1"
                     /db_xref="GeneID:2889949"
     CDS             913793..915106
                     /locus_tag="CAGL0J09240g"
                     /note="highly similar to uniprot|Q12122 Saccharomyces
                     cerevisiae YDL131w LYS21 or uniprot|P48570 Saccharomyces
                     cerevisiae YDL182w LYS20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448111.1"
                     /db_xref="GeneID:2889949"
                     /db_xref="GOA:Q6FNT3"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR011872"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT3"
                     /translation="MDQYQQVTESTPTVETSNPYGPNPADFLSNVKEFQLIDSTLREG
                     EQFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSFRDCKAICNLGLKAKILTH
                     IRCHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIE
                     IRFSSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSC
                     DIECHFHNDTGCAIANAYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEY
                     VKSKYKLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEIL
                     DPHDFGMKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVTTKIKKLGDIRPLNID
                     DVDSIIKDFHADLATPMVRPTEDGADNEEPLQLDEPAKKKSKLSQ"
     gene            <915500..>915799
                     /locus_tag="CAGL0J09262g"
                     /db_xref="GeneID:2889950"
     mRNA            <915500..>915799
                     /locus_tag="CAGL0J09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448112.1"
                     /db_xref="GeneID:2889950"
     CDS             915500..915799
                     /locus_tag="CAGL0J09262g"
                     /inference="similar to AA sequence:UniProtKB:P01098"
                     /note="similar to uniprot|P01098 Saccharomyces cerevisiae
                     YDL130wa STF1 or uniprot|P01097 Saccharomyces cerevisiae
                     YDL181w INH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448112.1"
                     /db_xref="GeneID:2889950"
                     /db_xref="GOA:Q6FNT2"
                     /db_xref="InterPro:IPR007648"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT2"
                     /translation="MPKNTLRSNDKFQSIKKMLAARTGSRAILRIRPQAVIRQYSDGF
                     MATGNGIFDQREKAKEDYFIRQHEREQLQKLKEQLEHHKSKVKDIQEKIDKLSKK"
     gene            <916357..>917022
                     /locus_tag="CAGL0J09284g"
                     /db_xref="GeneID:2889951"
     mRNA            <916357..>917022
                     /locus_tag="CAGL0J09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448113.1"
                     /db_xref="GeneID:2889951"
     CDS             916357..917022
                     /locus_tag="CAGL0J09284g"
                     /inference="similar to AA sequence:UniProtKB:Q07555"
                     /note="similar to uniprot|Q07555 Saccharomyces cerevisiae
                     YDL129w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448113.1"
                     /db_xref="GeneID:2889951"
                     /db_xref="GOA:Q6FNT1"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT1"
                     /translation="MSESSKFRPPIAETKKLESDILAIIQRLRDDEAGEGQVAKDEVI
                     SVLNRSLTALSHWVLQAQLMELDPNNQDRVAVENSLLKKEVEFLSGKASQKRLHPIQI
                     PPSQLKEPSERPYKVDVHTPVKEKRKKKIDISQITPKRGEFSPKQQNTGTKYDAEKSP
                     TGRSLNTRRTSGEPLSPKGLHEPGTQFKLVENKKPHPRMRRTSDNPSRNEYVRVFHLE
                     KEK"
     gene            <917765..>918973
                     /locus_tag="CAGL0J09306g"
                     /db_xref="GeneID:2889952"
     mRNA            <917765..>918973
                     /locus_tag="CAGL0J09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448114.1"
                     /db_xref="GeneID:2889952"
     CDS             917765..918973
                     /locus_tag="CAGL0J09306g"
                     /note="highly similar to uniprot|Q99385 Saccharomyces
                     cerevisiae YDL128w VCX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448114.1"
                     /db_xref="GeneID:2889952"
                     /db_xref="GOA:Q6FNT0"
                     /db_xref="InterPro:IPR004713"
                     /db_xref="InterPro:IPR004798"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:Q6FNT0"
                     /translation="MDSTAPLLGPNSRQTALSTYSAAKRDLIYVCASSPLHLLLIFVP
                     LGIIWGYMELSHTWTFVFNFLAIIPLAAILAHATEELADKAGSTIGGLLNATFGNAVE
                     LIVSVIALKEGQVRIVQASMLGSLLSNLLLVLGFCFLFGGYNRIQQTFNQTAAQTMSS
                     LLAISCASLLIPAAFKATLPHGKEDWIVDDKILHLSRGTSLILLMIYVLFLVFQLGSH
                     HAMFEQQHEETDEVVSELSIKPHQSLSIRSSLWFLLLSTVIVSICADYLVGTIDNVVE
                     STGLSKTFIGLIVIPIVGNAAEHVTSVMVAMKDKMDLAISVAIGSSLQIALFVTPFMV
                     LVGWWIDVPMTLNFSTFETTTLFIAVFLSNYLILDGESNWLEGVMSLAMYVLIAMAFF
                     YYPDVMADAA"
     gene            <920703..>921596
                     /locus_tag="CAGL0J09328g"
                     /db_xref="GeneID:2889927"
     mRNA            <920703..>921596
                     /locus_tag="CAGL0J09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448115.1"
                     /db_xref="GeneID:2889927"
     CDS             920703..921596
                     /locus_tag="CAGL0J09328g"
                     /inference="similar to AA sequence:UniProtKB:P25693"
                     /note="similar to uniprot|P25693 Saccharomyces cerevisiae
                     YDL127w PCL2 and similar to uniprot|Q12477 Saccharomyces
                     cerevisiae YDL179w PCL9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448115.1"
                     /db_xref="GeneID:2889927"
                     /db_xref="GOA:Q6FNS9"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS9"
                     /translation="MSDIEALLQFNRKPVSQEMITYLARSTESIIQVRETHSMIDVAI
                     PAPKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLIL
                     SAKTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNLTLSTNDLIQSLAPFL
                     KPIKDQIIRSRQQELLLFNAPTPSQLKSYMNSPQSRSSSYNSIPSLSSSNTISTINSS
                     RSRSSLNYSANIQTIPEGESDVVSQRKTSLSNLDPNKYANTSVSEKRKSSRPIILKTG
                     LDKPMVAGQTKIKRSNWTNFF"
     gene            complement(<922018..>924510)
                     /locus_tag="CAGL0J09350g"
                     /db_xref="GeneID:2889928"
     mRNA            complement(<922018..>924510)
                     /locus_tag="CAGL0J09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448116.1"
                     /db_xref="GeneID:2889928"
     CDS             complement(922018..924510)
                     /locus_tag="CAGL0J09350g"
                     /note="highly similar to uniprot|P25694 Saccharomyces
                     cerevisiae YDL126c CDC48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448116.1"
                     /db_xref="GeneID:2889928"
                     /db_xref="GOA:Q6FNS8"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS8"
                     /translation="MGEEHKPLLDGSGAEPTVEDSTATAILRRKKKDNTLIVDDATND
                     DNSVIAINSNTMDKLELFRGDSVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNL
                     RVRLGDLVSIHPCPDIKYASRISVLPIADTIEGITGNLFDVYLKPYFVEAYRPVRKGD
                     HFVVRGGMRAVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGG
                     CRKQMAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFF
                     FLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRV
                     VSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLR
                     IHTKNMKLADDVDLETLAAETHGYVGADIASLCSEAAMQQIREKMDLIDLEEDEIDAE
                     VLDSLGVTMDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVL
                     HPDQYTKFGLAPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESE
                     SNIRDIFDKARAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAK
                     KNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDEPARLSILKAQLRKTPLEPGLDL
                     TAIAKATQGFSGADLSYIVQRAAKYAIKDSIEAHRESLAAAEAEVKTEGGDVDMTSED
                     VKKEPVETVDPVPYITREHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNF
                     GDSNQGTTETGNDGNSGANFGSAGDDDDDLYS"
     gene            complement(<924990..>925576)
                     /locus_tag="CAGL0J09372g"
                     /db_xref="GeneID:2889929"
     mRNA            complement(join(<924990..925372,925522..>925576))
                     /locus_tag="CAGL0J09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448117.1"
                     /db_xref="GeneID:2889929"
     CDS             complement(join(924990..925372,925522..925576))
                     /locus_tag="CAGL0J09372g"
                     /note="highly similar to uniprot|Q04344 Saccharomyces
                     cerevisiae YDL125c YHI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448117.1"
                     /db_xref="GeneID:2889929"
                     /db_xref="GOA:Q6FNS7"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS7"
                     /translation="MSASVAHDAACIFCKIIKGEIPSFKLIETKHVYSFLDIQPTSQG
                     HALVIPKWHGAKLHDIPDEYLHDVLPTAKKIAKALNLDADGNYNILQNNGRLAHQEVD
                     HVHFHLIPKPDEKTGLIVGWPAKQADMDQLAKFHKELVAKLES"
     gene            <925839..>926774
                     /locus_tag="CAGL0J09394g"
                     /db_xref="GeneID:2889930"
     mRNA            <925839..>926774
                     /locus_tag="CAGL0J09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448118.1"
                     /db_xref="GeneID:2889930"
     CDS             925839..926774
                     /locus_tag="CAGL0J09394g"
                     /inference="similar to AA sequence:UniProtKB:Q07551"
                     /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
                     YDL124w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448118.1"
                     /db_xref="GeneID:2889930"
                     /db_xref="GOA:Q6FNS6"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS6"
                     /translation="MVKQEFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQ
                     LKYALSLPGVVHLDAAEFYMTYREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVG
                     LETGLKRLGLEYVDLYLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAK
                     EDLERVLKVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPAD
                     GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLK
                     DDEVTEITKLGLDHEPLRLYWHDQYNKYNSESQKA"
     gene            complement(<926972..>927418)
                     /locus_tag="CAGL0J09416g"
                     /db_xref="GeneID:2889931"
     mRNA            complement(<926972..>927418)
                     /locus_tag="CAGL0J09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448119.1"
                     /db_xref="GeneID:2889931"
     CDS             complement(926972..927418)
                     /locus_tag="CAGL0J09416g"
                     /inference="similar to AA sequence:UniProtKB:Q07549"
                     /note="similar to uniprot|Q07549 Saccharomyces cerevisiae
                     YDL123w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448119.1"
                     /db_xref="GeneID:2889931"
                     /db_xref="GOA:Q6FNS5"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS5"
                     /translation="MCCCTFPDFLLMLLAFIFPPAAVVIRSGIASSDLVLNMLLTMCG
                     FVPGCIHAIYYISMTSPLRNDDYSTRYQQGWIDSERLVSSNSDTRPVPLATHDPTPQV
                     ESSQGETPQATNDEVSRGYDVQTPLLNDPGYIVDNKKGGMPPPYSP"
     gene            928134..928207
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0J09438r"
                     /db_xref="GeneID:2889932"
     tRNA            928134..928207
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0J09438r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2889932"
     gene            complement(<928455..>929489)
                     /locus_tag="CAGL0J09460g"
                     /db_xref="GeneID:2889933"
     mRNA            complement(<928455..>929489)
                     /locus_tag="CAGL0J09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448120.1"
                     /db_xref="GeneID:2889933"
     CDS             complement(928455..929489)
                     /locus_tag="CAGL0J09460g"
                     /inference="similar to AA sequence:UniProtKB:P40507"
                     /note="similar to uniprot|P40507 Saccharomyces cerevisiae
                     YIL079c and similar to uniprot|Q12476 Saccharomyces
                     cerevisiae YDL175c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448120.1"
                     /db_xref="GeneID:2889933"
                     /db_xref="GOA:Q6FNS4"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR016713"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS4"
                     /translation="MTSLSEVETMDTLPFVKDTTPMSNDDIKVVAPSIEQVGNDPNEL
                     RFLRGEGRYFGLDDSEGIKEPEPKCRNCSQRGHFKRDCPHVICTFCGSMDDHYSQHCP
                     KAIKCANCNKVGHYRSQCPNKWKRVFCTLCNSKLHDRDRCPSLWRSYLLREELTGKGN
                     KKKLDLDTDAIYCYNCGGNGHFGDDCNQRRSSRVPKDDGSAFAGNNLRDELRTKYYKK
                     LDQERGKKGRKNNSKVKGNHKRFDDNNNFNYDDYEYDDSIYDEWDNSQLDRKYSGSTK
                     KKNTNKKQKKNNNSHRDPLEFPRSKRNDFNDNSKRGNFSRNDDKAKAKNMRWNNSKKN
                     RKSYRSTERN"
     gene            <929926..>930627
                     /locus_tag="CAGL0J09482g"
                     /db_xref="GeneID:2889934"
     mRNA            <929926..>930627
                     /locus_tag="CAGL0J09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448121.1"
                     /db_xref="GeneID:2889934"
     CDS             929926..930627
                     /locus_tag="CAGL0J09482g"
                     /inference="similar to AA sequence:UniProtKB:Q02685"
                     /note="similar to uniprot|Q02685 Saccharomyces cerevisiae
                     YPL024w NCE4 negative regulator of CTS1 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448121.1"
                     /db_xref="GeneID:2889934"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS3"
                     /translation="MSLSDILPNDITTITSLGSFKATPGTRENTIYQALCNVPWLDGL
                     GRAQIIETKMLAVDRDLLFQIMMVENISKSKVTQIDDMKTTIDPRNQRVDRLHNSNPN
                     GPSKKYKVINEVNIEEDDGNGSTESNGVIGGEKVMYKLTLQSRSGQIFYAINLKPISW
                     PLAVLGSKIVIKKGTKFSRGMFLLAEDNAIFVGGMVKKWNEDKDLKILEYLETKANKE
                     NERLQALKDSRKRKR"
     gene            complement(<930802..>932739)
                     /locus_tag="CAGL0J09504g"
                     /db_xref="GeneID:2889935"
     mRNA            complement(<930802..>932739)
                     /locus_tag="CAGL0J09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448122.1"
                     /db_xref="GeneID:2889935"
     CDS             complement(930802..932739)
                     /locus_tag="CAGL0J09504g"
                     /note="highly similar to uniprot|P46151 Saccharomyces
                     cerevisiae YPL023c MET12 methylenetetrahydrofolate
                     reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448122.1"
                     /db_xref="GeneID:2889935"
                     /db_xref="GOA:Q6FNS2"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS2"
                     /translation="MSICKTFSDRDGPLISLEFFPPKTESGKRNLLERMERMSALDPL
                     FITVTWGAGGSTSEKTLELAQIAQRDLNVPICMHLTCTNMDTTLIKEALDACRSYGIK
                     NILALRGDAPIEDQWDDKTINSSEGPEFRYAVDLVRYIKENYGDEFCIGVAAYPEGHC
                     EGEAEGNEQDPLKDLVFLKEKIDAGAQFVITQLFYDVSKFLDFEKMFREQISETIPVF
                     PGLMPINSFSLFHRAARLSHASIPKAVLDRFPQEIQNDDGIVKSIGVDVLIDIIEEIY
                     SKTNGRVKCFHFYTLNLEKAVAQIVSQSSTLSKILEESDNEEDQVVSQDEDGDIVLVD
                     QHEENPLKFKRRRQSSSVSADVIFNRAIINRGKTDRNESSELASKKLVVSISRGSGVL
                     GRDATWDEFPNGRFGDSRSPAYGEIDGYGPSLKVSNKRAYELWGSPTSIRDLKAVFVK
                     YLEGSIQSLPWCDLGLSPETALIQEELIQLNYRGYLTLASQPCTNASSSTDKIFGWGP
                     SKGHVYQKAFIEMFVHRQQWKTILKPKLDYYGRRKFSYYAGDSKGSFETNLDPHSSNV
                     VTWGVFPNSQVIQTTIIEEESFKAWRDEAFSIWSEWAKLFPRNTPSNTLLREVHSDYY
                     LVSIVHHDFIETDELWDLLLD"
     gene            <933145..>936360
                     /locus_tag="CAGL0J09526g"
                     /db_xref="GeneID:2889936"
     mRNA            <933145..>936360
                     /locus_tag="CAGL0J09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448123.1"
                     /db_xref="GeneID:2889936"
     CDS             933145..936360
                     /locus_tag="CAGL0J09526g"
                     /inference="similar to AA sequence:UniProtKB:P06777"
                     /note="similar to uniprot|P06777 Saccharomyces cerevisiae
                     YPL022w RAD1 component of the nucleotide excision
                     repairosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448123.1"
                     /db_xref="GeneID:2889936"
                     /db_xref="GOA:Q6FNS1"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR006167"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS1"
                     /translation="MQLFVQDDSDDELQLELSQQEEQKQKQFNDSRRLIDETQQKNDE
                     QVSVVSETTVYSPNDEDAILYPLIPDDLDESTEFKPNIEDIRPVDIQLNLSLPFQQQI
                     IEDVLATDDPLVIMGKGLGMVPIVSNLLHVLATPTVIKGQLKRSLVVVLNATGSENRQ
                     ISEELEELNWLVNADDNAGPFASIDEDDDDDPKYSIFNEVTAETLSVEKRRQLYLKGG
                     IVSVTSRIFIVDLLSGTIHPNRITGFVVLNADNLRNFSNESFILEIYRSKNRWGFIKA
                     FSNNPESFSMSFSPLINKMKELHLKNVLLWPRFRIEVSASLNNEKVINGQIRSDKVIE
                     VRINPTNAMSQIQFGLMGCLKKCIEELTRKNTEISIEYWNIENILDANFIRSIDAIMV
                     PNWHRISFESKQLVKDIKYLKRLLKMLYSSDAVDFYEEVQLSLEANKPSLGRKYSESP
                     WLMAEESQLVISYARQRIFNGQDYVLEELPKWDQLLSILDDIAYEKTTRNIEGSTLIV
                     CNNNTTVLQLRRVISKYDNEFGMRNIMLSKLEWYKMKREERKRIVRDFKKEETEPEVQ
                     LSVSSSFAKEEVVTKRRRTRGAAAVAAVQKLHSAGSGIDIEDVIENYDFNAEAQGTMK
                     STSDDLIEDYRVEEQEGYYNVEDEGEYDDFENSTLFKEFMKREADLIDQTMQKKKENF
                     EYLDRQDQLLIETFSRIGDDVLFEEMMPSYIIMYEPDLAFIRKVEIFRALKRENPPKI
                     FFLYYGDSAEEQTHLLSIKKEKDAFSKLIRENATLAQRFEAQTDLSHFKNLAERKLKL
                     SNIRKTNTRTAGGQLGLRELTQDVVLVDTREFNAALPGLLFRYGVRVIPCMLTVGDYV
                     LTPDICVERKSISDLIGSLQNHRLEAQCKKMSKHYKYPTLMIEFDEGQSFSLEPFSER
                     RLYRSRDSSTTHPISNKLSQDDIQMKLCKLVMKFPGLRIMWCSSPLQSVNIILELKLG
                     REQPDPNIAIELGLHRKMGLSEKSIDNEQSFKKLLSIPVLSKIDYFNIRKKVKTFRKL
                     TKMRLIDIQNVVGNEMVATKVYEFLHNDDNDDDDYDISDLD"
     gene            complement(<936524..>940777)
                     /locus_tag="CAGL0J09548g"
                     /db_xref="GeneID:2889937"
     mRNA            complement(<936524..>940777)
                     /locus_tag="CAGL0J09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448124.1"
                     /db_xref="GeneID:2889937"
     CDS             complement(936524..940777)
                     /locus_tag="CAGL0J09548g"
                     /inference="similar to AA sequence:UniProtKB:P09547"
                     /note="similar to uniprot|P09547 Saccharomyces cerevisiae
                     YPL016w SWI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448124.1"
                     /db_xref="GeneID:2889937"
                     /db_xref="GOA:Q6FNS0"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="UniProtKB/TrEMBL:Q6FNS0"
                     /translation="MDFFNSGAPEGDDNNMDSPFFNNEMNSTQFLFGDLMDTSNSGNQ
                     KMDDSQFYNNKPFNDGDIRTQSNNSNMNMNMNISNTSNNNGNNNSNNMNNFVSNPNTP
                     YTVPGNFVTNQSPMGSVGSNFDAAPPQNSSAMNNFQASGSLSPQAILAKNSMVDNQIL
                     GLNFNGADNSNNNMNANMTNTLSPQMTMSNIQSSANTPQQILMFNQSANTPGSSNNMN
                     LSGSNSTPGAVGANQDNMNMQFGSNMPSNSIMSTHGSPNIPNQMQQNNLPMNQNSGRS
                     SSNNSKISGKDALALQNASPQDRAAILAALQQRQQRRFQALQQQQIRKQQSQQQLQKQ
                     AQQQVQQQVHAQKQAQMQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ
                     AQAQAQAQAQAQAQAKAKAQAQAQAQAQAQAQAQAQAQAKAQAQAQAQAQARFKAQNR
                     QAMQQPNSPNPANGNLQQQKKSILQNLHPALQQKISMELNNKQYELFMKSLIENCKRI
                     HMPLQSIPEIQGKKVNLFYLFMFTQRLGGGEQISRNQQWNFLAQKLQISNAQELEGVY
                     YKLIYPYEKFLESPEGQKETQAKKFFLQQFLQELLKKVQQQQGLQQQQGLQQQPSQQP
                     GQIQNQNQGQTPTQLQQQAIPQKNQMHFSNQSQNMVGSFDTTNSPMINQQTTFDSKQR
                     KENRRKKASTDTPTGTPIATPVPSTSIINLDQNAKKAVKKPRKPRQKKKTKKELELEK
                     KQLEEMQKKQQQYIEEQQLQQKMVIEQKLKDQYKKELEKLPKVYKRSLCRNYTPLKRV
                     IQRSNGYDIEYVAKVGEKVNANKPIFLFAPELGTVNLHALSMSLQAGNIGEINVALNT
                     LLVTSSDAVLELNIEMYPELIESLCILGINLLSNLCENKSDLRLLQTNLFSYVLSDEV
                     ESFLSNDTCTFSKTNHNIDQIFDKLAKNTVESGNSVRVDSLTGTDILQNSSLNDNQDS
                     KDTIPPMTSEISDLLKPIYNNTWDLLPTPVKYLQNQFPNKLHVPSYLLSLRAVKDEVD
                     CPLTKVNTKGAENARILITDQLSTICMILRNASFSEANARILASNPFLRRFFADMLWA
                     VFLDHEKFVFERKRLNFRKDIAITLSNIAHLMPFHSSVDGFLLLILILSFGEPKKNSG
                     SLRSDELSYNEYSLTWGKYQSFGVDVLSKLLSTEQSTKNIIMRLLFSFSSATRDDSLS
                     KDELLTKKLVDAYCKGDQYKLLNDVVSFLLSVIPFEQINETSSLLYSMTPLISQSITS
                     LLLIVDQVCDEKSVNEYTLKKNMPLIWLTTAENYGYKLRSLGKLYNDISGDTNELSKA
                     NGNSVMENMEFKKLAPLIGSSCLKLVNLMIDKALEIDEKVKTNDKDEIASKTLAAVPE
                     LFPGEIESIEIITNQYLHPDILQQTQCLIELKDEILSRA"
     gene            complement(<941571..>943220)
                     /locus_tag="CAGL0J09570g"
                     /db_xref="GeneID:2889938"
     mRNA            complement(<941571..>943220)
                     /locus_tag="CAGL0J09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448125.1"
                     /db_xref="GeneID:2889938"
     CDS             complement(941571..943220)
                     /locus_tag="CAGL0J09570g"
                     /note="some similarities with uniprot|P35056 Saccharomyces
                     cerevisiae YDR244w PAS10 peroxisomal targeting signal
                     receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448125.1"
                     /db_xref="GeneID:2889938"
                     /db_xref="GOA:Q6FNR9"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR024111"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR9"
                     /translation="MDCRGGNSVLQLTRRIDSSLRFGKKLENKVSPRDEASAFLYTNV
                     PNAPNVQPTPLAIPSITLNKAASSSTCSSTSSHAHNNVNYCANNDSGYDLVREFKKIN
                     EPAPPTNNYNFTRHVPVSHRPIGFSPRTMGLQQPLNLDGSFDWEREFAQIEGELGESQ
                     NVLEGTTVSYGGEREHQESVHSTSTVGYHYSSDLEEDCLNIYDYVSSKATSVHSEGNT
                     CSAGPGLARSPSYRNPLTRDAYVFNTENKYLNSSPSAYEIACILMENNCNLSEIILAF
                     EAALQEHEQQHMVDCWYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLLAVSHI
                     NQGNAVEATVCLSRALELKGVTISNWPQELSILNVRETMENVLLDIPSTAINITRDKD
                     ILTVLALFNYLLGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMN
                     TIELKPSFVRARYNLGSTLVKNGELQRGIESLLTALVMQGSPIPPIATNLESFIEHLI
                     FTEAQGKNTIVTSLKNALLKIPDDDIELKTNIENRIRLILS"
     gene            complement(<944110..>945030)
                     /locus_tag="CAGL0J09592g"
                     /db_xref="GeneID:2889939"
     mRNA            complement(<944110..>945030)
                     /locus_tag="CAGL0J09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448126.1"
                     /db_xref="GeneID:2889939"
     CDS             complement(944110..945030)
                     /locus_tag="CAGL0J09592g"
                     /inference="similar to AA sequence:UniProtKB:Q12046"
                     /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
                     YDL209c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448126.1"
                     /db_xref="GeneID:2889939"
                     /db_xref="GOA:Q6FNR8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR012677"
                     /translation="MDSDKGWRQRKARVQLAEVSGELAAAQQTHSVNIWYGKWQSSRH
                     VSVHRLDPERDSGVTRGDSSGTWKFCLYFARGLCALGHKCEYLHHIPEQSDFDRYLVE
                     GTPLLDCFGREKHAENREDMAGVGSFNQQNRTLYVGNIGNAAVMKNGKPLNSRQVESR
                     IRYMFGRLGPMDRVRYLPEKNCAFVRYRHHITAEFAKEAMRDQSLSLSMAQDAALGAQ
                     DSTGLLVKWAREDPDPQSRAHKEEDLVNALLSLLPPQQTQTPSRTTSRTTNKTTNEAT
                     SKVRKLHRKVYRTTTAAMSHKNILTSYDSD"
     gene            <945660..>946055
                     /locus_tag="CAGL0J09614g"
                     /db_xref="GeneID:2889715"
     mRNA            <945660..>946055
                     /locus_tag="CAGL0J09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448127.1"
                     /db_xref="GeneID:2889715"
     CDS             945660..946055
                     /locus_tag="CAGL0J09614g"
                     /note="highly similar to uniprot|P32495 Saccharomyces
                     cerevisiae YDL208w NHP2 nucleolar rRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448127.1"
                     /db_xref="GeneID:2889715"
                     /db_xref="GOA:Q6FNR7"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR7"
                     /translation="MPAVLPFAKPLASKKLNKKVLKTVKKASRAKNVKRGVKEVVKAL
                     RKGEKGLVVIAGDISPADVISHIPVLCEDHGVPYLFVPSKQDLGSASATKRPTSVIFI
                     VPGSNKKDKSKEEEYKESYNEVVKEVKAL"
     gene            <946436..>948028
                     /locus_tag="CAGL0J09636g"
                     /db_xref="GeneID:2889716"
     mRNA            <946436..>948028
                     /locus_tag="CAGL0J09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448128.1"
                     /db_xref="GeneID:2889716"
     CDS             946436..948028
                     /locus_tag="CAGL0J09636g"
                     /inference="similar to AA sequence:UniProtKB:Q12315"
                     /note="similar to uniprot|Q12315 Saccharomyces cerevisiae
                     YDL207w GLE1 RNA export mediator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448128.1"
                     /db_xref="GeneID:2889716"
                     /db_xref="GOA:Q6FNR6"
                     /db_xref="InterPro:IPR012476"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR6"
                     /translation="MRFVLDELYSDEESSLDLGVGSDSDSSNDPDYSNIADPHDLYSP
                     KLRIPKKKDVPTKTRTAKEEEVTLLPEIARILEGKQFKSSVIAANTVPSVIHLSREEE
                     QNTESLIDKRKDNKLAHSLAPDVNIEQMEAQFSKVMLGKLDSLETLNRKRIEEVRAEK
                     KRIEEEQKRKLEEEKRRKELEDKRLKEEEERAKKEQEKQEKERLAALEAEKKREQEEK
                     AKKQAQAQEKDKAQKAVTDFDSISKTFWKYKAKIKSIKEEIVIPVKNADKELRNILSK
                     HKRKINPKFGQLTNTFSQLQSIQNELSHLIDETKGQQLAYLWILNFIAKAIVHQAETE
                     VRAKPESSVPLARLALYIMVRYPEFKELLLARFVKKCPFVMGFTCDIGTEDGRGNMGW
                     KRDSSGKWEEPTSYNERIGAMVTLFSVITRLELPQEFIQTSNHPLPISHSWHLVARIA
                     NTPLKLIQDTHFVVLGSWWDAAAKEFLQAYGVQAAKLLQLVGDNLTSAVADRKYVGAA
                     RLRILLESWQENKLESFPEMVP"
     gene            <948675..>950921
                     /locus_tag="CAGL0J09658g"
                     /db_xref="GeneID:2889717"
     mRNA            <948675..>950921
                     /locus_tag="CAGL0J09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448129.1"
                     /db_xref="GeneID:2889717"
     CDS             948675..950921
                     /locus_tag="CAGL0J09658g"
                     /inference="similar to AA sequence:UniProtKB:Q12424"
                     /note="similar to uniprot|Q12424 Saccharomyces cerevisiae
                     YDL206w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448129.1"
                     /db_xref="GeneID:2889717"
                     /db_xref="GOA:Q6FNR5"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR5"
                     /translation="MAVIPRLLAVCLFYSINLIAVIRYFDYDDRSGFGFYSKLILLTE
                     CFMMLGILTSDYLIPSLSFISRDILKISDRVSGMTLLALGNAIPDITTTYQSMKRNET
                     SLALGELIGGVFFLLTVILGVVGIVSTVKFEPSTSPFADYPESCETYRESMQSHSYSR
                     EIFLQDMKIFLTMIVVSTLFLYDGRLFVWECLIMVVTYVACAAYMVSSHLNYGLENNS
                     AVLNGDDHSSLRDIIYDNLSTITEENENSSLLGDNDHIVSPLTNENVNIRLFEAGIAE
                     RRKYIRRGIQRYMRTHYTGWVRMTLNDCLDLWEHSDMLKSQENLGKQDQDDIVDRTRE
                     IGSNEMDQTEISDTLSELPLPEQLPISKRIKRRSTSLTSNLERLEIPKIVYSDFSQGL
                     VSDRFEQTATPAPVPIFSTPQPLHAPVFDGRPPTYRSLSYDHLGDIIQERNYRSVSDN
                     RSELGEDLENMISRVSGTGREKKWYTASKLITYLIDAEVTLPISELITLLFSFPITLL
                     LAILIPNDVFRSAVGDNSFITALQLSIAPMVFSFTLDNMFNIYWLSLVSIILLFSLLI
                     FEAPLKDYQKHITSCFAFVLSLGGISFTVHLILDVLTSWADSFNLSPSVLGLTIFAWG
                     NSIGDLVSNITFVQLGVIDVALGACFGSPLLYILFGIGIDGILVMLNKHGFRMPEKWY
                     SLLFNCIQFKIDAHLISSSIGIIVAFFILIVGVPVNKWRLDFKVSILLLGLYVAVTVI
                     NIIFALKS"
     gene            complement(<952083..>953072)
                     /locus_tag="CAGL0J09680g"
                     /db_xref="GeneID:2889718"
     mRNA            complement(<952083..>953072)
                     /locus_tag="CAGL0J09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448130.1"
                     /db_xref="GeneID:2889718"
     CDS             complement(952083..953072)
                     /locus_tag="CAGL0J09680g"
                     /note="highly similar to uniprot|P28789 Saccharomyces
                     cerevisiae YDL205c HEM3 porphobilinogen deaminase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448130.1"
                     /db_xref="GeneID:2889718"
                     /db_xref="GOA:Q6FNR4"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /translation="MTRESINIGGRRSKLAVVQSNHVRDLVQAKFPQYDCTVFTLQTL
                     GDQIQFKPLYSFGGKALWTKELEDYLYCEDQEKRLDLIVHSLKDMPTLLPDGFELGCV
                     TKRVDPTDCIVMPRGSPHRCLADLPEGAVVGTSSVRRSAQLKRKFPHLKYQSVRGNIH
                     TRLEKLDDPEGPFQCLVLASAGLVRMGLEDRITQRLHSDIMYHAVGQGALGIEIRQGD
                     KKILQILDEIADLESTVCCLAERSLMRTLEGGCSVPIGVESSYDHKTKKLLLKGIVVN
                     VEGTMAIEDQQEVVVNDIREDSIKCGVLLAHKMIKDGAKKILDEINLERVIQQ"
     gene            complement(<953621..>955708)
                     /locus_tag="CAGL0J09702g"
                     /db_xref="GeneID:2889719"
     mRNA            complement(<953621..>955708)
                     /locus_tag="CAGL0J09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448131.1"
                     /db_xref="GeneID:2889719"
     CDS             complement(953621..955708)
                     /locus_tag="CAGL0J09702g"
                     /inference="similar to AA sequence:UniProtKB:Q07622"
                     /note="similar to uniprot|Q07622 Saccharomyces cerevisiae
                     YDL203c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448131.1"
                     /db_xref="GeneID:2889719"
                     /db_xref="GOA:Q6FNR3"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR3"
                     /translation="MFNARDTQSGNRYETHINMYPVADSGVRDGTVSGAGASASASAK
                     TPYPIEDTAIGTLNRIPVFTKASMSPSPSPDELADESHGAGDKRYELPFMLSTGSTGS
                     LGGSASGGVMGGVIGGVSGSNAGTQPGVPRGDDAAGAEPVRREAHAKAANPFRQMIDY
                     QDVETPPPPYVEKERKERDVLREKMYRTESRSPRKDTAGARPAEPDTGASVQPELAQP
                     ELVKPELVKQRSESSTTTTGSSSSSKSKRDLTVFSREAVEFYEVYCSVVADQGNFTPS
                     VQLKWCETLLEYVFKPDFISHYNINAERLKRALKPEEAQKNQKVILEHAFKVLKKLIS
                     SRYAPAIYLMGTLYSHQPYLDIKNKTIVTRNDEKALEFYCKAAALSHPESCYRAAVCY
                     EFRRGCDAALSHYECLQRAFQYYTQGAEQSTSCMYKLGMTHLYGLTSMNYAHEEDPRE
                     LERIVRQDVPQALMWLSKATEQGSPQACYELGKIYEFTNMPLPIQQVLAESGIQRDTA
                     KALAYYTRCAREYDYPLAQWKLGHCYETGDLDVAVDPHKSIAWYYRSASDSSTLTTTG
                     STTGSTTTSEGKTRRGNPMAMLALSGWCLTGSPGVLRSNDGEALRWAQRSSETAQGKL
                     PRGVRARVLLRARHRHPWRHPGHPAGHRPLPPRAAVPQGRPGPPPPGPVESPHPPPPH
                     THTYIPSQSHTHY"
     gene            <956118..>956774
                     /locus_tag="CAGL0J09724g"
                     /db_xref="GeneID:2889720"
     mRNA            <956118..>956774
                     /locus_tag="CAGL0J09724g"
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /transcript_id="XM_448132.1"
                     /db_xref="GeneID:2889720"
     CDS             956118..956774
                     /locus_tag="CAGL0J09724g"
                     /inference="similar to AA sequence:UniProtKB:P36521"
                     /note="similar to uniprot|P36521 Saccharomyces cerevisiae
                     YDL202w MRPL11"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /protein_id="XP_448132.1"
                     /db_xref="GeneID:2889720"
                     /db_xref="GOA:Q6FNR2"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:Q6FNR2"
                     /translation="MNSVGLVWQCVRRYSRVAVESGLKRQTWKPIDSRKTFLLDSYRY
                     MMDNNSMVLFAHYNNLTKNEDHHFREQIKQAGGKLTRIRNNIFKVCLRTLDREDPAVY
                     IKNKKELPHHPLIPLLKGPTAVISFQDTDPQGVAKVFKLLKNAQDKLLVMGAKVDKEV
                     YDFAKLDQFKTLPTKEVLQGQLAGLLQMLGGAGLVQVLEANKQHLYLTLKSHEDNIKE
                     "
     gene            <957247..>958104
                     /locus_tag="CAGL0J09746g"
                     /db_xref="GeneID:2889721"
     mRNA            <957247..>958104
                     /locus_tag="CAGL0J09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448133.1"
                     /db_xref="GeneID:2889721"
     CDS             957247..958104
                     /locus_tag="CAGL0J09746g"
                     /note="highly similar to uniprot|Q12009 Saccharomyces
                     cerevisiae YDL201w TRM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448133.1"
                     /db_xref="GeneID:2889721"
                     /db_xref="GOA:Q6FNR1"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /translation="MKAKPLSNDPGSKRYAYRVNKEENRKELKHVKIDESSLVEGHQV
                     DLPKKRFYRQRAHSNPFSDHQLEYPGSPEEMDWTKLYPHYVDPESGKMTKKVTIADIG
                     CGFGGLLVDLSPEFPDDLILGMEIRVQVTNYVEDRIIALRTNHVKEQGYQNINVLRGN
                     AMKFLPNFFQKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGIVYTIT
                     DVKDLHDWMVKHLTEHPLFERLPEEWEEEDSCVRIMRHATEEGKKVERKKGDKFVACF
                     RRLPTPEII"
     gene            complement(<958467..>959090)
                     /locus_tag="CAGL0J09768g"
                     /db_xref="GeneID:2889722"
     mRNA            complement(<958467..>959090)
                     /locus_tag="CAGL0J09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448134.1"
                     /db_xref="GeneID:2889722"
     CDS             complement(958467..959090)
                     /locus_tag="CAGL0J09768g"
                     /inference="similar to AA sequence:UniProtKB:P26188"
                     /note="similar to uniprot|P26188 Saccharomyces cerevisiae
                     YDL200c MGT1 O6-methylguanine DNA repair
                     methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448134.1"
                     /db_xref="GeneID:2889722"
                     /db_xref="GOA:Q6FNR0"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /translation="MEDLLYSFVVTDITSALVFVRRQTDALVYASLGLNKKQLLKGAR
                     TAFNQLSKKSAIHYNFKQIEVESEQEHVEKFQDTVNKFTKLLEGHIVKDLHYEYMFGT
                     SLQHRIWDELVKIPHGKVTTYKEIADKLKIKNGSRAIGSGIGSNNIAIVIPCHRVVCS
                     NGTLSGYKWSTSLKRKLLEREHVYASNKKDALNKDTKISLMKYKYSA"
     gene            complement(<959883..>960785)
                     /locus_tag="CAGL0J09790g"
                     /db_xref="GeneID:2889420"
     mRNA            complement(<959883..>960785)
                     /locus_tag="CAGL0J09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448135.1"
                     /db_xref="GeneID:2889420"
     CDS             complement(959883..960785)
                     /locus_tag="CAGL0J09790g"
                     /note="highly similar to uniprot|P38988 Saccharomyces
                     cerevisiae YDL198c YHM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448135.1"
                     /db_xref="GeneID:2889420"
                     /db_xref="GOA:Q6FNQ9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ9"
                     /translation="MAHNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTK
                     ITSGAQLNSVIFRDHAAEAFGKRVFTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNK
                     HFKKDFDSAFGDKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPEAFKGRGFLK
                     ILKDEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSI
                     VGASASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTT
                     GPKLVFSFALAQSLIPMFDNMLKK"
     gene            <961496..>962971
                     /locus_tag="CAGL0J09812g"
                     /db_xref="GeneID:2889421"
     mRNA            <961496..>962971
                     /locus_tag="CAGL0J09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448136.1"
                     /db_xref="GeneID:2889421"
     CDS             961496..962971
                     /locus_tag="CAGL0J09812g"
                     /note="highly similar to uniprot|Q00764 Saccharomyces
                     cerevisiae YBR126c TPS1 alpha alpha-trehalose-phosphate
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448136.1"
                     /db_xref="GeneID:2889421"
                     /db_xref="GOA:Q6FNQ8"
                     /db_xref="InterPro:IPR001830"
                     /db_xref="InterPro:IPR012766"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ8"
                     /translation="MTQIDKKEVSGNIIVVSNRLPVTISKDDTGKYQYKMSSGGLVTA
                     LQGLKKTATFKWYGWPGLEIPDDEKEQVKQDLLEQFNAVPVFLSDEVADLHYNGFSNS
                     ILWPLFHYHPGEINFDENAWLAYNEANRAFAEVIFETMQDDDLIWVHDYHLMLLPQML
                     QEEITKRKLRNVKLGWFLHTPFPSSEIYRILPVRQEILRGVLSCDLLGFHTYDYARHF
                     LSSVQRVLNVNTLPNGVEYQGRFVNVGAFPIGIDVSTFQDGLLKQQVKDRISQLKETF
                     KGQKIIIGVDRLDYIKGVPQKLHAMEVFLSEHPEWRGKVVLVQVAVPSRGDVEEYQYL
                     RSVVNELVGRINGQFGTAEFVPIHFMHKSVPFEELISLYAVSDVCLVSSTRDGMNLVS
                     YEYIACQEETKGSLILSEFAGAAQSLNGAIIVNPWNIDEMSDAINEALTLPEVKREVN
                     WEKLFKYISKYTSAFWGENFVHELYNTSSSSGSIKSSEEKH"
     gene            <963886..>965109
                     /locus_tag="CAGL0J09834g"
                     /db_xref="GeneID:2889422"
     mRNA            <963886..>965109
                     /locus_tag="CAGL0J09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448137.1"
                     /db_xref="GeneID:2889422"
     CDS             963886..965109
                     /locus_tag="CAGL0J09834g"
                     /note="highly similar to uniprot|P38089 Saccharomyces
                     cerevisiae YBR125c PTC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448137.1"
                     /db_xref="GeneID:2889422"
                     /db_xref="GOA:Q6FNQ7"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ7"
                     /translation="MGQLLSHPLTEKTIEYNDYKTKSSAAGSVPRFYNCVGSMQGYRL
                     SQEDAHKVQNEDTILRVRFFNPFTGKHEKMMISMFAVFDGHGGDSCSKFLSGTSNPHL
                     RAGLAKWVVYSFENHRYGAKKNISSVDNGGANNYTNTPNNSINGSNADNSTSYTRHFR
                     TMEGLISQIIKDAYIKQDQELHQHFANSACGSTAVVALIINGTMLYVANCGDSRCILS
                     SKARGIKTMSYDHKPQNIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVVYK
                     NTNPMRISANGNHNSPTPPQEAQVSVEPDVLMHKLDFNKDEFLVLACDGIWDIYNNTR
                     LIQFIKYHLMQGMKLDGIMTKLLDHGIAQANSSTGVGFDNMTAIVVVLNRPDESLHDW
                     MNKMKLRLEREKGII"
     gene            complement(<965386..>965919)
                     /locus_tag="CAGL0J09856g"
                     /db_xref="GeneID:2889423"
     mRNA            complement(<965386..>965919)
                     /locus_tag="CAGL0J09856g"
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /transcript_id="XM_448138.1"
                     /db_xref="GeneID:2889423"
     CDS             complement(965386..965919)
                     /locus_tag="CAGL0J09856g"
                     /note="highly similar to uniprot|P36531 Saccharomyces
                     cerevisiae YBR122c MRPL36"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL36"
                     /protein_id="XP_448138.1"
                     /db_xref="GeneID:2889423"
                     /db_xref="GOA:Q6FNQ6"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ6"
                     /translation="MLRNLIWKRLASTGGHPNATKISLPRRPLKKIRPGKARPAIYHQ
                     FNVKVELSDGSVISRRSQFPKDEFRLISDQRNNPLWNPSRDDLVVIDVNSGGSKDKFK
                     QKYSSIFSVDDAVDTKAEEKEVKSSKETKTEDKKEVKKDVEEDAFGVDDYLSLLDDSS
                     KQIKTGKLAQKKKKDKK"
     gene            complement(<966181..>968085)
                     /locus_tag="CAGL0J09878g"
                     /db_xref="GeneID:2889424"
     mRNA            complement(<966181..>968085)
                     /locus_tag="CAGL0J09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448139.1"
                     /db_xref="GeneID:2889424"
     CDS             complement(966181..968085)
                     /locus_tag="CAGL0J09878g"
                     /inference="similar to AA sequence:UniProtKB:P32367"
                     /note="similar to uniprot|P32367 Saccharomyces cerevisiae
                     YBR123c TFC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448139.1"
                     /db_xref="GeneID:2889424"
                     /db_xref="InterPro:IPR019136"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ5"
                     /translation="MESNDTPAMEDVSQAVSSKYARYHTLDLPRISSVEFPLAISTKK
                     HSIVRAIEMCGGIEDVKQALDNSTEPSVTDKGLELFLNNGLSPVDPWDDATSSARKPF
                     FNEHPIIGKRVPFRDDSIVLKITMPEGTLEKNGNDVAKALRSLDSKDVCATPVAVVNN
                     TIKFREMSDFQVILDNVPAAREFQKSFGSLDWQNIKKFIDSVPDNDSRPQDNINNIIL
                     DRSVKSPNCDFQLPPPPRFSMVGYPLQYKYKGNPFAVKKENGDHEVKGSYLKNYQLFV
                     HDMSPELKVPVEPQDKLLEIYNQAKQSGVYPGTKKESKFFEALEECLAILRSLFEKRP
                     IWVKRHLDGLIPKNVYHTLKIALALLSYRFTMGPWRNTYIKFGVDPRSSSEYAKYQTE
                     YFKIERKLLESATVRKNIPKPPPLVFESDTKDGIDSRFRFDGTRIPWYLMLQIDLLLD
                     EPNIAEVYEKVEYLDKPNEVTGWFTALDLAKIRRIVKYELGCMVQGRYEFNKYKLKYF
                     KSMLFFKESMMNNNGENTDVDGDTNMDRDKNPDDITQDDDEENNGVEAGEDEETLQEK
                     EDAESDNMKVSVMKDISDDEQDEPEDDFDVNNATFQDIIGKIRRLDPELADKYSRDLS
                     GLVNIAKLYD"
     gene            <969083..>969934
                     /locus_tag="CAGL0J09900g"
                     /db_xref="GeneID:2889425"
     mRNA            <969083..>969934
                     /locus_tag="CAGL0J09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448140.1"
                     /db_xref="GeneID:2889425"
     CDS             969083..969934
                     /locus_tag="CAGL0J09900g"
                     /note="highly similar to uniprot|P04840 Saccharomyces
                     cerevisiae YNL055c POR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448140.1"
                     /db_xref="GeneID:2889425"
                     /db_xref="GOA:Q6FNQ4"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ4"
                     /translation="MAPPFFSDIFKSVNDLLNKDFYHSTPAAVDLESVAKNGVKFNVK
                     SKQLVKEGPLAATVDAKFTDKATGLTLTQGWSNANNLNTKIELNNITPGLKTELMTSF
                     VPNISKVANLNLSFVQPFFTARGAFDLLKGPGFVGDMTLAHESGVVAGAQFGYDIAAG
                     SLSKYAIALGYAAQDYHLGLNINNDQVTTATFFQNVSPQLQIGSRATLNPRQTVSNVN
                     IEFATKYLPDPNSQVKAKISDAGIVALSYKQALRPGVTLGVGTSFDALKLSEPVHKIG
                     WSLSFVI"
     gene            <973259..>974542
                     /locus_tag="CAGL0J09922g"
                     /db_xref="GeneID:2889426"
     mRNA            <973259..>974542
                     /locus_tag="CAGL0J09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448141.1"
                     /db_xref="GeneID:2889426"
     CDS             973259..974542
                     /locus_tag="CAGL0J09922g"
                     /inference="similar to AA sequence:UniProtKB:P53616"
                     /note="similar to uniprot|P53616 Saccharomyces cerevisiae
                     YNL066w SUN4 or uniprot|P40472 Saccharomyces cerevisiae
                     YIL123w SIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448141.1"
                     /db_xref="GeneID:2889426"
                     /db_xref="GOA:Q6FNQ3"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ3"
                     /translation="MKFLTTAATLTAASILGSTALAAAMPDLKDCTTTAQGNHQHKRA
                     VAVEYVYETVIVDDQGHTLNVPPVKNDAASPTQAPKQSTQTPAAAPSTSTLAPASSSS
                     PSPAKKADSTTSTLAPSSSSSPSPSPSSSSSSSSSSQQSKPSSSTSSSSSYSGGIYGD
                     LAAFSGPSEKFQDGVIPCSQFPAGQGVIPISWLGENGWSGVENSDTSTGGDCKEGSYC
                     SYACQPGMSKTQWPSSQPADGRSIGGLLCKNGYLYRSNTNADYLCEWGVNSAEVESKL
                     SQGVAICRTDYPGTENMVIPTFVQAGATLPLTVVNQDTYYQWQGMKTSAQYYVNNAGI
                     SVEDGCVWGNAGSGLGNWAPLNFGAGYTNGITYLSLIPNPNNKAPLNYNVKIVAADDS
                     SVVNGECSYENGVYSGGADGCTVAVRSGKAKFVLY"
     gene            <976274..>978052
                     /locus_tag="CAGL0J09944g"
                     /db_xref="GeneID:2889427"
     mRNA            <976274..>978052
                     /locus_tag="CAGL0J09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448142.1"
                     /db_xref="GeneID:2889427"
     CDS             976274..978052
                     /locus_tag="CAGL0J09944g"
                     /inference="similar to AA sequence:UniProtKB:P53943"
                     /note="similar to uniprot|P53943 Saccharomyces cerevisiae
                     YNL065w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448142.1"
                     /db_xref="GeneID:2889427"
                     /db_xref="GOA:Q6FNQ2"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ2"
                     /translation="MVESGPHSINDDLSTNEYIEQPKFYHDDHASDSNSLSDIDDDNK
                     KHGGLYGTVSRTTTRELPEDLESEISSTHSQDAKEDLEIQHNAAPYSLLNYRDKWCMV
                     ALLTACGFWSSLGSPIYYPALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLAD
                     KFGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTV
                     KSERGTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLP
                     ETKRSIVGNLSIRPKNPLNIAPVTLLPAARRKLKYDNPDYETLDKTKPVFDLTSAFKI
                     CALPEIFLSLLPPGLAFAMWTLMLSAISSELSAAPYNYKLTIIGVCYLPAGIGGLIGS
                     FATGKIIDFQYKKKLKVFEEKKAAGIIPEDEKFNIMGARLQSVLPQNFLCVVTYILFG
                     WSCDKGWKIPSILITSCVSSFCAMSTLSAMSTLLVDLYPGKSSTASSCFNFMRCSLSA
                     ILMGCFAKMKHSLTVGGTFTLLAGLVFVGNFLMFIPMKHGMRWREEREQRAALKAKSM
                     DQANENGYKLFSKIKFSSPFKSEEKV"
     gene            complement(<978692..>979915)
                     /locus_tag="CAGL0J09966g"
                     /db_xref="GeneID:2889428"
     mRNA            complement(<978692..>979915)
                     /locus_tag="CAGL0J09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448143.1"
                     /db_xref="GeneID:2889428"
     CDS             complement(978692..979915)
                     /locus_tag="CAGL0J09966g"
                     /note="highly similar to uniprot|P25491 Saccharomyces
                     cerevisiae YNL064c YDJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448143.1"
                     /db_xref="GeneID:2889428"
                     /db_xref="GOA:Q6FNQ1"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ1"
                     /translation="MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAA
                     EKFKEVSSAYEILSDSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATG
                     GRPRGPQRGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKKCSSC
                     NGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDAKDRCKSCNGKKVDNERKILEVRI
                     EPGMKDGQKIVFKGEADQAPDVIPGDVVFVISEKPHKHFQRAGDDLIYEAEIDLLTAL
                     AGGQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFP
                     ENHFTSEENLKKLEEILPPRRQINIPAKAQVDDCVLSEFDPSKFGQSNGRSGANYDSD
                     DEDAHGGEGVQCASQ"
     gene            <980400..>981422
                     /locus_tag="CAGL0J09988g"
                     /db_xref="GeneID:2889429"
     mRNA            <980400..>981422
                     /locus_tag="CAGL0J09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448144.1"
                     /db_xref="GeneID:2889429"
     CDS             980400..981422
                     /locus_tag="CAGL0J09988g"
                     /note="weakly similar to uniprot|P53944 Saccharomyces
                     cerevisiae YNL063w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448144.1"
                     /db_xref="GeneID:2889429"
                     /db_xref="GOA:Q6FNQ0"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FNQ0"
                     /translation="MRIRPCDMRAAWGRHRWLPLLLPQCRSVDQALVEFGWMQGLAPD
                     NIVQGNAVQGNAVQGNIVQGNAVPGNTAARRLLRGCAARFRGVPLQYVLGSQPFGAAE
                     LVCRPGVLIPRWETEEWALKLARAIARYSSQQPLAQPLKLTLVDLCTGTGCVPIGIHD
                     ELARAPSLIKYTAVDVSPQAIDLCRLNVGRRAIEVKQVDVLRQDSPADIVGGLGPGRG
                     LGLGRGPAIDILLCNPPYIPRKAFTRTTARSVRLYEPRLALIADKEFYKNLVDVWSQH
                     TNSFVYEIGDSSQYEYVKQALDPSVWSVGLHIDSNGCPRAVYGYRNSIPSIAYIFEEF
                     KQPRYV"
     gene            complement(<981617..>983038)
                     /locus_tag="CAGL0J10010g"
                     /db_xref="GeneID:2889430"
     mRNA            complement(<981617..>983038)
                     /locus_tag="CAGL0J10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448145.1"
                     /db_xref="GeneID:2889430"
     CDS             complement(981617..983038)
                     /locus_tag="CAGL0J10010g"
                     /inference="similar to AA sequence:UniProtKB:P41814"
                     /note="similar to uniprot|P41814 Saccharomyces cerevisiae
                     YNL062c GCD10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448145.1"
                     /db_xref="GeneID:2889430"
                     /db_xref="GOA:Q6FNP9"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /translation="MDPLKSIVQDQHVILTLPSGNSKIVELKPDSSVSLGKFGAFQVN
                     DILGWPLGTTFEIYYDNVEEIVENKKKKPKSNELNKVPVGKVRLYKEVATDDKAEEEV
                     EEMDSSAVIPVELQNVLSSATNQGLINIGNDVQKLTMHDVERFKQQSASANEIITKMI
                     ESHGSFHQKTIYSQEKYLKRKKQKFAKFFTVDYLSSSMLLKFLVEKGDIQRVLDLSEE
                     SLGMILNLTNIRSDGTYLCMDETGGLIVYTMLERMFGGKEDLDAPGKIVVINENEHPN
                     LDLLKFSNYSEKFIEKHVVTLSILDYFRPPTMEEVEGRFTPLSKEEVNKLKSGKRSAY
                     SRKLKWYYTQLRVIEMATKQQYDGLVVASTLHLPSLVPRLAERVHGARPIVCFSQFKE
                     TLLELAHTLYSDLRYLAPTILETRCRPYQTARGKLHPLMTMRGGGGYLLWCHRVIPAP
                     EPEIEEPTDVNADEQEEKKQKME"
     gene            <983405..>985264
                     /locus_tag="CAGL0J10032g"
                     /db_xref="GeneID:2889431"
     mRNA            <983405..>985264
                     /locus_tag="CAGL0J10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448146.1"
                     /db_xref="GeneID:2889431"
     CDS             983405..985264
                     /locus_tag="CAGL0J10032g"
                     /note="highly similar to uniprot|P40991 Saccharomyces
                     cerevisiae YNL061w NOP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448146.1"
                     /db_xref="GeneID:2889431"
                     /db_xref="GOA:Q6FNP8"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP8"
                     /translation="MGKGRSKFKQAAPPSLDEFLAKKEKKQNKLNKKSKRTHEDKDDG
                     KKSKKQKKSKSKRAETEETEEEPADLPEVDYEELSKAKKSLFDDEEDAGADSNDEEEL
                     DDDELKDEFDLEQEYDYDEDEEAEAKPMFSDDEEDEEELERLNANNMEFLSKRLDEEE
                     AEEAEEAELELTEAHKQNPRADVLPSKEEEELMAQNPPDLTSIRTRIIEIVKVLEDFK
                     TLGAEGRSRSEYTDRLLKDICEYFGYTPFLAEKLFNLFSPAEALEFFEANEIARPITI
                     RTNTLKTSRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQA
                     ASSFLPVVALDPQENERVLDMASAPGGKTTYISALMKNTGCVFANDANKKRTKSLIAN
                     IHRLGCTNTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKDFIQ
                     IPHLQKQLLLSAIDSVDANSKKGGVIVYSTCSVAVEEDEAVVDYALRKRPNVKLVDTG
                     LQIGKEGFVSFRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKIGPSPHDDNQATAKE
                     KEAAARLEAIEEGIIKEDFAEFEDEEDKEYIEKSKSKLLKKRGVNPKAKLEKK"
     gene            complement(<985402..>987666)
                     /locus_tag="CAGL0J10054g"
                     /db_xref="GeneID:2889407"
     mRNA            complement(<985402..>987666)
                     /locus_tag="CAGL0J10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448147.1"
                     /db_xref="GeneID:2889407"
     CDS             complement(985402..987666)
                     /locus_tag="CAGL0J10054g"
                     /note="highly similar to uniprot|P53946 Saccharomyces
                     cerevisiae YNL059c ARP5 Actin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448147.1"
                     /db_xref="GeneID:2889407"
                     /db_xref="GOA:Q6FNP7"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP7"
                     /translation="MSREVSRDASLTPLRVDIIEDPPLRNSYEHFIDSATYDPNIPIA
                     IDFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARSP
                     FDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRSNWYQTLFES
                     FGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDAKRINWGG
                     HSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETDIEGYLTLGNLENKN
                     VVVEAPFVEVQAPQKSEEELRIQAEKRKESGKRLQEQARIKRKERLVQKREEYEYFSK
                     VKEQLEGEPKKKVLAVLQSAGFDDERDFKKYLYNVQRSIKKAEALELSEAVDEAEEEE
                     NMEGKFDLVDIPDEQLNEEQKQEKKVQKLLKANYDARQKAKEEKERILKEVEEQKKKD
                     EEWRSTDFNGWLKDKRNRLHDLMQKRKEKLKLKEDMKDRKSQVAQNRMKNLANLAEDN
                     ARGTKRTRQQATIDNDPNDTFGANDEDWMVYNDITQNPEALDEAIEDEYKEIVDLEGI
                     LLEYDPNFTEEDTLDAQYDWRNSVFHLFLRGPRPHDSENIHEQHQMHINVERIRVPEV
                     MFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKS
                     RVVKEFTEFLPSDTKINVNISEAPTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVD
                     YLKEHKLSNVPYFE"
     gene            complement(<988050..>989186)
                     /locus_tag="CAGL0J10076g"
                     /db_xref="GeneID:2889408"
     mRNA            complement(<988050..>989186)
                     /locus_tag="CAGL0J10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448148.1"
                     /db_xref="GeneID:2889408"
     CDS             complement(988050..989186)
                     /locus_tag="CAGL0J10076g"
                     /note="weakly similar to uniprot|P53947 Saccharomyces
                     cerevisiae YNL058c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448148.1"
                     /db_xref="GeneID:2889408"
                     /db_xref="GOA:Q6FNP6"
                     /translation="MLRRKRAFTDESLMLMERGLPRLVTTSTTPTPTTEPTTEPTTTK
                     DETSQTSATDASTATTSTAATSTAATSSTSTDITATSLTITSSSLSTDVANIVPPSAE
                     NNPYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDYLESMATQYP
                     YGSRGGHAHHSSIFSTASSDVYSYGGDDEKLSLGHSRSQSVDKKTHEKVKKSKIGLFG
                     GSTNDIFKTPTRNDSWESLSDAITNYGDGSVHRFNPIQDDIQYNNRRSLFISPTVEVM
                     NLPRQEVPDIFATPKKQQTSIYNDYDTPLIPDLSKPEDVALSPQRSHRKTPSNDKYHR
                     RNRSSANLSPSRSPTRTPIRTRNMARDHRKTPSMYLEDLLDDNY"
     gene            <989719..>990279
                     /locus_tag="CAGL0J10098g"
                     /db_xref="GeneID:2889409"
     mRNA            <989719..>990279
                     /locus_tag="CAGL0J10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448149.1"
                     /db_xref="GeneID:2889409"
     CDS             989719..990279
                     /locus_tag="CAGL0J10098g"
                     /inference="similar to AA sequence:UniProtKB:P53949"
                     /note="similar to uniprot|P53949 Saccharomyces cerevisiae
                     YNL056w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448149.1"
                     /db_xref="GeneID:2889409"
                     /db_xref="GOA:Q6FNP5"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP5"
                     /translation="MSGGRAKYIPPLNFAPIVSTDVSLYRSGYPMPLNYSFIRGQLHL
                     KTIIYVGDKSEPMPEYAEFLERERINYHHIHMDSCRDPDIDAQMDRVLQLVLRADNYP
                     ILIHSNKGKHRVGVVVGIIRKLLQGWSIAGIYQEYGLFSGGLKDEADLEYITMFETDI
                     LMDPRTVPRFALRRHHPTVIQQETTP"
     gene            <990695..>993127
                     /locus_tag="CAGL0J10120g"
                     /db_xref="GeneID:2889410"
     mRNA            <990695..>993127
                     /locus_tag="CAGL0J10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448150.1"
                     /db_xref="GeneID:2889410"
     CDS             990695..993127
                     /locus_tag="CAGL0J10120g"
                     /inference="similar to AA sequence:UniProtKB:P41813"
                     /note="similar to uniprot|P41813 Saccharomyces cerevisiae
                     YNL068c FKH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448150.1"
                     /db_xref="GeneID:2889410"
                     /db_xref="GOA:Q6FNP4"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP4"
                     /translation="MEARSQHQQGLTNAVISALAVPEQSTTVSKQYSNERNVATEVQA
                     YAKISGRDWTYYVKNLEVSIGRNTDPSSKDGERDSGIDIDLGPAKVVSRRHATIKFNM
                     EYGGWELKILGRNGGKVNFHRVEAGANAPSIKLSSGTILDIGGTQMIFILPDQEPFIP
                     QECLENLMPTLVSIYGVDGSNIANDNPLLREVIRESNYVKTHRELSRQPPGINQQVRT
                     FKMYGSGSSFHLGDSTPNFYGTAATPIPGMATSGIAANNKQPNSSYQNVNNAGPNGAG
                     IGQNMNTISDFPQSLDFASDLSRDENRNIKPPYSYATMITQAILSTGEGVISLADIYK
                     YISSNYSYYRYAKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISKDYQEEFLQ
                     KWNSGNGNKIRRGSSVSRQLQLHMSKFNRLPTQNDYSNDVASEDKKVTKKHSKKSSTS
                     SGGTMSTVNSGQNSLSSIESHPDVNFDKYGIMGSSRNSMQLLPPTLPEQPTNTMQPPI
                     RETLEPITSYSVARKNPTNNALVSFTNASSSYLKPTTSSNSAPSLPSISTKGIQNLPL
                     PTTAGSASNLLQQNPHLSPSYDSLLRSPTKSFHVTAMEAYTPERGSAQTNFSPSNSRG
                     ENNPTGVGLPSVSLPNGHTFSDDMRKTELMPSIQDPNPGGLRSTNMSDRLTPANFGSA
                     KSSQYRNSPGGWNSLLFSSVNNTPKFSLDSDTKNGNQTPKDLNGSASVKSSISEGRPD
                     VGNPSATTSNGNDLTVSVPDLDSKDINSSPLKRHLENRRDTEGNIPEDPSRKTDRNML
                     LDTDSAKITIVK"
     gene            <994957..>996150
                     /locus_tag="CAGL0J10164g"
                     /db_xref="GeneID:2889412"
     mRNA            join(<994957..994990,995582..>996150)
                     /locus_tag="CAGL0J10164g"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_448152.1"
                     /db_xref="GeneID:2889412"
     CDS             join(994957..994990,995582..996150)
                     /locus_tag="CAGL0J10164g"
                     /note="highly similar to uniprot|P26785 Saccharomyces
                     cerevisiae YNL069c RP23 or uniprot|P26784 Saccharomyces
                     cerevisiae YIL133c RP22"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_448152.1"
                     /db_xref="GeneID:2889412"
                     /db_xref="GOA:Q6FNP2"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP2"
                     /translation="MSTFEKVVVIDAKGHLVGRLASIVAKQLLNGQKIVVVRAEALNI
                     SGEFFRNKLKYHDFLRKATAFNKTRGPFHFRAPSRIFYKAVRGMISHKTARGKAALER
                     LKVFEGVPPPYDKKKRVVVPEALRVLRLKPGRKYTTLAKLSTSVGWKYEDVVAKLEEK
                     RKVRSAEYYAKKRAFNKKVTAATASAAETDAAKKLATLGY"
     gene            complement(<996792..>996974)
                     /locus_tag="CAGL0J10179g"
                     /db_xref="GeneID:2889444"
     mRNA            complement(<996792..>996974)
                     /locus_tag="CAGL0J10179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448153.1"
                     /db_xref="GeneID:2889444"
     CDS             complement(996792..996974)
                     /locus_tag="CAGL0J10179g"
                     /note="highly similar to uniprot|P53507 Saccharomyces
                     cerevisiae YNL070w TOM7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448153.1"
                     /db_xref="GeneID:2889444"
                     /db_xref="GOA:Q6FNP1"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP1"
                     /translation="MNFLPSFILSDESKERFNKILDLTQRVAHYGWIPFVLYLGWAQT
                     ANKPNLFNLLSPLPSV"
     gene            complement(<997347..>998756)
                     /locus_tag="CAGL0J10186g"
                     /db_xref="GeneID:2889413"
     mRNA            complement(<997347..>998756)
                     /locus_tag="CAGL0J10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448154.1"
                     /db_xref="GeneID:2889413"
     CDS             complement(997347..998756)
                     /locus_tag="CAGL0J10186g"
                     /note="highly similar to uniprot|P12695 Saccharomyces
                     cerevisiae YNL071w LAT1 dihydrolipoamide
                     S-acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448154.1"
                     /db_xref="GeneID:2889413"
                     /db_xref="GOA:Q6FNP0"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:Q6FNP0"
                     /translation="MSALLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALS
                     PTMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVA
                     VSRPIAVYVEDEADVAAFKDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKA
                     AKSNSTPSSVASGDRIIASPLAKTIALEKGIALKSVKGTGPRGRITKADVEKYLESAP
                     KSTSTAAPSATPSTTGGASYEDLEITNMRQIIGDRLLQSRQSIPSYIVSSDISVSKLL
                     KLRKSLNATAKDQYKLSINDILIKAVTVAARRVPDANSYWLQNEGIIRQFKNVDVSVA
                     VATPTGLLTPIVKNAESKGLIEISKEVKELASRAKINKLVPEEFQGGTICISNLGMNP
                     AVSMFTSIINPPQSTILAIGTVKRVAVEDAGAENGIAFDDQVTITGTFDHRTIDGAKG
                     ADFMRELKTVIENPLQLLL"
     gene            complement(<999365..>1000288)
                     /locus_tag="CAGL0J10208g"
                     /db_xref="GeneID:2889414"
     mRNA            complement(<999365..>1000288)
                     /locus_tag="CAGL0J10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448155.1"
                     /db_xref="GeneID:2889414"
     CDS             complement(999365..1000288)
                     /locus_tag="CAGL0J10208g"
                     /note="highly similar to uniprot|P53942 Saccharomyces
                     cerevisiae YNL072w RNH35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448155.1"
                     /db_xref="GeneID:2889414"
                     /db_xref="GOA:Q6FNN9"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN9"
                     /translation="MTVTEEKNVLPPTVQVSLNSLKTKTYYSEIPKSVIANESPVILG
                     VDEAGRGPVMGPMVYGISYCTKEYQDKVLIPKYTFDDSKKLTDPVRRMLFSKMYAGEI
                     DQVGYATTAITPYDISTGMSRYPPSRNYNLNEQAHDVTMALIQGVIDRGVSIDHVYVD
                     TVGPPASYQRKLEDRFPSIKFTVAKKADSLYCVVSVASVVAKVTRDLLIESLRRTPDE
                     IMGSGYPSDPKTVAWLKGNQKPLLGWPIEIVRFSWQTCQTLLKDKSTGSVSIKWDEDY
                     TNTKRKLVPIPVPETNFYEKPPTLDNWFMRS"
     gene            complement(<1000573..>1002204)
                     /locus_tag="CAGL0J10230g"
                     /db_xref="GeneID:2889415"
     mRNA            complement(<1000573..>1002204)
                     /locus_tag="CAGL0J10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448156.1"
                     /db_xref="GeneID:2889415"
     CDS             complement(1000573..1002204)
                     /locus_tag="CAGL0J10230g"
                     /inference="similar to AA sequence:UniProtKB:P32048"
                     /note="similar to uniprot|P32048 Saccharomyces cerevisiae
                     YNL073w MSK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448156.1"
                     /db_xref="GeneID:2889415"
                     /db_xref="GOA:Q6FNN8"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN8"
                     /translation="MLRIVGARLLYASSRIRIGRGLASKVAIDSSNLEFTKRNELVLS
                     SLDRYYPSMSSIERGNLVSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKM
                     AFIDLVDGIHGIQLILNCREIGNSATFESELSFLRKGDYVMTTGLPRLSKSRMKNISL
                     RCTDLPKILSVAQMPLPPKLIDTVKSNSNKVVDYQINGFQNIRIRSSILKSIRNFLEE
                     RDFIEVETPILSSKSNGAVAKPFMSSSKDFDKLMLRVAPELWLKRLIISGCNKVFEIG
                     KSFRNEGIDGSHNPEFTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYLPE
                     SLLELEDILKSNNWKFKRVEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKGQFFG
                     KSSSYSSSQILNRLCSELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFEL
                     FIKGREYSNAYEEENCPQVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPI
                     GGFGLGIDRLCMLITGCQRIEQVLPFGTLDDVNRQ"
     gene            complement(<1002530..>1003396)
                     /locus_tag="CAGL0J10252g"
                     /db_xref="GeneID:2889416"
     mRNA            complement(<1002530..>1003396)
                     /locus_tag="CAGL0J10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448157.1"
                     /db_xref="GeneID:2889416"
     CDS             complement(1002530..1003396)
                     /locus_tag="CAGL0J10252g"
                     /note="highly similar to uniprot|P53941 Saccharomyces
                     cerevisiae YNL075w IMP4 component of the U3 small
                     nucleolar ribonucleoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448157.1"
                     /db_xref="GeneID:2889416"
                     /db_xref="GOA:Q6FNN7"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /translation="MLRRQARERREYLYRKAQELQETQLQQKRQIIKQALAQGKPLPK
                     ELAEDEQLQKDFRYDQSMADNEDEAGVDDEYSASSGIVEARVIVTTSRDPSSRLAQFA
                     KEIKLLFPNAVRLNRGNYVMADLVSACKKSGTTDLIVLHEHRGVPTSLTVSHFPYGPT
                     AFFSLHNVVLRHDILNRGNQSEVNPHLIFDNFTTPLGNRVVTILKNLFPPGPKKDSSR
                     VITFANRGDFISVRQHVYVRTKDGVEMAEVGPRFEMRLFELRLGTLENKDADVEWQLR
                     RFVRTANRKDYL"
     gene            complement(<1003911..>1005890)
                     /locus_tag="CAGL0J10274g"
                     /db_xref="GeneID:2889417"
     mRNA            complement(<1003911..>1005890)
                     /locus_tag="CAGL0J10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448158.1"
                     /db_xref="GeneID:2889417"
     CDS             complement(1003911..1005890)
                     /locus_tag="CAGL0J10274g"
                     /inference="similar to AA sequence:UniProtKB:P34072"
                     /note="similar to uniprot|P34072 Saccharomyces cerevisiae
                     YNL076w MKS1 pleiotropic regulatory factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448158.1"
                     /db_xref="GeneID:2889417"
                     /db_xref="GOA:Q6FNN6"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN6"
                     /translation="MPSKLGLPRGPDNIPPLELSPGTDSKIPTGNAIKQTITQQHSEQ
                     QQKQRQQQHSQNNPNNKQNSGLSKQAISSEFLKVSPNLFTPERLHLFDTVELYTTLIK
                     TSKTIQQGERLGNLSWRILNKALLRNNDINISKKRDGVKNIYSVLNPMNNNGNNKSAA
                     TTFGTTTNITSKKPQTSFTQILPKNENTDKRSKITAIRPMEALNGATEPRRNRSNDSF
                     QKNDQHADIRGILSKERQHKSTTALFQKNHNRSENAGNQNDSDFNKSNHLLYKQFNQI
                     KQKKKKEDPQMVITGFDTNMVIIKKKHSSDSPNDKRNKSRSRSPEVLNIGKSNHKRSN
                     SGTSQVSDNNSKSIFKHESLFGKPNRRGSESKHNNNKTRKDNKIFFSSEDEDESDWDS
                     VSDSSEFYTDEIDEEDEDEQYYNKQWDKLVLAKQASNDKKLSAHGSELQDGAHHLEKI
                     QSNNLSQPIRRSLLSGLFHNGSSTYSTKDSGEDSGRSSLFNSQNSTPTSISGQNYKVS
                     SAHKPTIETTNVTAVGSVTPPHDSFMQPSQYIRETLTRSTSNMRSTSRRGSSSSIVSE
                     ATGARYLYESNAPPTAHTLLPTALSTHMFVPNNIQQQRMAVKADVNQREGRRLTRRES
                     MDIPIKNVKNSVLKTRMEISEEERYQRSQMQRRHK"
     gene            complement(<1006624..>1008063)
                     /locus_tag="CAGL0J10296g"
                     /db_xref="GeneID:2889418"
     mRNA            complement(<1006624..>1008063)
                     /locus_tag="CAGL0J10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448159.1"
                     /db_xref="GeneID:2889418"
     CDS             complement(1006624..1008063)
                     /locus_tag="CAGL0J10296g"
                     /inference="similar to AA sequence:UniProtKB:P53940"
                     /note="similar to uniprot|P53940 Saccharomyces cerevisiae
                     YNL077w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448159.1"
                     /db_xref="GeneID:2889418"
                     /db_xref="GOA:Q6FNN5"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN5"
                     /translation="MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEES
                     KKQFQEISKAYEVLSDPKSREMYDRYGTTDESAIASQEPFGEGMSFYSGGNPMHMFGT
                     SAGDLFAQFFNSSGDAGPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLS
                     DLYQGKKTKLGLNRMRVCSSCDGKGGMRVASCRTCKGQGEVVKTRRVGPMVQTMSSTC
                     NSCHGTGTFIKDSDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETS
                     HGLIKVQPGDVVIVIDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGK
                     IIKLSIIPNELLKPSCFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPE
                     RLEDTTITKLQEILEQDPNVKKEDESDQKRIDDAVTNSDGAVEVEEHVLSDFVPDYKN
                     FKEFKRSRSNRSDSRKRRRCNDDDDCIVS"
     gene            complement(<1008835..>1009995)
                     /locus_tag="CAGL0J10318g"
                     /db_xref="GeneID:2889419"
     mRNA            complement(<1008835..>1009995)
                     /locus_tag="CAGL0J10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448160.1"
                     /db_xref="GeneID:2889419"
     CDS             complement(1008835..1009995)
                     /locus_tag="CAGL0J10318g"
                     /note="weakly similar to uniprot|P53939 Saccharomyces
                     cerevisiae YNL078w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448160.1"
                     /db_xref="GeneID:2889419"
                     /db_xref="GOA:Q6FNN4"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN4"
                     /translation="MNTNEGHTTSVENDILNAVSNWEKYKQGQAGLPLTQATNAHRDY
                     GSIKRKASIARHSSIQRKDFTNVQELKKYKDKKKFIFHRGFFKRNSKKNTNFTRIQDS
                     NVKVKLEPHRFRNRAELESVMNYTDLRTLNLSQMYPRATDNAAAVYGIKRKYHYRPRV
                     VPTVERIPSRVYHVDDSTVSRKNSIKRSMPSVRNSKVNQMRHRDPVVSITSQAPSGLS
                     TSSTPTAIRRTIRRSKTSPGGYRNIRYRNLSREHQTIMKLWEQYMRNIIYQRIQLRIT
                     LMTTALTTDDSGSESGEVSAEDDAAHSILDEYVFSLPPAIEDDKSLSFRYTPTSGLSI
                     DDPIVIPEEEMHEQLMAQPTALRSRLHVIHPGSSSITTTSSSHNHISTPVTA"
     gene            complement(<1010761..>1011777)
                     /locus_tag="CAGL0J10340g"
                     /db_xref="GeneID:2889599"
     mRNA            complement(<1010761..>1011777)
                     /locus_tag="CAGL0J10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448161.1"
                     /db_xref="GeneID:2889599"
     CDS             complement(1010761..1011777)
                     /locus_tag="CAGL0J10340g"
                     /note="highly similar to uniprot|P53011 Saccharomyces
                     cerevisiae YGL100w SEH1 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448161.1"
                     /db_xref="GeneID:2889599"
                     /db_xref="GOA:Q6FNN3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN3"
                     /translation="MQPFNTGHEDIVHDVAYDFYGRTMATCSSDQHIKVFKLDKDATR
                     WEVNDSWRAHDSSIVSLDWASPEYGRIIASASYDKTIKIWEEDPNQEECSGRRWTRLC
                     TLNDSKGSLYCVKFAPSHLGLRIASIGNDGIMRMYDALDPSNLRSWTMTAEVKVLPVA
                     PANNLQSAFGLSWCFTRFSPEKIAVCALDQAYIYQRGKDGHFYQAGKLPGHTSLIRSI
                     SWAPLIGRPYHLIATGCKDGRVRIFRVNDSPSKSNTPNLSDSDDYNMEDQGIKQRQNN
                     TDLEVELLSEHDDHKGEVWSVSWNLTGTILSSTGEDGKVRLWKSTYSNEYKCMSIITS
                     KQDI"
     gene            complement(<1012289..>1012918)
                     /locus_tag="CAGL0J10362g"
                     /db_xref="GeneID:2889600"
     mRNA            complement(<1012289..>1012918)
                     /locus_tag="CAGL0J10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448162.1"
                     /db_xref="GeneID:2889600"
     CDS             complement(1012289..1012918)
                     /locus_tag="CAGL0J10362g"
                     /inference="similar to AA sequence:UniProtKB:P53144"
                     /note="similar to uniprot|P53144 Saccharomyces cerevisiae
                     YGL101w or uniprot|P38331 Saccharomyces cerevisiae
                     YBR242w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448162.1"
                     /db_xref="GeneID:2889600"
                     /db_xref="GOA:Q6FNN2"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN2"
                     /translation="MNESWKPEDHIPDNVKKALAGTKNSNYVIALLNIVQQLKIQKRT
                     GWVDHKVKDPESISDHMYRMGITSMLITNPDINRDKCVRISLVHDLAESLVGDITPND
                     PMTKEEKHRREYDTIKYLCDKIIAPFNSKAAKEILEDWLAYENVSSPEARYVKDIDKF
                     EMLVQCFEYEQSNNIRLDQFWSAKDAIKTPEVSEWCNDLIKMREEYFSS"
     gene            complement(<1013323..>1014251)
                     /locus_tag="CAGL0J10384g"
                     /db_xref="GeneID:2889601"
     mRNA            complement(join(<1013323..1013723,1014203..>1014251))
                     /locus_tag="CAGL0J10384g"
                     /product="60S ribosomal protein L28"
                     /transcript_id="XM_448163.1"
                     /db_xref="GeneID:2889601"
     CDS             complement(join(1013323..1013723,1014203..1014251))
                     /locus_tag="CAGL0J10384g"
                     /note="highly similar to uniprot|P02406 Saccharomyces
                     cerevisiae YGL103w CYH2"
                     /codon_start=1
                     /product="60S ribosomal protein L28"
                     /protein_id="XP_448163.1"
                     /db_xref="GeneID:2889601"
                     /db_xref="GOA:Q6FNN1"
                     /db_xref="InterPro:IPR001196"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN1"
                     /translation="MPTRFTKTRKHRGHVSAGKGRIGKHRKHPGGRGMAGGQHHHRTN
                     LDKYHPGYFGKVGMRYFHKQQNHFWRPVLNLDKLWTLIPEDKRDEYLKSSSKSAAPVI
                     DTLAAGYGKVLGKGRIPNVPVIVKARFVSKLAEEKIKAAGGVVELIA"
     gene            complement(<1015309..>1016439)
                     /locus_tag="CAGL0J10406g"
                     /db_xref="GeneID:2889602"
     mRNA            complement(<1015309..>1016439)
                     /locus_tag="CAGL0J10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448164.1"
                     /db_xref="GeneID:2889602"
     CDS             complement(1015309..1016439)
                     /locus_tag="CAGL0J10406g"
                     /inference="similar to AA sequence:UniProtKB:P46672"
                     /note="similar to uniprot|P46672 Saccharomyces cerevisiae
                     YGL105w G4P1 protein with specific affinity for G4
                     quadruplex nucleic acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448164.1"
                     /db_xref="GeneID:2889602"
                     /db_xref="GOA:Q6FNN0"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FNN0"
                     /translation="MSDLVAKFKGLSVADSTAQLSREQSALVAQWESILKTGQLQANL
                     NNLNLQLRDNSFIAATSQPTVHDVELFEATLPVIKELVSSSKDIKGTLGSYRHIIRWV
                     DYLQALLQLSKDQTLEFDRNIELPREVIEKPKKKDDAKKDDGKKDDKKDDKKKANDGD
                     KKQRGKPDEETLKKLREEAKAKKAAKKAAQAQQQKETKAPEKVLPSVIDFRVGFIQKA
                     IKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLEAMQERYVVAVCNLKPVNMRGVK
                     STAMVLCGSNAEDKVEFVEPPKGSKAGDKVFFEGFGAEDPLKQLNPKKKLWEQLQPHF
                     STNENLEVIFKDEEDKEHPVRKLTNAKGEEFKVATIVNANVR"
     gene            complement(<1016825..>1020031)
                     /locus_tag="CAGL0J10428g"
                     /db_xref="GeneID:2889603"
     mRNA            complement(<1016825..>1020031)
                     /locus_tag="CAGL0J10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448165.1"
                     /db_xref="GeneID:2889603"
     CDS             complement(1016825..1020031)
                     /locus_tag="CAGL0J10428g"
                     /inference="similar to AA sequence:UniProtKB:P33314"
                     /note="similar to uniprot|P33314 Saccharomyces cerevisiae
                     YKL092c BUD2 GTPase-activating protein for Bud1p/RSR1P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448165.1"
                     /db_xref="GeneID:2889603"
                     /db_xref="GOA:Q6FNM9"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM9"
                     /translation="MSNIEQLQAHFTSERFQVLIKKNKGCFIGKVDWCSELSIDVWKT
                     HYLQITDQGSLTHAIETPIISKEFVGATSGFKEPKHPIIKHLQKCGVRLLSANQHSQP
                     GGQQTYQSQPLPIIEVIARNPNATKDMKVYLRIVNLEKFQELLVSLIWWSTFNSKGIF
                     DKVRIQHPEYLPQTEPTDRIDVLSESFEIECNVYGPIPFDANVTTLKNISNIENYLSH
                     SSFIDAGSMLDPDYLSNSSNFSWFKAKCILKKTGILDIIIDETIIYSLDVKTLLSSEV
                     RIVNGHLYDDNCLYIGHLSSLRSKINYVGGNLLGGVGLDDKHQALLLHSKLKHEIELM
                     YTLFQLFTSAEQLSLIGAARSNTLRLVNNLEVSVLEGNLNDMSGIEEGTLFVDVILWG
                     KIFARTPFVQSSKNPFWREIFEFTEAVIPDKLQFDLKYNSDYKQQILGRCTITKDMIH
                     GTMLDKETRVPLFSVANPEKQVGTLCLKVTSRRNYILPPNNFKKIDETLNSINLKYLT
                     GFAYGESIGTSKEVEKCAVTFLNIFQTLQKEDIWCTILINKELEDFSKQSGSRPGIDG
                     QYMPSRVNSLFRGNSILTKTLELYFLRIGREYLEKAFGTLIRNLLNEEVSFEMDPMRI
                     SAKDDIERRQIIQHNSEDLKQWVCTIWNRIIETSNDLPKKIKKQLHELRKGFEIICLE
                     KGQQSILNCISAFLFLRFFCPLILNPKLFKFTESHLTMKQTRNMLLITKVLQNISTLN
                     PFGVKEQWLQPLNPFVEGFREQVIEYVDKVTERKIDFSTKLLGSTADRETAMSIIKPD
                     VLPYMKSSVYGIDKYQDETELIELITTDKLGVQNNIKSERTSDLDKLDDWTTVDEEKP
                     EIGELEFEEITEDNSDVFGDDLMRYLKSNESPKKKPSSKIYSMQFKEITKQDYDLFEQ
                     LETESALLVNKLDRLLDRLADYEYPSIQLTEMGSFVQSMSNKIYYTKNGVIVADVLRD
                     GYDDDQFSRLFNEDGKTDVFLSLPTVDIQNKRDNTERSQLHLHHQMNGNGKVKSSSMY
                     NLGKIIGTKKKMSESEEFEDEKKLNATTRFGRWLKKKI"
     gene            complement(<1021676..>1022596)
                     /locus_tag="CAGL0J10450g"
                     /db_xref="GeneID:2889604"
     mRNA            complement(<1021676..>1022596)
                     /locus_tag="CAGL0J10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448166.1"
                     /db_xref="GeneID:2889604"
     CDS             complement(1021676..1022596)
                     /locus_tag="CAGL0J10450g"
                     /note="highly similar to uniprot|P24280 Saccharomyces
                     cerevisiae YMR079w SEC14
                     phosphatidylinositol(PI)/phosphatidylcholine(PC) transfer
                     protein or uniprot|P33324 Saccharomyces cerevisiae
                     YKL091c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448166.1"
                     /db_xref="GeneID:2889604"
                     /db_xref="GOA:Q6FNM8"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM8"
                     /translation="MSEEAIKKEKEILDSFPSVCEPGSPSGTPGNLNDSQKKALAQLK
                     EQLQKDGYKLRLDDATLLRFLRARKFNVAMAKEMYVACEKWRKSAGVDTILEDFHYEE
                     KPLVAKYYPQYYHKIDKDGRPVYFEELGTVNLNEMYKITTHERMIKNLVWEYESFVKY
                     RLPACSRSRGYLIETSCTIMDLKGISISSAYHVLSYVKEASHIGQNYYPERMGKFYLI
                     NAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYKKELLKQIPAENLPVKYGGKSEVSSS
                     KGGLALSDIGPWRDPKFIGPEGEAPKSFVM"
     gene            <1023529..>1027566
                     /locus_tag="CAGL0J10472g"
                     /db_xref="GeneID:2889605"
     mRNA            <1023529..>1027566
                     /locus_tag="CAGL0J10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448167.1"
                     /db_xref="GeneID:2889605"
     CDS             1023529..1027566
                     /locus_tag="CAGL0J10472g"
                     /note="highly similar to uniprot|P38931 Saccharomyces
                     cerevisiae YDR443c SCA1 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448167.1"
                     /db_xref="GeneID:2889605"
                     /db_xref="GOA:Q6FNM7"
                     /db_xref="InterPro:IPR009401"
                     /translation="MKEATDDYDLSKLVSNFYRLEKITKINYAQYLPKKQNDQWGIQM
                     EIQMRKKDRKLLVALLSKELWCFSINDQVLPSPNDIDPELNVSADKTGSFTADYSKPN
                     LPPHYALFLKSLKRMIYLNLVEQSKNTLVQFGNSCINITKNNESNNLLQIEPHLFSNS
                     ELAISICVKDLGLLPLKVNSIDPAFLSSHALYMAPSGVRVYLVENKNDNSGTNQEHLH
                     KYLVPVPENGEVLLKTLYASHGIKLNSSTCQWVNIIPNITHLNGRAPNISQYMDLPKE
                     LRTIVWPLDLVFAQPALDIDSSTTLSQINGLDTFEDTLSLIDNFLQLKQSSSYRTPGS
                     SGGLTGTNIGTNVFSSEGAYTDQFQVYPKSQTNQQQTSSNSKVSPSDAASPYPGIDKI
                     IEQKQFTPDFMASPSVSGNSNELFNDRKNGHTDLLISPSKMDVDTDFPGSNLAGQEAP
                     SQPASDVKKSSVSASDSELFGEEDEDEDDADLFGESNNDSTGESNANNSKGEITEDIF
                     ASSDDESSLQPKKESTFYDGIKNGSAESGLNMQDRANLKRTYLDIRIEETPLSSPLYT
                     DPGAPLPVETPRDRRKSVFAPLNFNPIIAKDVDNKYKNGGKYSFSPLQKEEALNFDVS
                     RTELSSSEGEDSESSDDELEDLANKNDGVVYDKAENIGYKTFANLQDSVPPGLIKQDF
                     LGNPYLASLEGSKEGQNTIWKMPQTDIAQTESPLKAIDTSIGPDGTLPNTTSSEQSKS
                     VYVHDYGISPTKMSNDPAFDTAKIEGKYEFMNNFPSSFPFLLRHMPLSLIPDTFKHLN
                     PTITVNERNNQIIDLLAEQIVYDYNILGNLTIPDVPYSGIRNYSNGVVKNTIDNLFSE
                     FTRLDGTTLISRLYPMETPFVSVRKQHDQIKLRSDVQQFTKYANLKPVRGIKNFKFLV
                     LTDSFKEDCIQFISSLSQTYINHELGFCEHLQLTNEDSKGLIYLKDFEDSKLLLLAAQ
                     IVSYLSTNRTSGKEVAFMMIIPVQRCDISELVEKTAKFQIIQNEVKAKIPSMELYLKI
                     VPMDFIKSPLTSVDDYTNLCISIYNILPNKMIKFTHIRKQIPEKLTFKTSQQASAFKY
                     DAYIHLAYSRSVDKQWMFAALSDSAGKENMMKTWYLGSSKNKFDEACNHIWEMALSLA
                     GKNYGKVCLILTRLNGILPDDELMNWRRLSGRNIHLAVVCVDDNTKISFFDRNESYPS
                     YKRLYQNANSIETLVDPERIDDYLIRDLDQDIHGVIFENPFPLVNSLHRCAIKSGALV
                     KFNVSTTATEPHSLDKFEVNLLNCPHSDSFKLLETILEEFRNLAALNVWFGITNGENG
                     HIPWHVLAVKKMMKTLVHTRVKVAQ"
     gene            <1029320..>1029910
                     /locus_tag="CAGL0J10494g"
                     /db_xref="GeneID:2889606"
     mRNA            <1029320..>1029910
                     /locus_tag="CAGL0J10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448168.1"
                     /db_xref="GeneID:2889606"
     CDS             1029320..1029910
                     /locus_tag="CAGL0J10494g"
                     /inference="similar to AA sequence:UniProtKB:P49435"
                     /note="similar to uniprot|P49435 Saccharomyces cerevisiae
                     YML022w APT1 adenine phosphoribosyltransferase or
                     uniprot|P36973 Saccharomyces cerevisiae YDR441c APT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448168.1"
                     /db_xref="GeneID:2889606"
                     /db_xref="GOA:Q6FNM6"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005764"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM6"
                     /translation="MEMEEVSVVEECRRELRSALHQYPNFPTQGVLFEDFMTIFQNPS
                     LFKTLINTLKSHLNEEFPNGEIDYIVGIESRGFLFGPTLALAMDVGFVPIRKAGKLPG
                     ELVRADCEKEYGSATYELQKEAIPKGSNVVLIDDVLATGGSATAATQLLMSVGSNILE
                     YCFLMELDFLKGKLKLNDAPVFSLLHTQEEGLKRSP"
     gene            complement(<1030397..>1032355)
                     /locus_tag="CAGL0J10516g"
                     /db_xref="GeneID:2889607"
     mRNA            complement(<1030397..>1032355)
                     /locus_tag="CAGL0J10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448169.1"
                     /db_xref="GeneID:2889607"
     CDS             complement(1030397..1032355)
                     /locus_tag="CAGL0J10516g"
                     /inference="similar to AA sequence:UniProtKB:Q04089"
                     /note="similar to uniprot|Q04089 Saccharomyces cerevisiae
                     YDR440w DOT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448169.1"
                     /db_xref="GeneID:2889607"
                     /db_xref="GOA:Q6FNM5"
                     /db_xref="InterPro:IPR013110"
                     /db_xref="InterPro:IPR021162"
                     /db_xref="InterPro:IPR025789"
                     /db_xref="InterPro:IPR029063"
                     /translation="MQEGLKLAERYNASLGSSQTYPIDNHHDKESSTDVATDDIMEKD
                     LHSGKTISSQNSLDGSEASTPVHQLERPTIDVSERNDSRRKFRKKTSLDDLLDQASKF
                     QPQYEYSFPTSFLRKRKAPQSNESDGEEEAKQNRTNKIVKQKKTKKNVKVTSKSKASV
                     PIEEKHTINKQPKKTGTGGMKRGPKPGRKKKSQKNTKNSIKKESTNAINNHKMYEMDS
                     ASSRFAEHKNSTNSESANNSFIDWSLPKFSPPYQIFDIDNINSYSNFQGQIYSSASLT
                     KHHNEIGSKTPFSRNRDGSKSPIDDGQGKLIGLRSILYPDYYEEYLMDYKKVNFRYDG
                     MAEIGKIMEYVGRIYLPEKYQKEYKETVVDIYNTAYDNKDLALSISTVEKYNQFVGSI
                     PKAEIVNHLAATKELPRSFLHDFLQIVYTRSIHPYASKLKQYKAFSNYVYGELLPGFL
                     TDVYSKCGLSKNHLFMDLGSGVGNCVIQASLEFGCRESFGCEIMEAASELTEIQMREY
                     SNRCKLFGFKQSKIDYSLRKSFINNEKVESLIPECDVLLVNNFLFDGKLNYEVTKLLQ
                     KTKVGCKIISLKNIRASGYTLDTVNIESVLNRLEVKKYRLDNNSVSWTHNGGEYFIST
                     VLDRIDESLLDPQKRDRRNTHRPAKYTR"
     gene            <1032847..>1034079
                     /locus_tag="CAGL0J10538g"
                     /db_xref="GeneID:2889608"
     mRNA            <1032847..>1034079
                     /locus_tag="CAGL0J10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448170.1"
                     /db_xref="GeneID:2889608"
     CDS             1032847..1034079
                     /locus_tag="CAGL0J10538g"
                     /inference="similar to AA sequence:UniProtKB:Q03722"
                     /note="similar to uniprot|Q03722 Saccharomyces cerevisiae
                     YML020w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448170.1"
                     /db_xref="GeneID:2889608"
                     /db_xref="GOA:Q6FNM4"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM4"
                     /translation="MTVRPELSFPAKDLRRNLISLQPIENFVPVTCDTKRPIKCLIIG
                     VHGYFPNKAVDIILGERTGTSQRFVSQAESAVQLYFKELGVAVDTTTLALEKEGTVAK
                     RVEFFVDVLGEYRETLAEADFIYFVSHSQGVPVTVNLIGHLLIKGILQLDIDRVSHMS
                     DKPIYTQEKIVSVLGMAGVNYGPLYGADKNIWLRLFSVVERKSLMELFEFQNPATKLS
                     MDYMEKVQYILDAGVKITFVGSVNDQVVPLYSSLASFLQHPNIQRGIFYTSQCDVPPF
                     IMGCILDSITLLNSGKKDQGFIKEISPYLHGPLTGNGHSDLYFQSEVYTYGIKHALNS
                     QSIKHCPSPIIRSDIVSLKVNPYNLPWTMRGLLNEIEKELGKEEVKKLYKLYDEWAPN
                     TPLHQSLRIKLSGVTSKF"
     gene            complement(<1034276..>1035178)
                     /locus_tag="CAGL0J10560g"
                     /db_xref="GeneID:2889609"
     mRNA            complement(<1034276..>1035178)
                     /locus_tag="CAGL0J10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448171.1"
                     /db_xref="GeneID:2889609"
     CDS             complement(1034276..1035178)
                     /locus_tag="CAGL0J10560g"
                     /inference="similar to AA sequence:UniProtKB:Q04087"
                     /note="similar to uniprot|Q04087 Saccharomyces cerevisiae
                     YDR439w LRS4 involved in rDNA silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448171.1"
                     /db_xref="GeneID:2889609"
                     /db_xref="GOA:Q6FNM3"
                     /db_xref="InterPro:IPR018479"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM3"
                     /translation="MALQVVADYYRCVLENERIYYEYQLNRRETVKNSRSEDEFSGSE
                     RTNALKTDEQLQLQRQVNKLTVDLQSMAHENERLREFQKTQKQILESKIQQLKKTVDS
                     FKNERNSSSSSHVRTPPRQTRSGAYTQGKDTDLSRRGGFHLLSPIVGNVNPGKEKAGG
                     LKETLKVGRNTIFDKNSSLLDDDDDDDDDEINGTSVKERSRVTGRKLRSSSSLKDSKN
                     NHIEEEEAMEFTTDNSDEVGLMEGLKLRDGSAKANLQLPSGSLSPDEDTQSSNEETTN
                     TRKKRRRLTRRRIQTMNSDNSSSE"
     gene            <1035745..>1037154
                     /locus_tag="CAGL0J10582g"
                     /db_xref="GeneID:2889610"
     mRNA            <1035745..>1037154
                     /locus_tag="CAGL0J10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448172.1"
                     /db_xref="GeneID:2889610"
     CDS             1035745..1037154
                     /locus_tag="CAGL0J10582g"
                     /inference="similar to AA sequence:UniProtKB:P50109"
                     /note="similar to uniprot|P50109 Saccharomyces cerevisiae
                     YML017w PSP2 suppressor of DNA polymerase alpha mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448172.1"
                     /db_xref="GeneID:2889610"
                     /db_xref="GOA:Q6FNM2"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM2"
                     /translation="MSKKLSLEEFLGDGILGESVWNEDEINLDAINNTTNLDILKTKS
                     TEHGNARTPHFGPGMNGPGGPGGSSGSMQSPSMGGRVHAPPTNVNPNADYVVTGPPYI
                     IKFSNLPPRFSEFDIKDLFQAKSTQYVKFKLFWELNKNPSIDTMKNGTVFEKNFKKNW
                     KVAFVELFTARDMDKILKFWSTPLKELYNILLTPGEFPDFKEYIAKATLITDPNDDPA
                     KPHLEKELELQKEEKLKEKKTSPVPTTNKPSYSQILEKSLNSPSPAATPLSGGSSVIN
                     QSGHTMQHGDNLSKYSKHETNDSDDELSKNFEDKVNFDDNQSSSNDNNDGSQAGSYNG
                     NYNNYKRGSSRGSYNRGGRGNFNGRGGNRGGYNSRGNFNNRGGYHNRDGANKDQQRTN
                     SYGNRQDRKDNYSKNDDERSNSNKSDNDSLSGLFKPASDFLRGSDDRNSSRGDRGRGG
                     RGSHRGGRFSTRGQGTNRF"
     gene            complement(<1037574..>1038017)
                     /locus_tag="CAGL0J10604g"
                     /db_xref="GeneID:2889611"
     mRNA            complement(<1037574..>1038017)
                     /locus_tag="CAGL0J10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448173.1"
                     /db_xref="GeneID:2889611"
     CDS             complement(1037574..1038017)
                     /locus_tag="CAGL0J10604g"
                     /inference="similar to AA sequence:UniProtKB:Q04082"
                     /note="similar to uniprot|Q04082 Saccharomyces cerevisiae
                     YDR437w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448173.1"
                     /db_xref="GeneID:2889611"
                     /db_xref="InterPro:IPR013717"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM1"
                     /translation="MNYRREYYWFSQYVLVTFTLFFAIFWTLLPKVNENDDWVYGFIP
                     ASFVRSIGEIIPQRGWIIYFECFLLMGMLCTYIGLQFFNEDILTPPIDDLRTITDSNA
                     NIIVTDANDDFIRNYAFKESSGIVDLPIMDVCNILYKENYMGEYK"
     gene            complement(<1038392..>1039996)
                     /locus_tag="CAGL0J10626g"
                     /db_xref="GeneID:2889612"
     mRNA            complement(<1038392..>1039996)
                     /locus_tag="CAGL0J10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448174.1"
                     /db_xref="GeneID:2889612"
     CDS             complement(1038392..1039996)
                     /locus_tag="CAGL0J10626g"
                     /inference="similar to AA sequence:UniProtKB:P38799"
                     /note="similar to uniprot|P38799 Saccharomyces cerevisiae
                     YHR078w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448174.1"
                     /db_xref="GeneID:2889612"
                     /db_xref="GOA:Q6FNM0"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:Q6FNM0"
                     /translation="MEVFFVLLLLCATAFFVGKWSYDSLWLIASSIFETGYRLKTRNN
                     KSLYQLPSSGENSNYFFNKFYTVYSIKSQSITRGLRFLFAFGITCYAMTIEIVLWQIK
                     TADASQEHDLITKYIWPLTSLSLTVILILVQPFFILITILNKFFNDSLNINQLVMGTF
                     MSLALMIATLQYMSWGPFYYSKSILTSLSIAGVTVMAILSGIASISTLYYTFSMIFKR
                     RSDISGMQSSSLISRNRRLNLWTTQRQLQSQIDNYERNIIENISILKKMDEDNVGVAA
                     PLRRQMVDKISWFQLEVAKLEKSAKQPTLIRNSRRIFEISFLIYCCHKVLITFLKRIP
                     HIISHALKYPNDIDYEYFYDSSGSSSTGSDPLAVTVAKLLDLFLFGFNYKQDLDSLTK
                     QISLLISISLFICTLSTVNTTITYLLSLLPSRIQVIATLVMQGEEDADLLPTNTKVSS
                     RRNPSIIKNLIVSELIGVYVVSTILLIRSNLPFGTALKLKELLGEKFTMPTGAIDSWF
                     DKIYALVCIISVVGIHIAEKSTFYKT"
     gene            <1041784..>1045221
                     /locus_tag="CAGL0J10670g"
                     /db_xref="GeneID:2889613"
     mRNA            join(<1041784..1041789,1041982..>1045221)
                     /locus_tag="CAGL0J10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448175.1"
                     /db_xref="GeneID:2889613"
     CDS             join(1041784..1041789,1041982..1045221)
                     /locus_tag="CAGL0J10670g"
                     /inference="similar to AA sequence:UniProtKB:P38798"
                     /note="similar to uniprot|P38798 Saccharomyces cerevisiae
                     YHR077c NMD2 nonsense-mediated mRNA decay protein 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448175.1"
                     /db_xref="GeneID:2889613"
                     /db_xref="GOA:Q6FNL9"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR007193"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL9"
                     /translation="MNDERRNELYLLNSKAWLGEDVYPLKTMKLDSSIKRNTGFIKKL
                     RKGFTKENKPSLIKDLGEVSFQKYLSEIVSTTNEALTNVQSKNEEVETAVEVVSGLHQ
                     RFNVAFTEPLSLAFLQNFNFKNIDPTITKDEMAFSAKLKNNLRVFTELYLVNVFANLD
                     EMTDKELPSFLMKKGQKKEPILLSILKEALNYNFKTGHSSIVAIYFAKKFPEFFSTDD
                     QSTQSVPLNKDIKESVVSIYRLFFGALSTNASKLQTQVNKLIKEHHKCQIRTGKASDE
                     YLEKYEEISPIFERFKSSTLFLSQYLDVEAPQFEIIDINGSQHEQKEDIITNKILPPS
                     QRLWENDETRKLYEVLPDISDIVKEHSQSNKDPKPETLNSFFTELQNIESKGHLDDLV
                     RKYWSLNLNNKATRNRIIKFFIETVDWSKISLYARFFAINAPYMKETVDEFIQYLDNG
                     FRSQLHNTKFNIKNVIFFGEMVKFSLIPQFMVFHKIRTLIINMNITNNVEILTILFEN
                     CGKFLLNKAEYKDEMDKLVDRLKSRRTDHSLNMNTKASIEMLLRILFPPSTKSLNTEV
                     VQLTPEENFYTVLLRSELGNIGFKDTVRLIRKAHWKDPNTEKLFFTLFTEPEKVSYQN
                     IPILTQVLSGLYSFNRNFAIMCIDQVLENIENGLESNTYAENTSRIANIRYLVEIFNY
                     EMMKSNVLMDTMHHIVKYGHPNGQPNPFKLNPNDLPNNYFRIHLIVTILSNIRRTPSS
                     LTSSLQLLLRFFEYYIFTKEFPLPKETEYAVNNLFEKLSTLIEKKDKTKFTRSANLLE
                     SLQKFQEYLVLTKRSTTENQKGTDTSTLKTDLLEDGPAQDLDDDIGQENDEGLEMIEE
                     FEIIEDDGESYEENNLDTEVNTGSISSDESGTDLESDSELESADEDDSDDSMDSDSDS
                     ESDSDSGSEDEEDEFDAVLDGEDTPFRNYEDERESEQQRIFDEYKKQLQTEEEIKAQA
                     ELDKQFDLMMSESLEARKSETSTNDRGLLMVHPSGTKLKDSLNEFNTPEKRPKEKVAF
                     AFLTKTGRKTQSRVVNLSRDIKFVSNVVEEGKKLETEREKIKNIVLNRQFD"
     gene            complement(<1045346..>1046446)
                     /locus_tag="CAGL0J10692g"
                     /db_xref="GeneID:2889614"
     mRNA            complement(<1045346..>1046446)
                     /locus_tag="CAGL0J10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448176.1"
                     /db_xref="GeneID:2889614"
     CDS             complement(1045346..1046446)
                     /locus_tag="CAGL0J10692g"
                     /inference="similar to AA sequence:UniProtKB:P38797"
                     /note="similar to uniprot|P38797 Saccharomyces cerevisiae
                     YHR076w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448176.1"
                     /db_xref="GeneID:2889614"
                     /db_xref="GOA:Q6FNL8"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL8"
                     /translation="MYSAGVRVVNPWVLTKSMLIISLIMLIAGFLLTYTGLYCPSYQI
                     ESGTLYNRVFGNCSRRLFFSGGKSWYWNGNNGSATTDHTGGNSFVYKTAVAYQPKDRE
                     DVIYQKLKESLQSLTGEDNYFIQANAANDVYAGVADGVGGWAEHGYDSSAISRELCKA
                     LKEMAATLHKPLTPKQLLDNAYAKIKIDKIVKVGGTTANVAHLSSDGRLDVTNLGDSW
                     CAVFRDSKLVFQTEPQTLGFNTPYQLAIIPDEIQQAAAKNGNRYIQNQPSDADEYNFQ
                     LSKGDIVILATDGVTDNIAIEDLELFLRDNNDQLNENLQKTADELVKKVVKISKDPEF
                     PSVFAQEISRLTGKLYKGGKEDDITMVVVKVE"
     gene            <1046800..>1047771
                     /locus_tag="CAGL0J10714g"
                     /db_xref="GeneID:2889615"
     mRNA            <1046800..>1047771
                     /locus_tag="CAGL0J10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448177.1"
                     /db_xref="GeneID:2889615"
     CDS             1046800..1047771
                     /locus_tag="CAGL0J10714g"
                     /note="weakly similar to uniprot|P39955 Saccharomyces
                     cerevisiae YER047c SAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448177.1"
                     /db_xref="GeneID:2889615"
                     /db_xref="GOA:Q6FNL7"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL7"
                     /translation="MNTDLIGLAIEEEPEYIDIGLRESQAYQPEMNPTLKKSLSQNAL
                     NTIKRRNSTNSLHRTLSQSSCFSTSSSATAQIRDDSYKEFLLFLIGEENAKICWENLP
                     RETKNVFIAKALKKSNYLKSESTLKDPSLSEILKDGRIPTKNSFFYYRNRVTPHIRNS
                     EREHDAIAISKKASGFYNNELSESERQRLKLDAKKEYDKFLIQRRKVAEQFIDTYDKA
                     DDCDLVYQQLKEYKSQLPLEESLTKLTEAVERLSSQVSNTPATPIEKIPTTTVSKPKL
                     TATNKLSNDRNAPIMQSLYGRFIGKFKRKKKPAASTLIYRKPVEKCA"
     gene            <1048132..>1049292
                     /locus_tag="CAGL0J10736g"
                     /db_xref="GeneID:2889616"
     mRNA            <1048132..>1049292
                     /locus_tag="CAGL0J10736g"
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /transcript_id="XM_448178.1"
                     /db_xref="GeneID:2889616"
     CDS             1048132..1049292
                     /locus_tag="CAGL0J10736g"
                     /inference="similar to AA sequence:UniProtKB:P38796"
                     /note="similar to uniprot|P38796 Saccharomyces cerevisiae
                     YHR075c PPE1"
                     /codon_start=1
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /protein_id="XP_448178.1"
                     /db_xref="GeneID:2889616"
                     /db_xref="GOA:Q6FNL6"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /translation="MGDDLKRKILLHNLSSNNPILEKLKGGQEPNSNEEGSDSIGDLP
                     SLKNDYKRQDNNSTNCTYIPPSQWNTYFRSNEHIKVQSRNIEFNTYYTVPSSILGPSL
                     PVFIFHHGAGSSGLSFANLARNLGDQLNNNCCCLSFDARGHGGTKFIDAKQAQNYFRD
                     DFVDDFHTLVEYFVSEKLKHLPTEKLSIIFIGHSLGGSICTFTYSKLSIELKKQVIGV
                     AMFDIVEEAATLALEKVNHFLQVTPNMFSGYEEAIDWHVSHELSRLRESADIAIPALF
                     KSTESGKVVRITNLETFRPFWRTWFSDLSKSFVSLPTCKLLILAGNDNLDRELIIGQM
                     QGKYQLVVFQDSGHFIQEDTPRKTALTLVDFWKRNDNKNVVIKSNWGSSNKV"
     gene            complement(<1049391..>1051532)
                     /locus_tag="CAGL0J10758g"
                     /db_xref="GeneID:2889617"
     mRNA            complement(<1049391..>1051532)
                     /locus_tag="CAGL0J10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448179.1"
                     /db_xref="GeneID:2889617"
     CDS             complement(1049391..1051532)
                     /locus_tag="CAGL0J10758g"
                     /note="highly similar to uniprot|P38795 Saccharomyces
                     cerevisiae YHR074w QNS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448179.1"
                     /db_xref="GeneID:2889617"
                     /db_xref="GOA:Q6FNL5"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL5"
                     /translation="MSHLVTLATCSLNQWALDFEGNRDRILESIRIAKERGARLRVGP
                     ELEISGYGCLDHFLENDVCLHSWEMYAQILKNPETHGLILDIGMPLLHKNVRYNCRLL
                     SLDGKILFIRPKIWLANDGNYREMRFFTPWMKPGVVEELTLPPMIQKITGQKKVPFGD
                     AVINTLDTCIGAETCEEVFTPQSPHIAMSLDGVEIITNSSGSHHELRKLNKRLELILN
                     GTGRCGGVYLYANQKGCDGDRLYYDGCALIAINGKILAQGKQFSLDDVEVVTATVDLE
                     EVRNHRANVMSRGLQSSLADLKYEHIDVEIELAPRGSRFNPKITPTKSRDVTYHTPEE
                     EIALGPACWLWDYIRRCNGTGYFLPLSGGIDSCATAMIIHSMCRLVHKACHEGNDLVL
                     KDIRRITRSPDDWIPENPQEIANKMFHTCFMGTENSSVETRSRSKQLAEKIGSYHVDL
                     NMDGLVSSVVSLFEVATGRKPIFKIFGGSQIENLALQNIQARLRMVLAYLFAQLLPWV
                     RGIPNSGGLLVLGSANVDECLRGYLTKYDCSSADVNPIGGISKTDLKGFIKYASEEYD
                     MPILDEFLNATPTAELEPITKDYVQSDERDMGMTYEELSVFGYLRKVEKCGPYSMFLK
                     LLHEWTPRLTPAQVAEKVKRFFFFYAINRHKQTVLTPSYHAEQYSPDDNRFDLRPFLI
                     NPRFPWASKKIDEVVKQCEGHSSEIDFMTID"
     gene            complement(<1051926..>1054949)
                     /locus_tag="CAGL0J10780g"
                     /db_xref="GeneID:2889618"
     mRNA            complement(<1051926..>1054949)
                     /locus_tag="CAGL0J10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448180.1"
                     /db_xref="GeneID:2889618"
     CDS             complement(1051926..1054949)
                     /locus_tag="CAGL0J10780g"
                     /inference="similar to AA sequence:UniProtKB:P38713"
                     /note="similar to uniprot|P38713 Saccharomyces cerevisiae
                     YHR073w OSH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448180.1"
                     /db_xref="GeneID:2889618"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL4"
                     /translation="METIDIQNRCFVVRWVKCSKDDVINYQVKPLKKSIQFGIYKKLK
                     TDIDAQPSAVHIAPDTKAMLDYTSRTLLKRNSSIYGSSTSSSSTNVSNRRRNSSPSIV
                     SQSAEFKKKERSSSNLSIADIQQQTQELPLKEKLAASGFKLVEWLGTISGNNVKQGTI
                     EVKDNDYYYAFILDNTASKNAKKKILFNASVIKDTARPVMSPTSKKSSSSLFGRSRGN
                     SAKTSSTKLVNGAQGLHDLNLPKNAGILSVGQGRYLQGYLMKKRRKRLQGFKKRFFTL
                     DYRYGTLSYYLNDHNQTCRGEMVIHLSTVSANKKDRIIIIDSGMELWFLKAADAAAWQ
                     TWVDALQFCFEKNQPIASDIDADAEDTTLGSDAANIEGFSDRTINDSRVPSRPEFRNT
                     SAFSSSRNEYTPLSDDVYNEFAGNLGIIQEWVEKCKLDSLNYVPARKEFILEGSKSVG
                     GDHEKKGKMYLAGIQTPKEISSVDSLPEISEETPTSHQLYKRLSDLESIVDRFIKQSR
                     VLLKDHRYISKQVKDSRQSIISTFSDNDEYFDAKDGIPQGVILLDDAEEEVGETGIMK
                     DDSAVMIDDVEDDEYDSDMESRNQNLNGFTSTDSLVPNDRVLTTESTPTMLASKSDET
                     PSYKQQLYPFPIGGQITRRKDILPSLTTPPSLLSFLRKNVGKDLSSITMPVTSNEPLS
                     ILQVISEAFEYSDLLSRKDMQPLTSVTLFAISALSIQRDKTRALRKPFNPLLGETFEY
                     VHDKLGFRLIAEKVSHKPQIFAFNAEHQDWVCEYTMTPVQKFWGKSLELNNEGTIKLT
                     MKSSGVVYKWVQPTTMVKNLIAGERYTEPVNEFEILGSDGSKAKITFQKTGIFGGRSE
                     SLTATITPPKSSKWKRQALQGKWSEFLEDSTTHKKLWTVGDLVKDSSKKYGFTVFTAQ
                     LNEITDIERNNLPPTDSRLRPDIKAYESGDIEKAEELKLKLEQLQRDRRLKGHDVKPR
                     YFEKISNVEWKRIEGSACYWSKRERNDWSDVEKLW"
     gene            complement(<1055802..>1055975)
                     /locus_tag="CAGL0J10802g"
                     /db_xref="GeneID:2889619"
     mRNA            complement(<1055802..>1055975)
                     /locus_tag="CAGL0J10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448181.1"
                     /db_xref="GeneID:2889619"
     CDS             complement(1055802..1055975)
                     /locus_tag="CAGL0J10802g"
                     /note="highly similar to uniprot|Q6Q547 Saccharomyces
                     cerevisiae YHR072wa NOP10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448181.1"
                     /db_xref="GeneID:2889619"
                     /db_xref="GOA:Q6FNL3"
                     /db_xref="InterPro:IPR007264"
                     /translation="MHLMYTLDNEGKRVYTLKKMTEEGEITKSAHPARFSPDDKYSRQ
                     RVTLKKRYNLLPQ"
     gene            complement(<1056204..>1058405)
                     /locus_tag="CAGL0J10824g"
                     /db_xref="GeneID:2889511"
     mRNA            complement(<1056204..>1058405)
                     /locus_tag="CAGL0J10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448182.1"
                     /db_xref="GeneID:2889511"
     CDS             complement(1056204..1058405)
                     /locus_tag="CAGL0J10824g"
                     /note="highly similar to uniprot|P38604 Saccharomyces
                     cerevisiae YHR072w ERG7 lanosterol synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448182.1"
                     /db_xref="GeneID:2889511"
                     /db_xref="GOA:Q6FNL2"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL2"
                     /translation="MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQ
                     STFVQWLLQDEEFPTPSPRKEGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMF
                     MTIGYVAVNYIAGVKLPEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVC
                     LRLLGLPKDHIVCVRARHTLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLL
                     PYSLPIHPGRWWVHTRAVYLPVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQH
                     RNTVCGVDLYYPHSKILDTANDVIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSL
                     CIAPVNQAFCALVTYLEEGKDSKAFERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAF
                     MIQYFFVAGLAEKPEFREMIINAYKFLCRSQFDTECVEGSFRDKRVGAWGFSTKTQGY
                     TVSDCTAEAIKAIIMVRNSPVFSSVHDEITDERLCKGIDVLLSLQNIGKFEYGSFATY
                     EKIKAPLSMEKLNPAEVFGNIMVEYPYVECTDSSVLGLTYFHKYYDYRKDEISHRIRI
                     AIDYIKQAQQDDGGWYGCWGICFTYAGMFAMEALHSVGETYDNSLTVRKGCDFLLSKQ
                     MPDGGWGESMKSSELHDYVDSPKSLVVQTAWALIALLLAKCPNEDAIERGINLLKSRQ
                     QPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKALGLYNGRNYTNSSQNTQ"
     gene            complement(<1058824..>1059513)
                     /locus_tag="CAGL0J10846g"
                     /db_xref="GeneID:2889512"
     mRNA            complement(<1058824..>1059513)
                     /locus_tag="CAGL0J10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448183.1"
                     /db_xref="GeneID:2889512"
     CDS             complement(1058824..1059513)
                     /locus_tag="CAGL0J10846g"
                     /inference="similar to AA sequence:UniProtKB:P38794"
                     /note="similar to uniprot|P38794 Saccharomyces cerevisiae
                     YHR071w PCL5 cyclin like protein interacting with PHO85P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448183.1"
                     /db_xref="GeneID:2889512"
                     /db_xref="GOA:Q6FNL1"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL1"
                     /translation="MAFVTPSGELVPVETLSNNVYHTPPYQSLKSDGTSSEANTQLSS
                     SDFVSFITDVVAGVHSKSHKRINNSKTSIANFLKEVTKRAHISRDILLLASIYFDKLI
                     KSHEGAINVPEFAYCGKRLLLVCIILAHKFSNDITFSMRVWTQVSGLPTRSIAIMERW
                     CLKQLNYGLTVTNEAMTSWGSKLAGYEQRHTTSVCTLTSIANATLKRKMELDDDVTIG
                     DINPRKIIRTV"
     gene            complement(<1060575..>1061423)
                     /locus_tag="CAGL0J10868g"
                     /db_xref="GeneID:2889513"
     mRNA            complement(<1060575..>1061423)
                     /locus_tag="CAGL0J10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448184.1"
                     /db_xref="GeneID:2889513"
     CDS             complement(1060575..1061423)
                     /locus_tag="CAGL0J10868g"
                     /note="weakly similar to uniprot|P38790 Saccharomyces
                     cerevisiae YHR067w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448184.1"
                     /db_xref="GeneID:2889513"
                     /db_xref="GOA:Q6FNL0"
                     /db_xref="InterPro:IPR026223"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FNL0"
                     /translation="MSWKSLHWLHKDIISFEKNQAFNNLFKNAVRTNIKMTENIQLAD
                     NLLYFNPVDSDLDPDGYFSYQSPSSLISTLQRYRLRRWTNGEITNNKPLVPGKEYSCH
                     ERIKFIKPIGDSCFVSLQRTIRDSNDVTAITEDRTLQYTNRIGDRFSALEEMAQETKQ
                     YEAVAGINISDLDIVKYCQMTNNPHRIHWDRDYCRTQEGIKDILVPGPLITQIMARLL
                     CPNSASLITRIKYKTVSPIYPFTPLRAIKVSPTALWLADESKLYAKMEIKESHRDIMP
                     DQHLEA"
     gene            complement(<1061847..>1063241)
                     /locus_tag="CAGL0J10890g"
                     /db_xref="GeneID:2889514"
     mRNA            complement(<1061847..>1063241)
                     /locus_tag="CAGL0J10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448185.1"
                     /db_xref="GeneID:2889514"
     CDS             complement(1061847..1063241)
                     /locus_tag="CAGL0J10890g"
                     /note="highly similar to uniprot|P38789 Saccharomyces
                     cerevisiae YHR066w SSF1 mating protein or uniprot|Q12153
                     Saccharomyces cerevisiae YDR312w SSF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448185.1"
                     /db_xref="GeneID:2889514"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK9"
                     /translation="MAKRRQKKRTHVQVVPDEERGIPKSMVIRVGQTSLGNHSLNQLV
                     KDFRQIMQPHTAIRLKERKSNKLKDFVVMCGPLGVSHLFMFTQSEKTGNVSLKIARTP
                     KGPTITFQVMDYSLGRDIKKYLRRPKSLTKEDVMNPPLLVLNGFTTKPKDENDEKEVE
                     RANVDKIVVSMFQNIFPPLNPSRIHINSIKRVFMINKDKETGEISMRHYFIDIREVDI
                     SRNLKKLYKAKNNLSKAVPNLHKKEDISSLILDHDIGAYTSESEIEEDSIVKVMDTES
                     VKVKRSVKHKEDDTVEEAKDVDGDEDMKDFESSNIPLEEDDENEQEQAPVSTPRKKAV
                     RLTEIGPRLTLKLVKLEEGICSGKVLHHEFVQKTDSEIRALEKRHKEKMRIKEQRRKE
                     QEENIAKKKAHKEAKRQRKLERRAARKAAAEEGSEEGKDISESESDSSSSESENEYKD
                     VPEDIDSDLYSDIE"
     gene            <1063600..>1065081
                     /locus_tag="CAGL0J10912g"
                     /db_xref="GeneID:2889515"
     mRNA            <1063600..>1065081
                     /locus_tag="CAGL0J10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448186.1"
                     /db_xref="GeneID:2889515"
     CDS             1063600..1065081
                     /locus_tag="CAGL0J10912g"
                     /note="highly similar to uniprot|P38712 Saccharomyces
                     cerevisiae YHR065c RRP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448186.1"
                     /db_xref="GeneID:2889515"
                     /db_xref="GOA:Q6FNK8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAGKVGKVSKKSDDVSSLAAKIRARALENQKKMQAASRKDSESD
                     SSDEEVERPAKKQAKDEKVEEPEEEVTFESFAQLNLVPELIQACQNLNFTKPTPIQAR
                     AIPPALAGSDVIGLAQTGSGKTAAFAIPILNKLWEDQQPYYACVLAPTRELAQQIKET
                     FDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLKNLK
                     FLVMDEADRLLDMEFGPVLDRILKIIPTKGRTTYLFSATMTSKIDKLQRASLTNPVKC
                     AVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIGKTVIIFTRTKANAERLSGLCN
                     LLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPV
                     DSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKLPKESVDKNIILTLR
                     DSVDKANGEVVMEMNRRNKEKQARGKGRRGRMMAKENMDREEK"
     gene            complement(<1065251..>1067086)
                     /locus_tag="CAGL0J10934g"
                     /db_xref="GeneID:2889516"
     mRNA            complement(<1065251..>1067086)
                     /locus_tag="CAGL0J10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448187.1"
                     /db_xref="GeneID:2889516"
     CDS             complement(1065251..1067086)
                     /locus_tag="CAGL0J10934g"
                     /inference="similar to AA sequence:UniProtKB:P32776"
                     /note="similar to uniprot|P32776 Saccharomyces cerevisiae
                     YDR311w TFB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448187.1"
                     /db_xref="GeneID:2889516"
                     /db_xref="GOA:Q6FNK7"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013876"
                     /db_xref="InterPro:IPR027079"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK7"
                     /translation="MSHSGAASYKKVNGILTINEDVSPAELLWRSTDGDKTHMIVLDV
                     VDKLQATPATSEKLMLRLIEKVDESKKVKNNDGEMVSPKPAAHMFSFNNRSVMDNIKI
                     TLQAIISRYKDTEIHEQKQAVSGDSNAVSKESQQSQQQELINTSKLDDSLSYDNLMKN
                     LKLQQSLLTSNKQLMKTFQETVINSNLPPEEFWSTRIPMLRAFALSTSQKIGPYNVLS
                     VIKPVASSENQVNVNLSRDKIISIFQNYPIVKKAYLDNVPKNFKESEFWARFFSSKLF
                     RKLRGEKIMANDRGDVIIDRYLSLDIEFDRKDDERLFHPVSKFIDLGGNTQDDPVKRG
                     NKPDFTMQPGMDMNGNNDGTLDILRSMNRLSEKMTTALENEYSRSNLTNSAELEQEGN
                     EQELELNDLNDEYKAEYSIVHLKIGTKERSNGNEGEGRTTEHIKITDPIVRNQIEEVN
                     IGLQRELDLTDVVSGKDDKEGTIIDAINQQVIKTVRINAKQAKHNNMDSSYMTTFTTN
                     KINETDVPSEMPPDLLESCRMLHGTCCEFLKHFYIHFQSGDQKQANSVRKLYNHLKEC
                     VAKLKELLKDVKDGDGEKLASLCEAYLKTTMNSIELAISKYESCL"
     gene            <1068578..>1070431
                     /locus_tag="CAGL0J10956g"
                     /db_xref="GeneID:2889517"
     mRNA            <1068578..>1070431
                     /locus_tag="CAGL0J10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448188.1"
                     /db_xref="GeneID:2889517"
     CDS             1068578..1070431
                     /locus_tag="CAGL0J10956g"
                     /note="some similarities with uniprot|P46676 Saccharomyces
                     cerevisiae YDR310c SUM1 suppressor of SIR mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448188.1"
                     /db_xref="GeneID:2889517"
                     /db_xref="GOA:Q6FNK6"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR020478"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK6"
                     /translation="MTTDYNSLRQEIDSVSEKVAELESKVKKNDVDTTTSIEDMLVAI
                     KTIAYNQTVLESKFEDILKNQMNTDVLVNTISSRLDRIAKIIPTAGNNGTRSSTSSTS
                     TYTNSNSSGVQTRASSSRRVSTSNSATVTNNQAPAVPVKRGPGRPRKDGTYGGVSKTA
                     SSANSSASNSNTSNLTALKKTPNEAELPLGGRTRLPNNVPQVSKSKRYFVNPTDSPPQ
                     KTTATTHNRPGRPPTKTEAKTVAPGENPPVKRKRGRPPKKRPAVAIAAAARKESKSEL
                     GSQIKTENKETNGRSISDKSLSSSANESADSIITRFRRKRRYEQDDDNEEEKSSKIKR
                     EDEDVDEEEDEVDVEVEDEDVSVIENDDNSTEENEDGDSQITDNLYSKEDLDKRIKAF
                     KFGKKGPFWMGSRMTRLERIEFLKNSTRWNSHTEGTRKALAMALELESNADDDNISLS
                     EKMLELVDKYENENDDDYHRNINRDVNVDSDDTTSYENTSDRLVRAAQQVTDNLAARF
                     SKTNASNTEIKEVKKDLPRDDNSNKGIAMNPVHEDASNNTPTHGLPSHSNDEGPKVPI
                     ISKDLSQGPNNMAQLTDQNNQPAGVDTINEKKDKSDADANNVISNHLATST"
     gene            <1071911..>1073158
                     /locus_tag="CAGL0J10978g"
                     /db_xref="GeneID:2889518"
     mRNA            <1071911..>1073158
                     /locus_tag="CAGL0J10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448189.1"
                     /db_xref="GeneID:2889518"
     CDS             1071911..1073158
                     /locus_tag="CAGL0J10978g"
                     /note="weakly similar to uniprot|Q06648 Saccharomyces
                     cerevisiae YDR309c GIC2 CDC42 GTPase-binding protein or
                     uniprot|P38785 Saccharomyces cerevisiae YHR061c GIC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448189.1"
                     /db_xref="GeneID:2889518"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK5"
                     /translation="MASIQGNQMLPQIKSIWIDEDQEAEKLYGMAGQTLLLDESDMES
                     DNEEFDVTVLNSDKPVLNHKKKIMLPPLVPRSPTYHRYNKIASPDAGKKDKKFFRSLF
                     KSNGSKNKGSNGDKAMKISTPFDFHHISHASFNRNQSTDLPNLEDIENYYGSEQLSQL
                     AASRATGLNKAFVTKSTATKAPSNFSSLTKSQGYGNLALKKDRVVSSSSISLARSGSV
                     ASSNLSNNNSLMKNGRVVSSSTIATSLFDYEDHLSPNHSVGMKPTFASHTTPNFENKE
                     NRDSGNSELSINFLKSYSFPTLLEEEEEDAAFEVNKASEDKLVGNVLESLMDSCDSLE
                     SKNDSQTVHHDIDELESGIKRLSFENTPKKILTRRNSDTQVFKNFGESPLIHHSPKNM
                     KSADDLLTMLDNQINQAYSEDYF"
     gene            <1073752..>1074513
                     /locus_tag="CAGL0J11000g"
                     /db_xref="GeneID:2889519"
     mRNA            <1073752..>1074513
                     /locus_tag="CAGL0J11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448190.1"
                     /db_xref="GeneID:2889519"
     CDS             1073752..1074513
                     /locus_tag="CAGL0J11000g"
                     /inference="similar to AA sequence:UniProtKB:Q08954"
                     /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
                     YPL199c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448190.1"
                     /db_xref="GeneID:2889519"
                     /db_xref="GOA:Q6FNK4"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK4"
                     /translation="MDTDVLRRNNGADYNHSIDPEYQRLRAAADDAIKSRQKLSAESQ
                     KAYKSGDKAKAHQLSEEAKKKAALADTLNLQAAEYVFVQNNADSSSNEIDLHGLYVKE
                     AMWILKKRMAFAADKGELELRIITGKGNHSQNHISKIKEETIELCQSLGLNYHVNSKN
                     TGVVIVEVDKNKIPTDWVNPESTVSEPKPSAKINSHTQYQQSQNAGYQPQQGPTYQQG
                     PSYQQQPQQQSQTSAGGIAALVAGLLCLCLNNDRK"
     gene            <1075366..>1076025
                     /locus_tag="CAGL0J11022g"
                     /db_xref="GeneID:2889520"
     mRNA            <1075366..>1076025
                     /locus_tag="CAGL0J11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448191.1"
                     /db_xref="GeneID:2889520"
     CDS             1075366..1076025
                     /locus_tag="CAGL0J11022g"
                     /note="highly similar to uniprot|P47822 Saccharomyces
                     cerevisiae YDR308c SRB7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448191.1"
                     /db_xref="GeneID:2889520"
                     /db_xref="GOA:Q6FNK3"
                     /db_xref="InterPro:IPR021384"
                     /translation="MTDRLTQLQRCLDQVMEQFCATLNFIDKRHDFEPFNDKEPKMTD
                     KHASVATPEEFSNGIDELSTDIIVKIRQITTLIDSLPGVGVSAEEQLHKIDSLQKKLV
                     DIEDEKIHAIKKKDDLLKQVDDLITVFVGGIADSRRGTSLAPENVQEDNDIKQEAEVP
                     TSSEAIEQKIANEKIESKIEGEYNDNINEDSDSKSADSELFMDKDDADNISESISPGK
                     I"
     gene            complement(<1076112..>1078322)
                     /locus_tag="CAGL0J11044g"
                     /db_xref="GeneID:2889521"
     mRNA            complement(<1076112..>1078322)
                     /locus_tag="CAGL0J11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448192.1"
                     /db_xref="GeneID:2889521"
     CDS             complement(1076112..1078322)
                     /locus_tag="CAGL0J11044g"
                     /note="weakly similar to uniprot|Q06644 Saccharomyces
                     cerevisiae YDR307w PMT7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448192.1"
                     /db_xref="GeneID:2889521"
                     /db_xref="GOA:Q6FNK2"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK2"
                     /translation="MPEAKRQDAQPGETASSVLIKGPQGIPFVPIDAYKQHGIINTKI
                     CYTDKIIGALVIPAQFAAMCQPLIEEYLNSDSFLNEISEGLLAESLIDQMDKRAFIPN
                     IHPFIIQLLTLVLCKNRLLFQLRVLSFLCSCWTLTMLYFITRKLNINKLISVSVLSIY
                     MSLDIVQESAISNLTDNIQLASIMTLFFLWESYKYNVQNKITCSRMLFVSIPAIILVG
                     TKYLGSTMSWLFFVLIVVYHLWQNILPDVKNFKYLKNFFGLFKLLLISMTFIPFGVLT
                     CSYLLQDYSMIYLYDNSNYHVRSFMPIEYKKLVPTFDNYNSDEIIFKKSTVRIRHVES
                     LGGYLSTLPNVNYMSGSFEQIAFLSQFEDSELNNWIIEPSTEAQNNKEVRSGSRIRLR
                     NVVTGKLLRASSSRPPMSDQEYNSEVSLTGSANFSGDADETWLIDQKYVIGKAIPFNK
                     MGLPPSENINALINTNSVFTLRNDGHGCMLLSHDTDLPDDWDSMSSFKPEFHRQELTC
                     NTTPTKKLTYFMFESVVDQTNDTASRAPLTIHDKLKEVFKLIPSMLKTNYKFNYYIRN
                     SQFLKGRREEDDEIDMQYNLQKFQNRVPPEKWATWRPVSLITKKPSSVYIVSIIVLVL
                     YVLFEITNLLISWNPLSFDTPSLMVHKRLLGKISDEWMLQRMMSDDFLLECFLGWITH
                     YYIFTRTPHQNLDIVLYLPSLLFNLLFVITIFDTLTKSNKMWFSLLPIYIALAI"
     gene            complement(<1078886..>1080901)
                     /locus_tag="CAGL0J11066g"
                     /db_xref="GeneID:2889522"
     mRNA            complement(<1078886..>1080901)
                     /locus_tag="CAGL0J11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448193.1"
                     /db_xref="GeneID:2889522"
     CDS             complement(1078886..1080901)
                     /locus_tag="CAGL0J11066g"
                     /inference="similar to AA sequence:UniProtKB:Q07896"
                     /note="similar to uniprot|Q07896 Saccharomyces cerevisiae
                     YLR002c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448193.1"
                     /db_xref="GeneID:2889522"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK1"
                     /translation="MARKSKSLKLIEERNKKRQLEQDSLLQPGSFNNLDNVEEEYQAD
                     EGRRNKKAKQSWDDEEQSYELQPRKLRNDGEEMVEGLPIKINGKVERQLIAKNRKKVT
                     QTNESEDEDSEEENNKNAEKDKDSQSEVEKEDEPDTEEKIIQLQEEIADLVDKLMNEP
                     EEYPAALTRLVKMTTSKNPNTCIFSMLALVPVFKSVIPGYRIRPLTDLEKKEKVSKEV
                     ARLRTFEQGLVHNYKLYLDTLKELAKVPNNADPIKVNIGRQAVRAANELATTGSHFNY
                     RTELFTILVRRICKPNLQADPESLNIIKTIEGLFNDDTEGNVSAEFMRLLSKVIKTRN
                     YNVEESVINMFLSLDVLHDYDPNTKSENEPVRIKMKKKDRVHLSKKQRKARKEMKQIE
                     QEMEKAEQTVSAEERERNQGEILQLMLSLYLNFLKSDNPKLIGASLEGLTKFGSQVNF
                     DLLGDFLAVMKEIILTSKFDSLSSEEVRKILLCIVSAFSLVSNHNTMKFSVDLSSFVD
                     ALYYVLPYIALDADIEYSYKSLRLADPLENEIIKPSVNVSTKAELLLKALNHIFFRSK
                     SGTRERACAFTKRIYGCILQTPEKSSIALLKFIEKLMTRFPEIASLYSTEDRVLNGKF
                     DLFTDAIAQSNPTAAMLWENAVLQKHYCPTVVKGIRALSTRSKDSNK"
     gene            <1081270..>1081962
                     /locus_tag="CAGL0J11088g"
                     /db_xref="GeneID:2889523"
     mRNA            <1081270..>1081962
                     /locus_tag="CAGL0J11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448194.1"
                     /db_xref="GeneID:2889523"
     CDS             1081270..1081962
                     /locus_tag="CAGL0J11088g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448194.1"
                     /db_xref="GeneID:2889523"
                     /db_xref="GOA:Q6FNK0"
                     /db_xref="UniProtKB/TrEMBL:Q6FNK0"
                     /translation="MRVIRFKGYGKKLQRKVREPKPINLKYAQLLNRTFVIQNFTYTH
                     AKLKRDDFEDEIVSDGDYEELVNEFRAANNKQEQVEREEQEEISPVGSNDVELQVAQH
                     RPQLKLRHVSFMKDETNNIKSSKSATILHSMGNESVLQTSKVKHQRIIAKKMVSLQAN
                     NTIVHTSQKSHCKPKSSHVGTILHLNRCNNNSMPINKFMTNTSHMLKTSKRESVYSPK
                     APFSFRVKLNRR"
     gene            complement(<1082062..>1083588)
                     /locus_tag="CAGL0J11110g"
                     /db_xref="GeneID:2889485"
     mRNA            complement(<1082062..>1083588)
                     /locus_tag="CAGL0J11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448195.1"
                     /db_xref="GeneID:2889485"
     CDS             complement(1082062..1083588)
                     /locus_tag="CAGL0J11110g"
                     /inference="similar to AA sequence:UniProtKB:P47084"
                     /note="similar to uniprot|P47084 Saccharomyces cerevisiae
                     YJR003c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448195.1"
                     /db_xref="GeneID:2889485"
                     /db_xref="GOA:Q6FNJ9"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ9"
                     /translation="MSLVQRRLFGSAKLLCSYAKLLNRPHFKPLKETLSKVDTVDVSA
                     ARQIVNLLEKLDVSARDQAAVHNDILATLVKDNYGISNVHLKALQDLSVQPSKEALLE
                     LIRSNPGRVDSSWDLFVKYRGTEVSDDIVHAVIQKIIQMDQAMIADGKHNLDVNDIAQ
                     IVILLESLSDKTALDPQLYESFLNDIFREQLSCLLPLALSLAEVDSKVLKEKLVDATD
                     IQFIHLLEKIDPQSIVNDEELLLLSLDRLKPSTSATETEIETKNKGLLLEAIENARTV
                     SKLPFEHTLLDEPLEDKKAKLFSQITGEVQNNKLDETNIQLALKLLRIVGLEIGDVKL
                     ALEMYHNYLIKYVSHSEELMFEAFLMLSYQAVKTNNKQLQQYSEAFIPANLDIRDSLY
                     TKFLCGLILSKSKFSMDDALELYNDKNQVISKTADEHTLKSPFDRVTECLIMGYMLNR
                     DIDFARVIFQEAMGQKLFSGTTITKSIKSHMAEYGEATEKGTIQESMEKRILDYLCSI
                     "
     gene            <1084251..>1085066
                     /locus_tag="CAGL0J11132g"
                     /db_xref="GeneID:2889486"
     mRNA            <1084251..>1085066
                     /locus_tag="CAGL0J11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448196.1"
                     /db_xref="GeneID:2889486"
     CDS             1084251..1085066
                     /locus_tag="CAGL0J11132g"
                     /note="weakly similar to uniprot|P53885 Saccharomyces
                     cerevisiae YNL173c MDG1 GTP-binding protein of the
                     pheromone-response pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448196.1"
                     /db_xref="GeneID:2889486"
                     /db_xref="GOA:Q6FNJ8"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ8"
                     /translation="MSEVEFVWKSGTPSEVVVTGDFDEWKCSHKLEKRGDEFRGVVPV
                     KFTAPKVYFKFVVDGEWVASGDYKRESNDLGSENNYITKEDARMGSMDASMDAAPKGT
                     APMSSSTDGLQSTTTHELTSEVESQVKGSGEQRKKFKIKRVVKTNKKTGEREVVSQEV
                     IALDENDQPITESMENTPTAEPMMEDAKADTMEENKKEEKMAAPMAAEEKMNGDSVKK
                     SEPMKSENKPMAEQKKPMANGKPMTNSTKNGKQPEKKSFMKKVKTFFAPRQSL"
     gene            <1085737..>1086879
                     /locus_tag="CAGL0J11154g"
                     /db_xref="GeneID:2889487"
     mRNA            <1085737..>1086879
                     /locus_tag="CAGL0J11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448197.1"
                     /db_xref="GeneID:2889487"
     CDS             1085737..1086879
                     /locus_tag="CAGL0J11154g"
                     /inference="similar to AA sequence:UniProtKB:P53883"
                     /note="similar to uniprot|P53883 Saccharomyces cerevisiae
                     YNL175c NOP13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448197.1"
                     /db_xref="GeneID:2889487"
                     /db_xref="GOA:Q6FNJ7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ7"
                     /translation="MSDVEKEVKEVQEVPADEAEKIQKALSDPTKKRKAEDEIEIDLS
                     QTIPLSKKQKRLLRRGKITLEELNAKFNLDPSSVDEFHKEVAEKERGKDGESKDSAKE
                     SESSVKDSRKNGVWIGNLSFDTTKEDITRFIVGKTKGTDVEITEEDLVRVNMPLAKND
                     GKQIKNKGFCYVDFKTQEQVEAAIKLSESQLNGRNLLIKNSKSYEGRPDKTDLVSMSK
                     NPPSRILFVGNLSFDTTDELLRKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKNEEG
                     ATNALKDKSCRKIAGRPLRMEFGEDRSKRQVRKRPDAAPKKSFDLPNHDAVSRPPREE
                     KSYNEKKPRQRNYVESNNRVKSSIALKTAQRASAAIVPSQGKKITF"
     gene            <1088473..>1090362
                     /locus_tag="CAGL0J11176g"
                     /db_xref="GeneID:2889488"
     mRNA            <1088473..>1090362
                     /locus_tag="CAGL0J11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448198.1"
                     /db_xref="GeneID:2889488"
     CDS             1088473..1090362
                     /locus_tag="CAGL0J11176g"
                     /note="some similarities with uniprot|P53882 Saccharomyces
                     cerevisiae YNL176c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448198.1"
                     /db_xref="GeneID:2889488"
                     /db_xref="GOA:Q6FNJ6"
                     /db_xref="InterPro:IPR013320"
                     /translation="MIHNSSYTEAADIKSLSSFIEESSRVPDYISESNNIGWSSNINN
                     PPLFESSSFDITTQNDNWILTETMQNITTESSSTFSRSVASSVFPSSSQAFVSPPSII
                     DIPISSIPESSSISISSDVLSSAITVSQTSSSSYSSLISSYSTIQSTSSSSISENEIS
                     SSSRISPGLLSSVPSITTSFSSGISSSVSPTSSLQQIAEQSSNSSLAENDLLSSSLTI
                     LSSVLSSSVLLHNSGVSSSSFTDNFSSTLTNSSNSLAILSSISESSLINTITDLPSSS
                     VLLSPNNSESSIKVSSASSSSSRRKASTYTTPSRIPFSNSSEWYTPLPTPSISSSTND
                     TSSLLSELALIGISSSSSSSSSSQFYTSSTSSSSLVSSSENYSSSQPTTIEPITSTIS
                     SSYSDLSNDGEILSSTLGKSVYYSYIQTFDITASTTTFETALPIVTAFNLKDSYTFSK
                     PSSIITTDLHFYKDWLSGALDSNEENGNKSKNAGTIAGSVVGSVVGLLVCTLIVWYFY
                     IRKRRRNQKWKSFEVPSRSKDVEYNNNDNPFNNEFDFQHRVPPPLPPQRKNHNSIGVP
                     PSSMGLSNTRSADYHMRFSYISSSTDSSDDYSDSMQSALHIGSDSGRERSNDVPEMGY
                     LREII"
     gene            <1091056..>1091982
                     /locus_tag="CAGL0J11198g"
                     /db_xref="GeneID:2889489"
     mRNA            <1091056..>1091982
                     /locus_tag="CAGL0J11198g"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_448199.1"
                     /db_xref="GeneID:2889489"
     CDS             1091056..1091982
                     /locus_tag="CAGL0J11198g"
                     /inference="similar to AA sequence:UniProtKB:P53881"
                     /note="similar to uniprot|P53881 Saccharomyces cerevisiae
                     YNL177c"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_448199.1"
                     /db_xref="GeneID:2889489"
                     /db_xref="GOA:Q6FNJ5"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ5"
                     /translation="MFSRSLMRNAGLPLRNASRVLANRRLLSTSFPCLNNSGNLFGSI
                     TDTGNTNLEDKYDPTRETSRLEAAVKSTDDSGEISVDKDSITFEKDEVLQNYIREQFQ
                     KEALAPELLLSPLKRQVYELNCKQNGGFYKEDTVVTIPETKEKYKLKLSRQELEALEP
                     SIYLRSYRLKYSTKKAIHLLRMLSGLDVKKAITQCHFSDKKIARDLAELFQKGIEDGK
                     KLGLDADDLYISQIWSGNDGYLQKRVEYKGRGRIGIIRHRHIHVRCILKTHSVTKKRL
                     EYEKQLKEQNKKPWVQLADRPIRGVPGNAYKW"
     gene            complement(<1092254..>1092997)
                     /locus_tag="CAGL0J11220g"
                     /db_xref="GeneID:2889490"
     mRNA            complement(<1092254..>1092997)
                     /locus_tag="CAGL0J11220g"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_448200.1"
                     /db_xref="GeneID:2889490"
     CDS             complement(1092254..1092997)
                     /locus_tag="CAGL0J11220g"
                     /note="highly similar to uniprot|P05750 Saccharomyces
                     cerevisiae YNL178w RPS3"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_448200.1"
                     /db_xref="GeneID:2889490"
                     /db_xref="GOA:Q6FNJ4"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ4"
                     /translation="MVSLISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     KTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQA
                     ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHS
                     GQPVNDFIDVATRHVLMRQGVLGIKVKIMRDPATNRGGPRALPDAVSIVEPKDEEPVL
                     TPTVRDYRSAEEVGEKTEAPAEQAVEASA"
     gene            <1094754..>1095908
                     /locus_tag="CAGL0J11242g"
                     /db_xref="GeneID:2889491"
     mRNA            <1094754..>1095908
                     /locus_tag="CAGL0J11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448201.1"
                     /db_xref="GeneID:2889491"
     CDS             1094754..1095908
                     /locus_tag="CAGL0J11242g"
                     /inference="similar to AA sequence:UniProtKB:P53879"
                     /note="similar to uniprot|P53879 Saccharomyces cerevisiae
                     YNL180c RHO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448201.1"
                     /db_xref="GeneID:2889491"
                     /db_xref="GOA:Q6FNJ3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ3"
                     /translation="MRSIKCVVIGDGAVGKTSLLISYTTNTFPTDYVPTVFDNYTTTL
                     ALAAPMPLSSHSTSTSSMTGSSSVLVDHNTPVFKQSNSSRRKPLTEGDTLSSSASSFS
                     TGADSGSGALKRQIFKLNLWDTAGQEEYDRLRPLSYRQTDVFLICFSVSEPSSFRNVV
                     DKWFPELKRVSGIESGDLYTNFKKYPILLVGTKSDLRDDENEIQKMRDQNLSFVSKEE
                     IDKVVEDNGFMGYVECSAATQNNVRQVFEKAVHIVAFEPDKLQRAKCVDEARKMSIQE
                     DSLVQEESPAAEPKKSAHPQKQSHPQSQLQSQISVPKPHKLSSVSEKPTHEKRKASPI
                     SPESSPSQETSIGKSSGSRSDMEKSKQSVKSEIRQTKKKLKKKSVKCVII"
     gene            complement(<1096342..>1097571)
                     /locus_tag="CAGL0J11264g"
                     /db_xref="GeneID:2889492"
     mRNA            complement(<1096342..>1097571)
                     /locus_tag="CAGL0J11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448202.1"
                     /db_xref="GeneID:2889492"
     CDS             complement(1096342..1097571)
                     /locus_tag="CAGL0J11264g"
                     /note="highly similar to uniprot|P53878 Saccharomyces
                     cerevisiae YNL181w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448202.1"
                     /db_xref="GeneID:2889492"
                     /db_xref="GOA:Q6FNJ2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ2"
                     /translation="MPLNIIGTALLDGTDKIPYFQEIKKVAPYALAGAAVKYWSRGPS
                     NNWERKLHGKVYIVTGATSQGMGTSVVLEMARLGAQLIILCRDVDEWTTDWCEDLRER
                     TQNELIFVEQCDLSDLYEVRKFATTWLDNSPPRRLDGVVALSGDMEPWGIPMLSRPIR
                     RSSKDGLEIQMAVNFVGLFHLLDILQPSFKAQPPDRDVRIIVSTCWLQSLGDIKLDDP
                     LWQDVKYQSALKFFASSKLQLGLCLAELQRKVVEDVQSQKKAEKSGKNVTVTLVQPGT
                     MRSTSLRRVISNGSVFLLLFLYCVVLYPFLWFFTKSGNRGAQTVLYALMTPELEEVNL
                     KDTEIKYISDCRLVKFARKEYQDKALQQNMYNKTKDAIFELEKKSAVKRNAAEKSNNK
                     DKKNTKSTSKAKKSKKA"
     gene            <1097912..>1099498
                     /locus_tag="CAGL0J11286g"
                     /db_xref="GeneID:2889493"
     mRNA            <1097912..>1099498
                     /locus_tag="CAGL0J11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448203.1"
                     /db_xref="GeneID:2889493"
     CDS             1097912..1099498
                     /locus_tag="CAGL0J11286g"
                     /inference="similar to AA sequence:UniProtKB:P53877"
                     /note="similar to uniprot|P53877 Saccharomyces cerevisiae
                     YNL182c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448203.1"
                     /db_xref="GeneID:2889493"
                     /db_xref="GOA:Q6FNJ1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MDESVIFTTEQNALSTSLYSAEQAVLRQCSTNSRNSAVRVGDKY
                     LFVAQSNKALINVYNISGAHKRETVEQRLPTPEVITCLEVIQNRYEEKSAISDFELPH
                     LLLGSTDGGKIYCWELNSGALLSVKQMAHYQGITKIKSFMDGKYFITSGKDSRVIVWQ
                     TIDFVSNNASEPKPICILHDHNLTVNDIAVSMTHGANMSTSGAKLFTASEDSTVRCYD
                     FSFLRGDFRKNRKSQEQDQKMYQPRLLATFTFPAAIEAMSLDPADRALYVGTSEGLFS
                     LPLYYTVKGTSTVANLAQASGSNRNKLYSVVISGHDDDYKKLFSMGQLVCDKLISTPV
                     TKLELTFDATTILVGNKFGRISVVEIASKQILKTLQPLTTADTEEDAITNIIVTTVNN
                     SRQDSILEQHQSNKNVQKLPVLQRVVHDKDHAEHEVWYRAPETPEFSHELESLPPIAD
                     FEKYMDSIRSEETVFLTTETTSQVKNVKQELAPASHSNSQEQQELQQELQQVKSAYKE
                     LRELHESLFKEHEQLLSSMK"
     gene            <1099969..>1102155
                     /locus_tag="CAGL0J11308g"
                     /db_xref="GeneID:2889494"
     mRNA            <1099969..>1102155
                     /locus_tag="CAGL0J11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448204.1"
                     /db_xref="GeneID:2889494"
     CDS             1099969..1102155
                     /locus_tag="CAGL0J11308g"
                     /inference="similar to AA sequence:UniProtKB:P22211"
                     /note="similar to uniprot|P22211 Saccharomyces cerevisiae
                     YNL183c NPR1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448204.1"
                     /db_xref="GeneID:2889494"
                     /db_xref="GOA:Q6FNJ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FNJ0"
                     /translation="MSSLTKLLQEKNNKEVKTEPTIREESVGEAVGEAVPYYDGRSVL
                     GSSLMSTNFAQTATAYGSSLQMKERASYMDKHANGSLQYGYSSSLAVPTKNGGKMHSS
                     SAKQLPSLSTSIPYAVPNSNKESTHNGSVGSSLSSSWVDQYGGGMPSNISAIDSNVIS
                     SPKVDNVEPRFVISKEKFHKSSQDNQAHTVSRSSSLSSQLGNLFFSKNTTTNNGSSSP
                     GNSSSIQTINGRDIPNATATQIPKPTRARQSSIYSSSRQPSRSSYNDTYFGSPSSLHE
                     NQPSQSVPRSHHSSIADFKRFFKKSTSTSVTSMSMLSDSPVSGSFITGDSTLGTQHTQ
                     QSHGFNSESLHKQSSFSSNSGDIIYTNNYETSIPFSKRYSRTGEELGAGAGGSVKLVK
                     RIADNSVFAVKEFRSKHENESKRDYIKKITSEYCIGTTLNHPNIIETVEIVYEDNRIF
                     QVMEYCDYDLFAIVMSNKMSYEEICCCFKQILCGVQYLHSIGLAHRDLKLDNCVINSK
                     GIVKLIDFGAAVVFSYPFSKTLVEASGIVGSDPYLAPEVCIFTKYDPRPVDIWSTAII
                     FACMILKKFPWKIPKLRDNSFKLFCSGRNCDSLSALVTRTPEPPSYDSSEFSPSKPSH
                     YDSANSADPENSSIGPQRLLHALPEESQHIIGRMVDLAPACRSNIEEVLEDSWIKSID
                     MCHMESNGLVMKYVGGTDHTHTQVDQSEAHIAGLEKKKKKAKNKDK"
     gene            <1102695..>1103144
                     /locus_tag="CAGL0J11330g"
                     /db_xref="GeneID:2889495"
     mRNA            <1102695..>1103144
                     /locus_tag="CAGL0J11330g"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_448205.1"
                     /db_xref="GeneID:2889495"
     CDS             1102695..1103144
                     /locus_tag="CAGL0J11330g"
                     /note="highly similar to uniprot|P53875 Saccharomyces
                     cerevisiae YNL185c MRPL19"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_448205.1"
                     /db_xref="GeneID:2889495"
                     /db_xref="GOA:Q6FNI9"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI9"
                     /translation="MSQAAKNVLVKLIVGAGQAAPAPPVGPALGSKGIKAIDFCKEFN
                     ARTASYQPGVPIPVLITIRPDRSFTFEMKSPPTGYLLLKALGAEKGHGQPNILQKEKT
                     LGELSLKHVYEIAKIKKTDSRHAMLDMPGIVKSIIAVAKSMGIKVVP"
     gene            complement(<1103473..>1105788)
                     /locus_tag="CAGL0J11352g"
                     /db_xref="GeneID:2889496"
     mRNA            complement(<1103473..>1105788)
                     /locus_tag="CAGL0J11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448206.1"
                     /db_xref="GeneID:2889496"
     CDS             complement(1103473..1105788)
                     /locus_tag="CAGL0J11352g"
                     /inference="similar to AA sequence:UniProtKB:P53874"
                     /note="similar to uniprot|P53874 Saccharomyces cerevisiae
                     YNL186w UBP10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448206.1"
                     /db_xref="GeneID:2889496"
                     /db_xref="GOA:Q6FNI8"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI8"
                     /translation="MTTQETIKPLVDRILNNPLQFRRSTASPNISNKDTDMNGNSDSP
                     YIVIGKRKLADQNSKNNGKSDPNQRQSDENDSSEIVQKKRKMPTSVAEALNWYTNAAL
                     KDKTPKVKALPIVKDDSTSDRKGAIEKQADSNSSDSSDTDVFHEAVDFIEEPVKDLGA
                     ANVEITSQQDEDTGEDLGEDLGEDLGEDLGEDLGEDLGEDLGEEIKKVIKETEQNTKV
                     KESTNEVPNVQAAIPKIEPTKKKRKSSVSKELSLLQRDNEDYEREQLMIKQIKEQREK
                     ARKQDEELQQNKSKKTENSSQSQEKQKEGKDPETKDQQQAQEEVTETKHEEKDTFAES
                     ISPKKSVTPPSTIPDISEFYQFNENFDDKGCLENSSIVKSWGPTYSKLKPKGLLNHGV
                     TCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVLAETSRRMWHNDGKKSG
                     NSYINPKKLIARLDDINCMMSEWQQEDSHEYFMSIMSRLQEDSVPKGHKMTESIIYDI
                     FGGSLKQTVTCKSCGEVSTTEQPFYDLSLHLKGKKTDENTVNQEKSSSQSETKDSDSQ
                     TSRYSIEKSIRDFFNPELIKVDKEKKGYVCEKCHKTTNALKRNSILRAPETLLVHLKK
                     FRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPVKYELLSVVVHEGRSLSSGHYIA
                     HCKQPDGSWATYDDEYINKITEREVLKERNAYYVLYTRLTPKSVQLNEPKKQSTPNPI
                     TNVKQNNGKNNKSNKRSSNKKNWKKNKRRRL"
     gene            complement(<1106215..>1106466)
                     /locus_tag="CAGL0J11374g"
                     /db_xref="GeneID:2889497"
     mRNA            complement(<1106215..>1106466)
                     /locus_tag="CAGL0J11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448207.1"
                     /db_xref="GeneID:2889497"
     CDS             complement(1106215..1106466)
                     /locus_tag="CAGL0J11374g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448207.1"
                     /db_xref="GeneID:2889497"
                     /db_xref="GOA:Q6FNI7"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI7"
                     /translation="MCYVLPECVGIASQILETSVQPLVDCTSNAHSLTLLLSEFSKNF
                     LFNNLWIRRPIAFFFGKFFFFFRAGVLLQLIPFCVRFGG"
     gene            complement(<1106524..>1107783)
                     /locus_tag="CAGL0J11396g"
                     /db_xref="GeneID:2889524"
     mRNA            complement(<1106524..>1107783)
                     /locus_tag="CAGL0J11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448208.1"
                     /db_xref="GeneID:2889524"
     CDS             complement(1106524..1107783)
                     /locus_tag="CAGL0J11396g"
                     /note="weakly similar to uniprot|P53873 Saccharomyces
                     cerevisiae YNL187w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448208.1"
                     /db_xref="GeneID:2889524"
                     /db_xref="GOA:Q6FNI6"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MNQANVKNTTFHSMTSVSYNLSPYCSTGTTFRKQPLYRIWETES
                     STSADLSQKLNYMFPKLGLSESQTSLKDKDVTKDVVCQDIHWSVDATSLFTINSDYGI
                     RQYLIPDPKSDQTLLNPYSRIFAHESVLSSDISPRYSLYEGSSEPLANSILIGAKNVP
                     IKLVDLNDTNNLSTIRSYDISNLENEKFETPYVLKYHRESLFLSGTVRNKVNVYDVNR
                     REPVNTLTYSRRSKCGTQSYKSIISCLDDSFSDNQVRYCGSYKNQVFIIDLRGKTLQL
                     LNNLQGNGARGCYQIINSDNGSYLYVLQRYSSRIEILDHRRPDRPVNHLELPGRSDFQ
                     KLKACYNGSFQVGSPLGKGQILSWDKSTIESGGITRENQVVQCQPDILYNVPQCKSMR
                     INIIKTSSDATAISYSGDTAGIALLQR"
     gene            complement(<1107909..>1108949)
                     /locus_tag="CAGL0J11418g"
                     /db_xref="GeneID:2889525"
     mRNA            complement(<1107909..>1108949)
                     /locus_tag="CAGL0J11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448209.1"
                     /db_xref="GeneID:2889525"
     CDS             complement(1107909..1108949)
                     /locus_tag="CAGL0J11418g"
                     /note="some similarities with uniprot|P11927 Saccharomyces
                     cerevisiae YNL188w KAR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448209.1"
                     /db_xref="GeneID:2889525"
                     /db_xref="GOA:Q6FNI5"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI5"
                     /translation="MKENGRKSRSNALRATLNPNSQNNNISDLDLYKKHKAEYGTRLM
                     TEDLTSPEEIMLLNEGSPTTLRSKGKSFTENDEKDSMRKVVINNLEEDNLDPPKLKKE
                     LQFIGKKKASPQYQVLENKERSLDPIERHRRKTSLLKAIGEPVPLPYLQNGPNNYVNV
                     KNEESQRFDQTEMDSIDQRWNSVIESNRKIVKARLNEIRNAGKGIRLDSPQPRRVSEE
                     NVQGHSHNILEQSEKSNVSLKSEGHQDMYASFDDGYGDSIVIGTPKQDLIKSKRLDDA
                     KVLSDIKSILLENSTKLDTVIEVLGSSKKVKLDKNNKIALNRLYYSKNNLYWILCIII
                     LLICNIYVYYYV"
     gene            complement(<1109677..>1111308)
                     /locus_tag="CAGL0J11440g"
                     /db_xref="GeneID:2889526"
     mRNA            complement(<1109677..>1111308)
                     /locus_tag="CAGL0J11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448210.1"
                     /db_xref="GeneID:2889526"
     CDS             complement(1109677..1111308)
                     /locus_tag="CAGL0J11440g"
                     /note="highly similar to uniprot|Q02821 Saccharomyces
                     cerevisiae YNL189w SRP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448210.1"
                     /db_xref="GeneID:2889526"
                     /db_xref="GOA:Q6FNI4"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI4"
                     /translation="MDPSINDSTSNKFVPEYRRTNFKNKGRFSADELRRRRDTQQVEL
                     RKAKRDEVLAKRRNFVPPTDSVDSDEEDEESSAADQQFYGQLQQELPQMVQQINSSDM
                     QEQLAATVKFRQILSREHNPPIDIVIQSGVVPTLVNFMNENQPEMLQLEAAWALTNIA
                     SGTSAQTQVVVDAGAVPLFIQLLYTGSVELQEQAIWALGNVAGDSTSYRDYVLQCSAM
                     EPILSLFNSEKVTLIRTATWTLSNLCRGKKPQPDWSIVSKALPTLAKLIYSFDNETLI
                     DACWAISYLSDGPAEAIQAVIDARIPKRLVELLSHQSTLVQTPALRAVGNIVTGNDLH
                     TQVVINCGVLSALRNLLSSPKESIRKEACWTISNITAGNTEQIQAVVDANLIPPLIKL
                     LETAEYKIKKEACWAISNASSGGLQRPEIIRYMVSQGCIKPLCDLLEIADNRIIEVTL
                     DALENILKMGETDKEARGLAINENADLIEKAGGMEKIFNCQQNENDRIYEKAYKIIET
                     YFGEEDDTVDDNLAPQNAGNTFGFGSNVNQQFNFN"
     gene            complement(<1112678..>1113304)
                     /locus_tag="CAGL0J11462g"
                     /db_xref="GeneID:2889527"
     mRNA            complement(<1112678..>1113304)
                     /locus_tag="CAGL0J11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448211.1"
                     /db_xref="GeneID:2889527"
     CDS             complement(1112678..1113304)
                     /locus_tag="CAGL0J11462g"
                     /inference="similar to AA sequence:UniProtKB:P53872"
                     /note="similar to uniprot|P53872 Saccharomyces cerevisiae
                     YNL190w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448211.1"
                     /db_xref="GeneID:2889527"
                     /db_xref="GOA:Q6FNI3"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI3"
                     /translation="MKFSAVTVAAMAISSVLAKDRQYTTEITYTSDGATKTYTSTHKT
                     HKYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGS
                     KKPKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKFNNTHHEGSKKPKSTGTHKYGKF
                     NNTHHEKPTTEVEIKVPENDASGNRMNSMKLFGLTTGTAVVAGALMLL"
     gene            complement(<1114086..>1115174)
                     /locus_tag="CAGL0J11484g"
                     /db_xref="GeneID:2889528"
     mRNA            complement(<1114086..>1115174)
                     /locus_tag="CAGL0J11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448212.1"
                     /db_xref="GeneID:2889528"
     CDS             complement(1114086..1115174)
                     /locus_tag="CAGL0J11484g"
                     /note="highly similar to uniprot|P53871 Saccharomyces
                     cerevisiae YNL191w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448212.1"
                     /db_xref="GeneID:2889528"
                     /db_xref="GOA:Q6FNI2"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI2"
                     /translation="MCRFLIFKGKEPIRLSHLLTRPAHSIINQSFDSRLRLDRRRPIN
                     GDGFGVAYYPLDKELEEDGPCLFKAITPAWNNQNLETLAEKTKSSLVFAHVRASTYGV
                     LSETNCHPFTYHSLCFMHNGGISNFKRIKRVLLNHIDDEYLNFLQGGTDSECAFALFL
                     DTLHKLGHDPRKRDGDFGHEALRSALLKTIEYIKDWTLALRKDSRLDGELDSEPSLLN
                     FAVTDGSTVVVSRYITSRTDEAASLHFSSGSRFIETSPGEYRMERLDRNQDVIMVASE
                     PLTFERGDWTAVPTNSVLTIRKQTILLHPIVDEYYQEDPLYLRSSKLAESKGLMGAVP
                     LAKAVEKNVPPLEREGRSRPISATAHLV"
     gene            complement(<1115691..>1119185)
                     /locus_tag="CAGL0J11506g"
                     /db_xref="GeneID:2889529"
     mRNA            complement(<1115691..>1119185)
                     /locus_tag="CAGL0J11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448213.1"
                     /db_xref="GeneID:2889529"
     CDS             complement(1115691..1119185)
                     /locus_tag="CAGL0J11506g"
                     /inference="similar to AA sequence:UniProtKB:P08004"
                     /note="similar to uniprot|P08004 Saccharomyces cerevisiae
                     YNL192w CHS1 chitin synthase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448213.1"
                     /db_xref="GeneID:2889529"
                     /db_xref="GOA:Q6FNI1"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI1"
                     /translation="MSYQYGSGGSYGYNGYSGQGNGNSGNYNNNNSSYNNNNSNRQSR
                     HPYVSDSIPEEEAQSYEMHDVAQGVANDGYGNVGTMHSNPMYRNFVNTNSRGRPAPPP
                     QEYTDVFVNTDLNYRNNSFTDHNQEHSLVTPTTNGPSINIIQNTPELIHGTTSSSILA
                     SQTGNSTTHYFNEEDYYYNNNIIRTEDDINNGDRVNSSYLNTQSGVTPVISDTPSIIS
                     NSEDTRPILNNPVGNEPSFNNHYGYNNNYNNYEQNATHPYYGGEVPNGDIENSYVDPN
                     GDDYQINSYLGKNGEMIDPYEVDEDQYGYGHRSGRELLSVDYMKNKKYDAVTSNRELP
                     EAEGEYSYGDGEDGDLSSGSVISGYAHEDLADLDTNTIDKIKSLNTSFTSSMGSRDML
                     INQEESFKKRSLKRAGTQVRKFKLWKGNFVFDSPISRSLLNQYQSGIDKNNDLSNEFK
                     FMRYQAVTCEPNVLAQQNFTVRQLRYLNPRSTELLIVITMYNEDHILLGRTLKGVMDN
                     IKHMVKKTRSSTWGPDAWKKIVVCIVSDGRAKINEKSLALLSSLGCYQDGFAKDEING
                     KKVVTHVYEHTTMMNVVDVTDDNVELRCDQSTVPIQMLFCLKEQNQKKINSHRWAFEG
                     FAELLRPNIVTLLDAGTMPGKDSIYELWREFRNPQVGGACGEIRTDLGKNYSNLINPL
                     IASQNFEYKMSNILDKTTESNFGFITVLPGAFSAYRLEAVQGLPLQKYFYGESMEHEE
                     KFHFFSSNMYLAEDRILCFEVVMKKNANWILKYSRSSHATTDVPDRVPEFILQRRRWL
                     NGSFFASVYSFCHFYRIWTSGHNIFRKCFLMIEFLYLFFNTLLSWFSLSSYFLVFRIL
                     TLSIATTYKSVFGVLSVVFLWLYGVCLLSTFILSLGNKPKSTELYYVVTFIFFAVLMI
                     YMMFCSVFMSVKSFENLLKEDHITFHGLFTQETFRDMVISLGSTVCLYIASSVIYLQP
                     WHMLTSFVQYLLLSPSYVNVLNIYAFCNVHDLSWGTKGSASKPLGKITSKEDGTFKME
                     ILVSSAEIEANYEKYKKMLYEQPNEEDSKPELSPEEKKTGYYANVRSLVIIFWVMTNF
                     AICAVVLETGGIGDYLTLKTMNKQHTEQIQPRPLLSNKASIYFAIILWLVALSAVIRF
                     FGCTIYMISRFFKRLRHW"
     gene            complement(<1119969..>1121642)
                     /locus_tag="CAGL0J11528g"
                     /db_xref="GeneID:2889530"
     mRNA            complement(<1119969..>1121642)
                     /locus_tag="CAGL0J11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448214.1"
                     /db_xref="GeneID:2889530"
     CDS             complement(1119969..1121642)
                     /locus_tag="CAGL0J11528g"
                     /inference="similar to AA sequence:UniProtKB:P53870"
                     /note="similar to uniprot|P53870 Saccharomyces cerevisiae
                     YNL193w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448214.1"
                     /db_xref="GeneID:2889530"
                     /db_xref="GOA:Q6FNI0"
                     /db_xref="UniProtKB/TrEMBL:Q6FNI0"
                     /translation="MSSAGRRRIPKKKQSKEPVLVTQEDFYLEATNLEEQAERWILSD
                     IKKTLRFYIQASELYTKALHCTNEASQANRYNILYNQVRLYLVVYTEYVAANGYINIL
                     NYINNLEELVGLDQIIFTLPEITQKFESVLQECTSDNSVWDLKFNLLTCYLLLIEGIN
                     GVNPGIGWELDGAQVLTLFQEKFYPCFRELVDDIITSLKEWSEIQQSTDAELNNGLDE
                     KGFQNDTLQDQQASNDGTGVKHMQDSDQQETSLMEVSDQITPDTLIETYTIAYKLIEA
                     ITALIVESKYNGKNALFNDSQIFFFVDALKRFQAQLEEPLLDGQDQQIVDSLDINLSK
                     FSIYGQFMLLEGNTQKESLTKYLEEFELPFGQYNDQEIDIKILSVKADLIETILSTLD
                     DGQQITPANVEEQWFFSSMLSKIYQTISKQLNERRGDVISGKIRGLSDQLSNIVFRQC
                     DIIINASDNDLLRAFLMSIRNPSETRTIEILQKNARTFLTNAMKIAERPCGLEECIVD
                     KLKRNYIFNQAKNRLAILNNELARDQLHQSPDMLAQISDHPYYMRLLSL"
     gene            <1123203..>1124381
                     /locus_tag="CAGL0J11550g"
                     /db_xref="GeneID:2889531"
     mRNA            <1123203..>1124381
                     /locus_tag="CAGL0J11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448215.1"
                     /db_xref="GeneID:2889531"
     CDS             1123203..1124381
                     /locus_tag="CAGL0J11550g"
                     /note="weakly similar to uniprot|P40168 Saccharomyces
                     cerevisiae YNL195c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448215.1"
                     /db_xref="GeneID:2889531"
                     /db_xref="GOA:Q6FNH9"
                     /db_xref="UniProtKB/TrEMBL:Q6FNH9"
                     /translation="MFFPGYFPVKYQNPDIKKAQHFDSKKKSHHHKHHHTDKQSLEVE
                     SSEHISKTNHSQEFGYHSAEDYAKILGEGQAAQAYVNESDNMQSNTHHNMQSGSHHDH
                     DVHMGRAGIPGCGTASHLDYPHTGHGQHYDHHKVGMLPNECPGKDLLHMSPNKVGIPG
                     CGTAGGFTGENISARMNSKNVPMNAQDTTDPEFGPQSRNIPGAGRMDTGIVGGSMATA
                     GANTAGGQFDDAKMNSRNVPMGGMDTTDRAFGGQETANEIPGAGRMGNNGNGGMSSNS
                     GYNAGNVEPNVMLNSTHPKLETGSGAEYETTGKDRKISVGSFEDRHDNSHAYETVEGI
                     TVGHPVSAMPPQQQYNYIRAESTPRSHQHHHGEHKTAEEKKPGFVKKVEQTLHIGSEK
                     "
     gene            complement(<1124993..>1126375)
                     /locus_tag="CAGL0J11572g"
                     /db_xref="GeneID:2889456"
     mRNA            complement(<1124993..>1126375)
                     /locus_tag="CAGL0J11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448216.1"
                     /db_xref="GeneID:2889456"
     CDS             complement(1124993..1126375)
                     /locus_tag="CAGL0J11572g"
                     /inference="similar to AA sequence:UniProtKB:P33895"
                     /note="similar to uniprot|P33895 Saccharomyces cerevisiae
                     YOL069w NUF2 spindle pole body protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448216.1"
                     /db_xref="GeneID:2889456"
                     /db_xref="GOA:Q6FNH8"
                     /db_xref="InterPro:IPR005549"
                     /translation="MATPTQDIFPLLDLEELVICLQSCDFAMATEEHIARPTSQYVIT
                     LYKQIIENFMGISPEQVLAEQLSSRQNTEGNDESTSVDMFDGPYRETLQMLTLNKICY
                     KFFENVGINDFNIVDLYKPEAYRTRRLLSAVVNYARFREERMFDCNQFIIQMEEMLDE
                     LKSKFDDFNYLKAQLTAIEDDDEKTPGELEDLLQKNKVLETNLKKLTILQEKLSIDYN
                     NYKMKKQELLRELEKNSFTLIELESKKERLMNYNDDDQDLQNSLNNSIDRLTEEKKKQ
                     IGYVSKLEGNVSNLKVTVDTLEKAIEHIYDILRLLSTDLQESHRAELNIEGIKGPLTE
                     KRTRLKNLLESNVIYKYDVLKEQLNVAETEYQRINEEHYRETLENKKLIQELEGKYNN
                     IIHNKMQEAEVYIENEITEKKIKILQSELNDIQIQFNNEIDNIELHYSTLVGHINNYM
                     KKLITALNNH"
     gene            complement(<1126896..>1129709)
                     /locus_tag="CAGL0J11594g"
                     /db_xref="GeneID:2889457"
     mRNA            complement(<1126896..>1129709)
                     /locus_tag="CAGL0J11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448217.1"
                     /db_xref="GeneID:2889457"
     CDS             complement(1126896..1129709)
                     /locus_tag="CAGL0J11594g"
                     /note="weakly similar to uniprot|P22579 Saccharomyces
                     cerevisiae YOL004w SIN3 transcription regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448217.1"
                     /db_xref="GeneID:2889457"
                     /db_xref="GOA:Q6FNH7"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:Q6FNH7"
                     /translation="MVTLEFNNVTDSVVKSYNDLKKNLSHEDYNSLISAIRSDIDEFS
                     NGESSPDNSIERVIKGINEQYPHLSSTIRDIFGKDPNEYTTRTCGQNLNVDLIVDELC
                     GILENKQITYIERVLYSDLSRDEKISKLSIALKDEPKVLEKLLALIPTGVIDPRQSTE
                     KNEEQISSIRSTLSQNTDNRCAKFSMLSSKDTFYTPIDRPTNMAEFLIYFRNLVYDES
                     IYPEFLKLMNLFAQSLIDLNTFTKRAYIFFGSHNGLKTAFGNIMSEYKDIHQRMKPTL
                     KSNDFDDIEDFSTESGPSYKRLSGFETRASCHGRDRLCHEVLNDEWVGHPVWASEEVG
                     FIAHKKNQYEETLFKVEEERHEYDFFLLSVEHLIVKFTEYEKSLQLSKDDGRRRNRVS
                     SPKEPMISLNSITEKVIRRLYGIEHGNILIDAIKTNPEKVVPTILKTAKEKYQQWNSA
                     KNEWNKAWREVEQKAYYKSLDHLGLPFKNAEKRFLNDKQLLLEYKSEKQDKLLKEHYD
                     NYEYKYEFFDKSVLYDVKDIILCGLRSNSSTSESQKNLYCQIFEAFFDLLFEESSFTK
                     HLDFQFCHNPAISSNSQISEDDVEAMFMKGILEEKGLGRWFSNDTELKKEFSNRQNIN
                     IFCDINIMSLFHYIQTLYERYNDVKIAETTILKDLRTKKRRPSLLAKSLKLLPMQLSD
                     NGLELGQDDGYEWIKTTSKKFLSGNLDHQWFEESLRINFENKAYKLYTIDRVIRNILG
                     VITTISQTPSLLQILDLLVDNMKKLTTTKLQQLTYRTKVRMLMDGVGDMFRLEIVRDS
                     NAIYGQYIGVDDLLHAQLDKNKLEHSLYCQEYLSADATKYLDTDGLNTPYYSLNLLKR
                     EEQNIPFMNGNIYKPHLSVNINPLDYVVDIAPGSIDICSSTHITKLKSSLKSSRKTQM
                     ASLISKIAKNRKQQRARTIGTMK"
     gene            <1130080..>1130436
                     /locus_tag="CAGL0J11616g"
                     /db_xref="GeneID:2889458"
     mRNA            <1130080..>1130436
                     /locus_tag="CAGL0J11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448218.1"
                     /db_xref="GeneID:2889458"
     CDS             1130080..1130436
                     /locus_tag="CAGL0J11616g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448218.1"
                     /db_xref="GeneID:2889458"
                     /db_xref="GOA:Q6FNH6"
                     /db_xref="UniProtKB/TrEMBL:Q6FNH6"
                     /translation="MISIFSYSSANNLRDHQKCVDSYIPITVVMMPLDYYFSPSYAYF
                     RKIFEGQLLHRLVVQLENKTVFLLLPEKCILIWPSYLKLQLFRGNDMKIIEGRIKIKI
                     KIMIIKYNYWYRNEMK"
     gene            complement(<1130744..>1132984)
                     /locus_tag="CAGL0J11638g"
                     /db_xref="GeneID:2889459"
     mRNA            complement(<1130744..>1132984)
                     /locus_tag="CAGL0J11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448219.1"
                     /db_xref="GeneID:2889459"
     CDS             complement(1130744..1132984)
                     /locus_tag="CAGL0J11638g"
                     /note="highly similar to uniprot|P32562 Saccharomyces
                     cerevisiae YMR001c CDC5 involved in regulation of DNA
                     replication"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448219.1"
                     /db_xref="GeneID:2889459"
                     /db_xref="GOA:Q6FNH5"