GenomeNet

Database: RefSeq
Entry: NC_006034
LinkDB: NC_006034
Original site: NC_006034 
LOCUS       NC_006034            1302831 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome K complete sequence.
ACCESSION   NC_006034
VERSION     NC_006034.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1302831)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1302831)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380957.
            On Aug 5, 2010 this sequence version replaced NC_006034.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1302831
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="K"
     gene            complement(<3332..>5830)
                     /locus_tag="CAGL0K00110g"
                     /db_xref="GeneID:2889957"
     mRNA            complement(<3332..>5830)
                     /locus_tag="CAGL0K00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448233.1"
                     /db_xref="GeneID:2889957"
     CDS             complement(3332..5830)
                     /locus_tag="CAGL0K00110g"
                     /note="some similarities with uniprot|Q08294 Saccharomyces
                     cerevisiae YOL155c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448233.1"
                     /db_xref="GeneID:2889957"
                     /db_xref="GOA:Q6FNG1"
                     /db_xref="InterPro:IPR021031"
                     /db_xref="UniProtKB/TrEMBL:Q6FNG1"
                     /translation="MRKLPLFMAWKFWLICLYIIKVASTQIVIKSNTIVGGNNPSGFQ
                     NGYIVSGDAFLAFQDMNTVPMYQTVRIDKGGALYYINNDKQGFSILSDHNYNHPFVFL
                     NEGTVVVDDRRSISPGSWTIKDGSFTNNGNIMFTSSQGDIFSIGSNYITNTGFIFSKG
                     TSFEKPQRLQIGNGNIWINTGTVCMANTTYILENAIQGGGCISVGENSVFNIYSFDMQ
                     QQTVYLSHPSSVLILNGGHEVPVYGLGNGNGILYPDAPIRDIYYDSSTGIMDVTAGTN
                     GIYKFTVYIGAGYNESNFEIVSSIKIHGISYDNYNFVRYRGPPPNLAPSVCQPCVEIP
                     LYSFQVPDPYTTTNELGFSETVSFYSTYNENDIPVIGNTTIYVPPAIYTLTKVNENTT
                     ETDIISRVTGMGYNGLPFTYYTTITVGEMETGVVTKTITITENKSRSTKTTLMSRNYT
                     FSFSNYSPISSSGTYSVSTVDNITTLTDTVANVSSSGPNSIVTATMTTYQNNHEFNNA
                     SVINVTNSSNIMVPITSTFYSSVDSNLTTPITSLTRTSQSQIVSHITKLASSINETTI
                     ANTFPSPAASGTNYTTVVTNAEGSVQTDIVSHITTTDSDGKPTTIVSHITTTDSDGKP
                     TTIVTTFPAPAASGADYTTVVTNADGSVETDIVSHITTKDSIGKPTTVVTTVPYTLCA
                     SNADYTTVVTKSNVSVETEVVSHITTTAPCSDLESHVENQTTSPSMHTTSLVGSENGV
                     SAKTVNDKPNPTIFTEVAVSEGTTSNAGYVTDQGSSLEMFAPTGASAVESGNKVSQTQ
                     TASIFHGAGSTFKIKFNTILLSTSLTILILLGMA"
     gene            <14140..>18411
                     /locus_tag="CAGL0K00170g"
                     /db_xref="GeneID:9488028"
     mRNA            <14140..>18411
                     /locus_tag="CAGL0K00170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999530.1"
                     /db_xref="GeneID:9488028"
     CDS             14140..18411
                     /locus_tag="CAGL0K00170g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999576.1"
                     /db_xref="GeneID:9488028"
                     /db_xref="GOA:B4UN33"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:B4UN33"
                     /translation="MFNWIIVSYLLIVQWVHANDLGFSLFDKRALSSQNPFGYPIGCS
                     PQSTNVIPGLTMELYSYPIVSGTPPNCYDASYVDPEYPRTGYLKRKMIGKSTGVTGSL
                     NYKFSVEKACMVKYGNLPAGYNYNEPLTVSNFTMLLYGYFKPQTSGIHTFFVNADDLL
                     YINFGAGNAFDCCKREDSKFKLGEYVAYDIWHVDSSKNKVSLNLEKDVYYPIRMFFNN
                     IGKDSSLDLSFSVNGAVEHITDFSGYLYSVPDQPDACPAPIGYDTTCKSIDSTTTYST
                     QFITTKPEENVLPITSTIYYIATPCAKTPSPVPNCEGGFLDPLKNTCYYPKPEDPKPE
                     DPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEKPI
                     DPKPEEPSHNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPS
                     SKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSS
                     VNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVN
                     PSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNP
                     SSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSS
                     KPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSV
                     NPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSPSIFSPSVS
                     TKTVTLSNGSTTTVTVTVTPPSPNGGSSNSNTDSFSLPPPYTTTVSKSTTTETDIVSF
                     FPSTDSDGHTRTGTTTITLTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFP
                     STDSDGHTRTGTTTITLTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPST
                     DSDGHTRTGTTTITLTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDS
                     DGHTRTGTTTITLTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDG
                     HTRTGTTTITLTGSKPGNNGNVGTSSVPPVGNIVITPSVSTRTVTFTNGIISTITTTI
                     RPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNP
                     PSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPS
                     PNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPN
                     GGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGA
                     NSPRLSTSVAVNQPTLSTFKGEGSQAVKMMPTKLLLLVLIAPIFL"
     gene            complement(<20762..>24604)
                     /locus_tag="CAGL0K00231g"
                     /db_xref="GeneID:2890513"
     mRNA            complement(<20762..>24604)
                     /locus_tag="CAGL0K00231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448234.1"
                     /db_xref="GeneID:2890513"
     CDS             complement(20762..24604)
                     /locus_tag="CAGL0K00231g"
                     /note="highly similar to uniprot|P28273 Saccharomyces
                     cerevisiae YKL215c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448234.1"
                     /db_xref="GeneID:2890513"
                     /db_xref="GOA:Q6FNG0"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:Q6FNG0"
                     /translation="MSGNIRIAIDSGGTFTDCIGSKGTQCLDDDVVIKLLSVDPNNYP
                     DAPLEGIRRILEIFQKKEIPRGSQLDLSNVSSIRMGTTIATNSALERTGEKCALVVTK
                     GFKDVINIGDQTRPDIFDLNIRKPLPLYSMVVEIDERVTIEDFSEDPTNKVTEINNSD
                     IVEGRSGEAIRILKEPDPDHIKTVLNVIYGTGIRSIAVAFVHSYTYPKHEQIVYDIAK
                     AVGFSNITLSSDISPMIKYLPRTHSALADAYLTPVLHGYLNRIEDGLKNVSMHSLQFM
                     QSDGGLVQKSKFSGLRSILSGPAGGVVGYSRTCFDTANEIPLIGFDMGGTSTDVSRFG
                     ENRLEHIFETTTAGIIIQTPQLDIHTVAAGGSSILRWENSLFKVGPQSASADPGPACY
                     RKGGPLTITDANLVLGRLVPQYFPKIFGRSENEGLDIDKSYALFKELTKNINNDLGKA
                     LSLEEVAYGFLKVANAAMVRPIRAITETKGYMVSRHRLVSFGGAGGQHAIDIAESLNI
                     DTVLFHRYSSILSAYGIYLADVIEESQTPCSISTKELSFCERIKSIFQKLVEKNVSSL
                     NEQGFDQANIVHEKYLNMRYEGTESCIMIYEQDNSLNFEKWFLEQHEKEFGFTFNNRK
                     IVVDDVRVRSIGKSNVRTDSSVDEQVKKYIKRQTDMIQPQPEFSQQCYLRNKWQQIPV
                     FNIKSLKIGVQIKGPAILADETQTNVILENWTASILKTHIIVNKQEQERKRFTEVSDE
                     INPIMLSIFSHRFMDIAEQMGSQLRKTSVSTNVKERLDYSCALFDPVGNLVANAPHVP
                     VHLGSMSTCIAAQAKIWKGRLKKGDVIITNHPNSGGTHLPDITIITPSFSVSGEIIFF
                     VASRAHHSDIGGILPGSIPPNSKHLYEEGVSIFSDLIVEQGEFMEDRIFRIFVKEPEK
                     YPLCSGARKFSDNLSDLKAQIAANVKGVQLIQRLIDDFTLTTILKYMKAIQDNARNTI
                     KSMLKKLTIYFNRNVFEGKDYMDDGSVIQLKVTLLCEENKYIFDFSGTSPQMYGNLNA
                     PHSIANSAIIYCLRCLVGEDIPLNQGCLDPLTVILPVGSLLNPGEGAAVVGGNVLTSQ
                     RICDVILKTFQICADSQGDCNNLTFGRRSETDINGKQIPGYGYYETICGGAGAGPSSI
                     LKQGWNGADAVHTNMTNTRMTDVEIFERRYPVLLHKFEIRQNSGGKGKYNGGNGVIRD
                     ILFRDEVEVSILSERRALPPNGIYGGECGQRGYNLWIKKDGSEINIGGKNTIIAKKGD
                     RIVIMTPGGGGVGYGECS"
     gene            complement(<25117..>25623)
                     /locus_tag="CAGL0K00253g"
                     /db_xref="GeneID:2890535"
     mRNA            complement(<25117..>25623)
                     /locus_tag="CAGL0K00253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448235.1"
                     /db_xref="GeneID:2890535"
     CDS             complement(25117..25623)
                     /locus_tag="CAGL0K00253g"
                     /inference="similar to AA sequence:UniProtKB:P36036"
                     /note="similar to uniprot|P36036 Saccharomyces cerevisiae
                     YKL214c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448235.1"
                     /db_xref="GeneID:2890535"
                     /db_xref="GOA:Q6FNF9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSQNTKHHRVTNYRRRDLRNTLESRLGLPVEKRRLVPQLFRLKI
                     TNIGLDVSDYTILDIIKEFGEPEYINFRDHKDSRSCISDFKDNEIATKLIEKYNNFEI
                     NGKSIQVTLLDQQKRKRDADQERRKLRHGPRGGYGSHYTKSQKPIEQRNKTVDELNAE
                     LDAYMKES"
     gene            complement(<26129..>28276)
                     /locus_tag="CAGL0K00275g"
                     /db_xref="GeneID:2889973"
     mRNA            complement(<26129..>28276)
                     /locus_tag="CAGL0K00275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448236.1"
                     /db_xref="GeneID:2889973"
     CDS             complement(26129..28276)
                     /locus_tag="CAGL0K00275g"
                     /inference="similar to AA sequence:UniProtKB:P36037"
                     /note="similar to uniprot|P36037 Saccharomyces cerevisiae
                     YKL213c DOA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448236.1"
                     /db_xref="GeneID:2889973"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF8"
                     /translation="MYQLSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSG
                     DWEDVLVYQSDKFLNAVCYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHT
                     GNVCGLRFQNGLLLSSSWDKTAKIWDNNKLKYDLRNHEASVWDSTMVSDDIILTASAD
                     KSIGVWMEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNVFEG
                     HESFVYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLPNGDFVIC
                     CSDNTIRIFTEDQSRVASKDQLDAFKEELEKSAINSETINFDESKLSPYEVLSKPGKK
                     EGQLVVVKSPEGVTEAHQFSCGQWIKIGDVVGSATSGSDQKKEYEGKMYDYVFDVDVK
                     ENEPPLKLPVNITDNPYDIADKFIARYELPPEYRDQIVQFILTNTTGMKVGDTATSDN
                     NRDNSFTSSQTFAMFPVTKILSNKNFNADSIFNGIVKFNLKEQSFDDEDLGLIGSSLQ
                     SVDESWEALYGYANRILKSWENKIPAFDILRVIVDKLPDPNNINDYIDLGLSNKDIVI
                     SMLTVKILVNIFSNKIWGPQLLSSPKVYENIFETIETIYDNATEKKTSNLAIAVSTLL
                     FNFSTMVINDKNGTEMLPVICDTINTKFGPLEEYQANEEASYRLLMAYGNMATIEPTL
                     LQYAKSITWIRQMKHNFGHIDRFKVIFTDLKLH"
     gene            <30321..>32204
                     /locus_tag="CAGL0K00297g"
                     /db_xref="GeneID:2889955"
     mRNA            <30321..>32204
                     /locus_tag="CAGL0K00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448237.1"
                     /db_xref="GeneID:2889955"
     CDS             30321..32204
                     /locus_tag="CAGL0K00297g"
                     /note="highly similar to uniprot|P32368 Saccharomyces
                     cerevisiae YKL212w recessive suppressor of secretory
                     defect"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448237.1"
                     /db_xref="GeneID:2889955"
                     /db_xref="GOA:Q6FNF7"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF7"
                     /translation="MSGPLLFARNADGLYFKPLKNEDSKRVIHLSAHDQLLTAVDGGE
                     FPVAAKSTIKVAALLGFIRLKLNKYAIIADTVEESGRLDGHIIYKVVQHSIVNAKRSS
                     RIDKDEAEYLKLLEMQLKNSTLYFSYTYDLTNSYQRNEHIKSPVGSPYWKTCDKRFFW
                     NHYITEELRSLAQEDSNVEVFIQPIIYGYAKVLDTGLNGVPINVGLITRRSIYRAGTR
                     YFRRGIDENGNVGNFNETEQILQVRKTGGNPELFSFLQTRGSVPVYWAEINNMKYKPK
                     LVLGDNSTLESTKKHFDEQVSLYGDNYLVNLVNQKGHELPVKEAYETAVAGLNNPKIH
                     YIYFDFHHECRNMKWHRVKLLIDHLTEMGLSSKDYFHKIFTMDGLKTEKIVSEQHSTV
                     RTNCMDCLDRTNVVQSVLAHWILQNELETSGVVGEEQLWEQDKSLLSLFQNLWADNAD
                     AVSFSYSGTGALKTDFTRTGKRTKAGAFNDFVNSASRYYQNNLTDGPRQDSYDLFLGG
                     FKPFSTGVVSPFTDRRPFIIQAVPMLLYAAITVLGATILFPKGSFTDSKNMMYFICAA
                     VTTAACVQFLIKNGMQYVNWPKLMDVGFLVAMQTHNKEQEFRGFKYKPDPRFKAPTTS
                     KKD"
     gene            <34290..>37334
                     /locus_tag="CAGL0K00319g"
                     /db_xref="GeneID:2890034"
     mRNA            <34290..>37334
                     /locus_tag="CAGL0K00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448238.1"
                     /db_xref="GeneID:2890034"
     CDS             34290..37334
                     /locus_tag="CAGL0K00319g"
                     /note="highly similar to uniprot|P22515 Saccharomyces
                     cerevisiae YKL210w UBA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448238.1"
                     /db_xref="GeneID:2890034"
                     /db_xref="GOA:Q6FNF6"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF6"
                     /translation="MSKETGEIDESLYSRQLYVLGKEAMLKMQLSNVLIVGLRGLGVE
                     IAKNVALAGVKSLTLFDPEKAVLQDLSTQFFLSESDIGRRRDEVTRGKLAELNSYVPV
                     KTLESLNDDDLKQFQVVVATETVSLEDKIKMNNICHNSGVKFIATETRGLFGQAFVDL
                     GDEFSVIDQTGEEPRTGIVSDIEPDGTVTMLDDSRHGLEDGNYVKFSEVQGLEKLNDG
                     TLYKVEVLGPFAFRIGSVKDLGEYKKGGIFTEVKVPKTLSFKTLQESLSEPEYVFSDF
                     AKFDRVGQLHLGFQALHQFALKHQGELPRTLNDEDANEVLKLVTDLAAQNPNVLGSED
                     AEINEKLIRELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQYMYFDSLESLP
                     DPKQYPRTAENTAPINTRYDNQIAVFGIDFQRKLANSKVFLVGSGAIGCEMLKNWALM
                     GLGSGPDGRIIVTDNDSIEKSNLNRQFLFRPKDVGHDKSDVAARAVSSMNPDLEGKIT
                     PMTDKVGPDTENIFDDAFWEGLDFVTNALDNIDARTYVDRRCVFYRKPLLESGTLGTK
                     GNTQVIIPRLSESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFADAAEN
                     VNLYLNQQDYVQQLMKQSGDVKGTLESIAESLNNKPNNFDDCIAWARLEFEKKFNHDI
                     KQLLYNFPADAKTSTGEPFWSGSKRAPTPLVFDVNEPDHFHFIVGAANLRAFNYGIKG
                     DDGEPDVNYYNSVLTHVDVPEFSPNKNLQIQVNDEDPDPNAGSQNDNLDQLAASLPDP
                     KTLNGFQLAPVEFEKDDDTNHHIEFIAACSNCRALNYSIEVADRQKTKFIAGRIIPAI
                     ATTTGLVTGLVNLELYKVVDGKDDIEVYRNGFVNLALPFFGFSEPISSPKGKYNDKTY
                     DKIWDRFDINGDIKLSDLIDHFEKVEGLEITMLSYGVSLLYASFFPPKKLKERLNLPI
                     TELVKLVTKKDLSSHLKTMILEICADDKEGEDVEVPYVTIHL"
     gene            complement(<37531..>37953)
                     /locus_tag="CAGL0K00341g"
                     /db_xref="GeneID:2890035"
     mRNA            complement(<37531..>37953)
                     /locus_tag="CAGL0K00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448239.1"
                     /db_xref="GeneID:2890035"
     CDS             complement(37531..37953)
                     /locus_tag="CAGL0K00341g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448239.1"
                     /db_xref="GeneID:2890035"
                     /db_xref="GOA:Q6FNF5"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF5"
                     /translation="MFSSLLWIIVCNPLLHGGVVALTNGARTLTKEIQYIFWFSAVIQ
                     AVCFPFMGRNIVTSCVRGSSEFWCNVDVFMFILALFVLTGSIYTAINKVGITNKMIRK
                     KITEFRLKTMAGVSPVNQVIILITIIVALGLIPLISDM"
     gene            complement(<38281..>41964)
                     /locus_tag="CAGL0K00363g"
                     /db_xref="GeneID:2890191"
     mRNA            complement(<38281..>41964)
                     /locus_tag="CAGL0K00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448240.1"
                     /db_xref="GeneID:2890191"
     CDS             complement(38281..41964)
                     /locus_tag="CAGL0K00363g"
                     /inference="similar to AA sequence:UniProtKB:P12866"
                     /note="similar to uniprot|P12866 Saccharomyces cerevisiae
                     YKL209c STE6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448240.1"
                     /db_xref="GeneID:2890191"
                     /db_xref="GOA:Q6FNF4"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF4"
                     /translation="MLSIFKRYHKGNIYMNIRFRKNIWLLILILVCTVINGLVPAISS
                     ILFGRIFHLLDDNSDKVDYNTKRKQLVIRTMSILILGMGNLPFNWLAIYGWMMLGERQ
                     SYIIRKKLFHEYFNLPCSWFDKYRSDIMGEFTQLHRCIEEVRSSSAEASAIMSQSLVA
                     VIALIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAWM
                     LKNIEFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQGFW
                     FGSSMIKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTP
                     RESLAFIDAISGIDLLPIVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSG
                     KSTLFDLILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILA
                     CSNWTNLPSKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAF
                     ARNTSILLLDEPLSAVDMRQRIVLMENIKRWRNGKTTVIITHDLEFIRNTDNILNISE
                     RKILSSALNTEKTQEFKWDDHLTSESIYDNSATVSTDVSYLEEEAFQGEEYQYFAFSA
                     GISEYDQKDLESNTKSVILIPFNEIIYKFIISSSKKHVLVIGLIAAIIAAICNPVFSY
                     TFSYLMNGLLPTSYNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFEL
                     RQETFIKIIKNPISWFSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIG
                     LVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGM
                     KTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFK
                     LVLTGEYTHSKLFETIALLLFTIVTVASLVTQLPDITRGQRSISWIDQILKGDNQQTI
                     EPPSNLSTTKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSG
                     SGKSTLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNL
                     LYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLR
                     NPKVLILDECTSALDVTSAKKINDIIGSRSLAPVTIIVSHQKETIKLCDKIFFLVDGT
                     VAMMGTYEELMENNWEFRKLLNL"
     gene            <42643..>43347
                     /locus_tag="CAGL0K00385g"
                     /db_xref="GeneID:2890190"
     mRNA            <42643..>43347
                     /locus_tag="CAGL0K00385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448241.1"
                     /db_xref="GeneID:2890190"
     CDS             42643..43347
                     /locus_tag="CAGL0K00385g"
                     /inference="similar to AA sequence:UniProtKB:P36038"
                     /note="similar to uniprot|P36038 Saccharomyces cerevisiae
                     YKL208w CBT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448241.1"
                     /db_xref="GeneID:2890190"
                     /db_xref="GOA:Q6FNF3"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF3"
                     /translation="MRTSMILKRSHNLSRYVELPNYYTKFAHEQPAEIRSLGRELQPY
                     ARTLRYKELFESYDFFCVYKWESVQNKDTRFHIRNVWQSFHSDIPKGTNSLFVKERMS
                     CPSMDSLLGRKIYGDDTPMLRMSWHRTNEIDSIIKLLEKVYAKENVFHLHSVGISLPQ
                     HPIILKQLQPLLETTSQNFDYEKLMSIAKKHQNNQSKDKIKVETLLQGLAQRSIVTPL
                     LLKDGQWLVLMPKEKK"
     gene            <43874..>44683
                     /locus_tag="CAGL0K00407g"
                     /db_xref="GeneID:2890188"
     mRNA            <43874..>44683
                     /locus_tag="CAGL0K00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448242.1"
                     /db_xref="GeneID:2890188"
     CDS             43874..44683
                     /locus_tag="CAGL0K00407g"
                     /inference="similar to AA sequence:UniProtKB:P36039"
                     /note="similar to uniprot|P36039 Saccharomyces cerevisiae
                     YKL207w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448242.1"
                     /db_xref="GeneID:2890188"
                     /db_xref="GOA:Q6FNF2"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF2"
                     /translation="MWFDWVWTAVTISGSHVVDELTLDTRLKYWVLLPISVVMVLAGI
                     LRHYVMSLLNPSVKGTARVKLTENQYVLKAQVLLGNNSSLSDEAFEVRREYMAQLLSS
                     GKYIAQTNAKPGEVVNPFSDPNISDAMMNMAKGNMAQFIPQTVLMWWVNHFFAGFVLM
                     KLPFPLTIRFKEMLQSGVMTSDLDVRWVSSISWYFISVLGLNPVYNLILAEPEEDQLG
                     MMQQQQPDQMMGGPGAPQPEAVMKGLANDLTIAQHESCFDNIESRILKMYS"
     gene            <45259..>46407
                     /locus_tag="CAGL0K00429g"
                     /db_xref="GeneID:2890189"
     mRNA            <45259..>46407
                     /locus_tag="CAGL0K00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448243.1"
                     /db_xref="GeneID:2890189"
     CDS             45259..46407
                     /locus_tag="CAGL0K00429g"
                     /note="highly similar to uniprot|P47122 Saccharomyces
                     cerevisiae YJR072c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448243.1"
                     /db_xref="GeneID:2890189"
                     /db_xref="GOA:Q6FNF1"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF1"
                     /translation="MALSTVICIGMAGSGKTTFMQRLNSHIRSKKEVPYVINLDPAVL
                     RVPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIKLVEKKRDTHDF
                     CIIDTPGQIECFVWSASGSIITESFASTFPTVIAYIVDTPRNSSPTTFMSNMLYACSI
                     LYKTKLPMIIVFNKTDVKKSDFAKEWMTDFEAFQQAVREDQDANGDFGMGSGYMSSLV
                     NSMSLMLEEFYSTLDVVGVSSFTGEGFDDFLDAVDKKVDEYEEFYKAERERILKQKEE
                     EEKLRKDKSLNGLMKDLGLNDKKDKEDDSADVISDLEEGENDGLVDRDEDEGVERQYT
                     FAGDERLTGEVNEDSTPALQKRYQEALEDVGKSVSSETAENIARYIRQ"
     gene            complement(<46532..>47338)
                     /locus_tag="CAGL0K00451g"
                     /db_xref="GeneID:2890187"
     mRNA            complement(<46532..>47338)
                     /locus_tag="CAGL0K00451g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448244.1"
                     /db_xref="GeneID:2890187"
     CDS             complement(46532..47338)
                     /locus_tag="CAGL0K00451g"
                     /note="weakly similar to uniprot|P36040 Saccharomyces
                     cerevisiae YKL206c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448244.1"
                     /db_xref="GeneID:2890187"
                     /db_xref="GOA:Q6FNF0"
                     /db_xref="InterPro:IPR016562"
                     /db_xref="InterPro:IPR019151"
                     /db_xref="UniProtKB/TrEMBL:Q6FNF0"
                     /translation="MTAKLIIPLIGTGNVPQLSIDLLLHSTNSFNYVKRIDSKFCYPF
                     SGPLDHAAGEDPKLYNGKTLFSSAIELFKQKDEQIYVIQQRTPIIPGYLNNFIVETLI
                     PVLHEYQITELIVLDSFGALDGVVESLNGSGSFFNVGTCNLSSVNDLIQQFDDHLNLR
                     NNGQVNRVKAFNFDDKGIQQDITTEQDIFKVVYHLTNTSNLQLNKIKYYSTFVHEGDN
                     SEDAYTFYNNLMLAQPEVFPRIDEFHPPVSWKGVYGFTPIRSAYDEGLYT"
     gene            <48964..>52155
                     /locus_tag="CAGL0K00473g"
                     /db_xref="GeneID:2890186"
     mRNA            <48964..>52155
                     /locus_tag="CAGL0K00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448245.1"
                     /db_xref="GeneID:2890186"
     CDS             48964..52155
                     /locus_tag="CAGL0K00473g"
                     /inference="similar to AA sequence:UniProtKB:P33418"
                     /note="similar to uniprot|P33418 Saccharomyces cerevisiae
                     YKL205w pre-tRNA splicing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448245.1"
                     /db_xref="GeneID:2890186"
                     /db_xref="GOA:Q6FNE9"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /translation="MLARIREVVSIANGSTSSDPESKRQAIEYFEQLKNDVQSTEIFV
                     SLMTDEGSDDLMRFVALQVVCEQIGNGILSQAQLTFVRNAAIELLRSKVNVPNGNLKS
                     TPEYIRTKIAELVTRLFYVLYQDQWQSFFPDLTEILQIQSLLENPNENFSLIGIDYFC
                     RICVFINSEIADQTFVRSKEIQQKNNDLKDQMRVQDVQRLVTIWINTLKSIAPNKQPD
                     IAIMIMACIGSYISWIDVTLIVVPEYVSLIINYLEFPETKISCAQCLCEIISKKMKPV
                     DKLSLLSLLDLTTKVASFDNSVDDVDISEQLARLASAVGTELTIILEQCNEANPPTEE
                     SQQLFSAADQQILLQVIPLILKFMLHEYDSVTQQSFQFISQYLAVMKKMFAVGGKAGS
                     VVAVNSKRQSLDSAHEEFLVSLLQVCFKKMKIDESCTEESVDDIEVFCESIRSKLKVF
                     QDTVAVINPQIFLTNISACIQNLINSADWRDIELVIYQLHNLSESIRNNLFGLPKNQI
                     INSEPSMIMNNFMRLLLDNSTVFQMDSSYVQISFFELIVRHYQFLSFSGTKDELSLLN
                     IFCSPFGMFNKREKTRLRTWYLFSRLLKTTKPKFPISVLNEIVGKIAPLLPIKVYSLN
                     NDGVEEDSIFESQLYLFEGLGVLIGGNTDSNFEILNEILTPLFTDLEACISSSQEQPQ
                     VVLQCHHILLAIGTLARAVHSGLVPENRVNNALVSKKLIHRSLIEKFMNIAEVVLVTF
                     SYFSKHETIRDASRFTFSRLIPILSDDIVPFANKLILLYLESNLKMMEMSDFLSFLGQ
                     MIHMFHKEQSCFELFNNLLGPVISKVHVLMTQIEQERNGEENPEWNGTTLNKGHGSNG
                     KNIIITDAFRDKMLLKKAYMGFLQSFVTNNVTSLLLTTQGREVLPTILNDVLEYTPQE
                     IQELSVMKLSLNVLVNFVKFFGSGKCTDPEDMYAASIEKLDGLNEFFITKVIPLVFEI
                     PFKPEYKFNVREGSCRVIASDLSRLLLELYLQSGGGTSIDTNPCLKYLTEVYLPMVQF
                     PPELIMDLVQNLITSNPKSFEKYFVQLITNFTA"
     gene            <53462..>55564
                     /locus_tag="CAGL0K00495g"
                     /db_xref="GeneID:2890185"
     mRNA            <53462..>55564
                     /locus_tag="CAGL0K00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448246.1"
                     /db_xref="GeneID:2890185"
     CDS             53462..55564
                     /locus_tag="CAGL0K00495g"
                     /note="weakly similar to uniprot|P36041 Saccharomyces
                     cerevisiae YKL204w translation initiation factor
                     4E-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448246.1"
                     /db_xref="GeneID:2890185"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE8"
                     /translation="MNFDDSGFFGQRTTGAEQADNQPSQPQSGAQNLSRFFGEFIRRT
                     ENNDETLPDSGNPLQERPQVNIDIGIPSNSGANTTMENASATISVSQLEQSLFSNRIQ
                     PGMVQQQFPVNDHKEEHPVIFEALEMDITEFKPVNTSKEHVYSINELLELSKEIPKHT
                     IESISSMLPKKKFWRLYQKHSEPRSGNNKTRGTDNSFDKKNAKGKGQKLSNTKKFGNK
                     FGRNDRSGYVEENDINTNNDDLIALEEEIGSAPNSMMDFEAWKAKMKEMERRKKGLGG
                     SVDSINPTGGDIPSRSSSALNHNHISEAGTNSISEFLNISSSKIVSNPENELSLQGDD
                     TEIQMNNSPDVAVENEISTRESSTTDLTQIDENRKGGSSRFSSFFSTTSKSKTKDVGP
                     IIESHPNVTTADSSPVKQQGSSTGGSRLMSFFDNKEKNVSSNLQLNSSNSSPKLSMLS
                     SKKEENANQGNMRMEPLNSSMHPHIDNHNITRQGQNMPPINRQDSDRQHTAPTQIMPG
                     MVFPPNPQNNSSFFQDLLSKGKTNDHIRSSMPPPGLMHPGSGNNSSNMGNQRMMPMGM
                     PPPGYPMGMPPPNMMPGPGMPGFPLNNRGQPLGQIPQSKPADSKDGNIDNLQRGNNVN
                     MKGPQFMQNMPPPPGFAPLPNIPMGFPSGQFPPGMGPPPMNQTNFGKNPMNVPASNPY
                     AENQKSAMDNNNQQAFKR"
     gene            complement(<55747..>63162)
                     /locus_tag="CAGL0K00517g"
                     /db_xref="GeneID:2890183"
     mRNA            complement(<55747..>63162)
                     /locus_tag="CAGL0K00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448247.1"
                     /db_xref="GeneID:2890183"
     CDS             complement(55747..63162)
                     /locus_tag="CAGL0K00517g"
                     /inference="similar to AA sequence:UniProtKB:P32600"
                     /note="similar to uniprot|P32600 Saccharomyces cerevisiae
                     YKL203c Phosphatidylinositol 3-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448247.1"
                     /db_xref="GeneID:2890183"
                     /db_xref="GOA:Q6FNE7"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE7"
                     /translation="MQAILRKGADKRIKTGNKSNKLTVRKHRKSEEELSNVSAPGGDP
                     TDNSTARRAASSANGEENAKFIDLENGWDDSDISPSNLYDLFERLKSDDQMVRTNTAM
                     ELRTSIISIAREIPTDQFQRFINTLNNKIFELIHGSSSNEKMGGILAVDSLIDFYLEI
                     GELSNQTTRLANYLRVLIPSNDIDVMRLATQTLGKLALPRGTVTSEFVDFEVKTCLEW
                     LTASTDNPPLNFKQEYRRHAAILILYSLIENSPYLLFPYINPILDNIWGSLKDTKLII
                     RRDAAETMRKCMETLQSRDPQNAREWYQRSFSTATQGLNSNNIESIHATLLTFKELLN
                     LKDSYIKDKYSQIFQVVIKFRDHKNDIVRREVYAILPLLAMNDSDIFASKYLDPTMSF
                     YLKVLKDMDSSTANNADKEAIFISIGDLSENVRSKMHSYIHQLEINLREGLQTKYKIR
                     KHYEKALFYCIIKLTAALGPAIATNINKGFLDLILSCPLSSHLLEVMATIKKSIPALS
                     TSIDKRLIEIVHAYLSGERYNDGTNSQIMKTVSLPLARKWRDRDYCWKTGDQNSDNND
                     DFLLVQTLKMVDIIDPKHLVSEHTKMSIIAYIEHTHETVRKLAALKSVELYKLTEANL
                     PDDEHALDTSATVLGKLLVLAITDPNSNIRLSILQSFDYHFSSQLAQPDNLRLLFCSV
                     NDEVYTIRLEAIRVIGALTEFNPIYVVPEMQKIFLSFLTELKYSATNRKKENMLTLIH
                     AVINSHPDTLVPFIKDCLDSLIQRLEDNSSAVATIAMKTIGALAEAVGPDITNYVHQL
                     MPIIISTLHNQLNSIKRATAIKTLIQISSSTAYVIDPLIEYPELLGLLMNILKTESNM
                     EIKRDIIQLIGTLGAIDPYKYRAVETNSKGVQKIDTTQHSTAIDLLIKGMSPSNEEFY
                     PSVVMHSLVKILNDNSLSSYHTNTLQTIMRIFQDMGVQSIIFLKILVPAIKSVVKTCP
                     PSHLEFYFQQLSVLVNTVNHHIEPFTEDIFEIIADHFSITKLQVVIISLIESMSHLVK
                     NNLKRFLPKTVNLFLNVLENDRSNQKMASVSIMKALIAFGKNLEDYSHLIIPTIVRIC
                     EYSQNHLRKISIVTFGKLAKCINLTELSSMIINALVRVLTNGDKSLIKVTMNTLCLLL
                     LQLGNDFVVYIPTIHSVLIKNRIQHSIYDQLVNKLLNGEVLNTNILLDKDSEEKNKNI
                     NLQNNPRTEKFVVDQQILKSAWDCSQQKSKEDWQEWFRRLSVHTIRESASPSLRACSN
                     LVSVYNPLARDLFNVSFSSCWNELNIGSREHILNSLCSALSSPQNPTEIYLILINLIE
                     FMEHDMNPLPIPATITGEYAQKCNAFAKALHYKETEFIENEKPCIIESLIDINNQLHQ
                     PDASIGILKYAQQHYNLQLKETWYEKLQRWDDALQAYTDREKNGEDTPEVLMGKMRSL
                     YALGNWSEIADLANDKWNTVPLHIQEKLSPIAAGSSWALHNWDDIEKYCSILQDNSID
                     KEFFSTVMCLHHNNFEEAEQHADNVNSLLVGEMSALINESYSRIYNSVAKCQTVAELK
                     EIIKYKRLPRMSPKRKAMRETWNKRLLGCQQNIDVWQVILKTRSLVVNPEDDEEIWIK
                     FANLCRRNGRMNMTRDVLNSLLKFNEMSENPDILQASPEVVYSYLKYKWDTGEKNSAL
                     NQLAIFIGKVIRDLGLHPEHIISNKTFQSKTNISPNERPKYQKLLATCFAKQGDWTIA
                     LDPNWSNTDPGSVLSSYLLATHFDPQWYKAWHNWALANFEVISMMSSTNKDTNYQKSN
                     APITSFYQIRNNIFEKNGETPYYNQFPSRLINNHVVSAIKGFFHSIALSDSSLLQDAL
                     RLLTLWFTFGSTSETTQAMQEGFNMVKISTWLEVLPQLISHIHQPNPLISRALLTLLS
                     DLGKEHPQALVYPLTVAIKSESLSRQKAAISIIDNVRSHSPVLVDQAELLSRELIRVV
                     ALWNEMWYEGLEDASRHFFGENDNTKMLETLEPLYELLNKGPETIREISFKYAFGKDL
                     TYAYEWVKKYKETGEVSNLNQAWDIYYSIFKKINKQLPQMETLELQHVSPKLLAAKNL
                     ELAMPGTYIPGTEIVTIESVNGTCEVISSKQRPRKIALKGSDGKEYLYVLKGHEDIRQ
                     DSLVMQLFGLVNTLLQNDIECFQRHLDIQQYAAIPLSPKTGLLGWVTESDTIHVLIKD
                     YRDAKKMPLNIEHLVMLQMAPDYDSLTLLQKVEVFKYVLDNTQGFDLYNILWLKSKSS
                     ETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLNRNTGKVVHIDFGDCFEAAILR
                     EKFPEKVPFRLTRMLIKAMEVSGVEGSFRITCENVMRVLRDNKDSLMAILEAFAFDPL
                     IRWGFDLPTEQIKKENDKHFKATESIYGIDEASSMSNITTTSVKDKKREYINTRAVLV
                     LKRISSKLTGNDIPKHEDLDVAEQVDHLIEQAKSVENLCQHYIGWCPFW"
     gene            complement(<64028..>65398)
                     /locus_tag="CAGL0K00539g"
                     /db_xref="GeneID:2890184"
     mRNA            complement(<64028..>65398)
                     /locus_tag="CAGL0K00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448248.1"
                     /db_xref="GeneID:2890184"
     CDS             complement(64028..65398)
                     /locus_tag="CAGL0K00539g"
                     /note="highly similar to uniprot|Q00776 Saccharomyces
                     cerevisiae YPL259c Clathrin coat assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448248.1"
                     /db_xref="GeneID:2890184"
                     /db_xref="GOA:Q6FNE6"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE6"
                     /translation="MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETN
                     LIPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEE
                     SIRDNFVIIYELLDEMMDYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSL
                     TNSVSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLK
                     LGINDKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKF
                     ENEKQITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKS
                     TATNVEILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLP
                     STNAGEESEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDD
                     YTIRLS"
     gene            complement(66068..66139)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0K00561r"
                     /db_xref="GeneID:2890182"
     tRNA            complement(66068..66139)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0K00561r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2890182"
     gene            complement(<67074..>67970)
                     /locus_tag="CAGL0K00583g"
                     /db_xref="GeneID:2890230"
     mRNA            complement(<67074..>67970)
                     /locus_tag="CAGL0K00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448249.1"
                     /db_xref="GeneID:2890230"
     CDS             complement(67074..67970)
                     /locus_tag="CAGL0K00583g"
                     /note="highly similar to uniprot|P25358 Saccharomyces
                     cerevisiae YCR034w V-SNARE bypass mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448249.1"
                     /db_xref="GeneID:2890230"
                     /db_xref="GOA:Q6FNE5"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE5"
                     /translation="MLQDYTPTVDRPFFNIYLWSHFNDAASYLTNGRFVPDEFQFFPG
                     GPPLSKFSHVLVGIATYYLLVFGGRYMLRNTRPFKLNTLFQCHNLFLTSFSFLLLTLM
                     VEQLVPLLIRHGLYDTLCSKYAWTQPLMTLYYLNYLTKFVEFIDTLFLVVKHKNLTFL
                     HTYHHGATALLCYIQLVGHTTIAWVPITLNLGVHVVMYWYYFLAARGIRVWWKEWVTR
                     FQIIQFILDVGFIYFAAYQKTAYRFYPSWPHCGDCVGTLTSNYSGCAIISSYLFLFIA
                     FYIEVYKRSGTKKPVTTNKKKN"
     gene            <69112..>70683
                     /locus_tag="CAGL0K00605g"
                     /db_xref="GeneID:2890231"
     mRNA            <69112..>70683
                     /locus_tag="CAGL0K00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448250.1"
                     /db_xref="GeneID:2890231"
     CDS             69112..70683
                     /locus_tag="CAGL0K00605g"
                     /inference="similar to AA sequence:UniProtKB:P09119"
                     /note="similar to uniprot|P09119 Saccharomyces cerevisiae
                     YJL194w Cell division control protein 6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448250.1"
                     /db_xref="GeneID:2890231"
                     /db_xref="GOA:Q6FNE4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015163"
                     /db_xref="InterPro:IPR016314"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE4"
                     /translation="MSYQRALRPRNTPLPVTPTKDVPVNVVPLKRTKLVFETPIQTKR
                     HREAESLPSPAASPKKQCVGVSHGLLSLTARVKACLQRSASTQYDDVSGCLVSRRTQF
                     DQVIQFLNSAISEGRSDSLYITGPPGTGKTAQLNSILKHRFTPVASPVSPLSDITNLH
                     DFVLPNGNVEKVAIISINCITVNDPSSIFNKIYLSFLNSDGGNRAVPQRYSVKTMLDL
                     KNFMTRYASEMTFIVILDEMDKLVHTNSASVNATKVIFELFLLAKLPEIKLLLIGIAN
                     SLDLKDRFLSRLNLKQELLPETVVFQPYTADQMYEIINHRINSVLLATEESLFNPMAI
                     RFAAKKCSGNTGDLRKLLDILRNSVEVMELERITASRRCVTDENDRPLPAENKPMKVG
                     LQHIAKVFTQINNTQSTKSMITKLNMQQRIVLCTLIHRQKIDIFQGHCTIDDAYDYYL
                     KLLRGSENFVALKRNEFLEICNALEMMGVATITTGRISGKRRGMVKLIKGTVDNNEFN
                     QEMSKFDILKELLII"
     gene            <71269..>72501
                     /locus_tag="CAGL0K00627g"
                     /db_xref="GeneID:2890229"
     mRNA            <71269..>72501
                     /locus_tag="CAGL0K00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448251.1"
                     /db_xref="GeneID:2890229"
     CDS             71269..72501
                     /locus_tag="CAGL0K00627g"
                     /inference="similar to AA sequence:UniProtKB:P39542"
                     /note="similar to uniprot|P39542 Saccharomyces cerevisiae
                     YJL193w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448251.1"
                     /db_xref="GeneID:2890229"
                     /db_xref="GOA:Q6FNE3"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE3"
                     /translation="MLTKLPHSVQTNIHIITLCLCWYFISSLASQVTKQILTICPLPL
                     FLGEFQFLFTALLAAISCALAFNYRWIYDLFPEGTFPRYYVTIHEHENERDQERIYAI
                     TRPSKHIITTVLPLSFFQFVGKYFGHTATALVPVSTVASVKTLSPVFIVIFQKMLKMP
                     TVNLNVRILTSLAALIFGVWLIVNEDNKQKLASKKKTQLIDTESGRSSNYGIVCAIIS
                     MFIFVMQNIYGKKVFTYKRNHEKTMIPKKKSIYNLGDNPSELPIYSESKTLSPKTTKY
                     DKLTLMIYISLVGFSLSFFWFMTIEFSTVWRYLCGYTTQSDGQPLIISTIPWTLFLLN
                     GVFHFMQAMITFHLLGEVSTLTYSIANLMKRIAIISVSWLFAGIHVTLLQIVGLSLNA
                     IGLFLYERYSSTQKHANK"
     gene            complement(<72798..>73532)
                     /locus_tag="CAGL0K00649g"
                     /db_xref="GeneID:2890228"
     mRNA            complement(<72798..>73532)
                     /locus_tag="CAGL0K00649g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448252.1"
                     /db_xref="GeneID:2890228"
     CDS             complement(72798..73532)
                     /locus_tag="CAGL0K00649g"
                     /inference="similar to AA sequence:UniProtKB:P39543"
                     /note="similar to uniprot|P39543 Saccharomyces cerevisiae
                     YJL192c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448252.1"
                     /db_xref="GeneID:2890228"
                     /db_xref="GOA:Q6FNE2"
                     /translation="MWKSVIYLFVLLLGVIRAEDVKDLRNNEVSIKGRLELSEIDISA
                     YMIPRCSFRLYQIGNYSADKPFHQITRIKDKNGTFEFNHVPINHGVNESTYFVMTPSS
                     RDFNLLPQRVLVEVTNIFNETTGKVEQQLKAFRNYFGREYFPSKDIHFPDKLEEMDAL
                     PYISIKMSKMLPFRDYLQQRNVGLLQSGPLAGILNSKWKIAAVITLLALMTFPYLVEK
                     LDPETARAMKEEARKKQREKYVVKEE"
     gene            <74297..>75272
                     /locus_tag="CAGL0K00671g"
                     /db_xref="GeneID:2890227"
     mRNA            join(<74297..74306,74866..>75272)
                     /locus_tag="CAGL0K00671g"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_448253.1"
                     /db_xref="GeneID:2890227"
     CDS             join(74297..74306,74866..75272)
                     /locus_tag="CAGL0K00671g"
                     /note="highly similar to uniprot|P39516 Saccharomyces
                     cerevisiae YJL191w CRY2 or uniprot|P06367 Saccharomyces
                     cerevisiae YCR031c CRY1"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_448253.1"
                     /db_xref="GeneID:2890227"
                     /db_xref="GOA:Q6FNE1"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE1"
                     /translation="MAKDLVQSRDASQVFGVARIYASFNDTFVHVTDLSGRETISRVT
                     GGMKVKADRDESSPYAAMLAAQDVAAKCLEVGITAVHVKIRATGGTRTKTPGPGGQAA
                     LRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            complement(<75466..>78096)
                     /locus_tag="CAGL0K00693g"
                     /db_xref="GeneID:2890514"
     mRNA            complement(<75466..>78096)
                     /locus_tag="CAGL0K00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448254.1"
                     /db_xref="GeneID:2890514"
     CDS             complement(75466..78096)
                     /locus_tag="CAGL0K00693g"
                     /inference="similar to AA sequence:UniProtKB:P32944"
                     /note="similar to uniprot|P32944 Saccharomyces cerevisiae
                     YJL187c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448254.1"
                     /db_xref="GeneID:2890514"
                     /db_xref="GOA:Q6FNE0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FNE0"
                     /translation="MENSEFGKGLGIYYDFDQRSDGMVPDDPPQNNDDASSMDDEEMN
                     SYNSPNGSNRLKFYPYSNNSMTRSVATLNLSISNSHNQVEETLPSKNNRIRQGLDFGI
                     PSSNTRLQLPAITKTTVDYSKTENKNFNMETCLNDWSPFNYNGSSSSNSSKSELSPFV
                     NNPETLKKWSWMPKQNKKHGKPLDKANIIITQTPRNTSKNHPDFEIAKPDPSAFETSG
                     LKPKSLLNTAQKLAVPNTPVKKSPFIDTGNTFSSASRVADSSILEFSTLNYRNSTTGH
                     TSFLFSPSLNKTPVHDKFYNSTGILDDSPLQLSKGQKSNNKDFKQNNVRPLHSESNTP
                     DSTHKGSYKKIKKSRDSVILKNIELSNSLLQFTNDLYDEEENRNNNKENHPTIFESEA
                     DDECVPPAGKADDHRRDKNCGLSLHISSPKYNSQISTKSNVNHLITVESSYDVKSLLT
                     PTRTKSIAGAKMTDKLANPYLNEELSSFDGLSPLSSKKKIHNQENPDMHLSKKFEDIS
                     IIGQGPFSTVYYVVDPETNKKFAIKSMQINKKNPIKRILQEINLLTEFQSTNLDEEGK
                     EYIIDYITSWKYGDSYYIMTDFYENGSLDKFLQEQVVSKKTKLEDWRIWKIMVEICLG
                     LRFIHDSCQVVHLDLKPANIFITFEGNLKIGDFGMATHLPLTDKSFENEGDREYIAPE
                     IITDSVYDFKADIFSLGLIMVEIAANVILPDNGNAWHKLRSGDLSDAGRLSSTDIHSE
                     SLFSSVTKVEKGNSGLLDYNREVLSQIDSNAFEGNSNPVLDLPHSSTTKVSNKLNSNI
                     NAEKQHSRDSIPAWVPKFLIDGESLDNIVKWMIEPNYKRRPSADEILHTEECLYVEMT
                     RKAGAIVQEDDYGPRPEFFQ"
     gene            <80166..>81185
                     /locus_tag="CAGL0K00715g"
                     /db_xref="GeneID:2890515"
     mRNA            <80166..>81185
                     /locus_tag="CAGL0K00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448255.1"
                     /db_xref="GeneID:2890515"
     CDS             80166..81185
                     /locus_tag="CAGL0K00715g"
                     /inference="similar to AA sequence:UniProtKB:P53047"
                     /note="similar to uniprot|P53047 Saccharomyces cerevisiae
                     YGR213c RTA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448255.1"
                     /db_xref="GeneID:2890515"
                     /db_xref="GOA:Q6FND9"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:Q6FND9"
                     /translation="MSTNSTINLSDDFKFDFYKYTPNLGASIAFAVLFLIAAIIITGQ
                     LWILTKSHRQFLTQWMNSPTYYANIRHYNTFKLFAAHIPLIVGCIIEVVGYIARSVSR
                     HDVYSLPPFAVQVVLLLVGPTLYAASIYMVFGRMAHLMFVENLMIMPARFNTVIFVLG
                     DVASLLLQAAGGGMQASASTEKAGSNIVTVGLFIQIAFFGIFMINEFLFVIRVRALRN
                     KNKIASKSNTWIYYNWILIVNSAMILVRSIVRTVEFIQGYDGYITSHEYFLYIFDATP
                     MFLLPLITIVFMMKYNIFEIQRESIQIQSELDKDYESEDNDSSLDIEADIEDGSENRM
                     SKTEF"
     gene            complement(<81263..>82636)
                     /locus_tag="CAGL0K00737g"
                     /db_xref="GeneID:2890517"
     mRNA            complement(<81263..>82636)
                     /locus_tag="CAGL0K00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448256.1"
                     /db_xref="GeneID:2890517"
     CDS             complement(81263..82636)
                     /locus_tag="CAGL0K00737g"
                     /inference="similar to AA sequence:UniProtKB:P53304"
                     /note="similar to uniprot|P53304 Saccharomyces cerevisiae
                     YGR212w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448256.1"
                     /db_xref="GeneID:2890517"
                     /db_xref="GOA:Q6FND8"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:Q6FND8"
                     /translation="MVRHLGGIEQYFYQRSSLNLHSCFSVGVELNSLPNRSDFICALR
                     RVVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINSVFRKYNFE
                     YGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEELKQDNDLDVDEI
                     IYRPGGSTDSIDQCHPYEKLPIPFSWKVKRPIVKALFTIAPGAVVSQDASIIQFDEYK
                     IPEDYLKKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDCKQHHVSFTAYLTAVLYL
                     ALGKIPKEKYSGSTIKYEVPMNTRNRISNSGEYSNSYGTFVAGGEFIETLDFERDEWE
                     LAQSIHKKIVEKSTTGVMDAINEARLLELVDAKKFMKMKFETTTGPSSTFEVTNLGFQ
                     NFSQNEHSKYTVTDAFFNEPQLFTNLITYSVISTPSGGLNCSMAYPEKLDSILCNSVA
                     FLKNKFN"
     gene            complement(<83056..>84495)
                     /locus_tag="CAGL0K00759g"
                     /db_xref="GeneID:2890192"
     mRNA            complement(<83056..>84495)
                     /locus_tag="CAGL0K00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448257.1"
                     /db_xref="GeneID:2890192"
     CDS             complement(83056..84495)
                     /locus_tag="CAGL0K00759g"
                     /note="highly similar to uniprot|P53303 Saccharomyces
                     cerevisiae YGR211w Zinc-finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448257.1"
                     /db_xref="GeneID:2890192"
                     /db_xref="GOA:Q6FND7"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:Q6FND7"
                     /translation="MSEDKLFKPVGEAANEVQEENDNGVSLTGASDAMGHPVQEIESL
                     CMNCEKNGVTRLLLTSIPYFREVVLMSFECPHCGFKNSEIQPASQIQEKGSKYQLKVE
                     SKEDFNRQVVKSETATCKFVELDVEIPAKRGQLTTVEGLLSEMIEDIEQDQEMRKSID
                     ENLYNQIAEFIKKVRSYINCEPGTLPLTFILDDPSGNSWIEYKPGEPQHKWSHVQYVR
                     SDEQNVVVGILTEDQYEQRRRAKLEELSNKGRNPSESVKVGSANAEFLSDATDIENFN
                     NEVQTFRASCPSCTQECETHMKPVNIPHFKEVIIMSTTCEHCGYKSNEVKTGGSIPEK
                     GRKITLLCDDPADLSRDILKSETCSLHIPELHLDIQEGTLGGRFTTLEGLLKQVYEEL
                     ESRVFTQTSDSMDEATKQRWVDFFAKLKEALDGKVHFTVIMEDPLAGSYIQNVYAPDP
                     DPNMKIEDYERTQQQNEDLGLNDMKTDAN"
     gene            <84829..>86055
                     /locus_tag="CAGL0K00781g"
                     /db_xref="GeneID:2890193"
     mRNA            <84829..>86055
                     /locus_tag="CAGL0K00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448258.1"
                     /db_xref="GeneID:2890193"
     CDS             84829..86055
                     /locus_tag="CAGL0K00781g"
                     /note="highly similar to uniprot|P42942 Saccharomyces
                     cerevisiae YGR210c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448258.1"
                     /db_xref="GeneID:2890193"
                     /db_xref="GOA:Q6FND6"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FND6"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDASAAVGSFPFTTIEPNKA
                     TGYLQVDCACSRFGKEELCKPNYGWCEKGKRHIPIMLLDVAGLVPGAHSGRGLGNKFL
                     DDLRHADALIHVVDVSGTTDAEGKNCRGYDPLNDIEWLQDEIRLWIENNLKKRWGSIV
                     RRHTATKSSVVDTLQAQFGGYGSLIPMVQRCLDRLEGLPPLEKWDDEWITKVVKSFMM
                     EKFPTVLALNKIDHPDADKNVSKIMLKYPETKAVLTSAITEVFLRKLKKQGFIQYDSG
                     TEFVDTCEDDPSLKPLDEKSLARIENIRDLVLYRFGSTGVVQVLQAATDVLDLIPVYT
                     VKNMTTFTGGNGTNVFRDCFLVKRGTPVGKVARYILGDVTVAAIETVGSVRVSEETPV
                     LPGKNDILTFKIAPRS"
     gene            <86725..>87036
                     /locus_tag="CAGL0K00803g"
                     /db_xref="GeneID:2890194"
     mRNA            <86725..>87036
                     /locus_tag="CAGL0K00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448259.1"
                     /db_xref="GeneID:2890194"
     CDS             86725..87036
                     /locus_tag="CAGL0K00803g"
                     /note="highly similar to uniprot|P22217 Saccharomyces
                     cerevisiae YGR209c thioredoxin II highly similar to
                     uniprot|P22803 Saccharomyces cerevisiae YLR043c
                     thioredoxin I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448259.1"
                     /db_xref="GeneID:2890194"
                     /db_xref="GOA:Q6FND5"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q6FND5"
                     /translation="MVKQITSVSEFDSAIAVDKLVVVDFFATWCGPCKMIAPMIEKFA
                     AEYSTADFYKLDVDELPEVAQKNEVSAMPTLVLFKNGKEVAKVVGANPAAIKQAIANN
                     V"
     gene            complement(<87331..>88218)
                     /locus_tag="CAGL0K00825g"
                     /db_xref="GeneID:2890195"
     mRNA            complement(<87331..>88218)
                     /locus_tag="CAGL0K00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448260.1"
                     /db_xref="GeneID:2890195"
     CDS             complement(87331..88218)
                     /locus_tag="CAGL0K00825g"
                     /inference="similar to AA sequence:UniProtKB:P42941"
                     /note="similar to uniprot|P42941 Saccharomyces cerevisiae
                     YGR208w Phosphoserine phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448260.1"
                     /db_xref="GeneID:2890195"
                     /db_xref="GOA:Q6FND4"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023190"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FND4"
                     /translation="MSFVVTVIAHGDALRSEKELVDRVVGALDAELIKTETLSKRAVD
                     IFVKAPGEVLQLKQKLDQLDVDGADLAVQVVDEQLQRRPLKLCVFDMDSTLIYQEVIE
                     LIAAYAGVEPQVHEITERAMNNEIDFKQSLRERVRLLKGLKIDNLYEEIKQKLQITEG
                     VPQLCSTLKQHGIKLAVLSGGFIQFASYIKDQLSLDYARANLLEMDDSGVLTGEVIGE
                     IVDGQCKAETIKQLCKDWSIDLENVCMIGDGGNDLPSMHVSGYGIAWNAKPTVQKQAP
                     SKLNTKSLADALYIFGIIE"
     gene            <88542..>89321
                     /locus_tag="CAGL0K00847g"
                     /db_xref="GeneID:2890196"
     mRNA            <88542..>89321
                     /locus_tag="CAGL0K00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448261.1"
                     /db_xref="GeneID:2890196"
     CDS             88542..89321
                     /locus_tag="CAGL0K00847g"
                     /note="highly similar to uniprot|P42940 Saccharomyces
                     cerevisiae YGR207c electron transfer flavoprotein
                     beta-subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448261.1"
                     /db_xref="GeneID:2890196"
                     /db_xref="GOA:Q6FND3"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:Q6FND3"
                     /translation="MSKPLRILVPVKRVVDFQIKPRVNKTLTGIEKSGIKFSINPFDD
                     IAVEETVRIKEKHGDLVEHTQAVSIGPAKAQDILRNCLAKGIDNVSLIDCKDLELEPL
                     AVAKVLKNIVEKQNINLIIMGKQAIDDDFNHTGQMLAGLLNWPQATNAAKVDILADEG
                     KVRITREIDGGEETLKASLPLIITTDLRLNTPRYVGLPNLMKAKKKPMEKLTLEKDFA
                     DIDTKPRLEILSVNEPNAKEPGITVGSVDELVQKLKDSKVL"
     gene            complement(<89436..>89774)
                     /locus_tag="CAGL0K00869g"
                     /db_xref="GeneID:2890197"
     mRNA            complement(<89436..>89774)
                     /locus_tag="CAGL0K00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448262.1"
                     /db_xref="GeneID:2890197"
     CDS             complement(89436..89774)
                     /locus_tag="CAGL0K00869g"
                     /note="weakly similar to uniprot|P42939 Saccharomyces
                     cerevisiae YGR206w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448262.1"
                     /db_xref="GeneID:2890197"
                     /db_xref="InterPro:IPR019014"
                     /db_xref="UniProtKB/TrEMBL:Q6FND2"
                     /translation="MSDNQLKNIDDILNNIPLRNKFGDNYPRERLSKVEVPLYKIENI
                     ADSKKMFEPWYKECDEIIAACEVHDQLGRNFEQWYNEKYISTKPPGMVQGNGEISVLS
                     PSKKHGEMLK"
     gene            complement(<90112..>91011)
                     /locus_tag="CAGL0K00891g"
                     /db_xref="GeneID:2890147"
     mRNA            complement(<90112..>91011)
                     /locus_tag="CAGL0K00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448263.1"
                     /db_xref="GeneID:2890147"
     CDS             complement(90112..91011)
                     /locus_tag="CAGL0K00891g"
                     /inference="similar to AA sequence:UniProtKB:P42938"
                     /note="similar to uniprot|P42938 Saccharomyces cerevisiae
                     YGR205w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448263.1"
                     /db_xref="GeneID:2890147"
                     /db_xref="GOA:Q6FND1"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FND1"
                     /translation="MADKLNSLEHCMKFVDEYVPAWFETGKRDPLFIFISGPQGSGKS
                     YVGKRIYEHLKDYYKDQKSVAYASMDDFYLTHEAQQKLNKEYPNNKLLQGRGLPGTHD
                     MALLYKCINAILQRHGNDNDSIDGDHLQDSSKLVLPKYDKSAFNGEGDRSTVTVSEKI
                     PVDIFILEGWFLGFEPILQNFESEETVKGDMVDVNSKLFIYSDLLWDNPEIKSLGIVF
                     AADQLENVYDWRLQQEKELIAKTGNGMNDEELKKFVDRYMPCYDLYYNHLIHTESLGS
                     VATLTLGLDKERKVFSFKTRYIE"
     gene            complement(<91347..>94187)
                     /locus_tag="CAGL0K00913g"
                     /db_xref="GeneID:2890148"
     mRNA            complement(<91347..>94187)
                     /locus_tag="CAGL0K00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448264.1"
                     /db_xref="GeneID:2890148"
     CDS             complement(91347..94187)
                     /locus_tag="CAGL0K00913g"
                     /note="highly similar to uniprot|P07245 Saccharomyces
                     cerevisiae YGR204w C1-tetrahydrofolate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448264.1"
                     /db_xref="GeneID:2890148"
                     /db_xref="GOA:Q6FND0"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FND0"
                     /translation="MAELIDGKACAQGIRASIKEEIEAIKQQNPSFVPTLTIVQVGDR
                     PDSATYVRMKRKAAEEAGIRADFLHLAEDVSENELYEEVTKLNENPDIHGVIVQLPLP
                     GHINEDKITSAVVAEKDVDGFGPINIGELNKKNGKPFFLPCTPKGIIELLKQAGVQIA
                     GSKSVVIGRSDIVGSPVAELLKSLDSTVTITHSKTPDIPSYLNDADIVVVAIGKPEFV
                     KGEWFANNKKGAVVIDVGTNYVDDSTKKSGYRCCGDVEFKEACKYVRKITPVPGGVGP
                     MTVAMLMQNTLIAAKRQLETGGKLSEFEPLPLQLKRPVPSDFEISRAQKPKQITKVAL
                     EAGILPSELEPYGSTKAKVSLNILDRLKDRENGKYILVTGITPTPLGEGKSTTTVGLT
                     QALGAHLNKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMA
                     NNLLAAAIDTRMFHESTQKDGPLYKRLVPAKKGERKFTPTMLRRLKKLGIDKTNPDDL
                     TDEEITRFARLDIDPETITWRRVVDCNDRFLRGITVGEAPTEKGFTRKTGFDISVASE
                     CMAILALCNSLSDMRERLGKIVVAASKSGEPITCEDIGCAGAMTALLKDAVKPNIMQT
                     LEGTPVFVHAGPFANISIGANSVLADKIALKLAGVDPKLPEEKKKEQVGYVVTEAGFD
                     FTMGGERFLNIKCRSSGLVPDVVVIVATVRALKVHGGGPEVKAGAPLPSEYLNEDVEL
                     LRKGCANLAKHIENAKQYNLPVVVAINKMSSDTDKEHEVIREESLKAGAYDAIVSDHW
                     AEGGAGAVDLAKGIIKAADETDNSKFSFLYESQGKVEDKIQKIANAMYGAKDVEFLPE
                     AQKKIDLYTKQGFGDLPICIAKTQYSLSHDANLKGVPKDFTFPIRDIRASIGAGYLYA
                     LAAEIQTIPGLPTHCGFMNIEVNEDGEIEGMF"
     gene            complement(<94846..>95286)
                     /locus_tag="CAGL0K00935g"
                     /db_xref="GeneID:2890149"
     mRNA            complement(<94846..>95286)
                     /locus_tag="CAGL0K00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448265.1"
                     /db_xref="GeneID:2890149"
     CDS             complement(94846..95286)
                     /locus_tag="CAGL0K00935g"
                     /inference="similar to AA sequence:UniProtKB:P42937"
                     /note="similar to uniprot|P42937 Saccharomyces cerevisiae
                     YGR203w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448265.1"
                     /db_xref="GeneID:2890149"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC9"
                     /translation="MSRSIANIQYLEAKNLAHWMKSADAPLFQVIDVRGSDYVGGHIK
                     GCWNYPYRRLKVDDGYMEEMYKALNKKLEDTGSDRSLNAIFHCAQSQQRGPAAAMKLL
                     RFLPDDKLSNFKIWVLRGGFNHWQDQYGEDQELTEDYEPDIWSW"
     gene            <95657..>98038
                     /locus_tag="CAGL0K00957g"
                     /db_xref="GeneID:2890150"
     mRNA            <95657..>98038
                     /locus_tag="CAGL0K00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448266.1"
                     /db_xref="GeneID:2890150"
     CDS             95657..98038
                     /locus_tag="CAGL0K00957g"
                     /inference="similar to AA sequence:UniProtKB:P42935"
                     /note="similar to uniprot|P42935 Saccharomyces cerevisiae
                     YGR200c subunit of elongating RNA polymerase II
                     holoenzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448266.1"
                     /db_xref="GeneID:2890150"
                     /db_xref="GOA:Q6FNC8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC8"
                     /translation="MVTVNSEAIFIGANKQTQVCSYNKARNVLAFGAGKNIALWNPLD
                     ADCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELECIQTIT
                     HYSHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLS
                     NVVGNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETP
                     GDYLLCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFE
                     ALIIGHDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMSSKGAS
                     TATGSSGGFWSCLWFEENGADYILTNGKTGSWRIWEAKDEIMCEQRVGITGAVRPVTD
                     VAWAPCGKYLLSTSLDQTTRLFAPWIYNENNELRSRKTWHEFSRPQIHGYDMICVEPV
                     NDERFISGGDEKILRSFDLPKGVAHLLKKFVGLRFTNEEEERPEAASVPVLGLSNKAV
                     EENESNDTDDPDVRESNDNKNISYDLVTSANTPPMEETLQRHLLWPEVEKLYGHGYEI
                     TSVDVSPDQKLVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHSLTITRLRFSPDSK
                     YLLSVCRDRKWAVWERNFDDNTFTLKYTDEKPHSRIIWDGEWAPLEFGNVFLTTSRDR
                     KVKVWSLETSESNAFSMLHFIKLNSPITAISIYNKVINNKLIVAVGLETGEIFIYNYS
                     KSDGFELISQFEQYITPSDRIERLRWSNWVDNDKLLLASASLDQSCRIYSILI"
     gene            complement(<98135..>100327)
                     /locus_tag="CAGL0K00979g"
                     /db_xref="GeneID:2890151"
     mRNA            complement(<98135..>100327)
                     /locus_tag="CAGL0K00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448267.1"
                     /db_xref="GeneID:2890151"
     CDS             complement(98135..100327)
                     /locus_tag="CAGL0K00979g"
                     /inference="similar to AA sequence:UniProtKB:P42934"
                     /note="similar to uniprot|P42934 Saccharomyces cerevisiae
                     YGR199w Dolichyl-phosphate-mannose--protein
                     mannosyltransferase 6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448267.1"
                     /db_xref="GeneID:2890151"
                     /db_xref="GOA:Q6FNC7"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC7"
                     /translation="MVEDKLADEKTTETKENTPDQTKVVPRACNFAKYRDLIACLGFT
                     VLSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGF
                     DGEFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVT
                     LEHSFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCV
                     CSVKWVGLFITLVVGLFTIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFC
                     FKIHFLLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYGSEVTIRSHGLSPNLLHS
                     HVQLYPDGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDTI
                     RLFHVRMGCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFG
                     KEDNEVLHPISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWN
                     VEDHWNDQLVVDEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWP
                     ILHKGLRLCGWSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQSIVINEE
                     SCWKLFTLLLFPFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYLLADYC
                     TVKAFLAFLSMVGCTYIYWYFAPICQGLHGIGSHYFYLQWLPGWDIAV"
     gene            complement(<100751..>103117)
                     /locus_tag="CAGL0K01001g"
                     /db_xref="GeneID:2890152"
     mRNA            complement(<100751..>103117)
                     /locus_tag="CAGL0K01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448268.1"
                     /db_xref="GeneID:2890152"
     CDS             complement(100751..103117)
                     /locus_tag="CAGL0K01001g"
                     /inference="similar to AA sequence:UniProtKB:P46951"
                     /note="similar to uniprot|P46951 Saccharomyces cerevisiae
                     YGR198w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448268.1"
                     /db_xref="GeneID:2890152"
                     /db_xref="GOA:Q6FNC6"
                     /db_xref="InterPro:IPR011990"
                     /translation="MFIRDAVLQALEARLLGASEFHSTCNALDRALVVQFRLQYHTGG
                     DSVITPATGKVLFGDIDKVEMLSRRFPLDKPLLDLINKILGNCAGIIHFSIGEFEDAK
                     VRLQQARDIKLDKTFDVYDMYLGLENLYYTACLRQDEQQISDCLYDHLFDTLSFVPSA
                     SEALTHQCLWKIAKRLKGHNNLANLIKIWPENNRALVFLISIIASDNGAYTEFSKDND
                     EMILKYGMNLVEKIKFPKASENNNYHLEQFMLFLQVYFKNIVPDQAASTEWYNFILKA
                     MSKTFQSINVAHTALFVMKKIGSDNEKGKINGTLLRKEALLNFVNFIRYSNKEFKLNK
                     NYNDIISLLVCYNFVINEFTKKDNIDNLFDYDKSLDELLSLLVFFYKEYNIPLSEKKQ
                     SLDILENPIRLAFPPHVANTLSRSWLTLYNYHSTSLSALLSFDLLAFLANCVPISRSM
                     DEGLFISTVFQYALTLAKQRDVETAIKVLEKLILERHPNCYKAWHLMALCHSTKENKE
                     TAYKIVCSVLEAMNENMKDLTFEEKFQYIYMKITQLRLIQDMFGTDETLELIPELFEL
                     YNTLFLGGANQKKVTINGVYDLDMTLQDIWLYVCSLYMKTPSTDNLQEAETAMDEAMA
                     LEKDHWKGRYLPLRAKLNILKQQNKQALLDIEKAIDLDNSNIDAILCFAELIFDVEKK
                     SEEDLTDEYYKLVPIEGIKECSKNQSENEDRLFFNATDRSAATARLKLLLDSAVAESI
                     EGYYTPEVWWSLSQIHEQFATKDYKLSLMKCIKFEELRPIAQFENCNY"
     gene            <103486..>104451
                     /locus_tag="CAGL0K01023g"
                     /db_xref="GeneID:2890153"
     mRNA            <103486..>104451
                     /locus_tag="CAGL0K01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448269.1"
                     /db_xref="GeneID:2890153"
     CDS             103486..104451
                     /locus_tag="CAGL0K01023g"
                     /inference="similar to AA sequence:UniProtKB:P12686"
                     /note="similar to uniprot|P12686 Saccharomyces cerevisiae
                     YGR084c MRP13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448269.1"
                     /db_xref="GeneID:2890153"
                     /db_xref="GOA:Q6FNC5"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC5"
                     /translation="MLKNCSRFYSAVAKSNKQLLDEFYQYHTTRMNLRPLIYRPKNAT
                     LLRSMDLKDPETNKPIQPREPMKPLKKQVLNNYVQEIPQGSKELMDFLQKWFKVSNRK
                     RELFAFLEGSHLQVMLAASLFRIGHYSHVLGLLHSYQSKVVGTGNTKAYDQDRFFNTV
                     LMCSLLRNDLKDLKDAEIGLKKLKVNWGKVTEKNDTLGLTQPLLEAYANQQGISKEDL
                     VLKGRETISNINLPSIGDESRFSRLVTFITENKYTYFLARTIQKFSESCPSEIETFIN
                     EYKNALTTLKKDDEYDWSVQNMTEVNKIPEETKQERETQEETQEQ"
     gene            <104993..>106897
                     /locus_tag="CAGL0K01045g"
                     /db_xref="GeneID:2890154"
     mRNA            <104993..>106897
                     /locus_tag="CAGL0K01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448270.1"
                     /db_xref="GeneID:2890154"
     CDS             104993..106897
                     /locus_tag="CAGL0K01045g"
                     /note="highly similar to uniprot|P12754 Saccharomyces
                     cerevisiae YGR083c Translation initiation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448270.1"
                     /db_xref="GeneID:2890154"
                     /db_xref="GOA:Q6FNC4"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC4"
                     /translation="MSENSSADQVKPENVNASPKTAQGSDAGTAPAATAVGERQLSNK
                     ELKELKKKEKAAKRAAQKQANGISIEQQKQQAEAKKQKKQQQREKQQKEQQKKQKKSD
                     PSAKPKRSVKKTTLFGHLETTEERRATILAITSAISSPKASRITAAGLMVPAVASSLA
                     IANEESAEGSAGSLSTVQQPQSAATTTTSGTSEQNAIDLAKSLANISLDYEKNSVVPG
                     ISSVIPEAMEQTLEGPSILASVKELLLNKDMLHPAISLLTSNLASYKIVGSIPRCIAM
                     LEAFQIVINDYETPEGTTLSRNLTSYLSHQIDILKKARPLSVTMGNAIRWLKQEISLI
                     DPSTPDQEAKKDLCEKIGQFAREKIELADQLIIDNASNHIENSTRIVTYGSSKVLTEL
                     LLHNAVTLEKNIEVIVVDSRPLFEGRKMAKLLRSKGVNVRYCLITSLDTAFNMDVDYV
                     FLGAHSILSNGFLYSRAGTAMIAMSAKRRNIPVLVCCESLKFSQRVQLDSVTYNELAD
                     PNDLVPIDYDNPVERRSNQGTLLKQFVKERNAEKARLELEQKNKGAKQKQQSGGASKG
                     QNSGKPEQLSEQSSNDKDVLHNWQDLQSLNIVNILYDLTPPEYIKKVITEFGALPPSS
                     VPVILREYKA"
     gene            complement(<107542..>108096)
                     /locus_tag="CAGL0K01067g"
                     /db_xref="GeneID:2890155"
     mRNA            complement(<107542..>108096)
                     /locus_tag="CAGL0K01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448271.1"
                     /db_xref="GeneID:2890155"
     CDS             complement(107542..108096)
                     /locus_tag="CAGL0K01067g"
                     /inference="similar to AA sequence:UniProtKB:P35180"
                     /note="similar to uniprot|P35180 Saccharomyces cerevisiae
                     YGR082w Mitochondrial import receptor subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448271.1"
                     /db_xref="GeneID:2890155"
                     /db_xref="GOA:Q6FNC3"
                     /db_xref="InterPro:IPR002056"
                     /db_xref="InterPro:IPR023392"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC3"
                     /translation="MAQSLGRTLAAATAVGAVALSAYALYFDHQRRSNPEFRKELKRR
                     VKKEAKAAQVAEEQAKRQKLEKVTQYLTQELAADPIPASATERETVFTKNVELGERLS
                     MTPGQELEAAAKFYKALTVYPNPADLLGIYQRSVPENIYEYIVLMIAIMPPANVSTFI
                     RGAAAGNDNAAAKEVEESVADVDE"
     gene            <108352..>108984
                     /locus_tag="CAGL0K01089g"
                     /db_xref="GeneID:2890156"
     mRNA            <108352..>108984
                     /locus_tag="CAGL0K01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448272.1"
                     /db_xref="GeneID:2890156"
     CDS             108352..108984
                     /locus_tag="CAGL0K01089g"
                     /inference="similar to AA sequence:UniProtKB:P53251"
                     /note="similar to uniprot|P53251 Saccharomyces cerevisiae
                     YGR081c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448272.1"
                     /db_xref="GeneID:2890156"
                     /db_xref="GOA:Q6FNC2"
                     /translation="MVAKKRTKLRDKVSRLNAKESAVEEEVPYTSVLGEDPKAFLHQS
                     KETKKEKQSLKHSSFLDRLREKSSANDFSGISKSAARRRKRKLRDDLKPKMQDLLTSL
                     ENDVEVESESGEEEYHDTVEDNHDPEIMEDAIPQRKVTRLVSSKKLKKHEKPSGSIVI
                     KKNAPNIRNQRGAKQLSKQESERFNKVLTNQTFQQNPFGSLRDIIKMQKY"
     gene            109314..109387
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0K01111r"
                     /db_xref="GeneID:2890157"
     tRNA            109314..109387
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0K01111r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2890157"
     gene            complement(<109615..>110598)
                     /locus_tag="CAGL0K01133g"
                     /db_xref="GeneID:2890158"
     mRNA            complement(<109615..>110598)
                     /locus_tag="CAGL0K01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448273.1"
                     /db_xref="GeneID:2890158"
     CDS             complement(109615..110598)
                     /locus_tag="CAGL0K01133g"
                     /inference="similar to AA sequence:UniProtKB:P53250"
                     /note="similar to uniprot|P53250 Saccharomyces cerevisiae
                     YGR080w Twinfilin A actin monomer sequestering protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448273.1"
                     /db_xref="GeneID:2890158"
                     /db_xref="GOA:Q6FNC1"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR028458"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC1"
                     /translation="MSNQSGILANQALLDELNKDLANAGVVTARISSDSTAVELDRTY
                     ATVEDCVKALSDEPLYIFYHAPATAEYQFISYVPDTSAVRSKMLYASTKNTLVRQIGT
                     NSIGKQLLITEASELADFANNLANDNGTDNDALTESERSAREIDATQKREFYSTYNSI
                     SGRQLVSQTGGGPNVLQFDVKMSDNVKQLLKETNVVAFKIDLSNEDISVLNKENISNP
                     EDLKLSSEHPTYTLYRNNELYYFIYSCPSGSKVKERMLYASNKSGFIKHLNEKEGIEF
                     SNVIEIGDADELELSLISSGTTQQLQSEASKSDSNSTRKFNRPRGPGGRKR"
     gene            complement(<111197..>111808)
                     /locus_tag="CAGL0K01155g"
                     /db_xref="GeneID:2890159"
     mRNA            complement(<111197..>111808)
                     /locus_tag="CAGL0K01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448274.1"
                     /db_xref="GeneID:2890159"
     CDS             complement(111197..111808)
                     /locus_tag="CAGL0K01155g"
                     /note="some similarities with uniprot|P53249 Saccharomyces
                     cerevisiae YGR079w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448274.1"
                     /db_xref="GeneID:2890159"
                     /db_xref="GOA:Q6FNC0"
                     /db_xref="UniProtKB/TrEMBL:Q6FNC0"
                     /translation="MSKQFKLGVITAQDISPLCKNKLPHPTVMANESLVSQVDELPEE
                     FHLDYTPHHEYNEYVDLGDLPVDSSISDFWNEVKSTHAEAPVTSSVTSVADTDDELRQ
                     LSQSLSEGHEHAHAHAHAHAGSDTSLEDFLNHEDLDNDIVTPTQEVKLLCLRDSKGKF
                     TLKTTERSKKNKVKKNKKNKVLRRKSGVCAMISTGIGINEFML"
     gene            <112575..>113147
                     /locus_tag="CAGL0K01177g"
                     /db_xref="GeneID:2890160"
     mRNA            <112575..>113147
                     /locus_tag="CAGL0K01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448275.1"
                     /db_xref="GeneID:2890160"
     CDS             112575..113147
                     /locus_tag="CAGL0K01177g"
                     /note="highly similar to uniprot|P48363 Saccharomyces
                     cerevisiae YGR078c tubulin folding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448275.1"
                     /db_xref="GeneID:2890160"
                     /db_xref="GOA:Q6FNB9"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB9"
                     /translation="MDTLFNSTEKNPRGIPSAPFLEDIGAFMAKEKEFELVFSKFQER
                     LSKYKFMLESKQATVRQLHVRIPDIENTLQVCRQLKQSKEDGEESALKFNYKLNETLF
                     TKAQVDLTKDLNVGLWLGADVMLEYPIDEAIALLEKKLEDSQDSLRIAKEDVEFLREN
                     ITTMEVNCARLYNWDVELRKATKATEKLAI"
     gene            complement(<113285..>114196)
                     /locus_tag="CAGL0K01199g"
                     /db_xref="GeneID:2890161"
     mRNA            complement(<113285..>114196)
                     /locus_tag="CAGL0K01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448276.1"
                     /db_xref="GeneID:2890161"
     CDS             complement(113285..114196)
                     /locus_tag="CAGL0K01199g"
                     /inference="similar to AA sequence:UniProtKB:Q08232"
                     /note="similar to uniprot|Q08232 Saccharomyces cerevisiae
                     YOL073c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448276.1"
                     /db_xref="GeneID:2890161"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB8"
                     /translation="MSLETPVGLRRFPVTKLCMVTGIVVPVVAALTETKYVFKATYDP
                     FIKEYGQYYRYLTYQLSSVNETDVALIVLLFYQYRQLERLFGNEKYLSMLAMLIFYQG
                     LATVSVHLLFNNLVGPWLGTQWNELASGAFGVVIGLFHFYKQYTPIVYEFDIVLGAPL
                     WSQLFHKGVIRRFDNENKSMKVRLNDQFMVNVLVIILICNQGAWGPLQALVAWLSGLF
                     LDIGILPGLDKWRVPFAHYMLFGEVKRLEVGSTSANTSASLGGNSVTQLANNSASSQL
                     EEDNENDEPNDEPARPLGVQFLDAFRR"
     gene            <114592..>116427
                     /locus_tag="CAGL0K01221g"
                     /db_xref="GeneID:2890162"
     mRNA            <114592..>116427
                     /locus_tag="CAGL0K01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448277.1"
                     /db_xref="GeneID:2890162"
     CDS             114592..116427
                     /locus_tag="CAGL0K01221g"
                     /note="weakly similar to uniprot|P53248 Saccharomyces
                     cerevisiae YGR077c Peroxisomal protein PAS6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448277.1"
                     /db_xref="GeneID:2890162"
                     /db_xref="GOA:Q6FNB7"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB7"
                     /translation="MVQADERTEVRYLLNLLRSSGHRSNKALHMSLIGNLVYYVPRLK
                     DPKLLAQLANALFDSTLWFQEDVDPSRLLDMAQGMFYWKLEISEPTLPIEEFYSIWNN
                     IFCENQGWSVYKLAILSGACSTLDRYTQLQSQYYIVESPRWIDGLYQNWKYNIFLRSW
                     SQFLSKSSDDSKKDVPRIEVLCLLYCPISRHHDVSRCHAQNVHFPLSFVIIALINLAI
                     VYAIDHPPEDEFLSRNINQVARTLQILLPQCDNPKEISMVLDELCVACFNISYKESSS
                     DMPNKDYSGVKYYSNTLLTFTLTFKGILDTKMKKPKTIFYQILTCMYYLNFIALDFGT
                     IGFESYEYTHNASIAGITSSGDQLTVYSNLLSTFNNNIWHTLKYPNKINDAKLLFLLD
                     FLKRSIEITSLDFGSRMSTSDFINNTILPLKMQYLNSQDETIRDSMHSVMLAVFLNNS
                     SGYELMAWQRKSFLNYLSTAVEQYVIHNMLKPEQIIHIYQSMAFRMTILDKIKLEDEE
                     CTLVRETLNYTYLQVKNAKFKEQKITLLKCLIYMIPYINHAYILVWLNNIMQLFDQEL
                     GVTTPDDQQLLYNTLWEVIPLVKSTDAALIWWYSTIVPRIRHSKL"
     gene            <116832..>117296
                     /locus_tag="CAGL0K01243g"
                     /db_xref="GeneID:2890163"
     mRNA            <116832..>117296
                     /locus_tag="CAGL0K01243g"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_448278.1"
                     /db_xref="GeneID:2890163"
     CDS             116832..117296
                     /locus_tag="CAGL0K01243g"
                     /inference="similar to AA sequence:UniProtKB:P23369"
                     /note="similar to uniprot|P23369 Saccharomyces cerevisiae
                     YGR076c MRPL25"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_448278.1"
                     /db_xref="GeneID:2890163"
                     /db_xref="GOA:Q6FNB6"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB6"
                     /translation="MSSKQYFEQLPKKLKDFFYKYPPSVKYAVKPTSTHAMDANPFLA
                     NKHPVTGKYHGAKYSARRMSDIYKLAYRYGVQDLLPQTNKQFFEEKYNNKKFMRGILT
                     PKGHKHELNMEERMKRKAEGIANAEKILAEVKGSKYKRRMEKVQEKKRVGWV"
     gene            <117543..>118283
                     /locus_tag="CAGL0K01265g"
                     /db_xref="GeneID:2890164"
     mRNA            <117543..>118283
                     /locus_tag="CAGL0K01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448279.1"
                     /db_xref="GeneID:2890164"
     CDS             117543..118283
                     /locus_tag="CAGL0K01265g"
                     /inference="similar to AA sequence:UniProtKB:Q00723"
                     /note="similar to uniprot|Q00723 Saccharomyces cerevisiae
                     YGR075c Pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448279.1"
                     /db_xref="GeneID:2890164"
                     /db_xref="GOA:Q6FNB5"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB5"
                     /translation="MSAEFQYESFISEKQLNNQSVSLVIPRITRDKIHNNIYYRCNLH
                     PVSMRGDTMLNLAPIIIRDLGKLRNPYQKPLNATLLLGGSEFKCLLMKLIEIRPTWEQ
                     IMTLINEEMVEESFENKYIVALVLVYGRIQYYFLTFSDDYYDDAIKWRRLFKKYLNDY
                     RKLKALDLNVDCWSTSQMQNVELIHLDEIVDWLATKDDIWGIPLGKCQWANVYNDDIE
                     DSSSDSSSSSSDSSSGSESDSDSGPESV"
     gene            complement(<118361..>118816)
                     /locus_tag="CAGL0K01287g"
                     /db_xref="GeneID:2890050"
     mRNA            complement(<118361..>118816)
                     /locus_tag="CAGL0K01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448280.1"
                     /db_xref="GeneID:2890050"
     CDS             complement(118361..118816)
                     /locus_tag="CAGL0K01287g"
                     /inference="similar to AA sequence:UniProtKB:Q02260"
                     /note="similar to uniprot|Q02260 Saccharomyces cerevisiae
                     YGR074w snRNA-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448280.1"
                     /db_xref="GeneID:2890050"
                     /db_xref="GOA:Q6FNB4"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB4"
                     /translation="MTLLVNFLKKLKNEQVTLELKNGTTVWGTLQSVSSQMNVTVTDV
                     VLSLPKSQSGKVSGGPGALASVYLVNNAQPDKANNDDGSVSLQYMNIRGNTIRQIILP
                     DSLNLDSLLVDEAQVKRLKKASAKPSETNYRKRRNEFSGNTAKRIKRGV"
     gene            complement(<119076..>120332)
                     /locus_tag="CAGL0K01309g"
                     /db_xref="GeneID:2890051"
     mRNA            complement(<119076..>120332)
                     /locus_tag="CAGL0K01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448281.1"
                     /db_xref="GeneID:2890051"
     CDS             complement(119076..120332)
                     /locus_tag="CAGL0K01309g"
                     /note="weakly similar to uniprot|P48412 Saccharomyces
                     cerevisiae YGR072w UPF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448281.1"
                     /db_xref="GeneID:2890051"
                     /db_xref="GOA:Q6FNB3"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB3"
                     /translation="MADGSDRRRRRRKGAGAAGAAGSAGTGGNSDAGKKDTSKEASKA
                     GSSANGNANGNDNGGSNASAKSNSKGNAKGASKGKGKDRRRNKGKEDKKDDKKGVSKV
                     KRSGRKNEPGPKNSKTTKKKEAQRVQSALEQDYKKLVVRLLPPMLTETQFWSTVGAPT
                     LENKQQYFDAHGIVEHYFHQGDAYAKFATMNARKKSYSRMYLIFKDIDHAKKYVLAIK
                     DLTFTDDHDNSNNPTFKISQYVKLFASGSTKQKSGSALEGTIDDDKIFKNFLKSMKYV
                     REHQFEEDVEGISMLRPIEKELALKRERKELAEKAAQHAIAKLTGVSESDKKKKKRKK
                     KKKGAVEETPKEKKKRKRNKKKKEKKKKASEGNEPKADSNNFVILEKAGKQVLKERLA
                     KKGSMTALPALTPDKPKVPKILKRNI"
     gene            <120540..>121517
                     /locus_tag="CAGL0K01331g"
                     /db_xref="GeneID:2890052"
     mRNA            <120540..>121517
                     /locus_tag="CAGL0K01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448282.1"
                     /db_xref="GeneID:2890052"
     CDS             120540..121517
                     /locus_tag="CAGL0K01331g"
                     /note="highly similar to uniprot|P20604 Saccharomyces
                     cerevisiae YDL047w SIT4 ser/thr protein phosphatase PP1-1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448282.1"
                     /db_xref="GeneID:2890052"
                     /db_xref="GOA:Q6FNB2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB2"
                     /translation="MDTASNRRGPDEWLETVKKCQALTENEMKQLCEMVKELLMEESN
                     IQPVMTPVTVCGDIHGQFHDLLELFRTSGGFPDDDVNYIFLGDYVDRGYYSLETFTLL
                     MCLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAI
                     IDGKILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGA
                     GWLFGSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVA
                     SVMKVDEDLEPTFKIFSAVPDDYINQDASSPTTNNGNSGSNSQRAGYFL"
     gene            <121967..>122524
                     /locus_tag="CAGL0K01353g"
                     /db_xref="GeneID:2890053"
     mRNA            <121967..>122524
                     /locus_tag="CAGL0K01353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448283.1"
                     /db_xref="GeneID:2890053"
     CDS             121967..122524
                     /locus_tag="CAGL0K01353g"
                     /note="some similarities with uniprot|Q12408 Saccharomyces
                     cerevisiae YDL046w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448283.1"
                     /db_xref="GeneID:2890053"
                     /db_xref="GOA:Q6FNB1"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /translation="MQVKSLISSVALWGCAFTVANPIIGWGIGDVDKKAPMPPGFGET
                     KPIPGDSPLKMCDIAEGQLLEITKLDLVPNPPKRGSKLVIKASGEIFETIEEGAYVDV
                     EVRLGYIKLLTQTYDLCEILEDNDVDGLTCPIKKGKYDNLSKDVDIPQEVPPGKYLVT
                     ARAYTNDDDLITCITGEVYFPPPGI"
     gene            <122991..>123278
                     /locus_tag="CAGL0K01375g"
                     /db_xref="GeneID:2890054"
     mRNA            <122991..>123278
                     /locus_tag="CAGL0K01375g"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_448284.1"
                     /db_xref="GeneID:2890054"
     CDS             122991..123278
                     /locus_tag="CAGL0K01375g"
                     /note="highly similar to uniprot|O75012 Saccharomyces
                     cerevisiae YDL045wa MRP10"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_448284.1"
                     /db_xref="GeneID:2890054"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:Q6FNB0"
                     /translation="MSGKPPIHRLPPLPRLKVKKPIITQEANKCLVLMSNLLQCWSSN
                     GHMSTVCEGLAKELKLCTAERAMGKGTQTQKSNINYHAARLYPKINGNPHD"
     gene            complement(<123633..>124547)
                     /locus_tag="CAGL0K01397g"
                     /db_xref="GeneID:2890055"
     mRNA            complement(<123633..>124547)
                     /locus_tag="CAGL0K01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448285.1"
                     /db_xref="GeneID:2890055"
     CDS             complement(123633..124547)
                     /locus_tag="CAGL0K01397g"
                     /inference="similar to AA sequence:UniProtKB:P38913"
                     /note="similar to uniprot|P38913 Saccharomyces cerevisiae
                     YDL045c FAD synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448285.1"
                     /db_xref="GeneID:2890055"
                     /db_xref="GOA:Q6FNA9"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="PDB:3FWK"
                     /db_xref="PDB:3G59"
                     /db_xref="PDB:3G5A"
                     /db_xref="PDB:3G6K"
                     /db_xref="PDB:4KKV"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA9"
                     /translation="MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILIN
                     ETFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTK
                     LPTVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAI
                     VIGIRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRY
                     GFTSLGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVK
                     IENLHEDYYPGWYLVDDKLERAGRIKKK"
     gene            complement(<125052..>126314)
                     /locus_tag="CAGL0K01419g"
                     /db_xref="GeneID:2890056"
     mRNA            complement(<125052..>126314)
                     /locus_tag="CAGL0K01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448286.1"
                     /db_xref="GeneID:2890056"
     CDS             complement(125052..126314)
                     /locus_tag="CAGL0K01419g"
                     /inference="similar to AA sequence:UniProtKB:P10849"
                     /note="similar to uniprot|P10849 Saccharomyces cerevisiae
                     YDL044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448286.1"
                     /db_xref="GeneID:2890056"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA8"
                     /translation="MLRRSSIVSVTRSGSRYFHSSIKLRKEEKSNISGNKEYEDQSTV
                     DAAATQIEQNLYNSVFERVKQKQNLRKKQASSSFILDHFFSGNEEKQNPHIIFGGESK
                     AKAKSDQNLVDYLTGRIDSESNLSSFKSTNLRKYPVSLTSTSLLDEDTASAQNVIKDL
                     KDNLKNVNTVSRLETPQNLKLVFNKKTLEEITIKEKFKGTLELLLKPYMDNLIEAIND
                     DHDLLVKAEQLLKLYENRDKKWDNRESGEVKVILDHLKTTCTDNPTELPQPYRVSLPY
                     VIVKLLERQTFEFSTDRLYRIITYIYNYCKSSPDITLYLNVCNVDFYNSLLSLSWESY
                     SEIKQIRHITSEMKINGIFGDISTIEKLNKIVGEAREFNDNIPTVDELGNIQKKYNSV
                     SVVWDKDSPNDLRMVEIYLRDLKERLTN"
     gene            complement(<126584..>127375)
                     /locus_tag="CAGL0K01441g"
                     /db_xref="GeneID:2890057"
     mRNA            complement(<126584..>127375)
                     /locus_tag="CAGL0K01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448287.1"
                     /db_xref="GeneID:2890057"
     CDS             complement(126584..127375)
                     /locus_tag="CAGL0K01441g"
                     /inference="similar to AA sequence:UniProtKB:Q07350"
                     /note="similar to uniprot|Q07350 Saccharomyces cerevisiae
                     YDL043c Pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448287.1"
                     /db_xref="GeneID:2890057"
                     /db_xref="GOA:Q6FNA7"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA7"
                     /translation="MDFQNRAGSKKGGGGIASDSQINQQRRRQVEELLQQGENIKYTF
                     QDKEGEKDDTDTKKVQSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGMNVI
                     RRGELDEIRHEKQQATKPVDTFEMKVEARRKTINTIEGLVPTCHSTEVIDEKGNKGIA
                     VMLEFEESDKTADVLNADRPYARIVSGLELNTSAQKDKRFLVVAYEPYQNVAIEIPND
                     REIVMNGYQPQSDEEIFVDTLNRQCTFWIENQRQFIVQIFFKETS"
     gene            complement(<127773..>129332)
                     /locus_tag="CAGL0K01463g"
                     /db_xref="GeneID:2890058"
     mRNA            complement(<127773..>129332)
                     /locus_tag="CAGL0K01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448288.1"
                     /db_xref="GeneID:2890058"
     CDS             complement(127773..129332)
                     /locus_tag="CAGL0K01463g"
                     /note="some similarities with uniprot|P06700 Saccharomyces
                     cerevisiae YDL042c Silent information regulator 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448288.1"
                     /db_xref="GeneID:2890058"
                     /db_xref="GOA:Q6FNA6"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA6"
                     /translation="MSDESSTRRSKRLKTGPSPTSSSASSTSVSPMGPFSSGRTLRSS
                     RLSPNRHSALGSPMMTAEEIAQQESLMPREPPSPILIGKNVKDGKFVVTAFTRKDTIN
                     ACMYLKYYGLRKFWTAYFPPEINSLHLYYMIRLLGFQLKDREVLNHISKNVEEWKANK
                     KYTISYADMNDPLDKKFTIRLLRNLYKAINKVLSTRLRLMNFFTIDHLVERLEKAKRI
                     VVLTGAGISTSLGIPDFRSSEGFYTKIKYLGLEDPQDVFNYEIFLRDPSVFYNIANMV
                     LPPENIYSPLHSFIKLLQDKRKLLRNYSQNIDNLESYAGIEVSKLIQCHGSFATASCV
                     TCKWSLPGEKIFKNIRNFEIPLCPHCYKKRTKYLELYERELDGEEHIPEWFDQVDKDT
                     IKSFGVIKPDITFFGEPLPSRFHKTVKEDIFRCDLLLCIGTSLKVAPVSEIVNMLPAH
                     VPQVLINRDPVRHAEFDISLLGYCDDIATMIAQKCGWKIPHQKWDKELTNKKFEIKES
                     AVSVYSVVSAD"
     gene            complement(<129822..>131195)
                     /locus_tag="CAGL0K01485g"
                     /db_xref="GeneID:2890059"
     mRNA            complement(<129822..>131195)
                     /locus_tag="CAGL0K01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448289.1"
                     /db_xref="GeneID:2890059"
     CDS             complement(129822..131195)
                     /locus_tag="CAGL0K01485g"
                     /inference="similar to AA sequence:UniProtKB:Q12362"
                     /note="similar to uniprot|Q12362 Saccharomyces cerevisiae
                     YOL066c RIB2 DRAP deaminase or uniprot|Q12069
                     Saccharomyces cerevisiae YDL036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448289.1"
                     /db_xref="GeneID:2890059"
                     /db_xref="GOA:Q6FNA5"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA5"
                     /translation="MIRAVLNFFRAGKPKLDGVTASTATKRSFTEIQDKDKSTFDAQL
                     EQEIKRAKRVQEEKIKRRERNKKSNAKSEIIRDGAGFKLRASSTNKKTKNRQSDPPYT
                     IEVDGPLRKIVPYYFTYNTYCKLRWRDRNLLDVFTNEFRDRPAEYYKKTIERGAVLLN
                     DKPATLESIIKNGDLITHKVHRHEPPVTSRPIEIVFEDNDILVINKPSGIPVHPTGRY
                     RFNTITKALEKERGYVVHPCNRLDRMTSGLMFLAKTSKGADKIGDQLKAREVEKEYLA
                     KVVGEFPEGTTVVDKPLKLLEPRLTLNVVCEETDPDAKHARTIFERVSVSKDKQTSIV
                     KCKPLTGRSHQIRVHLQHLGHPIANDPIYSSPEVWGDGKDYDEVIKRLDNVGKSYPAG
                     TWQLPSSRSNGTMLTGELCPECETELYSDPGPNDIELYLHAFRYSTKEDTEQQWSYET
                     KLPHWAN"
     gene            complement(<131704..>134490)
                     /locus_tag="CAGL0K01507g"
                     /db_xref="GeneID:2890060"
     mRNA            complement(<131704..>134490)
                     /locus_tag="CAGL0K01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448290.1"
                     /db_xref="GeneID:2890060"
     CDS             complement(131704..134490)
                     /locus_tag="CAGL0K01507g"
                     /inference="similar to AA sequence:UniProtKB:Q12361"
                     /note="similar to uniprot|Q12361 Saccharomyces cerevisiae
                     YDL035c G-protein coupled receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448290.1"
                     /db_xref="GeneID:2890060"
                     /db_xref="GOA:Q6FNA4"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA4"
                     /translation="MLDALANFNVTEVPSLKTSVREAMSTLNTTTVNLALGLPGMFST
                     FNAGQLYRIRVVAITASALSIFGGVVGIYCMLNIDKRRKVFRHDLILFLIICDFIKAL
                     ILMIYPAIILNNNYVYATPAFFNTLGWLTAYATEGADIAIMVFAIHFALLIFKPNWKW
                     RNAKTGNMEGGLYKVRGYIWPMTALIPSVLASLAFINYNKLHKWTQAERDAVVLDNNN
                     YDFPFKPRIGGYKPWSAWCYLPPRPLWYKIVLSWGPRYFLVITIIAIYISIYLYVSSK
                     IRKIKNQLKDFKHEQEEARHEEDRILRSSKFGTIKWLMKRYISPLFMGIIKSFKNFFT
                     LSMEDISDDSELSTRSYSIYSSGSSYAYGANKADNEDYDKYHQGLQILKYKNSKNAQE
                     RNAVREQIQNQNQDQVENKAEDKDIEMADLETPKETFNNPLSKLSSLRKHMSIHSTDR
                     RSGHSRRFSDASDESNIDSLLENGLTEIFSTPIPDGEDSETQNPVAYQMEDLSKGISP
                     MDNSVVPPLGDERRIVGANEIDDVKKNFQREMYQNMKKRRSQIQKNVRSIFIYPCSYL
                     ALWVFPIIADCLQYNYEEKHGPVMWVTYLDTFTRPLACIVNSMVFFYREKPWRHTWER
                     VEKKVLLDKFILKGEMSEQDMLFYRKTKLGRRGWYYRGKWLKRQCWSHQKEWWKRCLW
                     YVYRTFIGAFKLDFDYEDNCWDNEFWDQYYSGKPLPEFRSHQNAKEGKMRSTETENVL
                     TSDSSLSPSREDAFYDAQDKLKISAFWMLVHLFPMLNGVDLDEINRVLRMKYKEDDFV
                     IPGLTYALTQRNAQVPTPQVAAGKHSRNPSTIRNTNTKLPTFDLRTQQIPSSDEHHYM
                     RETPKIDEHLFSNRNSQVSFARLDTDRPTSTVSESTSKQTTPPASTSVSQPSNHDDDD
                     EHIDILAFLNEPLK"
     gene            complement(<134906..>136126)
                     /locus_tag="CAGL0K01529g"
                     /db_xref="GeneID:2890017"
     mRNA            complement(<134906..>136126)
                     /locus_tag="CAGL0K01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448291.1"
                     /db_xref="GeneID:2890017"
     CDS             complement(134906..136126)
                     /locus_tag="CAGL0K01529g"
                     /inference="similar to AA sequence:UniProtKB:Q12093"
                     /note="similar to uniprot|Q12093 Saccharomyces cerevisiae
                     YDL033c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448291.1"
                     /db_xref="GeneID:2890017"
                     /db_xref="GOA:Q6FNA3"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023382"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA3"
                     /translation="MLEKFLRLARGRVVPGYSPQHVPAKFDNVVIAMSGGVDSSVAAA
                     LFAHYPKATGVYMQNWSESQALESIAEEPCYEKDWKDVAKLGDFLGVPVEKVNFESDY
                     WIDVFEPMLQEYDQGRTPNPDIGCNKFVKFGKLKSYLDQKYGHDNYHLVTGHYSRVLQ
                     HLESKEYHLLRGYYPQKDQSYYLSQINGGILPRLVLPMGHLTKPEVRDMARELQLPTA
                     NKRDSQGICFVNNSQHKKFNKFLEHYLTNKPGNVITVEPTGEKTVWGTHKGLWSYTLG
                     QKIGDGISLPQADPRYTGAWYVSEKIPATNEIVIVRGRENPQLYRDKLRIQDFEYLGE
                     PQTIRKAITEALQRGELRARYRSLMEPEPLISINTDADEFHLQFQRPQRAMAPGQFCC
                     LLSQNRILGSGPIM"
     gene            <136421..>139330
                     /locus_tag="CAGL0K01551g"
                     /db_xref="GeneID:2890018"
     mRNA            <136421..>139330
                     /locus_tag="CAGL0K01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448292.1"
                     /db_xref="GeneID:2890018"
     CDS             136421..139330
                     /locus_tag="CAGL0K01551g"
                     /note="highly similar to uniprot|Q12389 Saccharomyces
                     cerevisiae YDL031w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448292.1"
                     /db_xref="GeneID:2890018"
                     /db_xref="GOA:Q6FNA2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVKNLKRKERDEHESDSDEEIDIAGNLVADGSDSESDDSSDGSD
                     EEVQDVIEYSSDEEEPAKPAKAVKKKVEDKSFPSLELSDDEDEKKKVDNDDDDVNAYF
                     SVNTDAKSKHKKGSFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMAR
                     TGSGKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHLRSVL
                     LTGGDSLEDQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEMGF
                     QEQLNELLAALPSSRQTLLFSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLF
                     LSTKNDEREANLLYILQEVIKLPLATPEQIKQLNDNKADDSDESAEEDEDKKRRKRKS
                     FNRKAMPKANELPSEKATVVFVPTRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQL
                     YNFRIGLTSILVVTDVAARGVDIPMLANVVNYSLPASSKIFIHRVGRTARAGNRGWAY
                     SIVSENELPYLLDLELFLGRKILLTPMYEALERLSKEKWVAEGNDETLFQSPKISYTS
                     RMVLGSCPRLDIEALSELYNNLMKSNFDLDMAKKTALKAEKLYFRTRTSASPESLKRS
                     KEIISSGWDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTRNPEDEMANLMHRRR
                     RAIAPIQRKAKERKELLEKERMAGLTHALEDEILKGDDAEVGYTVTEDTLKAFEDADT
                     ILAEQENASKKKKKTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDD
                     KVQVHKQTATVKWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKL
                     APLKTGANESSIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQK
                     KKVESALERGIAVKGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF"
     gene            <139809..>141359
                     /locus_tag="CAGL0K01573g"
                     /db_xref="GeneID:2890019"
     mRNA            <139809..>141359
                     /locus_tag="CAGL0K01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448293.1"
                     /db_xref="GeneID:2890019"
     CDS             139809..141359
                     /locus_tag="CAGL0K01573g"
                     /inference="similar to AA sequence:UniProtKB:P19736"
                     /note="similar to uniprot|P19736 Saccharomyces cerevisiae
                     YDL030w Pre-mRNA splicing factor PRP9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448293.1"
                     /db_xref="GeneID:2890019"
                     /db_xref="GOA:Q6FNA1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA1"
                     /translation="MELDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDD
                     IPKLGLDDDRMVNKIYKARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKS
                     DGLKYKDSECKFELLKKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNG
                     KLVSERCSLLDINTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFID
                     DKKYLLDPVMDRKTKGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTK
                     AIITESGIYYCLYCDKMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMR
                     EEFENTKEYVDRKMAFTNKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDE
                     LKEMLGLGEDMPLGPDGLPIPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPT
                     HTYHLKCLGIEPSSAFQGITKIKEAQALWKQMQRNTTQELAEEVEDKEGNVMSKDIYE
                     ELKKQGLV"
     gene            <141618..>143124
                     /locus_tag="CAGL0K01595g"
                     /db_xref="GeneID:2890020"
     mRNA            join(<141618..141639,141971..>143124)
                     /locus_tag="CAGL0K01595g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448294.1"
                     /db_xref="GeneID:2890020"
     CDS             join(141618..141639,141971..143124)
                     /locus_tag="CAGL0K01595g"
                     /note="highly similar to uniprot|P32381 Saccharomyces
                     cerevisiae YDL029w ACT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448294.1"
                     /db_xref="GeneID:2890020"
                     /db_xref="GOA:Q6FNA0"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:Q6FNA0"
                     /translation="MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER
                     ATINKPLKDIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTS
                     GGKILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK
                     LCYVSYDLDLDTKLARETTTLVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAG
                     IGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPT
                     RLDKFKVRIEDPPRRRHMVFIGGAVLASIMADKDHMWLTKQEWRESGAAAMSKFGPR"
     gene            complement(<143308..>145632)
                     /locus_tag="CAGL0K01617g"
                     /db_xref="GeneID:2890021"
     mRNA            complement(<143308..>145632)
                     /locus_tag="CAGL0K01617g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448295.1"
                     /db_xref="GeneID:2890021"
     CDS             complement(143308..145632)
                     /locus_tag="CAGL0K01617g"
                     /inference="similar to AA sequence:UniProtKB:P54199"
                     /note="similar to uniprot|P54199 Saccharomyces cerevisiae
                     YDL028c Serine/threonine protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448295.1"
                     /db_xref="GeneID:2890021"
                     /db_xref="GOA:Q6FN99"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016242"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FN99"
                     /translation="MGNPYHSESDQIWRISSQDSDDGEIGNPPKLSNFGSELISDAIE
                     NINPNRSDKKLISEETRIHESHSQQLNTDINQSTRVTHSASSPLYFEDTSPSTMFVQS
                     QASAQPSATTYDISSQDYSDSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRT
                     TKLGPALRNLTSPALAINDNNSIDNKMNETSKVNSSFDTNNAYVDFHQTKQDIYTSGE
                     EHNNTKDNGKIGATQQNDYSDINIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEEN
                     RKKALKNVNMKQSLNYDLKHYSNSFPSIESGKENNLIHNTEIEDFNGRGHSTNNHSSS
                     YLSNSHSHPVSTQFVESANIELEKPTLKKSLSNADSYRHTQREALQNIDVNSNVRDGA
                     IDYKRQKIALKDSEFDGILDKKKYRGIKRVEIVEPPTSTRPPSRKNVVSVNGTEYERV
                     ELLGRGGSSNVYKVRGLKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQ
                     LYDFEMGSGVLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGI
                     VHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYT
                     ADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKI
                     EYKEVLPDKTVIPSLALELMQYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLIT
                     TAVSYGAREGDVSPSRLEALTDSVLARLADFRMH"
     gene            complement(<146143..>147354)
                     /locus_tag="CAGL0K01639g"
                     /db_xref="GeneID:2890022"
     mRNA            complement(<146143..>147354)
                     /locus_tag="CAGL0K01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448296.1"
                     /db_xref="GeneID:2890022"
     CDS             complement(146143..147354)
                     /locus_tag="CAGL0K01639g"
                     /note="weakly similar to uniprot|Q07349 Saccharomyces
                     cerevisiae YDL027c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448296.1"
                     /db_xref="GeneID:2890022"
                     /db_xref="GOA:Q6FN98"
                     /db_xref="UniProtKB/TrEMBL:Q6FN98"
                     /translation="MLINTVSVIAQRNNTSATSKFHIAYKNMLSRFSGIATRNPLRAS
                     SLILKGLPNRNAKIVQLLSLTSVTRSTQSLPALRSSNQLLTIPPCQPRTLNKVLKRGF
                     YTTSKKSIKFIFSKGDKDNHNKMKYYSIPTPVVILSTIGGFVLLFTILPFLFTFGFPF
                     LIGMIVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLKYRLIEQGLPMLTNFSN
                     KTTKQLSSRGETLINQLQQRIKESFANNDNNIANVFVPQGHKLSEYELLLPHHTFKSY
                     TKKLPHDQDIGLLSLSLYMRRRQHRNIKVAMPIPVELNLGNKVANVYFVYKGDTARGL
                     LNTQILLEAAKAGVDLQEIKSSTQFLISIVPLDSWLPTQYIIADAGSLGSFNEDPSSS
                     SREFVINNKSK"
     gene            complement(<147781..>149229)
                     /locus_tag="CAGL0K01661g"
                     /db_xref="GeneID:2890023"
     mRNA            complement(<147781..>149229)
                     /locus_tag="CAGL0K01661g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448297.1"
                     /db_xref="GeneID:2890023"
     CDS             complement(147781..149229)
                     /locus_tag="CAGL0K01661g"
                     /note="some similarities with uniprot|Q12100 Saccharomyces
                     cerevisiae YDL025c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448297.1"
                     /db_xref="GeneID:2890023"
                     /db_xref="GOA:Q6FN97"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FN97"
                     /translation="MVSFINGTDRLPGSSSSSSLSGRKSSLRKLFFRSSDEIPSIAPK
                     SSSIHLNPTTSTPVSSEHRPFPHNLHSPLNYTTRQLSQRHTSSASQLEMLHPVEALMH
                     RKLPETWPDIPTVHEPQEKKKQPPLKRFLKKFNSSSNSSSTDDSYNASSSMVTPVTYK
                     QTVLTDYVDTPMELIHKYGIPGKKIGEGASGSVSIVKKSNGQQYAVKMFRTSPNSTQE
                     QIEKYCKKITAEFCMGSTLHHANVIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTMS
                     PDEISCYFKQLCHGVNYLHAMGIAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYER
                     NIVKATGIVGSDPYLSPELLEMNHYDPRLADVWSLAIIYYCMTLKRFPWKAPRKQFNS
                     FRLFCEDPDDENDFSKGPMKVLRQLPSYSRDLIGKMLELEVKDRYYLEQVMKHEWFQS
                     IEVCIADSKGELLYKPKTHIHHLETELKVSNT"
     gene            <150099..>151301
                     /locus_tag="CAGL0K01683g"
                     /db_xref="GeneID:2890024"
     mRNA            <150099..>151301
                     /locus_tag="CAGL0K01683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448298.1"
                     /db_xref="GeneID:2890024"
     CDS             150099..151301
                     /locus_tag="CAGL0K01683g"
                     /note="highly similar to uniprot|Q00055 Saccharomyces
                     cerevisiae YDL022w Glycerol-3-phosphate dehydrogenase or
                     uniprot|P41911 Saccharomyces cerevisiae YOL059w GPD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448298.1"
                     /db_xref="GeneID:2890024"
                     /db_xref="GOA:Q6FN96"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /translation="MSNSAAGRLNQTSHILNESIKNDDISLRRSQPSTTSLQALEHPF
                     KVTVIGSGNWGTTIAKVVAENTALNPHLFVSRVDMWVFEEKIDGKNLTEIINEQHENV
                     KYLPDIKLPENLVANPNLIDSVKGADILIFNIPHQFLPRIVSNLKNHVGPHVRAISCL
                     KGFEVGKKGVQLLSSYVTDELGIQCGALSGANLAPEVAKEHWSETTVAYHIPKDFRGE
                     GKDVDHKLLKALFHRPYFHVNVIEDVAGISIAGALKNVVALGCGFVEGLGWGNNAAAA
                     IQRVGLGEIIKFGQMFFPESRVQTYYQESAGVADLITTCSGGRNVRVAKHMAKTGKSA
                     LDAEKELLNGQSAQGIITCKEVHEWLETCEMTHEFPLFEAVYQIVYNNVPMKNLPDMI
                     EELECIAD"
     gene            <151967..>152926
                     /locus_tag="CAGL0K01705g"
                     /db_xref="GeneID:2890025"
     mRNA            <151967..>152926
                     /locus_tag="CAGL0K01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448299.1"
                     /db_xref="GeneID:2890025"
     CDS             151967..152926
                     /locus_tag="CAGL0K01705g"
                     /inference="similar to AA sequence:UniProtKB:Q12008"
                     /note="similar to uniprot|Q12008 Saccharomyces cerevisiae
                     YDL021w or uniprot|Q12326 Saccharomyces cerevisiae YOL056w
                     Phosphoglycerate mutase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448299.1"
                     /db_xref="GeneID:2890025"
                     /db_xref="GOA:Q6FN95"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FN95"
                     /translation="MSTLKLFILRHGQSDLNHENIFCGWIDAKLTDKGRSQAKNAGQL
                     IAQHCKSNGITLPQIGFTSRLLRTEQTMDVILNELQLGKKDEVSGQFNNPVFVVFDYI
                     YTLAEIRSYLLSEKEENPISNEIPVLRTWRLNERHYGAWQGQRKPKVLKEYGEEQYMY
                     IRRDYNGRPPEVDLEKEMIQKHDLGAATGYEFKEPNRSLKYELEELNQNIKLPYSESL
                     SDVVARLEPFLDEIILKVAKEFDLDSCLIVGHGSSVRSLLKILEGVSDEDIKGVDIPN
                     GIPLVIELDKTNNFKFLRKYYLDPELAKINAEKVRKEGFEENP"
     gene            complement(<153398..>154897)
                     /locus_tag="CAGL0K01727g"
                     /db_xref="GeneID:2890026"
     mRNA            complement(<153398..>154897)
                     /locus_tag="CAGL0K01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448300.1"
                     /db_xref="GeneID:2890026"
     CDS             complement(153398..154897)
                     /locus_tag="CAGL0K01727g"
                     /inference="similar to AA sequence:UniProtKB:Q03465"
                     /note="similar to uniprot|Q03465 Saccharomyces cerevisiae
                     YDL020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448300.1"
                     /db_xref="GeneID:2890026"
                     /db_xref="GOA:Q6FN94"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FN94"
                     /translation="MTSIDLGLKRTLTDVLEDELYNMRLREQETAQEQLDLREAGKVR
                     QVQLQQQQMFSQYADPSVTMMSGDVACEGVLSTAPANLLANPDIRQAPAPQAQAQMLQ
                     VNPEVLISYANKNSAHMNVSAVDDKLNRGLVDENSYYDDVDYSSMNAKMADWQLDDNV
                     AMLDNNDARLIFDNEFADDDDLSDDENLFDEGLENYHNELVSSNSPIESLDVAEHKES
                     VDDRLRKYHLDNIQNILSKTSTNDKDILQIKLPSDFTTTNLHSTNPSGLIEDPSQLVL
                     GSSKKITEDTHVEEESKNLPDLTELTSATEIEDILLAVDSDDDDLYTKPIAKQTTKKD
                     NSKPVEKTVVEKTSSVTKAGSNHSRSTLARPTAHARKLSSSRKQAPKVYNPKTTTKST
                     HTHSKNNATHEAFVCELVNSVTNEVCGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIR
                     ALGDEGFQKTFSRLDALTRHIKAKHENLSLEERQQVTKYAKSNIGFVTA"
     gene            complement(<155385..>159134)
                     /locus_tag="CAGL0K01749g"
                     /db_xref="GeneID:2890027"
     mRNA            complement(<155385..>159134)
                     /locus_tag="CAGL0K01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448301.1"
                     /db_xref="GeneID:2890027"
     CDS             complement(155385..159134)
                     /locus_tag="CAGL0K01749g"
                     /inference="similar to AA sequence:UniProtKB:Q12451"
                     /note="similar to uniprot|Q12451 Saccharomyces cerevisiae
                     YDL019c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448301.1"
                     /db_xref="GeneID:2890027"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FN93"
                     /translation="MATHDVGVTLRKSRVSKPMLKLKLLQAMTGGSFKELHDMLQKEF
                     VPYDDPSVMEVSTLLLHYAVQVAPIALIKEIVRDYVVRDPFHLGLHKTPEGDITVNLN
                     INYRDYNGNTPLHLAASQSRVDVVNFLMELPDINDTIVNNAGQEPIDMCKTLDIVAAM
                     QNKRDEYVSQVAQDLRDAFDRRDFDKLEQIWKIQRNEELLDINGLDPTSGDTVLHEFV
                     KKKDVQMCKWLVDHGADPLRRNAKALLPIDLLGPTSPSKHQGSSSELRNYIETVTRDR
                     NVVNVSETDHQTHAPTYKGQLKKWTNIAKGFQTRWFVLSEDGYLRYYKNRPKEGSSPR
                     DKVHLSKCRLFSNSHEKVKFELLIGDQGRWRLKGTNPAEAKKWIAAIQAGISYANAKH
                     SQKQPSNRSVISGSANEGQSRSAPSLQPAKPNRSRANSSTSQRISQVQKGLKPPVLGI
                     STDHSNYGSNASDAESVVGSLNINTNRLRRDMSPLTPMSNSLNSPILKDESFNSPTLE
                     SLLGKDKLNAIDPYAKDSDEDIDEILVKPIDPDEEYLKTQYGPFIENLNVYKKTISMQ
                     LASVLEVLDTADISSSDLSTLRGTIQNTVDTFNNLAKLGAERDRKLVQIITKHRDVNN
                     VWIDSVKELELELNKKEDLLEALTKERRHLRKELNQELQETADQDNKMIKRASTVISR
                     FLNVTKSVVEDGNGDEFYDAEELIDEIGSIPDTTPGEMSEAKEMREQIKTMVPEQPAE
                     SKVEHEETSEKKEVEQAETKPALEQKAISKEQEKMEAIKEQTSKPTDEESTLRETATS
                     TASVKGESNEIELQRKLFASSKMKSQTESQKAKEKLLLEEGSFFGYDEGVRKRLKLDE
                     DDRPKISLWGVLKSMVGKDMTKMTLPVAFNEPTSLLQRVAEDLEYSELLDKAVQFEDS
                     TLRLLYVSIFTASAYASTTKRVAKPFNPLLGETFEYARPDKQYRFFAEQVSHHPPISA
                     TYTESPRWDFWGESYVDTHFNGRQFNVKHLGLWYINLLPNSTDRKELYTFKKPNNNVI
                     GILVGNPQVDNYGEVVITNHTTGDYCKLYFKARGWRSSSAYEVKGEVFDKDNKKHWVL
                     GGHWHDSIYAKHVNGKDKDEIALDHKKTHTATEPTRDGSKFLVWKVNPRPDAPFHLTP
                     FAITLNAPQKHLIPWLAPTDTRLRPDQRAMEDGQYDLAAEEKHRVEEKQRAARRTREE
                     QNIQYKPLWFTKETHPVTKKPYWKFHGDYWQQRKNHQLKGKADIF"
     gene            complement(<159387..>161375)
                     /locus_tag="CAGL0K01771g"
                     /db_xref="GeneID:2890028"
     mRNA            complement(<159387..>161375)
                     /locus_tag="CAGL0K01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448302.1"
                     /db_xref="GeneID:2890028"
     CDS             complement(159387..161375)
                     /locus_tag="CAGL0K01771g"
                     /inference="similar to AA sequence:UniProtKB:P80235"
                     /note="similar to uniprot|P80235 Saccharomyces cerevisiae
                     YAR035w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448302.1"
                     /db_xref="GeneID:2890028"
                     /db_xref="GOA:Q6FN92"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6FN92"
                     /translation="MTVGTEEEYKNFQTLERLPIPPLEATLKRYIDRTEPLLGSEEAQ
                     KTKKVVYSESNLEVLSYLQDKLLEYENWLATFEPQSSYIEQFWYNAYLMYDSPVVLNV
                     NPFFELEDDPTLDYSMRTGVFQEYTLQIKRASRVVTSALRFASQIRNNTLKPDILRND
                     VPLSMDQYQKLFGSSRIPPKPKQQSCHLQTDSTSHHIVIMYKGSFYWFDVLDCQNELI
                     FQSAEEIEWNLYSIIMDRERLNKENHKGFLEMGILTTESRRTWANIREHIHKQDSRQN
                     WQNLKIIDSALFVLCLDDYESHLDDPNSLLKLFLTGTSEIDFNSPFEIDEYVHAPKNL
                     QRGTCINRWFDKLQIIVTKCGKAGVNFEHTGVDGHTVLRLANEIYTDAITSFAQTVTS
                     RTPRTLPQADSNLITVPRKLEWLKDEYLCRAVHFAEVKCTDLISQYEIESLEFGGYGS
                     ARIKSVFKCSPDAFVQQMFQVAFYALYGTFETIYEPAMTKTFLNGRTEAIRPVTHDSI
                     KFVKSVFNHRSTDTERIDLLHRACQEHTRITRECSMGMGQDRHLYALQCIWQKLQAET
                     PDDPITHSTPPIFEDNAWHKINKNILSTSNCGSPALKWFGFGPVDKDGFGIGYIIKDS
                     KISVTVSSRHRQTARFITMLDRALNELDTIFNRAPKTI"
     gene            complement(<162060..>162722)
                     /locus_tag="CAGL0K01793g"
                     /db_xref="GeneID:2890029"
     mRNA            complement(<162060..>162722)
                     /locus_tag="CAGL0K01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448303.1"
                     /db_xref="GeneID:2890029"
     CDS             complement(162060..162722)
                     /locus_tag="CAGL0K01793g"
                     /inference="similar to AA sequence:UniProtKB:Q12403"
                     /note="similar to uniprot|Q12403 Saccharomyces cerevisiae
                     YDL018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448303.1"
                     /db_xref="GeneID:2890029"
                     /db_xref="GOA:Q6FN91"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FN91"
                     /translation="MLAIAVLFLSLVGASPLTFELLKGERQCFHTLTTRTDCSISYYY
                     EVLSGTGNDLNVQYEIFEPGNLHEPIVNRNNEHKGHWSFPAKHRGEYTFCFYGGKAHD
                     KIVELEITSECGNVASDVRSQRRNFRKNQRGIEDKGESKQLKTKLEDSIDKIERQLYS
                     LENSLGYYKTRNDRNHATVRSTEKRITAFSFYGILLIIGMSLGQIAVLQWVFKESRKQ
                     KV"
     gene            <162973..>164487
                     /locus_tag="CAGL0K01815g"
                     /db_xref="GeneID:2890030"
     mRNA            <162973..>164487
                     /locus_tag="CAGL0K01815g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448304.1"
                     /db_xref="GeneID:2890030"
     CDS             162973..164487
                     /locus_tag="CAGL0K01815g"
                     /inference="similar to AA sequence:UniProtKB:P06243"
                     /note="similar to uniprot|P06243 Saccharomyces cerevisiae
                     YDL017w Cell division control protein 7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448304.1"
                     /db_xref="GeneID:2890030"
                     /db_xref="GOA:Q6FN90"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FN90"
                     /translation="MVGKYEIPEEIKQEIEQVYEEVPPLRDQYRLIDKIGEGTFSSVY
                     KAEDLQGKVTRKYGSHFWYKDSKYVALKKIYVTSSPQRIYNELNLLYILTGCVRVAPL
                     CDAMRVRDQVMAVLPYYPHEEFRNCYRDLPIKGIKMYMWELLQALSFVHSKGIIHRDV
                     KPTNFLYNPEIGRGVLVDFGLAEMQSDIITHGAEMAFPTAKDDDAAFAMKDYRNQELF
                     CPCIMRESKDTTIPSATHPLITIQNGKVVQLGNANGVDLTKGYPKNETRRVKRANRAG
                     TRGFRAPEVLMKCGAQTTKIDIWSVGVILLSLLSRRFPLFQSLDDTDSLLELCNLFGW
                     KAMKKCAAIHGLGFEVAGVQNLREEPFQHGLKQFVYELLDKECEAGTFPEYSIAFETH
                     SYLKYEIEEGHSIEPHLPSQIEEDNDNEKMMQLKQYQKEIWSDHFWCFQVLEQCFKLD
                     PSKRSSADELLRSAFFNELNVGAGESTEGELTDEDVSDTASEAASSDEEVMLIA"
     gene            complement(<164774..>165706)
                     /locus_tag="CAGL0K01837g"
                     /db_xref="GeneID:2890031"
     mRNA            complement(<164774..>165706)
                     /locus_tag="CAGL0K01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448305.1"
                     /db_xref="GeneID:2890031"
     CDS             complement(164774..165706)
                     /locus_tag="CAGL0K01837g"
                     /inference="similar to AA sequence:UniProtKB:Q99190"
                     /note="similar to uniprot|Q99190 Saccharomyces cerevisiae
                     YDL015c elongation of the VLCFA moiety of sphingolipids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448305.1"
                     /db_xref="GeneID:2890031"
                     /db_xref="GOA:Q6FN89"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q6FN89"
                     /translation="MLVTIKPRSKVLKETKVNLSESSTLEQVLIEVSRNNRNISKNRL
                     RLTYAKENKQLPILDDSYFKGLDSATTELYVKDLGPQISWRLVFVCEYIGPIIIHTLL
                     YRLSQNQSVISKFHNSSVHRDPFLYSLIYWLNTIHYTKRVLESLFLHKFSQATMPLFN
                     LFKNSSHYWILNGSITASYFGYGFLIGNDTLRPVYEFLHLEKVNTLVTLFLISEAWNF
                     YIHLKLRLWGDLQKKQGNTTKRVPLNEGIFNVLVAPNYSFEVWSWIWFAFIARLNIFA
                     LIFLAVSATQMYLWAQKKNKKYNTRRAFLIPFIF"
     gene            <166115..>167086
                     /locus_tag="CAGL0K01859g"
                     /db_xref="GeneID:2890032"
     mRNA            <166115..>167086
                     /locus_tag="CAGL0K01859g"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_448306.1"
                     /db_xref="GeneID:2890032"
     CDS             166115..167086
                     /locus_tag="CAGL0K01859g"
                     /note="highly similar to uniprot|P15646 Saccharomyces
                     cerevisiae YDL014w Fibrillarin"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_448306.1"
                     /db_xref="GeneID:2890032"
                     /db_xref="GOA:Q6FN88"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSFRPGSRGGARGGRGGSRGGFGGRGGSRGGFGGRGGSRGGSRG
                     GFGGRGGSRGGPRGGSRGGPRGGARGGARGGAKGGAKVVIEPHKHDGVYIARGKEDLL
                     VTKNMAPGESVYGEKRVSVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFI
                     APGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNVIPIIE
                     DARHPQKYRMLVGMVDAVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTV
                     DAETVFAREVQKLREEKIKPLEQLTLEPYERDHCIVIGRYMRSGLKK"
     gene            <167939..>169459
                     /locus_tag="CAGL0K01881g"
                     /db_xref="GeneID:2890033"
     mRNA            <167939..>169459
                     /locus_tag="CAGL0K01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448307.1"
                     /db_xref="GeneID:2890033"
     CDS             167939..169459
                     /locus_tag="CAGL0K01881g"
                     /note="weakly similar to uniprot|P32828 Saccharomyces
                     cerevisiae YDL013w Hexose metabolism-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448307.1"
                     /db_xref="GeneID:2890033"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FN87"
                     /translation="MKRDGEEDPVIVLDSDNEEPANSEHEGVRPLPAIVVDEEDNSGA
                     PVEVTSVNADEGGDDDELTLLRQSNIRVPRRQISTPVAYINLDDEAAHHDASDDIEFL
                     GGNLVPNAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMR
                     NNQLRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEWETPDLSSGYQSSAS
                     NYPSRPSSALINDWAIARARNAARRRTRAMTESRISAALGQLAGLSGSDLVNGYINFP
                     VLPQSMASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSES
                     QKKKFYEEAKQLPPGYSASFATPEVIRENDDEDNSNNDDDEDMIVCNLCGVELGIGIP
                     EEFTGISKEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRC
                     WRRYLNARSLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF"
     gene            complement(<169669..>169974)
                     /locus_tag="CAGL0K01903g"
                     /db_xref="GeneID:2890325"
     mRNA            complement(<169669..>169974)
                     /locus_tag="CAGL0K01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448308.1"
                     /db_xref="GeneID:2890325"
     CDS             complement(169669..169974)
                     /locus_tag="CAGL0K01903g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448308.1"
                     /db_xref="GeneID:2890325"
                     /db_xref="GOA:Q6FN86"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:Q6FN86"
                     /translation="MSAEQYYGNQYAQNQYVHTRDQYYSAPQYQQPQYYQPPPQGYAP
                     QGQYYQAQPPPYYQPPPQVRQQQPIYVQQAPPQNGNEDCLMACLAAMCICLTLDLLI"
     gene            <170897..>172243
                     /locus_tag="CAGL0K01925g"
                     /db_xref="GeneID:2890326"
     mRNA            <170897..>172243
                     /locus_tag="CAGL0K01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448309.1"
                     /db_xref="GeneID:2890326"
     CDS             170897..172243
                     /locus_tag="CAGL0K01925g"
                     /note="highly similar to uniprot|P39958 Saccharomyces
                     cerevisiae YER136w Secretory pathway GDP dissociation
                     inhibitor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448309.1"
                     /db_xref="GeneID:2890326"
                     /db_xref="GOA:Q6FN85"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:Q6FN85"
                     /translation="MDQETIDRDYDVIVLGTGITECILSGLLSVEGKKVLHIDKQDHY
                     GGEAASITLSQLYSKFKQNPLSKEDREAKFGKDRDWNVDLIPKFLMANGELTNILVHT
                     DVTRYVDFKQVSGSYVFKQGKIYKVPANEVEAISSPLMGIFEKRRMKKFLEWISSYKE
                     DDNSTHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSYERIL
                     LYCQSVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIEEVLYSDTDKKFA
                     GVKTKLGEFKAPLVIADPTYFPDRCKSTGQRVIRAICILNHPVPGTGNADSLQIIVPQ
                     SQVGRKNDIYIAVVSDAHQVCSKGHYLAIISTIIETDKPHIELEPAFKLLGPIEEKFM
                     GIAELFEPKDDGSKDNIFLSRSYDASSHFESMTDDVKDIYLRVTGHPLVLKKRAEE"
     gene            complement(<172341..>172658)
                     /locus_tag="CAGL0K01947g"
                     /db_xref="GeneID:2890327"
     mRNA            complement(<172341..>172658)
                     /locus_tag="CAGL0K01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448310.1"
                     /db_xref="GeneID:2890327"
     CDS             complement(172341..172658)
                     /locus_tag="CAGL0K01947g"
                     /note="some similarities with uniprot|P40083 Saccharomyces
                     cerevisiae YER137c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448310.1"
                     /db_xref="GeneID:2890327"
                     /db_xref="GOA:Q6FN84"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6FN84"
                     /translation="MHCIKKRDAQPNRHCYANDMGKNELEEDVRKLSEAMDQIAKLVI
                     ATGVVKKPQDGSQEPQGPQVQPQMQTPKKKKKKKNKIHCSYCNEVGHTRARCPKKLGL
                     IDI"
     gene            <173107..>173155
                     /gene="SCR1"
                     /locus_tag="CAGL0K01961r"
                     /db_xref="GeneID:2890328"
     ncRNA           <173107..>173155
                     /ncRNA_class="SRP_RNA"
                     /gene="SCR1"
                     /locus_tag="CAGL0K01961r"
                     /product="uncharacterized ncRNA"
                     /note="noncoding RNA scR1 domain IV (SRP RNA)"
                     /transcript_id="XR_002648369.1"
                     /db_xref="GeneID:2890328"
     gene            <173321..>173713
                     /locus_tag="CAGL0K01969g"
                     /db_xref="GeneID:2890329"
     mRNA            <173321..>173713
                     /locus_tag="CAGL0K01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448311.1"
                     /db_xref="GeneID:2890329"
     CDS             173321..173713
                     /locus_tag="CAGL0K01969g"
                     /inference="similar to AA sequence:UniProtKB:P38204"
                     /note="similar to uniprot|P38204 Saccharomyces cerevisiae
                     YBL025w RNA polymerase I specific transcription initiation
                     factor RRN10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448311.1"
                     /db_xref="GeneID:2890329"
                     /db_xref="InterPro:IPR007898"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:Q6FN83"
                     /translation="MDHTVYDACSDLILEHGKAVSADEVLADRIGNCVPIPLKTRQEL
                     ELLSRGDRAAGVFSGDVVPRIDLRVVHYYATQLILAKYPQLMNRFDETSMITLGLLIE
                     QWVEEYLSGDSADAVAKHIDYRLNPTDI"
     gene            <173969..>175987
                     /locus_tag="CAGL0K01991g"
                     /db_xref="GeneID:2890330"
     mRNA            <173969..>175987
                     /locus_tag="CAGL0K01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448312.1"
                     /db_xref="GeneID:2890330"
     CDS             173969..175987
                     /locus_tag="CAGL0K01991g"
                     /note="highly similar to uniprot|P38205 Saccharomyces
                     cerevisiae YBL024w NCL1 tRNA
                     (cytosine-5-)-methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448312.1"
                     /db_xref="GeneID:2890330"
                     /db_xref="GOA:Q6FN82"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FN82"
                     /translation="MARRRNYNKKKTFGARDDTNARKGWNELVRENAKWESYYKLLQL
                     FPAEQWDEFKTTCQSPLPLTFRVTGSRKHADEVLSLFKTRHLPNLTDVEFEGNKIQAP
                     KSLPWYPNEYAWQLDVPKTVIRKNEQFAKTQRFLVVENAVGNISRQEAVSMIPPIVLE
                     VEPHHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDADSRRSHMLVHQLKRLNS
                     ANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGDGTMRKNVNVWKDWNT
                     QGALGLHTVQLNILDRGLHLLQNNGRLVYSTCSMNPIENEAVVAEALRRWGDKVRLVD
                     CSEKLPGLIRSQGITQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVY
                     PHQQNTGGFFITVFEKVVEEEEEVEEPQQKKVKLDTQAPVKKEKLPRDANEEPFVFID
                     PNHAALQTCWKFYGIDDKFDKTACLVRNATGEPTRVVYTVCSALKNIIQRNEDRLKII
                     YSGVKLFVSQRSDIECSWRIQSESLPIVKHHMQSDRIVKVKPELLKLLLVDSFPSFEM
                     IQNEHIDDDFVEKMKEISSGCAFIEVIRDDENKENLFLPLWKGNRNVNLMVCKEDTHE
                     LLYRVFGIETTAKDNPKAQAQKNAAEKKSEQDSEKESEKESTEPAVEA"
     gene            <176257..>177375
                     /locus_tag="CAGL0K02013g"
                     /db_xref="GeneID:2890331"
     mRNA            <176257..>177375
                     /locus_tag="CAGL0K02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448313.1"
                     /db_xref="GeneID:2890331"
     CDS             176257..177375
                     /locus_tag="CAGL0K02013g"
                     /note="similar to DEHA0F22847g Debaryomyces hansenii and
                     KLLA0F12606g Kluyveromyces lactis and CA4239|IPF8174
                     Candida albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448313.1"
                     /db_xref="GeneID:2890331"
                     /db_xref="GOA:Q6FN81"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:Q6FN81"
                     /translation="MSSEGQGQTEEISASDFVNQQKQLEDEARELMPWEPKQCTYELG
                     SIRQPVFACRSHNQIGICYSCSILCHTSCDIVELFTKRHFTCDCGTERDTKPADEDGI
                     HCQLRKNRSKDISSDSNEYRQNFKGLFCGCSTEYDPENPAVMLQCVLGTECGEDWFHD
                     YCILGKTKEEADELRARKQPDAENDDELEDPLAGMPDLETFDAFVCWKCTSKYEQYFK
                     RLLSHPLSETVIAKQLYRQCSEVKETDDGKRKHDEGSEDYSLFLKKDHESAFKKILKS
                     SEADSKIRIFLTDLAPHLIKDEPVYEPPEEKEETLSIEALTRQIIQNAMDRHTAVEGL
                     TAFHSLKDKLNSFLAPFAEAGQTVKEEDIVTFFSKSKH"
     gene            <177716..>178252
                     /locus_tag="CAGL0K02035g"
                     /db_xref="GeneID:2890332"
     mRNA            <177716..>178252
                     /locus_tag="CAGL0K02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448314.1"
                     /db_xref="GeneID:2890332"
     CDS             177716..178252
                     /locus_tag="CAGL0K02035g"
                     /note="highly similar to uniprot|P40081 Saccharomyces
                     cerevisiae YER134c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448314.1"
                     /db_xref="GeneID:2890332"
                     /db_xref="GOA:Q6FN80"
                     /db_xref="InterPro:IPR010033"
                     /db_xref="InterPro:IPR010036"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR024734"
                     /db_xref="UniProtKB/TrEMBL:Q6FN80"
                     /translation="MSYPEVAVFDLDYTVWPCYCDSHVFSPFKPVVNDNGEVHTLVDR
                     HGFEVTFFPDIPRIFTDLKDHGVKLISASRTWAPEVAQELLKGFKIRYHGKLVTLHEM
                     FDSLKWGERSKVGHIQDGMKEIYGSTELKKYRICLFDDESRNRDVERHGVKFIYIRNP
                     EKGPTWSLYQKYLNGELD"
     gene            178449..178521
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0K02057r"
                     /db_xref="GeneID:2890333"
     tRNA            178449..178521
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0K02057r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2890333"
     gene            <179166..>180104
                     /locus_tag="CAGL0K02079g"
                     /db_xref="GeneID:2890334"
     mRNA            <179166..>180104
                     /locus_tag="CAGL0K02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448315.1"
                     /db_xref="GeneID:2890334"
     CDS             179166..180104
                     /locus_tag="CAGL0K02079g"
                     /note="highly similar to uniprot|P32598 Saccharomyces
                     cerevisiae YER133w GLC7 Serine/threonine protein
                     phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448315.1"
                     /db_xref="GeneID:2890334"
                     /db_xref="GOA:Q6FN79"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FN79"
                     /translation="MESQQVDVDSIIDRLLEVRGSKPGQQVDLEEHEIRHLCSKARSI
                     FIKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLET
                     ICLLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
                     AAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSEN
                     DRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFD
                     NAGAMMSVDESLLCSFQILKPAQKSLPRQQAGRKKK"
     gene            <182946..>187847
                     /locus_tag="CAGL0K02101g"
                     /db_xref="GeneID:2890335"
     mRNA            <182946..>187847
                     /locus_tag="CAGL0K02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448316.1"
                     /db_xref="GeneID:2890335"
     CDS             182946..187847
                     /locus_tag="CAGL0K02101g"
                     /inference="similar to AA sequence:UniProtKB:P32634"
                     /note="similar to uniprot|P32634 Saccharomyces cerevisiae
                     YER132c PMD1 or uniprot|P53094 Saccharomyces cerevisiae
                     YGL197w MDS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448316.1"
                     /db_xref="GeneID:2890335"
                     /db_xref="GOA:Q6FN78"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FN78"
                     /translation="MSLLLPSACACYPLHLPSPYSHPRSNSSSSLNSADVRSPTKVSK
                     KDKEDDVYLDEALRKRLTLDVRTGSTTLLTRSNIYVNGGLTIPLNLTEVNSTQLQKEL
                     MLYFAKEKNKSISFKNLNEWISSETFFLDLISRSWRRLETTIDESSTTDDTNIKTNGR
                     LFHAMCFNEGFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYN
                     HEMHVLNSEDPTKDTKLVIVGGIDNMDEPVAKIDIFNLTTLQWESNAVEKTTRKNSGD
                     MTALNTNIDGLKTHINMDNNFSVMLDNSGKDSNAIPTLGFYLPIHKRSSKSYGKPTTK
                     KSDSKKSSKTHASENSSNKDNGLTVDTSDPKDDDLSPVAMLPLLPNTKGTRLTSRKLL
                     KLEDFPKKSTDDRSVPYNLMGPSGDSVSYSIIASGFHNNFSAANFHCYFYNVCSDTWT
                     KLCTNCQDSSIHRHRFWKTLVWKSHHQAILLGTANDDGQLPSVQKFDYLLSISLPMLN
                     GFNRILHEITPDTNIHKKVSLKTPITPLTTVDKITQSQPIIPISSPHNTSIPDPLDPR
                     RNLSLISNPTSQFENYIRYITDPLEMESTSSVFPPYAMVLGKDTLEVFGKTLADFEFI
                     TNDGESIGVPMFLLRKRWGRYFDRLLAQGYSKVCEDYRSNGVESTLIKYGSENNPILS
                     ASKTLPNKYPSNHPKIVQEKHKIKIEKRSFKKEKDNEKITSSSNGMVFRVPFKGCDED
                     NCETNNGNHLIAGTLSPSSEEKNKIMIKQKSTRTSSLVVPPPLQHRRNSVEERTQLRR
                     LSHPAKLPNGEIIDEYHFSSKHNLNTRKHHHGRYIMSNSSSRKASIVSQNSLLSFVSS
                     SSDRRTRGNSRKSSVANMSGASSPKLMPLQVNLPPQPRQPSESVPLPPLPTNLSLTQA
                     LSNIPHHRRNSHNYDYIYGDRSSASASGRSSIVQTHRYSISSDPKFSMSEKSYSGSDD
                     GNATQRHSTDKERQNDHNQEYFKRAYSWSSDAGSERSNSDASNKDDPHAINSVEIEPL
                     LIPRSLYMPWPAVSVKAFTEFFFTGQINGKWPLSPVTLDLWMMSKVYEIRLLYDLITE
                     ALYSIIGKKEGSILVNCNSLIDLFISKVNACYEDNEKCKIVLENNEAFRKLVDLRNAV
                     KDIESGFLDTTLMEKSTRIDSISTGGSYFTEGPDGMTNRKLSLSSNNLNKHFRALHNN
                     SQQSFGSRSHWKNSIDVRSISLAIPEDNGERQGNKSGRPHSKSLENLNEIDSSSEANS
                     NPNVDAKQTDKNSSVELEEQIEQVRLQTLSDIALGSGTTSPLTDNAGISNSMLPNDAL
                     AMDTESLLSTISDSDEYDMLHDEMPLNMMTEKVREEKEEFEGSIDPLYKLPSTKAGST
                     VDTGTRSSENKNSAGENEIPPFSTLENMMSPNALPPVDHVLKSICRTAVLVNDGGIML
                     RASECIEFSKKLKKLKTIITNDLMTLENNTMAAPIPMGRGALEDIIFGSFQKFDSEPN
                     IQRATAVRPPLGPKTTSHNVEVLRKPSNANSIYTTQSTISPRTSAVHSDIFIPTTGSM
                     YNSNSANTPSSILTNSASKSNTNQRRNRQNSRFNSQASGSMAVLMNPAVMPPPPPSSP
                     SAAKSKKEGPPSTGPLSFLGIKK"
     gene            complement(<188731..>189090)
                     /locus_tag="CAGL0K02123g"
                     /db_xref="GeneID:2890336"
     mRNA            complement(<188731..>189090)
                     /locus_tag="CAGL0K02123g"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_448317.1"
                     /db_xref="GeneID:2890336"
     CDS             complement(188731..189090)
                     /locus_tag="CAGL0K02123g"
                     /note="highly similar to uniprot|P39938 Saccharomyces
                     cerevisiae YGL189c RPS26A"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_448317.1"
                     /db_xref="GeneID:2890336"
                     /db_xref="GOA:Q6FN77"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:Q6FN77"
                     /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKSVPKDKAIKRMAIRNI
                     VEAAAVRDLSEASVYSEYVLPKTYNKLHYCVSCAIHARIVRVRSREARRIRTPPQRPR
                     FNRENKVSPADAAKKAL"
     gene            <190884..>191837
                     /locus_tag="CAGL0K02145g"
                     /db_xref="GeneID:2890337"
     mRNA            <190884..>191837
                     /locus_tag="CAGL0K02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448318.1"
                     /db_xref="GeneID:2890337"
     CDS             190884..191837
                     /locus_tag="CAGL0K02145g"
                     /note="some similarities with uniprot|P39959 Saccharomyces
                     cerevisiae YER130c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448318.1"
                     /db_xref="GeneID:2890337"
                     /db_xref="GOA:Q6FN76"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FN76"
                     /translation="MTDTFQLVHSDLTGNTLINNDAEQSVVIDDYEYEMLKRPSISDY
                     MLDRSRYYEYEKFDDISTAVLPEDKFIEPSQQIKKTTKVRNYFNNIFSNNIWSNYKRN
                     KSNSSALSGQDAYDVMTLNDEKMDDGDDIMDLDDDHNDLDMEPQVLNVNPRKVFSSID
                     NEALTQNQVFNFHSIINEVDDQFYIHNNPYQTYERRSNSIRQNESIDEDWNDQEDNTE
                     SQYSEKTAYDSSTTNSPEGKKIRINGLPPRTRGRKPSLVPDLSKQFGCEFCDRRFKRQ
                     EHLKRHIRSLHMGEKPYECHICNKKFSRSDNLNQHIKTHSH"
     gene            complement(<192297..>195785)
                     /locus_tag="CAGL0K02167g"
                     /db_xref="GeneID:2890296"
     mRNA            complement(<192297..>195785)
                     /locus_tag="CAGL0K02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448319.1"
                     /db_xref="GeneID:2890296"
     CDS             complement(192297..195785)
                     /locus_tag="CAGL0K02167g"
                     /inference="similar to AA sequence:UniProtKB:P38990"
                     /note="similar to uniprot|P38990 Saccharomyces cerevisiae
                     YER129w Serine/threonine-protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448319.1"
                     /db_xref="GeneID:2890296"
                     /db_xref="GOA:Q6FN75"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FN75"
                     /translation="MVITTDSKYIEEVDIPENLQLEIDLSDPLLKGNSNSNTNVCTQS
                     TLNTTTSTVSPVRKRFESLPEGLSASSSSLDSLNLLLEKQMTKQLNHPQHQEHLGSGK
                     YSPLGGNGGKLGRRTKVKETNRISLTYDPVSKRKVLNTYEIIKELGHGQHGKVKLGRD
                     LVTKRLVAIKIVDRHEKKERKFFSFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVL
                     DDLKSRKIYLVLEYCSRGEVKWCPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLH
                     YQGIIHRDIKPANLLLSETGIVKISDFGVSLAASSSNVDGSDETIDELELAKTAGTPA
                     FFAPEICLGEDAFEKYQLDREELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFEL
                     ELFEKIVNDPVKFPKYSDMLKNNQVLQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEI
                     KRHPFVCWDFDHLDGESEQELSLKLEEKMNFQCAQRDYLTQISVTMHELNNAVCGVGK
                     EIKESDLQSITYRENASSDNSINLEKFNLIRDRDNSLIVSEGSILKNMKDLRRLSSKK
                     SGADESLKKETNLEQSQLLLQNLKLVSSEDCEYDQDADFEESHGTSYSDNDESASETL
                     SQKEQFEKEMEEFEKRQQNNNVVNLPINSSFASLDSFYIDNFAMTKMGMDNEVTNPEQ
                     RNSSASTFTKWNTGSTHSVSPISHNSAHFTNNGNPSGNTTNISRNPSSHMLPYSLGMS
                     STRNDRIPRNHSISPHYSSNSSRKSRLQLSEAFPAKLKMTSKSKSQTNYHEGYENTEV
                     DREKAGKRASSHPRTQSRMQRANSTTKNSNHAIAAKNEAANRSTDSNRSDSPLISLQD
                     MVKASGSNQDTYNVKKGNFFDNFNGDDDSSSRSSVSSESSESYSDVPISEDSYSSASV
                     SRRNTDTESLPYEFGIDSGRASTVSLRDVPQNLGNVRPFLDLHPLTNSSSKGSQQRRD
                     SMNSSGSDSDSDGPGSVLVLRAGNKGHMRRQNSYQNDRPFNDSASTITPGATSPKRFY
                     AKGSTLQPTNDRAKGYCKSNLNPGVMAANAGTLVMSDSRAKPVIGTSDVFGTISNSTL
                     TDVARHPLSRDLLKDALSSGENSGRRGSIPLGILGIGSNSSPMNATVGGTLNKRASWS
                     KDRTSLSDDELHSKNH"
     gene            complement(<196915..>197532)
                     /locus_tag="CAGL0K02189g"
                     /db_xref="GeneID:2890297"
     mRNA            complement(<196915..>197532)
                     /locus_tag="CAGL0K02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448320.1"
                     /db_xref="GeneID:2890297"
     CDS             complement(196915..197532)
                     /locus_tag="CAGL0K02189g"
                     /inference="similar to AA sequence:UniProtKB:P40080"
                     /note="similar to uniprot|P40080 Saccharomyces cerevisiae
                     YER128w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448320.1"
                     /db_xref="GeneID:2890297"
                     /db_xref="InterPro:IPR013640"
                     /db_xref="UniProtKB/TrEMBL:Q6FN74"
                     /translation="MINDYTRRKVAVQDTQACYLCHKPTNVVLYNQSGPDWFYTCELH
                     LQNNPQFAVPVYGAEYESILKKMKETKELLNKQVTSKGGVGNWDGWVNKLISSRKSKD
                     DDKEADKKDDQKDDTQDAERQEPDLQKQYDMLLDKLTEIKSKNKKYKLSDMMFQNRVD
                     LKERERLRRIRIQKEQEQYSNTDPVELETKFQFPSIPQTTPNKKV"
     gene            complement(<197792..>198847)
                     /locus_tag="CAGL0K02211g"
                     /db_xref="GeneID:2890298"
     mRNA            complement(<197792..>198847)
                     /locus_tag="CAGL0K02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448321.1"
                     /db_xref="GeneID:2890298"
     CDS             complement(197792..198847)
                     /locus_tag="CAGL0K02211g"
                     /inference="similar to AA sequence:UniProtKB:P40079"
                     /note="similar to uniprot|P40079 Saccharomyces cerevisiae
                     YER127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448321.1"
                     /db_xref="GeneID:2890298"
                     /db_xref="GOA:Q6FN73"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:Q6FN73"
                     /translation="MSLKSTLREINESLKATSESLDKLQDQYESGLPIEGGLKKYLGK
                     DGSGNEQVSLLTLKNDSMLAYLNSLLHILHDKMDRTGERVTADGHRERTIEHRVVLER
                     GVKPLEKKISYQLDKLTRAYTRMEKEYTDAEKRAAEKSAHREAEDSDSADDSSDEELS
                     YRPNASALVASKDKTSRDRKNKGDEGEGDESGEDEEKSGVYRPPKINAVLPPQQHHFE
                     DRFVARDHKNKSNRSRMQAMEDYIKENSEQPDWESSIGANIVNHGRGGVKSLRDTEKE
                     RQVTTYEEENFTRLNVGSSSAEKRKQKQRERNAKVNIIGGEDFSIFNSKRKLEDSTSR
                     RGNKKSRNAWDRAKRRL"
     gene            <199177..>199962
                     /locus_tag="CAGL0K02233g"
                     /db_xref="GeneID:2890299"
     mRNA            <199177..>199962
                     /locus_tag="CAGL0K02233g"
                     /product="ribosome biogenesis protein NSA2"
                     /transcript_id="XM_448322.1"
                     /db_xref="GeneID:2890299"
     CDS             199177..199962
                     /locus_tag="CAGL0K02233g"
                     /note="highly similar to uniprot|P40078 Saccharomyces
                     cerevisiae YER126c"
                     /codon_start=1
                     /product="ribosome biogenesis protein NSA2"
                     /protein_id="XP_448322.1"
                     /db_xref="GeneID:2890299"
                     /db_xref="GOA:Q6FN72"
                     /db_xref="InterPro:IPR022309"
                     /translation="MPQNDYIERHIKQHGRRLDYEERKRKREAREVHKVAEKAQKLTG
                     WKGKQFAKKRYAEKVAMRKKIKAHEQSKAKGSSKPLADNGEALPTYLLDREQTNTAKA
                     ISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKSKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKG
                     TIIEVNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAILLV"
     gene            complement(<200548..>203016)
                     /locus_tag="CAGL0K02255g"
                     /db_xref="GeneID:2890300"
     mRNA            complement(<200548..>203016)
                     /locus_tag="CAGL0K02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448323.1"
                     /db_xref="GeneID:2890300"
     CDS             complement(200548..203016)
                     /locus_tag="CAGL0K02255g"
                     /note="highly similar to uniprot|P39940 Saccharomyces
                     cerevisiae YER125w Ubiquitin--protein ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448323.1"
                     /db_xref="GeneID:2890300"
                     /db_xref="GOA:Q6FN71"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR024928"
                     /db_xref="UniProtKB/TrEMBL:Q6FN71"
                     /translation="MPAISVKLVAAESLYRRDVFRSPDPFAVLTIDGYQTKSTAAAKK
                     TLNPYWNETFRFDDINENSILTIQVFDQKKFKKKDQGFLGVVNIRVGDVLGHLDEDTA
                     TQTRAKEETITRDLKRSNDGMAVSGRLIIVLSKVAGSGSGSATASANGSSTAAETTAS
                     AMGNLSLDNSTNVNSSPIANHNSSTMSSSASGTRTVQAASLTPRPTAQAVETTLQSGN
                     QSNPAATAAAANVANRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPT
                     LEQSEQERGSQLTANTELERRQHRGRTLPGNVTDGVTVQVGGTSTTPAINGAAAAAFA
                     ATGATTSGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQ
                     QQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRR
                     KVIYFRSQPALRILPGQCHIKVRRNNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLD
                     YGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTIQINSNSGINPEHLNYFKFIGRVVG
                     LGVFHRRFLDAFFVGALYKMMLRKKVALQDMEGVDADVYNSLKWMLENSIDGVLDLTF
                     SADDERFGEVVTVDLKPDGRNIEVTDEVKKEYVELYSQWRIVDRVSEQFKAFMDGFNE
                     LIPEDLVTVFDERELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDN
                     EQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGEVEQLPKSHTCFNRVDLPP
                     YADYDSMAKKLTLAVEETIGFGQE"
     gene            <203760..>205463
                     /locus_tag="CAGL0K02277g"
                     /db_xref="GeneID:2890301"
     mRNA            <203760..>205463
                     /locus_tag="CAGL0K02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448324.1"
                     /db_xref="GeneID:2890301"
     CDS             203760..205463
                     /locus_tag="CAGL0K02277g"
                     /inference="similar to AA sequence:UniProtKB:P40077"
                     /note="similar to uniprot|P40077 Saccharomyces cerevisiae
                     YER124c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448324.1"
                     /db_xref="GeneID:2890301"
                     /db_xref="GOA:Q6FN70"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MTDYYEPINIFRQCAISVKKRGQEHGLDVATRRVASWQRSAKLN
                     SPTLRKVSDDYFLTKKVKSDYWQVSDMDLSATAFSSVGNLVMVTSNKDQDNVKLYTYA
                     EDPNSMRQLQTITVPGAPITTATLLPAAEFNPTAYVPDHEQLLLTGHRDGIVNLISTS
                     FTKGESRIVKRYNHRKHLVSMANEVMNIDTKHKDEIEQLLANHKQKSNSARAMPVRSI
                     KPWNGMGFVSLINDSLFVFTLNNTKTPQYLNSFPGIQSFAIQTHSNPYLLGLTGTHFG
                     ANNIALLDLKKTLYIPDPVIDKEYRKSSSRSVSSDCTWISSCYLAQALGKEVNIWDVR
                     RTDGKPKAKILPNKGVIEHLSYHYETDTLFSSDDQGNIIAWDLTNLDRLEYCGLVHGL
                     DAVKYNMNLPINDSNYSQCGNVVVNGNNNSACTYRKLARKIEVNQRAGTLFSYCDHEL
                     GLHRLFSAPVEISLQLSDTETINYESEEEEVMVHVDKLHDNSHENSSILHSDSTTLHS
                     RDFDSYSDNESANTTDNDNELAYMDTFKRPVPAFLDEKVAAYNNPVLSSSSSTLAYGY
                     F"
     gene            complement(<206161..>207777)
                     /locus_tag="CAGL0K02299g"
                     /db_xref="GeneID:2890302"
     mRNA            complement(<206161..>207777)
                     /locus_tag="CAGL0K02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448325.1"
                     /db_xref="GeneID:2890302"
     CDS             complement(206161..207777)
                     /locus_tag="CAGL0K02299g"
                     /inference="similar to AA sequence:UniProtKB:P39962"
                     /note="similar to uniprot|P39962 Saccharomyces cerevisiae
                     YER123w Casein kinase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448325.1"
                     /db_xref="GeneID:2890302"
                     /db_xref="GOA:Q6FN69"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FN69"
                     /translation="MSGQRTGSNPRSGYQHVVGMHYAVGPKIGEGSFGVIFEGQNILN
                     SSDGRQGHGSGSGSAHGSGNGNGNSLAGFPVAIKFEPRHSDAPQLRDEFRAYRILNGS
                     KGIPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGRKFSIKTTCMLAKQMIERVRIIH
                     DHDLIYRDIKPDNFLISEFQKASNNNGECVKYCAQSAGGDPNLIYMVDFGMAKQYRDP
                     RTKQHIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLK
                     APNNKLKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYTRSLKFDEDPDYDYLISLM
                     DGVLLSKGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNAQPRNNNNNNNGAKNNG
                     NTGRQRNDSKRTSQQQQVQLAQTAMHSAKNKLATPSKQKEAMSTDKKHLSNLSEHSSD
                     VIYHTLTQPNMNQGYDSMGTQDRRKSQSQHKLQTKRKNSRAHMQYQKGSNNAKDNFFN
                     DQQQRYDSAVERYSIKSEKGLCARICCCFF"
     gene            <208082..>209149
                     /locus_tag="CAGL0K02321g"
                     /db_xref="GeneID:2890303"
     mRNA            <208082..>209149
                     /locus_tag="CAGL0K02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448326.1"
                     /db_xref="GeneID:2890303"
     CDS             208082..209149
                     /locus_tag="CAGL0K02321g"
                     /inference="similar to AA sequence:UniProtKB:Q12432"
                     /note="similar to uniprot|Q12432 Saccharomyces cerevisiae
                     YPR023c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448326.1"
                     /db_xref="GeneID:2890303"
                     /db_xref="GOA:Q6FN68"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR008676"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR017398"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="InterPro:IPR026541"
                     /translation="MFEVGGKCLAYHGPLLYEAKILRRWNPKLEKVEYSVPLKSGEED
                     GLPESMNREEFYYYIHYQGWKSSWDEWVSVDRIMELTEANIELKKQLVMEAKKASLAQ
                     QQKTKNGGSAKRGGGGAHSESNHGGRRSGSGDRRDSNAEERGIVPSEGPFRTSSVMSY
                     NFSRNKLRIHIPMILESMLVDDWEIVTKEKKISNLPNPFPVETILDRFYKDVATRTTS
                     PVELSLVEEYVYGLKQYFNEAIGNLLLYKLERLQYEQVFYPTPEQQQAMTPVERSLSG
                     RRPGQLYGVLHLLRLISILPEMLSNCVGMDTQAINVILRHTEKLLLWLVDRIEDLLPH
                     KVHKSYYTNTSSQYEGVALGL"
     gene            <209474..>212962
                     /locus_tag="CAGL0K02343g"
                     /db_xref="GeneID:2890304"
     mRNA            <209474..>212962
                     /locus_tag="CAGL0K02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448327.1"
                     /db_xref="GeneID:2890304"
     CDS             209474..212962
                     /locus_tag="CAGL0K02343g"
                     /inference="similar to AA sequence:UniProtKB:Q12139"
                     /note="similar to uniprot|Q12139 Saccharomyces cerevisiae
                     YPR022c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448327.1"
                     /db_xref="GeneID:2890304"
                     /db_xref="GOA:Q6FN67"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FN67"
                     /translation="MVENHSYNVTPESVSLPSSGGEVHVVRKRSKTVSMVVGEDGQYR
                     YKCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHE
                     KRHENKSYTGRKSRSISREITPGITSPVAESPSNPSFQHSETSAYATSSRSNSNSSFT
                     VGKFSVTPQEESGNKRKRQRTKSSQKLNETTDSIGPIDPKLLDPSEADRSIYTTPAEK
                     EEDKPKTIPVYNNDVLINANNNIEDPNDDTIMTFISKKNARKQQKLVKIAPKPHNSRA
                     RPANTVIDPAIHQFSYPERKSVDHKFNNESIPAPYNAELLNYGNTIVQEKSQKKRSQS
                     GPDGSNVSRDVFDWNSVMADRDDAHQSISNSNSSTNLNKVYDLFSIDFLSDDPLQNFM
                     QELSVGHKQGGSMTSAQASTQSTNPVNSPTQDSNCSSNGLRKSEDIHLQAMPKFDDSQ
                     KSHIKDNLSTQKININNFIKKDKEQRILERDSDSKRLHHKKRKNMKLSMRQIPSFFFT
                     DQATKFDISKDKCLELFNLVPELRYIPAIELKKSLKSFWYNFHPQYGLLHKPSFNVND
                     APAILILSMIMTGASFLGSNAREMVSDPICGPLRWIIFSHPDFQPPSQTYIIQSLLLL
                     EGYEKASTNRYLHERSFLHHGTTIQLLRRTPSLGGHPSIVKREGNTTAAKILDDEQGQ
                     RDALEEIYRQWIDFEMLKRIAFYAFYMDTTHAVVFGYWNLFIHCNQIQLNLPCSDEIW
                     ESYDLSYETLLNNGFGGEARVENYQFLPTLKSLMNEVTETLRIQKLKAPTSSTPEAVK
                     AAIDSVDKVSGRKWNIRSIFGKKLLLAGIISIMFQCQEAVLPTTFRVGDGTDQVFSWT
                     EIVSFAANYWLIKVQGDCTAAKSCMVSCGNDSDILTNSDVTVDEDVIKLDLLGEEADT
                     ICKIPVYHVIQIVLRIFHNDYYIYAGAPWRMNVRLDKDEYSVVSNRVRKFASDPYNGG
                     VAIVHGFQFLFQMFLKVDSSENDGKERTITFKDYDINSDYIITRPNTVALISVLIWCY
                     NNVLFGPESQIWDNSKEEDVEASEENTRKNNEAKELYTPKESFEQYLIRMYHSLYIDT
                     NTDVITYQNEIWAKATILGTIPNTNNMCGMMLYMRDTYRRSFWDLGREFGNLFDNCLE
                     RSMGKSSPTCFNMYDV"
     gene            <213531..>216290
                     /locus_tag="CAGL0K02365g"
                     /db_xref="GeneID:2890305"
     mRNA            <213531..>216290
                     /locus_tag="CAGL0K02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448328.1"
                     /db_xref="GeneID:2890305"
     CDS             213531..216290
                     /locus_tag="CAGL0K02365g"
                     /note="highly similar to uniprot|Q12482 Saccharomyces
                     cerevisiae YPR021c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448328.1"
                     /db_xref="GeneID:2890305"
                     /db_xref="GOA:Q6FN66"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FN66"
                     /translation="MEQLNSNGRKKLEQVAIFKRFASTIDDTQDDKTASILSFLKSSH
                     GDNGIGARTTVERTGHKSTGEMVLMYDDFVRLISNSQQFYSKFSGHTFNLNQVPANTF
                     GCIFFAMDENNKGYLTISDWFQLNNILEHENYHLIILYEFFRKFDVEKTNAQLRKSVF
                     GGSKYRKQNTLHHSPDSGYGERLPFNTKSINYANKFLSFDELLLNLDQFKETISLLQN
                     CIKNDDFVQKNDLILHWDKFDFLKLYQCFHYGKPYLTLNSLVTILQNDLKYEKMITGF
                     RHLAQFDASRHRLSLNKNQLVYLLKLFYSHKVSADIFESLNLSNTKLIKSDNNSIAFN
                     VYRDIFYLFQNFDLLNQVFLKYAEDNNMSDRDIREQVITKKNLMDFLNKQYNKVTNIS
                     EFSPSQINLLFSIVANSKEYNRHRTRLIQNSQELNHEDSEINHFIHNEFMHGGRNKKE
                     ELETFNDNYKDIANGFAQDSNIKSISKTSTGWFERVFGGRSDIATMRSDLTVQDFLKI
                     LNPNYLNDVVHRLELRHIEEESLYTNYYFYPIFDSLYNFSLGSVAGCIGATIVYPIDF
                     VKTRMQAQRSLSQYKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVNDYM
                     RNKLKDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLT
                     ALQIIKRLGLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNT
                     WELLSAGALAGMPAAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSF
                     FKGGAARVLRSSPQFGFTLAAYELFHNIFPLPNDKDKFVISEDDRRAKILNNNARGPN
                     IDKRELTRIVENPYSDSYLNYYYKSCQVAKTFIELDNNFAKFDYGTYLKFHEHLRAIS
                     RGEDP"
     gene            <216795..>218492
                     /locus_tag="CAGL0K02387g"
                     /db_xref="GeneID:2890306"
     mRNA            <216795..>218492
                     /locus_tag="CAGL0K02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448329.1"
                     /db_xref="GeneID:2890306"
     CDS             216795..218492
                     /locus_tag="CAGL0K02387g"
                     /note="highly similar to uniprot|P45818 Saccharomyces
                     cerevisiae YGL171w ATP-dependent RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448329.1"
                     /db_xref="GeneID:2890306"
                     /db_xref="GOA:Q6FN65"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MDIFRVLTRGASINKKANQKGKTVDYSTADTDNDKVDNKQVEKQ
                     LNRELDFFRNKKIVSKVETAKAKLEDSVEDSHQQDNNDDVTEVAYDVKITTKEQASAL
                     RKSYKGNITGEDIPLPIGSFEDLISRFSLDKRLLNNLIENHFTEPTPIQCEAIPLCLN
                     GRDLLACAPTGSGKTLAFLIPLLQQIIEEKNFSGVKGLIISPTKELATQIFNECVKLS
                     KRIYLDKKRPLQVAILSKSLGAKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSNV
                     KHLIFDEADKLFDKTFIEQTDDILNSCTDPSMRKSMFSATIPSSVEETANSIMNDPVR
                     VIIGHKEAANTNIEQKLIFCGNEEGKLIAIRQLVQQGEFKPPIIIFLESIARAKALYH
                     ELMYDRINVDVIHAERTAIQREKIIERFKTGELWCLICTDVLARGIDFKGVNLVINYD
                     VPTTAQAYVHRIGRTGRGGRSGKAVTLYTKLDSVAIKPIINVMKQSGCEVEGWMNNIS
                     KITKREKEAIKKGKSHKERDQISTVPKVERLKRKKKQDMIRASKRRQLESNAIESAD"
     gene            complement(<218954..>219325)
                     /locus_tag="CAGL0K02409g"
                     /db_xref="GeneID:2890307"
     mRNA            complement(<218954..>219325)
                     /locus_tag="CAGL0K02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448330.1"
                     /db_xref="GeneID:2890307"
     CDS             complement(218954..219325)
                     /locus_tag="CAGL0K02409g"
                     /inference="similar to AA sequence:UniProtKB:Q12233"
                     /note="similar to uniprot|Q12233 Saccharomyces cerevisiae
                     YPR020w ATP synthase G chain mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448330.1"
                     /db_xref="GeneID:2890307"
                     /db_xref="GOA:Q6FN64"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="UniProtKB/TrEMBL:Q6FN64"
                     /translation="MIERLQSLANRLVVRGNQLATKSIYYGKVTAEVSKQIYAKEGLK
                     PPTVNEFKSTYCKLYKQGLQYFNKPSEIINCAKNIKKPDALKYGSYLVQFLGFYSVGE
                     IIGRRKFIGYKNYEHNAKAAH"
     gene            complement(<219856..>222630)
                     /locus_tag="CAGL0K02431g"
                     /db_xref="GeneID:2890308"
     mRNA            complement(<219856..>222630)
                     /locus_tag="CAGL0K02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448331.1"
                     /db_xref="GeneID:2890308"
     CDS             complement(219856..222630)
                     /locus_tag="CAGL0K02431g"
                     /note="highly similar to uniprot|P30665 Saccharomyces
                     cerevisiae YPR019w Cell division control protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448331.1"
                     /db_xref="GeneID:2890308"
                     /db_xref="GOA:Q6FN63"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FN63"
                     /translation="MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGDPSSPALFFNSS
                     SSQPQGDSQPVAPSSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYG
                     SDRQVLHSSSSNMGGYPSQRTNLRRNDIHASDLSSPRRIVDFDSRSGIQQPSSSSSSM
                     PSEATEPLRIIWGTNVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYV
                     KQLNEMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVV
                     DNQLEHELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMK
                     VAFFKCNICDHTMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQE
                     TPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKT
                     YIDVVHVKKVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPD
                     LYDLLARSIAPSIYELDDVKKGILLQLFGGTNKTFKKGGRYRGDINILLCGDPSTSKS
                     QILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDE
                     FDKMSESTRSVLHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTEN
                     IDLPPPLLSRFDLVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQ
                     YINYVKQNVHPLVTEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEA
                     HAKMRLSSTVDLEDVREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDL
                     AREIIRILKEYPADSMSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDKVIILGEGV
                     RRSVRLNIRV"
     gene            complement(<223090..>224844)
                     /locus_tag="CAGL0K02453g"
                     /db_xref="GeneID:2890309"
     mRNA            complement(<223090..>224844)
                     /locus_tag="CAGL0K02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448332.1"
                     /db_xref="GeneID:2890309"
     CDS             complement(223090..224844)
                     /locus_tag="CAGL0K02453g"
                     /inference="similar to AA sequence:UniProtKB:Q12495"
                     /note="similar to uniprot|Q12495 Saccharomyces cerevisiae
                     YPR018w CAC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448332.1"
                     /db_xref="GeneID:2890309"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:Q6FN62"
                     /translation="MTDKNEKGILSFFQNTISAKVKKSSEVIDLDDHHDDDEQQSVEE
                     GTQKQLSPMSDGLQKEATLDTSQDDSQSSNGGTASSSQSESRQSEKNRMRELKRVQRE
                     AEKLRREQLKAEEKLKKEKKKEEERLRREEEKKKREEEKRLKELQREEEKRKREQAKE
                     EERKKKEQLRLQKEEEKRQKEEEKRLKEEAKERAQSRIGNFFRKVSDDANKNVSRKTD
                     YEKYFLPFYARDGVEIRQPWTMDTQKLQSSIKTLDDLLKDRNQDASTLDPCSWLKERS
                     LDGIGYPIKNTAVSLLQQMTAKEKSDEELQTMLSMVPHKYIKFYENVRPPYIGTYSKE
                     FFLPILDPFSTSITDFNYDYDSDLEWVNEEGEEGGVDNLESGEDDDDEEDDDLASEGE
                     FDGFLDTENGDGNSKTGTNGKKFIGPLIPIVQLRSDISTFDEEDRIYFKKLAAVPLTQ
                     METFSIDPNYITPSPSPIKSSSASQRDLKRAATDQNSSGLSTPTQSPNKKSKSIITED
                     QDLLTLLKEVQNSTFSLATVSEIIQKNLPKYNKQTIKNTVKEYAVRSSGKGNEPRKWE
                     IKDLEHWENLQKAGEHKE"
     gene            <225092..>225544
                     /locus_tag="CAGL0K02475g"
                     /db_xref="GeneID:2890310"
     mRNA            <225092..>225544
                     /locus_tag="CAGL0K02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448333.1"
                     /db_xref="GeneID:2890310"
     CDS             225092..225544
                     /locus_tag="CAGL0K02475g"
                     /inference="similar to AA sequence:UniProtKB:P32601"
                     /note="similar to uniprot|P32601 Saccharomyces cerevisiae
                     YPR017c exchange factor for SEC4P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448333.1"
                     /db_xref="GeneID:2890310"
                     /db_xref="GOA:Q6FN61"
                     /db_xref="InterPro:IPR007515"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="UniProtKB/TrEMBL:Q6FN61"
                     /translation="MASTGKVRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIME
                     KYKIMETREGADAQKEYEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTW
                     ELIHCQRYLACAECDRGPIGLLCEVQDANDHSSTRKICLLSIASVDCK"
     gene            <226058..>226795
                     /locus_tag="CAGL0K02497g"
                     /db_xref="GeneID:2890311"
     mRNA            <226058..>226795
                     /locus_tag="CAGL0K02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448334.1"
                     /db_xref="GeneID:2890311"
     CDS             226058..226795
                     /locus_tag="CAGL0K02497g"
                     /note="highly similar to uniprot|Q12522 Saccharomyces
                     cerevisiae YPR016c Eukaryotic translation initiation
                     factor 6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448334.1"
                     /db_xref="GeneID:2890311"
                     /db_xref="GOA:Q6FN60"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:Q6FN60"
                     /translation="MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGD
                     SIPIAHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGL
                     VHPQTTIQDQEELSSLLQVPLVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVI
                     ESIFRLQDAQPDAISGNLRDTLIETYS"
     gene            complement(<227541..>228185)
                     /locus_tag="CAGL0K02519g"
                     /db_xref="GeneID:2890312"
     mRNA            complement(<227541..>228185)
                     /locus_tag="CAGL0K02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448335.1"
                     /db_xref="GeneID:2890312"
     CDS             complement(227541..228185)
                     /locus_tag="CAGL0K02519g"
                     /note="weakly similar to uniprot|P32488 Saccharomyces
                     cerevisiae YMR081c MBR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448335.1"
                     /db_xref="GeneID:2890312"
                     /db_xref="GOA:Q6FN59"
                     /db_xref="UniProtKB/TrEMBL:Q6FN59"
                     /translation="MQVGLENIFERSVQDPCCLIEDEMDTYTEFPKYDYSHCQAGQDE
                     LHGYTSLRKYNSVPSIPLQHNTQHIIPVSPTQARDHTTRRRSSLYSADPSHTCRRSHS
                     NANILCTPTQNRSKRNSLCSPHSSRPQEGPMRSRSQSVVAIPSHLLSIEKYITSELDT
                     NISPTINPSTKANPPFLSSQSSSDSGSYTSDYTRPPTTRRRSSFKVSLASSFSS"
     gene            complement(<230312..>231277)
                     /locus_tag="CAGL0K02541g"
                     /db_xref="GeneID:2890262"
     mRNA            complement(<230312..>231277)
                     /locus_tag="CAGL0K02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448336.1"
                     /db_xref="GeneID:2890262"
     CDS             complement(230312..231277)
                     /locus_tag="CAGL0K02541g"
                     /note="highly similar to uniprot|P38689 Saccharomyces
                     cerevisiae YHL011c ribose-phosphate pyrophosphokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448336.1"
                     /db_xref="GeneID:2890262"
                     /db_xref="GOA:Q6FN58"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:Q6FN58"
                     /translation="MPTNSIKLLAPDVHRGLAKLVAKRLGIELTDCKLKRDPSNEVSF
                     SIGESVRDQDIFIITQIGSGTVNDRVLELLIMINASKTASARRITAIIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDIPVDNLYAEPSVVRYIKE
                     NVKYEDAIIISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAAEVLLDNGHAKSVIAIVTHGVLSGNAIANINNSRLDRVVCTN
                     TVPFEDKMPQCPKLDVIDISSVLAEAIRRLHNGESISYLFKNYPL"
     gene            complement(<231812..>233572)
                     /locus_tag="CAGL0K02563g"
                     /db_xref="GeneID:2890263"
     mRNA            complement(<231812..>233572)
                     /locus_tag="CAGL0K02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448337.1"
                     /db_xref="GeneID:2890263"
     CDS             complement(231812..233572)
                     /locus_tag="CAGL0K02563g"
                     /inference="similar to AA sequence:UniProtKB:P38748"
                     /note="similar to uniprot|P38748 Saccharomyces cerevisiae
                     YHL010c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448337.1"
                     /db_xref="GeneID:2890263"
                     /db_xref="GOA:Q6FN57"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FN57"
                     /translation="MLHTVNEGTSLTYKLVLEFENREQQSNSYNIFTNHSDQKHSVIH
                     HTKNKSSDSFQDWRTSDIMLERVNITKKKNSESDKDIVTSEYLGHGIIKLFKSGTETD
                     KDDAETKDIITVPGEDTMVSILFVPTYFTIHDLLHYYIGDEIVNNQVSDFRILRNKQK
                     GFGFNFMVLMKFRESTAAKNFKDEFNGKRFSKMDPETCHVAYIKEIIFAKKLFPGDEK
                     KELPYLLNDPFTTVRENTNADHDVELPTCPVCLERMDSETTGLITIPCQHTFHCQCLD
                     KWKNSKCPVCRLSSFRLSRDTLRKHGNKEKCSECGSSENLWICLICGHVGCGRYNSRH
                     AIKHFEETSHCFAMDSKTDRVWDYAGDNYVHRLVENEVDGKLVESVGRVDDRKAGIGS
                     SFQPSTSSNYKDDDDKDLRVNFMRNREYHLEYVEVLISQLESQSEYYEMKMQDTYKMT
                     DEIENLNQKLKDMQKENKNLKEVVDRNDQIKKDLESKIIEDKLIIKGLQENLAFRDEK
                     IESIEQRLKDQEEQNKELQDQLKDIMFYLESRDKFDQAPDEVKEGTILVQPGVTTTKS
                     KKKRNKKKVPKLPPKIDDIQ"
     gene            complement(<233972..>235078)
                     /locus_tag="CAGL0K02585g"
                     /db_xref="GeneID:2890264"
     mRNA            complement(<233972..>235078)
                     /locus_tag="CAGL0K02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448338.1"
                     /db_xref="GeneID:2890264"
     CDS             complement(233972..235078)
                     /locus_tag="CAGL0K02585g"
                     /note="some similarities with uniprot|P38749 Saccharomyces
                     cerevisiae YHL009c transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448338.1"
                     /db_xref="GeneID:2890264"
                     /db_xref="GOA:Q6FN56"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FN56"
                     /translation="MSKDKGKNLAKSRTKATTKVKKVTKGKNNNDNSHENSVTPHGQI
                     SPHYLQAYLNSANLTMGTNFLNVPMGTAQVPPPFIQHGNTEMIKTASIPPSGPNASAY
                     SIEASVNPHAQSVPPNYFMPPQFAHSTQPIIKHEDGLDAQIMSNTSIDKSETQSQTGT
                     PNDLEVSFPSISSGNASISGKDKFNEEGLTEDEIKARKKAQNRAAQKAFRERKEARLK
                     ELENKLSDIEKNRDLLVNELEDLRRLNMEINEENRILLRKGDTVYKLEPNEVAENGKF
                     SFPSEDEFFAQVVLGKYNAEGAKHSNDFEDDANKLLTVPKTWSYLHRLSEEKNFDVLC
                     LMERLKGREVSHKNGPAYYKNVIDTLVEEACLEN"
     gene            complement(235675..235748)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0K02607r"
                     /db_xref="GeneID:2890265"
     tRNA            complement(235675..235748)
                     /gene="tRNA-Val (AAC)"
                     /locus_tag="CAGL0K02607r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2890265"
     gene            <236721..>237842
                     /locus_tag="CAGL0K02629g"
                     /db_xref="GeneID:2890266"
     mRNA            <236721..>237842
                     /locus_tag="CAGL0K02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448339.1"
                     /db_xref="GeneID:2890266"
     CDS             236721..237842
                     /locus_tag="CAGL0K02629g"
                     /inference="similar to AA sequence:UniProtKB:P53912"
                     /note="similar to uniprot|P53912 Saccharomyces cerevisiae
                     YNL134c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448339.1"
                     /db_xref="GeneID:2890266"
                     /db_xref="GOA:Q6FN55"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FN55"
                     /translation="MSTPQTMQAAVIDGDHLTLKEVPVPELRDGFVLVKNRAVAGNPT
                     DWKHITWKIGPQGSIAGCDIAGEIVKLGPNVDTNKFKVGQKVYGFVHGASVKHPDNGG
                     FATYSALDSKIAYTVDDSFEVSGKDQIPEGAIKYYEDVATLPISLTTAGAVLTTNFNI
                     NLEWQPSEAQRDFPILFWGGATAVGQLLIQVAKKLHGYKKIIAVASKKHEAHLKSYGA
                     DDVFDYHDADVIEQIKNKYPDIQNLVDCVSNNDTIKQVYAVASETKPATIVQLTTLSI
                     NDIPESERKDNKTIVGCLLYCASGEEIPFGAFTLPANPEFREKVIKFIEFISPKVTAG
                     DIHHIPVKVYKNGLNDVQQILDDIQYNRNSGEKLVAVLN"
     gene            complement(<238200..>240083)
                     /locus_tag="CAGL0K02651g"
                     /db_xref="GeneID:2890267"
     mRNA            complement(<238200..>240083)
                     /locus_tag="CAGL0K02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448340.1"
                     /db_xref="GeneID:2890267"
     CDS             complement(238200..240083)
                     /locus_tag="CAGL0K02651g"
                     /inference="similar to AA sequence:UniProtKB:P38750"
                     /note="similar to uniprot|P38750 Saccharomyces cerevisiae
                     YHL008c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448340.1"
                     /db_xref="GeneID:2890267"
                     /db_xref="GOA:Q6FN54"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:Q6FN54"
                     /translation="MVDDTYYITPHEAALALVATAMKKARITFDALVLNSILGGVVFC
                     SGSLLYLAIHCESPELWDKNPGVVNFLGGIVISIGLFYVVILGADLYNSNILYFSVAF
                     LRRAVSIWDVLISWSVSWLGNLAGNLFVSYVIIYLSGIGHSEEWKAGTIKIAEQKASF
                     SFIQTFLKAIGGNFYVALAIYLQLLAKPLHVKFLAILIPIFTLVCIGLTHVVADEAML
                     FLGMYNGANVSVGKYIWKLLIPATIGNFIGGFVFAAYIPFYLHLVVVERDKEKLSLPE
                     YDERDEQPELNVDSRVVRVPRKEAESEKIDDDTEDEDDSTDKDNNEYLSEKGPLNDNS
                     STATDNEVQPYLEQIGPTMSRPASDISINSSESSVQRRYDYEGYRTRSHPNVPVTGGY
                     TTSRSLREVKTTPNLKRRRTLRSPPGVFPVRGMGEPLLREKTIENPYYTKKHKGKILR
                     ETAKHIKDAHDIGDTHEDNPHTVSNENYLKLVKTIETEEEKDYRSSSGYNVLNNKPGA
                     HLERFMTGMIKKTTSRSRGEESNDIDSRMDLSEATTQAVFPHNNISAADSYSSVGEAR
                     KTASENLGSLFKAVSRPFENPHKRPKNINDIEQQLEEAGISKRAADAANTVGGMENYS
                     DID"
     gene            complement(<241338..>244085)
                     /locus_tag="CAGL0K02673g"
                     /db_xref="GeneID:2890268"
     mRNA            complement(<241338..>244085)
                     /locus_tag="CAGL0K02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448341.1"
                     /db_xref="GeneID:2890268"
     CDS             complement(241338..244085)
                     /locus_tag="CAGL0K02673g"
                     /inference="similar to AA sequence:UniProtKB:Q03497"
                     /note="similar to uniprot|Q03497 Saccharomyces cerevisiae
                     YHL007c STE20 Serine/threonine-protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448341.1"
                     /db_xref="GeneID:2890268"
                     /db_xref="GOA:Q6FN53"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MSNANQKENVPSLGLPRTHGTLNVNALKATDILKHKGKLNEVNS
                     DQSTTNENDEVQEEAVFLDDPVHFTRVSSSSELSAALSVNTTEQEQDEEKGTEHAELE
                     PAEEDTVEVDTIRNNGDKTYSTIRESASDFETTNNTLIEISKNSSTYSSTEFLNNNNN
                     GISNSNRATIDSESKLRMNKLREGSSTSLSNDSNGFNGMISSNQASTVLSTPSQKPSS
                     TTNTITKANNGGSTRAQKEKHTSPKLPSTVTAPSSHRKSADLSKTNKLPSTTAKRTPK
                     QAVTSSSPKEPAKRKSSTSKMKGMFSSLVQNMKRNSSDNRKSASSLSSVSSSSSSTLK
                     ISTPYNPKHIYHVGVDARTGEYTGLPEEWERLLASSGISRKEQQQNMQAVIDIVNFYQ
                     DVADHTGEEKVIKTFDPKKQNPLVRDSLSKYEQVDDNRTSYASGGTPTLEQNGFHTSS
                     TPRSRTSLTSPTAGYSMISTPPMATQEKYIPTRPAPKPPGQQTPSSNASLTPKMQNAT
                     MSPIKENISSPVTKSEVDDELLLSKKNASLPKLPSDDSSSHKKSATDSAPTSVETDTE
                     TVKVPPIPKTTPTVPAKASRRSNEKKKEERERNKKLLYAKLTEICSPGDPKSKYRDLI
                     KIGQGASGGVYIAHDTESEDSVAIKQMNLEKQPKKELILNEILVMRESKHSNIVNFID
                     SYLAKGDLWIVMEYMEGGSLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDI
                     KSDNILLSLKGNIKLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIW
                     SLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDP
                     SERATATELLDDPFITEIAEDNSSLSPLVKLARIKKLEEQEEDAGTDETEPETTPDTT
                     I"
     gene            complement(<244992..>245459)
                     /locus_tag="CAGL0K02695g"
                     /db_xref="GeneID:2890269"
     mRNA            complement(<244992..>245459)
                     /locus_tag="CAGL0K02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448342.1"
                     /db_xref="GeneID:2890269"
     CDS             complement(244992..245459)
                     /locus_tag="CAGL0K02695g"
                     /note="weakly similar to uniprot|P38751 Saccharomyces
                     cerevisiae YHL006c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448342.1"
                     /db_xref="GeneID:2890269"
                     /db_xref="GOA:Q6FN52"
                     /db_xref="UniProtKB/TrEMBL:Q6FN52"
                     /translation="MVLEVVRNLLDEDINCASRRKSLIIVLGYDARSKLESLKNYKDE
                     PLTVNSILRSRRDVHVLFLNSLQYIFMYLIKLEVQPDSHTHLVIYGLDSLINEMCQED
                     SLDLNQVRAANLIFQTAYRVSRQNQLQEVLFIAYDQKKWDKLEPLRKYWQEVC"
     gene            <245911..>247104
                     /locus_tag="CAGL0K02717g"
                     /db_xref="GeneID:2890516"
     mRNA            <245911..>247104
                     /locus_tag="CAGL0K02717g"
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /transcript_id="XM_448343.1"
                     /db_xref="GeneID:2890516"
     CDS             245911..247104
                     /locus_tag="CAGL0K02717g"
                     /inference="similar to AA sequence:UniProtKB:P32902"
                     /note="similar to uniprot|P32902 Saccharomyces cerevisiae
                     YHL004w MRP4"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /protein_id="XP_448343.1"
                     /db_xref="GeneID:2890516"
                     /db_xref="GOA:Q6FN51"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005706"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="UniProtKB/TrEMBL:Q6FN51"
                     /translation="MSLRALRGFLIGTRNLPLRGIRYQSTSTGTSNNVDVNENTDDLY
                     LMKQQELNNVVVQQLKEFSKMSQAEIDNYLNNSKGAEPTEKEQLLEQELRNLFQKYSQ
                     DNQLLGGLDTAEEGHSRAVEEILQTKRFPFLVPSASDKPYSPQELYLRQAHHGSHVAK
                     LGARVEQVFSPNRDIYTPPTPEKMSIEKLMAAGVHLGQSTSLWRSSTQPFIYGEYNGI
                     HIIDLNQTLAYLKRAAQVVEGVAERGGVILFLGTRKGQKVALEEAAKRTHGYFVSTRW
                     IPGTLTNSTEISGGWEKHEVDLQDKPTGRPLQTDEKSRIVKPDLLVVLNPTENRNALN
                     EAMKSRVPTIGIVDTDSEPSFLTYPIPGNDDSLRSVNLLLGVLAKAGERGVKNRIRKA
                     SEMKQ"
     gene            complement(<247481..>248776)
                     /locus_tag="CAGL0K02739g"
                     /db_xref="GeneID:2890270"
     mRNA            complement(<247481..>248776)
                     /locus_tag="CAGL0K02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448344.1"
                     /db_xref="GeneID:2890270"
     CDS             complement(247481..248776)
                     /locus_tag="CAGL0K02739g"
                     /note="highly similar to uniprot|P38703 Saccharomyces
                     cerevisiae YHL003c longevity-assurance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448344.1"
                     /db_xref="GeneID:2890270"
                     /db_xref="GOA:Q6FN50"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:Q6FN50"
                     /translation="MKDTYAEKGESPALNRRQNLTVKTRDRRSSSVGRIDLGDTVPSI
                     STMNETKYSKLEAKRRKRALMGSDENDLDLMRKLWYSYREVNYRHSWVTPLLILFSVY
                     SAYLTSGNRTETNPLHMFVAISYRIGDTDRYGKGIKDLAFIFYHMIFFTFLREFLMDV
                     VIRPITRILNITSRHKVKRMMEQMYALFYCGCSGPFGLYIMYHSDLWLFKTKEMYNSY
                     PDFTNPFLYKVFYLGQAAFWSQQACVLVLQLERPRKDYKELVFHHIVTLLLIWSSYVF
                     HFTKMGLSIYITMDISDFFLSLSKILNYLDSIFTPPVFLVFVGSWIYLRHVVNIRILW
                     SVLTEFKTEGNYVLNFATSQYKCWISQPIVFVLIFALQLVNLYWLFLIFKILLRLIFK
                     GEQKDERSDSESDESTMPGTPADDNITICINESSKEKDE"
     gene            <249893..>251245
                     /locus_tag="CAGL0K02761g"
                     /db_xref="GeneID:2890271"
     mRNA            <249893..>251245
                     /locus_tag="CAGL0K02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448345.1"
                     /db_xref="GeneID:2890271"
     CDS             249893..251245
                     /locus_tag="CAGL0K02761g"
                     /inference="similar to AA sequence:UniProtKB:P38753"
                     /note="similar to uniprot|P38753 Saccharomyces cerevisiae
                     YHL002w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448345.1"
                     /db_xref="GeneID:2890271"
                     /db_xref="GOA:Q6FN49"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /translation="MPSLEVKLRKAVLAATDGKLRSDNWQYIIGVCDLVKEDPEDASQ
                     IVMEMIEKRLGQNDANVMLRSLALVVALAENCGSRLKQQVSSKHFTGILAQLLESGDV
                     HMTVKKEIAKVVKQLSDSFKSDPSLKTMGDLNTRIRRKWPGLLEEPEKPSKQKVSHQE
                     ATDEDQELQRALKMSLEEFEKSKQQSNGSAVQSNSLQDHNQGQQQPQQQTTSGIRRVR
                     ALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPITEPSPVE
                     SQREQQIEEGVLSQAQNVQVLSAKMQMASGKGLSELNQDPEFNDLYSTVTPIRPHVTK
                     LIGKYAKEKDDVIALRQVLLNAESTYNELLDRAAKSYSIPNTQAPPYAPAVTSQPGYV
                     SNNTYQTTNGQYTQHNITPQQQYQVPSQNYQSQPPSMQSNHYIGYQHPGINDQPPPNY
                     "
     gene            <251638..>252426
                     /locus_tag="CAGL0K02783g"
                     /db_xref="GeneID:2890272"
     mRNA            <251638..>252426
                     /locus_tag="CAGL0K02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448346.1"
                     /db_xref="GeneID:2890272"
     CDS             251638..252426
                     /locus_tag="CAGL0K02783g"
                     /inference="similar to AA sequence:UniProtKB:P28495"
                     /note="similar to uniprot|P28495 Saccharomyces cerevisiae
                     YKL007w F-actin capping protein alpha subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448346.1"
                     /db_xref="GeneID:2890272"
                     /db_xref="GOA:Q6FN48"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /translation="MSNDFDTIIKNIIKDSPAGELEEVYQDLITIAGENSKETIIDAI
                     AEYNVENSIPIDVDGKDVIISKYNKQGTKFVDPVNGIQFSVDHLHQKGLDVEEYSADI
                     DADQKKAITDLGNYLSTNFPGRATFAVLPLEEQSKTAIIIVSTKYNPSNFWNGHWKSE
                     YVYDKTEGKLSGTIDIDVHYYEDGNVKFHSSKLVEETNIKDPVASIKELEHKFEQDLQ
                     ESFTDLNEKQFKSLRRRLPITRARVNWGKAIGNYRLGRDAAQGK"
     gene            <253188..>254438
                     /locus_tag="CAGL0K02805g"
                     /db_xref="GeneID:2890128"
     mRNA            <253188..>254438
                     /locus_tag="CAGL0K02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448347.1"
                     /db_xref="GeneID:2890128"
     CDS             253188..254438
                     /locus_tag="CAGL0K02805g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448347.1"
                     /db_xref="GeneID:2890128"
                     /db_xref="GOA:F2Z684"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:F2Z684"
                     /translation="MRLGRWFAILSSKLCSDTDVTKLERSLDVRVTLRRLRSYRPTIG
                     DTVHYSFLSMILLYSYFANPLPFIVKTLIAMILMTLFVVPMTSQFFFNALPILTWLIL
                     YFTSSHIPNSHRPSISVEVLPAIETILYGDNLSEILAAWQNTILDILAWIPYGLFHFG
                     APFVVAIVLFIFGPPTVLQGYAFAFGYVNLFGVLFQNIFPAAAPWYKIHYGLQVANYS
                     IKGMPGGLSRIDDLLGVNLYSSGFKNSAVVFGAFPSLHSACATMEALFFSYCFPSLTP
                     LFIFYVWWLWWSTMYLTHHYFVDLTAGSVLAYFIFQYTKYTHLPIVDPNLLFRWSYDS
                     IEFYDVKNNDPLSITNNDIESIPLNTIELDTEEVFNIEREKSRTPELSHAVSSSSLAN
                     GRSQTYPNTGNTFKSKTRLSKLVI"
     gene            <255258..>255719
                     /locus_tag="CAGL0K02827g"
                     /db_xref="GeneID:2890273"
     mRNA            <255258..>255719
                     /locus_tag="CAGL0K02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448348.1"
                     /db_xref="GeneID:2890273"
     CDS             255258..255719
                     /locus_tag="CAGL0K02827g"
                     /note="highly similar to uniprot|P36108 Saccharomyces
                     cerevisiae YKL002w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448348.1"
                     /db_xref="GeneID:2890273"
                     /db_xref="GOA:Q6FN46"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FN46"
                     /translation="MKAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQL
                     QKISMEFEKQSDLMDQRQEFMDEAIDNVMGDELEENEDADEIVNKVLDEIGIDLNSQL
                     QNTPQHELKLPGEAESQNGVAETVGASGSGGDTKMSPDDDLQARLDSLKRQ"
     gene            complement(<256016..>257362)
                     /locus_tag="CAGL0K02849g"
                     /db_xref="GeneID:2890274"
     mRNA            complement(<256016..>257362)
                     /locus_tag="CAGL0K02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448349.1"
                     /db_xref="GeneID:2890274"
     CDS             complement(256016..257362)
                     /locus_tag="CAGL0K02849g"
                     /note="highly similar to uniprot|P38755 Saccharomyces
                     cerevisiae YHR001w OSH7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448349.1"
                     /db_xref="GeneID:2890274"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:Q6FN45"
                     /translation="MKDSLKIKGNSASHSSTSLSESMSKVSISSKSNENIDTDDIDEN
                     DESGQNILLSIIAQLKPGCDLSKITLPTFILEKKSMLERITNQLQFPDIVLDAHQEKD
                     ELQRFVKIVKWYLAGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYIAEQTCHHP
                     PESAYFYMIPESNIRVDGVVIPKSRFLGNSSAAIMAGETILQFLDMKDKDGKPEKYTL
                     SQPNIYARGILFGKMRMEVGDHMIIKGPKYEVDVEFKTKGFISGTYDAIEGVIKDKKG
                     KEYYQISGKWNDIMYIKDLREKHAKKTVLFDTHKNKPLKPKVRPLEEQGEYESRRLWK
                     KVTDALAVRDHEVATEEKFKIEDYQRQLRKKRLEDGVEFHPKLFRKANPGDDIDHYIY
                     KHIPEGDDYEAQIKSILEIAPILPGQKFTEKFAIPAFKKHEIQEKSMSQLSLHKAK"
     misc_feature    257665..257774
                     /note="Centromere Cen0K"
     gene            <258618..>259042
                     /locus_tag="CAGL0K02893g"
                     /db_xref="GeneID:2890276"
     mRNA            join(<258618..258626,258815..>259042)
                     /locus_tag="CAGL0K02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448350.1"
                     /db_xref="GeneID:2890276"
     CDS             join(258618..258626,258815..259042)
                     /locus_tag="CAGL0K02893g"
                     /inference="similar to AA sequence:UniProtKB:P37299"
                     /note="similar to uniprot|P37299 Saccharomyces cerevisiae
                     YHR001wa QCR10 ubiquinol--cytochrome-c reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448350.1"
                     /db_xref="GeneID:2890276"
                     /db_xref="InterPro:IPR019182"
                     /db_xref="UniProtKB/TrEMBL:Q6FN44"
                     /translation="MVSYISRLAAAPGLHFGKISFKNLLNYSPNLMVWGATSFAGILV
                     FVEGWPLFQQTLFQKIPVFGSHWIKEIPPEDKSN"
     gene            <259855..>260883
                     /locus_tag="CAGL0K02915g"
                     /db_xref="GeneID:2890277"
     mRNA            <259855..>260883
                     /locus_tag="CAGL0K02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448351.1"
                     /db_xref="GeneID:2890277"
     CDS             259855..260883
                     /locus_tag="CAGL0K02915g"
                     /note="highly similar to uniprot|P38702 Saccharomyces
                     cerevisiae YHR002w LEU5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448351.1"
                     /db_xref="GeneID:2890277"
                     /db_xref="GOA:Q6FN43"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002167"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FN43"
                     /translation="MTKTNNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKI
                     LFQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYE
                     QIRSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIV
                     KTIYHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMK
                     SSLMAPYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRR
                     LQVSTLSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYE
                     RMKWHLGI"
     gene            complement(<261102..>262418)
                     /locus_tag="CAGL0K02937g"
                     /db_xref="GeneID:2890278"
     mRNA            complement(<261102..>262418)
                     /locus_tag="CAGL0K02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448352.1"
                     /db_xref="GeneID:2890278"
     CDS             complement(261102..262418)
                     /locus_tag="CAGL0K02937g"
                     /note="highly similar to uniprot|P36101 Saccharomyces
                     cerevisiae YKL027w or uniprot|P38756 Saccharomyces
                     cerevisiae YHR003c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448352.1"
                     /db_xref="GeneID:2890278"
                     /db_xref="GOA:Q6FN42"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FN42"
                     /translation="MGKDHWKLVAVTAAVTITLTKIAEVAWKKYVEQKDAITQQVSVK
                     KMLKREYDDNLFREQLARNYAFLGEDGMEKLKNQYIVVVGAGGVGSWVVTMLIRSGCK
                     KIRVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWNKEN
                     GEELLLGGGKPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDI
                     TITEEDPLARAVRRRLKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELS
                     ALKDFRVRILPVLGTMPGIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAG
                     QMTRIGMPDQRVPIALKEVGYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVV
                     LTKEEQKEHEQRILNGKEALSDVYSQDVIDLVNQRFEEELYYSRYR"
     gene            complement(<262936..>264330)
                     /locus_tag="CAGL0K02959g"
                     /db_xref="GeneID:2890215"
     mRNA            complement(<262936..>264330)
                     /locus_tag="CAGL0K02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448353.1"
                     /db_xref="GeneID:2890215"
     CDS             complement(262936..264330)
                     /locus_tag="CAGL0K02959g"
                     /inference="similar to AA sequence:UniProtKB:P38757"
                     /note="similar to uniprot|P38757 Saccharomyces cerevisiae
                     YHR004c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448353.1"
                     /db_xref="GeneID:2890215"
                     /db_xref="GOA:Q6FN41"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FN41"
                     /translation="MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQD
                     TEGNDKCLNTKAQIRVNDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPV
                     SDEDEEKDIDGQMSRGLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVR
                     RRGKATENEHLSQSPATNKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPT
                     NKDSSQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVI
                     DLDETLIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYN
                     LIIFTASMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKN
                     ATIPLTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRN
                     VLALKNSEKAFQLS"
     gene            <265614..>266450
                     /locus_tag="CAGL0K02981g"
                     /db_xref="GeneID:2890216"
     mRNA            <265614..>266450
                     /locus_tag="CAGL0K02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448354.1"
                     /db_xref="GeneID:2890216"
     CDS             265614..266450
                     /locus_tag="CAGL0K02981g"
                     /note="weakly similar to uniprot|Q04751 Saccharomyces
                     cerevisiae YMR069w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448354.1"
                     /db_xref="GeneID:2890216"
                     /db_xref="GOA:Q6FN40"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FN40"
                     /translation="MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQR
                     KVLVIDGDDYCLANKALTNEVVLRSKHIKESKNILSSLLELLDQNLGQKYEISSKEMY
                     GNKKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSV
                     IFLYEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLP
                     AINLYQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKP
                     IL"
     gene            <277585..>279528
                     /locus_tag="CAGL0K03003g"
                     /db_xref="GeneID:2890217"
     mRNA            <277585..>279528
                     /locus_tag="CAGL0K03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448355.1"
                     /db_xref="GeneID:2890217"
     CDS             277585..279528
                     /locus_tag="CAGL0K03003g"
                     /note="weakly similar to uniprot|P54785 Saccharomyces
                     cerevisiae YMR070w MOT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448355.1"
                     /db_xref="GeneID:2890217"
                     /db_xref="GOA:Q6FN39"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FN39"
                     /translation="MKDGASEDCNPSSAVEEDRGRHAAPINHLGSSNKANEIAVADRE
                     HTFSIRKLYPISENVSRVKSQQQEVPYQRNLPTINGTETESARQNLQHAFDKYSKNNN
                     LTPKAVQPALNQGVRYIWTKTNPVPRVGNSTVSLSNSSEGSSGAMVNNNDHALDNALN
                     TSVTKGQNDPRLSHILSSSNGNIDTTVAKHSLRKEEKSSLEISNNFDHQAQAPKGLDL
                     SAVDTTSQPGLYTTTGSQVHPVTQHYQYNGSKMPYDWSNSLRQRIGNSNTAGQVYFVG
                     TPPDAPNRSHDYTHLYANTAPLPQGVSYVWHAHGPPFLASNSNTTESYSGSTLVAATT
                     NQAKIASPSVSYGNNTHPENTPRLSVSNIHQLTPNQKGASFQRPLQSILPIIPSHTQS
                     KFANVKLDQDKQTNFGNQIMFNSSENTPPLAHQVVYADNRLGSVPNNAISYNADASRA
                     PIGPPIGSAGVYYNPNYTYVMQEQPKTVSDNVVSRINSHPILGQTNYLLPRADPSLTT
                     QLGVTNEMMFGNQGEKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPW
                     CNSRHKRRDNLLQHMKLKHVPNLLQEINSRNMRFNWPILERLSKQIDGTIEYPDTKTL
                     IHEGLLNKDELKNILNTVIDKHN"
     gene            complement(<283076..>283579)
                     /locus_tag="CAGL0K03025g"
                     /db_xref="GeneID:2890218"
     mRNA            complement(<283076..>283579)
                     /locus_tag="CAGL0K03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448356.1"
                     /db_xref="GeneID:2890218"
     CDS             complement(283076..283579)
                     /locus_tag="CAGL0K03025g"
                     /note="highly similar to uniprot|Q04767 Saccharomyces
                     cerevisiae YMR071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448356.1"
                     /db_xref="GeneID:2890218"
                     /db_xref="GOA:Q6FN38"
                     /db_xref="InterPro:IPR019365"
                     /translation="MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIA
                     NLFHVSAVIAFGIVGIVQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYT
                     LMAIVQYCSLAVMTTSLLVLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHD
                     AVVREML"
     gene            <284084..>284689
                     /locus_tag="CAGL0K03047g"
                     /db_xref="GeneID:2890219"
     mRNA            <284084..>284689
                     /locus_tag="CAGL0K03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448357.1"
                     /db_xref="GeneID:2890219"
     CDS             284084..284689
                     /locus_tag="CAGL0K03047g"
                     /note="weakly similar to uniprot|Q02486 Saccharomyces
                     cerevisiae YMR072w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448357.1"
                     /db_xref="GeneID:2890219"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6FN37"
                     /translation="MLALNLIRGVSRSAGVRFLQTSPIVWSKTAEGAKGKDKDAKSGV
                     SRKDLIKQFGPKRPAAAFILYTVQERANATAENPGLSTKEISAVLGEKWRQLSEYEKE
                     PYFQKTQQALEEYKTKKQEFEAMLPPKKPLSPFLLFSNEVREEIKSQNPSLSFGDLAS
                     LIGRRWKSLGEYEKKKYYDRYAENKSSWEQEVQRKLQNFKL"
     gene            complement(<285190..>285774)
                     /locus_tag="CAGL0K03069g"
                     /db_xref="GeneID:2890220"
     mRNA            complement(<285190..>285774)
                     /locus_tag="CAGL0K03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448358.1"
                     /db_xref="GeneID:2890220"
     CDS             complement(285190..285774)
                     /locus_tag="CAGL0K03069g"
                     /note="weakly similar to uniprot|Q04772 Saccharomyces
                     cerevisiae YMR073c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448358.1"
                     /db_xref="GeneID:2890220"
                     /db_xref="GOA:Q6FN36"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6FN36"
                     /translation="MQMERDKMAFKVPQMKPPQINVSDEPRSVLMDVPVQASCSTLRA
                     GGYRNKVKLAPGHSALDWQEMVSTKGKAGKLITGIDSIREDPKVLEHFKEVNSPQSLI
                     QLERGVPTYAIRPPLCIDAHELARHNTAEDCWTVINGKVYSISSYLSFHPGGAKILID
                     KSSGQDSTVLFNRYHRWISVEKMLETCLVGVYVG"
     gene            complement(<286946..>287335)
                     /locus_tag="CAGL0K03091g"
                     /db_xref="GeneID:2890221"
     mRNA            complement(<286946..>287335)
                     /locus_tag="CAGL0K03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448359.1"
                     /db_xref="GeneID:2890221"
     CDS             complement(286946..287335)
                     /locus_tag="CAGL0K03091g"
                     /inference="similar to AA sequence:UniProtKB:Q04773"
                     /note="similar to uniprot|Q04773 Saccharomyces cerevisiae
                     YMR074c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448359.1"
                     /db_xref="GeneID:2890221"
                     /db_xref="GOA:Q6FN35"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:Q6FN35"
                     /translation="MDAELQALREARLAELKRGTSDSNGGSNGGAPQERIGSSISRFL
                     EPEALERLSRVSLVRPDRAQAVENYLKQLVSTGQLRNKVSEKDIVQILDGVAREQNKK
                     NETKIIFDRRETVEDDVELEDDDDFFD"
     gene            <287882..>289165
                     /locus_tag="CAGL0K03113g"
                     /db_xref="GeneID:2890222"
     mRNA            <287882..>289165
                     /locus_tag="CAGL0K03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448360.1"
                     /db_xref="GeneID:2890222"
     CDS             287882..289165
                     /locus_tag="CAGL0K03113g"
                     /inference="similar to AA sequence:UniProtKB:P38746"
                     /note="similar to uniprot|P38746 Saccharomyces cerevisiae
                     YHL014c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448360.1"
                     /db_xref="GeneID:2890222"
                     /db_xref="GOA:Q6FN34"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FN34"
                     /translation="MKPTTNKKAKMKLPNILDALKVTNNPTSGIVGLANVGKSTFFQT
                     ITNSHLGTAANYPYATIDPEVAKVPIPSPELPVLQKLYQSGKVIPAALTIYDIAGLTR
                     GASEGHGLGNKFLSDIRHVDGIFNLVRGFKDENITHIEGNVDPVRDLSVVQDELILKD
                     LEFIDNVREKASRKLRMLSKNSKEYQEYNFEIELLGKLEEHLYDGKRISNFKNEDEKW
                     NVDEIKVLRRNNFLTAKPSLTLLNVSPEEYLQLHSQNTLENAAFSKEVTEWLKEYSPN
                     DDLIYFSAEYEKNYLEYTKNNDKSGLAQYCKNVAGTDINTSDKRTALPDIILRMKHLL
                     GLISFYTCGPLEVRQWNIRRGNNAQEAAGVIHTDLQETFISADIINYESLRDIEPPLD
                     ESYLKKKGLIKRVGKQYIMEENDIALFKAAGGKTR"
     gene            complement(<289619..>289978)
                     /locus_tag="CAGL0K03135g"
                     /db_xref="GeneID:2890223"
     mRNA            complement(<289619..>289978)
                     /locus_tag="CAGL0K03135g"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_448361.1"
                     /db_xref="GeneID:2890223"
     CDS             complement(289619..289978)
                     /locus_tag="CAGL0K03135g"
                     /note="highly similar to uniprot|P38701 Saccharomyces
                     cerevisiae YHL015w URP2"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_448361.1"
                     /db_xref="GeneID:2890223"
                     /db_xref="GOA:Q6FN33"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR018268"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:Q6FN33"
                     /translation="MSDIQKDKVQEQEAPQIIKIRMTLTSTKVKQLENVSANIIRNAE
                     QNNLVKKGPVRLPTKVLRISTRKTPNGEGSKTWETYEMRIHKRYIDFEAPVSIVKRIT
                     QITIEPGVDVEVVVASN"
     gene            <291381..>293555
                     /locus_tag="CAGL0K03157g"
                     /db_xref="GeneID:2890224"
     mRNA            <291381..>293555
                     /locus_tag="CAGL0K03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448362.1"
                     /db_xref="GeneID:2890224"
     CDS             291381..293555
                     /locus_tag="CAGL0K03157g"
                     /note="highly similar to uniprot|P33413 Saccharomyces
                     cerevisiae YHL016c Urea active transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448362.1"
                     /db_xref="GeneID:2890224"
                     /db_xref="GOA:Q6FN32"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR019900"
                     /db_xref="UniProtKB/TrEMBL:Q6FN32"
                     /translation="MGEFKAPLPQGAGYAIVLGLGTVFAVGMILTTYMLRRYQKEIIT
                     AEEFTTAGRTVKTGLVAAAVVSSWIWCSTLLTSASKQLDGMLGGYSYSAGACFQIVAF
                     AILAIKTKQKAPNAHTYLELVRKRYGKIGHCCYLFYAFATNILVTAMLLTSGAAVFES
                     MTGMNSVASCFLLPVGVVIYTLFGGIKATFLTDFIHTCVIIVIIMVFAFKVYATSDVL
                     GSPGKVYDLVREAAKRHPVPHNAQGEYLTMSSRSGGIFLIINLVGNFGTVFLDNGYWN
                     KAISASPAAALPGYVMGGLAWFAVPALLSVTMGFACLATETLKSFPTYPDPLTPEQVS
                     AGLVLPAAAVSVMGKGGAVATCLMVFMAVTSAMSAELIAVSSVFTYDIYRIYINPSAD
                     GKRLIYSSHFACVVFGLCMSGFSVGLYYAGVNLGYLYELMGIIISSAVLPVVLTLCWK
                     GQNIIAAVVSPILGTALAIMSWLVCTKSLYGEITLATSFEDYPMLTGNLVALLSPAIF
                     IPILTFLFKPQNYDMELFKEISRVDETKEILEAYPEIEPIISKTQIAHESEGSLIESD
                     YNKEDEKDAVTHIKTTEKHELDRIDTENLSEYDAQEEKKLKRALNWAYFLCIFFALAF
                     LVVWPMPMYGTKYIFSKRFFTGWVVVMIIWIFISAFCVCVFPVWEGRHGIYTTCRGIY
                     WDLTGQSYKLKEWQETNPSELHVVQSQKSIRPKISRIDDLIE"
     gene            complement(<293765..>295462)
                     /locus_tag="CAGL0K03179g"
                     /db_xref="GeneID:2890225"
     mRNA            complement(<293765..>295462)
                     /locus_tag="CAGL0K03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448363.1"
                     /db_xref="GeneID:2890225"
     CDS             complement(293765..295462)
                     /locus_tag="CAGL0K03179g"
                     /inference="similar to AA sequence:UniProtKB:P32857"
                     /note="similar to uniprot|P32857 Saccharomyces cerevisiae
                     YKL039w PTM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448363.1"
                     /db_xref="GeneID:2890225"
                     /db_xref="GOA:Q6FN31"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:Q6FN31"
                     /translation="MISTLPWTYWFLLFLAVLTVVRSPFVEANKKHVNDRMRVVCSGM
                     YSKEARGGKVDPFIGFDLEKLYPTQHDYEPGVIAVIYDFRDYQHIGIELPNGEVQYVC
                     DEYSIGKGLCKESQLNHFIIQDVIYDPFSDSTKGLSNEVLTFSHNYLGKHQSVYPVMK
                     TGYYCVRTATISSSIRFDVAINFRNAFGKIDAAEIDNIRLYGWLSLGYLVSMSMYFFQ
                     LWKNKDDLLPLHRYIMIFFSFLTIETVSIWIYYLLKNEKGNITPTKVYMVFISLMSAG
                     KASFTYFLLLIIALGYGIVYARLNKTLVNRCRAFAILNFFLYSAYLIQSYAQNPESTS
                     ITILITAVPTVLLMFVFFFLILRAITKTTSYLKGQRQTYKLSVYNRLLIVIYATLVCI
                     FIGLILCAFAYLGMNAIEIIEKHWMIRFYLTDFWPSLVYFFAFISFAYIWRPTGTTFM
                     LTTSQQQPEELENVMGLEMDDLDEFSDEFDMDDYAESETSEHRVHGINEAERQNIDDI
                     FANNEPNMDDVFSDQNELQDTDVISNFSGHNSDEDLVPNASNTKQSINDIANPKTRK"
     gene            complement(<295826..>296152)
                     /locus_tag="CAGL0K03201g"
                     /db_xref="GeneID:2890226"
     mRNA            complement(<295826..>296152)
                     /locus_tag="CAGL0K03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448364.1"
                     /db_xref="GeneID:2890226"
     CDS             complement(295826..296152)
                     /locus_tag="CAGL0K03201g"
                     /inference="similar to AA sequence:UniProtKB:P38744"
                     /note="similar to uniprot|P38744 Saccharomyces cerevisiae
                     YHL018w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448364.1"
                     /db_xref="GeneID:2890226"
                     /db_xref="GOA:Q6FN30"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:Q6FN30"
                     /translation="MFNKIVKSEAERVSAADLQKALKQLKGWTHDNSRLVREVAFKDY
                     QLTWAFLTQVAMRSHLWGHHPLITTSYTSVRLELQTHDLEMSPGVSNIDVKLAKQIEK
                     YISQHQ"
     gene            <296371..>298167
                     /locus_tag="CAGL0K03223g"
                     /db_xref="GeneID:2890165"
     mRNA            <296371..>298167
                     /locus_tag="CAGL0K03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448365.1"
                     /db_xref="GeneID:2890165"
     CDS             296371..298167
                     /locus_tag="CAGL0K03223g"
                     /inference="similar to AA sequence:UniProtKB:P38700"
                     /note="similar to uniprot|P38700 Saccharomyces cerevisiae
                     YHL019c involved in clathrin-independent transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448365.1"
                     /db_xref="GeneID:2890165"
                     /db_xref="GOA:Q6FN29"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027200"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FN29"
                     /translation="MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHVRQSQNPI
                     IDVYNWRFVYIKRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRN
                     LVLDNTLLVMELIDETLDYGIVQLTEPSIMKDYIRVRVNLPEQRIMLEEIWNTDSDSD
                     SDGNSKRKHKHKSKGDKDKPALGKVPLSKEELDKVLKTSKDKVYKKIKDNINELEKIG
                     KFRGKDEYDDDANENETFINSYIAKTTIMPVSWRAKGIHYAKNEFFLDVIEKLQYLVD
                     LESGMVRRSLIHGQIVCRSYLSGMPKLKMSLNKLLQNDKQFISQVQFHQCVSLDSIEK
                     VIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFE
                     ITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGR
                     VVYNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERE
                     TSMNPPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKV
                     EYLKIDEDQLQYQSFPWVRYKTINDDEYAYII"
     gene            complement(<298216..>299646)
                     /locus_tag="CAGL0K03245g"
                     /db_xref="GeneID:2890166"
     mRNA            complement(<298216..>299646)
                     /locus_tag="CAGL0K03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448366.1"
                     /db_xref="GeneID:2890166"
     CDS             complement(298216..299646)
                     /locus_tag="CAGL0K03245g"
                     /note="weakly similar to KLLA0F25410g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448366.1"
                     /db_xref="GeneID:2890166"
                     /db_xref="GOA:Q6FN28"
                     /db_xref="UniProtKB/TrEMBL:Q6FN28"
                     /translation="MLLFGSARRCVHGWSHVAKQLGKYGVDEVAISKLRLLQENTAIR
                     CGVLMNTRQGSFGSAFVTDKEALGSSWVPTLINRWVNEDKTPVLMKYGDQFREINGEV
                     RTFEIPSSFLKETNAEILEIPEQDQSKDKRLPHVHDGCHVYLDIRGDPTVSQPTWPTI
                     EIEDVLSKGKLLLTNQIDSQMALESLLKYNNSTISEYLNKQNASNFDRIRAKLVDKLK
                     DGNLIRTELKSSIRRYLQSTDRDISNEKRLIGKRDLTNEEIDKWAECSHKTLRDEIVP
                     SFLSFARAHLSLWKLYTYSPAKLKLNFMEYCMIPLYKVHEIENSAKVLEANMFREFDL
                     ETVSAQVMTPILPTTEIQKIGRIQTEINKAIYKQFFTIQLPMVLCALLGVVSEQFSAY
                     YMGSLAALGIVLGFWRCMKQWQYILNGYTRKVAFLLKDRIELRRAELKKLSDRCFEEK
                     ALAAKKKKELLEPLLEVDLRQKNKKC"
     gene            <299919..>301382
                     /locus_tag="CAGL0K03267g"
                     /db_xref="GeneID:2890167"
     mRNA            <299919..>301382
                     /locus_tag="CAGL0K03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448367.1"
                     /db_xref="GeneID:2890167"
     CDS             299919..301382
                     /locus_tag="CAGL0K03267g"
                     /inference="similar to AA sequence:UniProtKB:P21957"
                     /note="similar to uniprot|P21957 Saccharomyces cerevisiae
                     YHL020c Negative regulator of phospholipid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448367.1"
                     /db_xref="GeneID:2890167"
                     /db_xref="GOA:Q6FN27"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="UniProtKB/TrEMBL:Q6FN27"
                     /translation="MDTRRGWIHNYISFSGLSEEDVEAAEALDVLRNSHVDADVEVEE
                     DRSKKRVRDGEDEDGGHVRRRKASVRDRSDSRMSQLSNVSNASTEERVVRVNSHEDSQ
                     SKRQEEESLFDKVCRNSNEILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDS
                     RSISTTGADADTESQGTQGSYNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLRE
                     YKLTMSIESKKRLITCLHLLKLANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALN
                     GEHSGPQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQ
                     VRESLLNLPSNWNTSVHNGFKNNGTGIMTASSSTDSLSSYSSILPVSSNGKYLILAKE
                     SLNMVQSVIDVVDSTLGRAEEWVKQKQELKEMIKKKFLEQQEHQKMLGIGTESLDQNE
                     SSVKKEQPTTHISISSITNSTNTLDTVKEEDMHLQKV"
     gene            <301825..>302718
                     /locus_tag="CAGL0K03289g"
                     /db_xref="GeneID:2890168"
     mRNA            <301825..>302718
                     /locus_tag="CAGL0K03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448368.1"
                     /db_xref="GeneID:2890168"
     CDS             301825..302718
                     /locus_tag="CAGL0K03289g"
                     /note="highly similar to uniprot|Q03161 Saccharomyces
                     cerevisiae YMR099c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448368.1"
                     /db_xref="GeneID:2890168"
                     /db_xref="GOA:Q6FN26"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:Q6FN26"
                     /translation="MSIEETDSQVVITHPSNSNTSVTILKYGATVTSWKLNGEEQLWL
                     STAAKLDGSKPVRGGIPLVFPVFGKNQSDELLSKLPQHGFARNSTWEFLGQVKSNPPT
                     VQFGLNPKIANQELVKLWPLDFNLILTIELGEDFLKTAIEVENASEENMKFNWLFHTY
                     LHIEDIEDTMVSNLVGMKVYDQLLKESFIDKHPVVTFHQETDSIYQNVDSDRLIQVVG
                     KGKPLHTVKRENLPDAVVWNPWVDKSAGMGDFEPKDGFKNMVCVEPGHVSDFVVLPPG
                     QKWSAAQILSKQELNYQAIEP"
     gene            complement(302969..303041)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0K03311r"
                     /db_xref="GeneID:2890169"
     tRNA            complement(302969..303041)
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0K03311r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2890169"
     gene            <303720..>305528
                     /locus_tag="CAGL0K03333g"
                     /db_xref="GeneID:2890170"
     mRNA            <303720..>305528
                     /locus_tag="CAGL0K03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448369.1"
                     /db_xref="GeneID:2890170"
     CDS             303720..305528
                     /locus_tag="CAGL0K03333g"
                     /inference="similar to AA sequence:UniProtKB:Q03162"
                     /note="similar to uniprot|Q03162 Saccharomyces cerevisiae
                     YMR100w involved in budding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448369.1"
                     /db_xref="GeneID:2890170"
                     /db_xref="GOA:Q6FN25"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:Q6FN25"
                     /translation="MRDSNHRSISNNKPVITITSTVYDRRALDIESTVPLINSLNHLT
                     YLTSNSAKIRETIANDGALDRLVSILHNCHLSLHEILDKDLEFFKTHERAKSIYKRKR
                     LALCAWKWTLAFQCLVLTGTRGTEQIRKKVVLAGVIPVLATVLDNYMLFHKHYDFIRD
                     ETLDFEIDEILTFDSYKLLRKNSEETYEEYISYLIGRDKLKPTDFKRFSVEELTTPIM
                     TCATDFRDVWQRYNDSPLPTPSDKSNAKLEENCFYENDEEKFLVSTPRSFFIGKIIPK
                     QDDVIWSLQLLAFISKYTYMKQKLQNVELIDSLSFRSMIERYKKRKMTTFSNNLSPLS
                     ISKNLSEKDENIVGDIKDESDITNLQMKINNPIIKEIMECGKRCLKIEKKRKECKPKC
                     RTCILNMKSPPYIKNLQLNKYFDRLWNYQKVSKRLTDETWNSFISKQLINAFPLVEKY
                     TITDKNTHDIIYWSSVIMRNSCRKNEVTGVRQCANFSCGKWERYPREFAKCRRCKRTK
                     YCSRECQLEAWKHHRYWCHEVTSSNKSSSMNTETNTPGGTGNDSSTMMARTEGGTILQ
                     TNTAGLMLQQHTPDLTHTEEMAGQFSNDNEDINGME"
     gene            complement(<305791..>306819)
                     /locus_tag="CAGL0K03355g"
                     /db_xref="GeneID:2890171"
     mRNA            complement(<305791..>306819)
                     /locus_tag="CAGL0K03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448370.1"
                     /db_xref="GeneID:2890171"
     CDS             complement(305791..306819)
                     /locus_tag="CAGL0K03355g"
                     /inference="similar to AA sequence:UniProtKB:Q03175"
                     /note="similar to uniprot|Q03175 Saccharomyces cerevisiae
                     YMR101c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448370.1"
                     /db_xref="GeneID:2890171"
                     /db_xref="GOA:Q6FN24"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:Q6FN24"
                     /translation="MIHLIRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYI
                     NVITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVY
                     ICKTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLR
                     IVGDRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSN
                     IIDSNLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWP
                     QFNFFQMYLIILRWSMFKMFQIYNMNNVSKHSKFGSKLYKPYKTILKYIFSERLPDPP
                     MAVPVTNR"
     gene            complement(<307358..>310294)
                     /locus_tag="CAGL0K03377g"
                     /db_xref="GeneID:2890172"
     mRNA            complement(<307358..>310294)
                     /locus_tag="CAGL0K03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448371.1"
                     /db_xref="GeneID:2890172"
     CDS             complement(307358..310294)
                     /locus_tag="CAGL0K03377g"
                     /inference="similar to AA sequence:UniProtKB:Q03177"
                     /note="similar to uniprot|Q03177 Saccharomyces cerevisiae
                     YMR102c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448371.1"
                     /db_xref="GeneID:2890172"
                     /db_xref="GOA:Q6FN23"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FN23"
                     /translation="MTRFNFAIGHDEDGTTDLGKVATDTTTTTGSSIPVRSSMDSDSF
                     SHDEDAELSRSMDDSQDAREVKSMNSEYSSDDGSKDRTKKEINSAEYSADIQPLQFKM
                     SRRRTTQFDGTESSKASRKANASGNGSDPIKTLRFDEGSLSSSPTAIASDATRASLQR
                     DTFAKVREHIQRGSVGNSGLTRSDFNPFAFIDREQFETYLKEPRYIRIFKKRSRSSKQ
                     FRRLFLAQELKTTDEFDDIEAMSASLLSQPDGLKPNTSITNATLNGNNFHDNINDPNH
                     DMHSDKTFSGTACPVLPTSGHLEPAKNTKAIWSTKFSIDGKYMATGSRDGVLRLWKVL
                     STPVERWGLDSSIDSAHLTSAKSLRLQQNQHGSSHGGPLGSPAMRRDTFDNIDAKENS
                     SNLYAPVFQPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQ
                     HPDFVTCVKFHPTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGT
                     YTIVGTFNGYIHVLQTKGLEHITSFHVTAKKTHENTHEVLCPSNDSKVRHGPRVTGLQ
                     CFNSLIDNSLRLVVTSSDSRIRVFDLTRRKLIEILRGFQCGSSQHKAQISVYRNQPIV
                     INSSDDHWVYGWRLKSSDPVEINKKAKKHGMSRSGSIRGLFSKSISRSSSQGSEDRQS
                     LRNTLKLSSLLPIPHSSHSDGVMKNSDYFSFHAHNAPVTTVTMAPEETSKTLSLSNDP
                     ICELSLEFFEPSDEVDIIKLKDTQKGGHDNIPATKTPVTTSLAKPTPVEVIGSILIST
                     DSNGLIRVFRADMSKSIRARVLQKLQKYNREMGKQYGSTDSLVSENDKSRPNLGTVGH
                     QPSTNSTSFLSSTGSTNTTTVGSGSKASITRNHSFRSLKAFKSPTANFSNTALGATMN
                     RAPRESISSVRSDSTSNTMTPMSFPGLKCHVCDGTKFEPLTRSSGSQDKSYFCVDCKT
                     LLNNFR"
     gene            complement(<311316..>313427)
                     /locus_tag="CAGL0K03399g"
                     /db_xref="GeneID:2890173"
     mRNA            complement(<311316..>313427)
                     /locus_tag="CAGL0K03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448372.1"
                     /db_xref="GeneID:2890173"
     CDS             complement(311316..313427)
                     /locus_tag="CAGL0K03399g"
                     /note="highly similar to uniprot|P12688 Saccharomyces
                     cerevisiae YKL126w Serine/threonine-protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448372.1"
                     /db_xref="GeneID:2890173"
                     /db_xref="GOA:Q6FN22"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:Q6FN22"
                     /translation="MYSWKKFKFGKSKDEKEQKKDKLFHFHHKHTGSDVSDNFGNGND
                     KEKSVDSLPSSSEITPYPSDLPSQNTNGNNSSRNDTMVNSNSSNRISSASSAKGPGSS
                     SSTIKDVPLGGENERSSSHIDQVSQKSATSTKKTSTPSTGVMTIKVYNGDGFRLPFPI
                     TSNKKILSRLLESGIASDNHDTSLEVEAILQRISRLELTNSNSNENLLPGDIATQSIP
                     STIKLPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNID
                     VFVRIPSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATI
                     RLYNHHWVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDT
                     KKIYALKAIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACI
                     NGGELFYHLQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIA
                     LCDFGLCKLNMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLP
                     PYYDENVPKMYKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPF
                     FSQLSWKRLLMKGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQFG
                     GWTYVGSEQLGNSLVQGGSIR"
     gene            complement(<314680..>316386)
                     /locus_tag="CAGL0K03421g"
                     /db_xref="GeneID:2890174"
     mRNA            complement(<314680..>316386)
                     /locus_tag="CAGL0K03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448373.1"
                     /db_xref="GeneID:2890174"
     CDS             complement(314680..316386)
                     /locus_tag="CAGL0K03421g"
                     /note="highly similar to uniprot|P37012 Saccharomyces
                     cerevisiae YMR105c Phosphoglucomutase 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448373.1"
                     /db_xref="GeneID:2890174"
                     /db_xref="GOA:Q6FN21"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q6FN21"
                     /translation="MSQIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVM
                     EAIPEGAKGAVLVVGGDGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIM
                     RTYKEKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKI
                     VKDFPELDLTKLVENKKYGPLLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGW
                     KLLVDSMNGVTGPYAKAIFVDEFGLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVER
                     VNKEKIEFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYANEIPYFKKQGIYGLAR
                     SFPTASAIDRVAKKHGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKDG
                     IWAIMAWLNILAIFNQRHPDKEASIKTIQNEFWDTYGRTFFTRYDYEKVETDKANKVI
                     ENLRQYVADSGTKGSKFPTDSALTVVDAGDFSYTDLDGTISSHQGLYVILSNGARFVV
                     RLSGTGSSGATIRLYIERYTDDKSKYSLDAQEYLKPIIKSIVQFLDLKTILGTEEPTV
                     RT"
     gene            complement(<317197..>319044)
                     /locus_tag="CAGL0K03443g"
                     /db_xref="GeneID:2890175"
     mRNA            complement(<317197..>319044)
                     /locus_tag="CAGL0K03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448374.1"
                     /db_xref="GeneID:2890175"
     CDS             complement(317197..319044)
                     /locus_tag="CAGL0K03443g"
                     /inference="similar to AA sequence:UniProtKB:Q04437"
                     /note="similar to uniprot|Q04437 Saccharomyces cerevisiae
                     YMR106c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448374.1"
                     /db_xref="GeneID:2890175"
                     /db_xref="GOA:Q6FN20"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:Q6FN20"
                     /translation="MSEATSVLIDVDVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSA
                     YLVNHTETQNSQDVPHVVRLCDFLAPTTEGAIALLRQLALVRREYRGDNILQALLLAS
                     IDGRDYFGKRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQ
                     GSQWDALVRTVKGSMSFHIDELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEP
                     HRRDEAAAADNPKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDA
                     SKPGFVPVKSVIDYELRDNEVEGEGKGKGEGDAPPITVARESITKAYRYGTDYVVLPS
                     SLEDQLVYQTYAGLDIRGFMNMSDMHRHFLTSESVFVVSSSSSADQITFSALIDAMIQ
                     IDKIAIGRYVPKNNSDVQMCMLYPMILEKENGTHVRTLILNRLPFTEDERIAIFPRLT
                     REDDKKSEKDETIDQLMAGFVESRSMDDLPRVEEKKYYEFYEDSVRDTTLVLPMKSKD
                     ETRERDPLMVPAMGLHRQLQVMLEYLHQVVINKSEKFDPPELQDHLKAKITPHIVSDF
                     PELEELVNLLELKKVEPKSKEFKPPAPAEPVPSLEELLKRGEAAREGES"
     gene            <319329..>319613
                     /locus_tag="CAGL0K03459g"
                     /db_xref="GeneID:9488029"
     mRNA            <319329..>319613
                     /locus_tag="CAGL0K03459g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999531.1"
                     /db_xref="GeneID:9488029"
     CDS             319329..319613
                     /locus_tag="CAGL0K03459g"
                     /inference="similar to AA sequence:UniProtKB:Q04438"
                     /note="similar to uniprot|Q04438 Saccharomyces cerevisiae
                     YMR107w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999577.1"
                     /db_xref="GeneID:9488029"
                     /db_xref="GOA:B4UN34"
                     /db_xref="InterPro:IPR020485"
                     /translation="MPSFWDSFAVYNRNKHAKGDVHGGHMSQNMGGQPMYLQAKEHAD
                     IKKKEDGTLEAKIETPDGPRLVDVSNMTQQEFERTYNSLRKGEPNNRVNF"
     gene            <320030..>322063
                     /locus_tag="CAGL0K03465g"
                     /db_xref="GeneID:2890176"
     mRNA            <320030..>322063
                     /locus_tag="CAGL0K03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448375.1"
                     /db_xref="GeneID:2890176"
     CDS             320030..322063
                     /locus_tag="CAGL0K03465g"
                     /note="highly similar to uniprot|P07342 Saccharomyces
                     cerevisiae YMR108w Acetolactate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448375.1"
                     /db_xref="GeneID:2890176"
                     /db_xref="GOA:Q6FN19"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FN19"
                     /translation="MTRRGLTDPMIRISGVVARACRRSAAYQVCKYSVRAVPRPEPSP
                     SFNVDPDTAAANTGSGVKLSSKLKNVATQKMDNSFVGLTGGQIFNEMMARNNVDTVFG
                     YPGGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNV
                     VTPMADALADGIPMVVFTGQVPTTAIGTDAFQEADIVGISRSCTKWNVMVKNVAELPL
                     RINEAFQIATSGRPGPVLVDLPKDVTAAILRTPIPVKSTLPSTALQQLTAGVQDQFVI
                     ENIKKSADLINIAKNPVLYVGGGILNNVDGPRLVKELSERAQIPVTTTLQGLGAFDQE
                     DPKSLDMLGMHGCATANLAVQNSDLIIAVGARFDDRVTGNITKFAPEARKAALEGRGG
                     IIHFEITPKNINKVVEAQVAVEGDAASNLSKLIPLVFPVKERPEWFEKINKWKKEFPY
                     SYSLETPGSRIKPQTAIAKLSKIANATSKEVIVTTGVGQHQMWAAQHWTWKNPRTFIT
                     SGGLGTMGYGLPSAIGAQVAKPDALVIDIDGDASFNMSLQELSSAVQANAPVKILVLN
                     NEEQGMVTQWQSLFYEHRYSHTHQLNPDFVKLAEAMGMKGMRVKDQAELEKTLKEFVD
                     YQGPVLLEVEVEKKVPVLPMVPAGKGLHEFINYDPEMEREQNELRHKRTGGKH"
     gene            <322859..>326512
                     /locus_tag="CAGL0K03487g"
                     /db_xref="GeneID:2890177"
     mRNA            <322859..>326512
                     /locus_tag="CAGL0K03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448376.1"
                     /db_xref="GeneID:2890177"
     CDS             322859..326512
                     /locus_tag="CAGL0K03487g"
                     /note="highly similar to uniprot|Q04439 Saccharomyces
                     cerevisiae YMR109w myosin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448376.1"
                     /db_xref="GeneID:2890177"
                     /db_xref="GOA:Q6FN18"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAILKRGARNKTHQEPAKRGGNNIKKAAFETSKKKEVGVSDLTL
                     LTSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLGIYTDAIMKSYQGKNRLEV
                     PPHVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSESIGK
                     IKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEKQRV
                     VGQITNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDDVKDFEA
                     TIKAMQVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAYLLQV
                     DSQSLIKALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVDRV
                     NKSLHAYPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTY
                     AREKIQWTPIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLSL
                     FSSNPHFEQRQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTTLF
                     PNQVDKDNKRRPPTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDHQVL
                     HQVKYLGLQENVRIRRAGFAYRQGFEKFVERFYLLSPRCSYAGDYTWTGDILEAVRLI
                     LQDALIPEKEYQLGVTQVFIKTPETLFALENMRDKFWHNMAARIQRAWRRYLQRRIDA
                     AVKIQRTIKERKEGNKFEKLRDYGTSLLGNKKERRSMSLLGYRAFMGDYLSCNESKSN
                     GSYIKRQAGISEKVVFSFHGEALHSKFGRSAQRLKKTFILSPTTLYIIGQVRVQNAMQ
                     YTADYKINVNSILQLNMTNLQDDWVGIVLANSSMPDPLINLSFKTELITHLKTLNSKI
                     QVKVGPTLEYQKKPGKMHSVKCQVSDTAPKYGDVYKSSTIFVRRGNPANSKSKKKPRK
                     KSSGMSAPTTQSSKTLAPPRMSSNNQNTTVSQSLNGGMNVKPQTPASRSAKKPAPPPP
                     GSKKPAPQPMAKKPAPHPTPQAQMQTQTQIPASQSSATQSSIPPPPPPPPSKTSEPQF
                     EAAYDFPGSGNPSELPLMKGDIVYITKEEPSGWSLAKTLDGSKSGWVPTAYMVKHEGA
                     KAPPPAPAVTASQPAIQNQSQPASAQTVAATSQVPASFGDGLVSALAARANKMRVESD
                     EEAAASSDNDDDW"
     gene            complement(<326872..>328455)
                     /locus_tag="CAGL0K03509g"
                     /db_xref="GeneID:2890178"
     mRNA            complement(<326872..>328455)
                     /locus_tag="CAGL0K03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448377.1"
                     /db_xref="GeneID:2890178"
     CDS             complement(326872..328455)
                     /locus_tag="CAGL0K03509g"
                     /inference="similar to AA sequence:UniProtKB:Q04458"
                     /note="similar to uniprot|Q04458 Saccharomyces cerevisiae
                     YMR110c aldehyde-dehydrogenase like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448377.1"
                     /db_xref="GeneID:2890178"
                     /db_xref="GOA:Q6FN17"
                     /db_xref="InterPro:IPR012394"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:Q6FN17"
                     /translation="MAEILNYTELSEIDAKISISRNYFQQNRKELANQKNVRSADNKQ
                     RQFWLKKLYWSVKDHEEQILEALEKDFHRSRQESISLEYVKLLGDILHLIEGIPKWNK
                     PKKVRDNSAPFMFGNINIEKISRGNVLVISPFNFPVLLALAPVACALSAGNTVILKPS
                     EMTPHCALVLEDIVKSCQLPEGVLQIVQGGVEQTTKLINSESLDMIFYTGSPRVGSIV
                     AQAAAKNLVPCVLELGGKSPTFITGSLQKKNLETALKRIFFGAFGNAGQICVSPDYLL
                     VHESIYDDVVKESGKVMKELYPDLNEHTEYTHMIHKASYDKTLEKLQKTKGRKVSAAD
                     VKIDNTSGKLMIPPTIVFDSDWDDALMEEENFAPVLPVIKYTDIDATIDKILSKHDTP
                     LVQYIFSEKQKEIDHILARLRSGDCIICDTTIHVGIKDAPFGGIGQSGYGNYGGVYGF
                     DAFSHERIVLKQPFWVDFLLKLRYPPFTAKKVKLLKLATERQPWFDREGNDHRSYKLI
                     AMFSVTCALLAVGVKSFFV"
     gene            complement(<329108..>329485)
                     /locus_tag="CAGL0K03531g"
                     /db_xref="GeneID:2890179"
     mRNA            complement(<329108..>329485)
                     /locus_tag="CAGL0K03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448378.1"
                     /db_xref="GeneID:2890179"
     CDS             complement(329108..329485)
                     /locus_tag="CAGL0K03531g"
                     /inference="similar to AA sequence:UniProtKB:Q99278"
                     /note="similar to uniprot|Q99278 Saccharomyces cerevisiae
                     YMR112c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448378.1"
                     /db_xref="GeneID:2890179"
                     /db_xref="GOA:Q6FN16"
                     /db_xref="InterPro:IPR019404"
                     /translation="MSKSTLEQPEYVKERLESLAEVDRQLCSMLQEASQVAFTYGEVL
                     RGNAMMKPQFQEHVSAFYSTLDNASGKLKKEIELLDENVGNRLLPINVNKKALGQDDD
                     KLKEQMETLKEFLKTDNEETSTS"
     gene            <330861..>332201
                     /locus_tag="CAGL0K03553g"
                     /db_xref="GeneID:2890180"
     mRNA            <330861..>332201
                     /locus_tag="CAGL0K03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448379.1"
                     /db_xref="GeneID:2890180"
     CDS             330861..332201
                     /locus_tag="CAGL0K03553g"
                     /inference="similar to AA sequence:UniProtKB:Q12676"
                     /note="similar to uniprot|Q12676 Saccharomyces cerevisiae
                     YMR113w Folylpolyglutamate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448379.1"
                     /db_xref="GeneID:2890180"
                     /db_xref="GOA:Q6FN15"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="UniProtKB/TrEMBL:Q6FN15"
                     /translation="MSIRLGLGRIGRLLEFIGNPHQHLKVLHIAGTNGKGSVCTYLST
                     VLQQQRTHFRVGKFTTPHLIHVTESISINDQPIPNSQYLSIRNQLDILNSEHRLGCTE
                     FELLTCTALQYFKEMECHWCVVEVGLGGREDATNIIPGSFKLCCGITKIGLDHESFLG
                     NTLEEIAREKAGIITEGVECAVIDGSNDKTVLDKVKQHCESMHCKLIITEGSMNSHTV
                     RTAAWGTIEFNQKLPLNGEYQIFNLRVALAILDELQRSKYINVSRQELVAGLDQVQWP
                     GRLHDLDFCFLLSEGDDRKKLTFPVLIDGAHNASAAIELSKHLRKQFGDKPLTFVIAV
                     TAGKNLNTLLRPLLRAQDRVIATKFSSVDGMPWIQPTDPKDLSSFIKSKFTTNCISEN
                     SLCDVFNLLSEEYYHNDASEISPVIVCGSLYLCGELLRMHKRNSQTKGTNAESS"
     gene            complement(<332625..>333698)
                     /locus_tag="CAGL0K03575g"
                     /db_xref="GeneID:2890181"
     mRNA            complement(<332625..>333698)
                     /locus_tag="CAGL0K03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448380.1"
                     /db_xref="GeneID:2890181"
     CDS             complement(332625..333698)
                     /locus_tag="CAGL0K03575g"
                     /inference="similar to AA sequence:UniProtKB:Q04471"
                     /note="similar to uniprot|Q04471 Saccharomyces cerevisiae
                     YMR114c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448380.1"
                     /db_xref="GeneID:2890181"
                     /db_xref="GOA:Q6FN14"
                     /db_xref="InterPro:IPR003738"
                     /db_xref="UniProtKB/TrEMBL:Q6FN14"
                     /translation="MCGRFALMYDSWEVAEQIQRGFNLEINPVVSTSREDNTDTHYNA
                     SFNVSPTNMSAVYKNKDKGELRYMKWGLVPHWTKDLKSFKSYSTFNARLETLQESRLW
                     IHPCKSNRCAVPISGYYEWKTSGTKKGGSKTNIHKTPYYVTRSDGKLMFLAGMYDYVP
                     AEDFYSFTIITAPAPKNLKWLHERMPVVIEPGTREWDSWMDPEKKDWSQKELNEILEP
                     RYDEDHMISYQVSPEVGKTTNNGENLIKPILKADKNKFEKLIKKELDETKVHDSIKNE
                     HDQGKLKTESNNTIKRENESSVKTENDNDKLYRGNNKGYKPKTKDDSLVKKESKEGNA
                     KKKRNITDMLRSSSKQSPKKQKR"
     gene            <334102..>335559
                     /locus_tag="CAGL0K03597g"
                     /db_xref="GeneID:2890131"
     mRNA            <334102..>335559
                     /locus_tag="CAGL0K03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448381.1"
                     /db_xref="GeneID:2890131"
     CDS             334102..335559
                     /locus_tag="CAGL0K03597g"
                     /note="some similarities with uniprot|Q04472 Saccharomyces
                     cerevisiae YMR115w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448381.1"
                     /db_xref="GeneID:2890131"
                     /db_xref="GOA:Q6FN13"
                     /db_xref="UniProtKB/TrEMBL:Q6FN13"
                     /translation="MIVRSTARLARLGGVSLRRFTPGVTVQLRKNGTKKDSSYEQGKE
                     NIKNTAPIYGQKRWVYTVAGLSLLGFAIRQYYWSSKNQLPPSVAENVRKAVWHESDQG
                     GNNYRKALQYYIMVIDELSNSNFDALSDEYTRLELKLAEMYEKLGMIQECKDVFKELL
                     SRFYEALLTTNKVLEDKRSDLIRKDLRVLIKSLELNTDVEYGKKLLLSHLLLVQEEIL
                     TRSPELKQFFENRKSKAEEATKSSLHMPRLYDADSFEAFVNEKNIKLDENGYMILDLS
                     KNSSAWEPYKEEFFTARDLYTAYCLSSKDIAAALSCKLTSVEWMVMADMPPGQILLSQ
                     ANLGSLLYLQAEKFDSDILKLQKKIEEDAELKENPAILKALRFLHKNRDSCIKMAYKS
                     YESIVSFYKKNTKLRFHTKDQLDPSVVQAIALSIYGLGVLNLHDGVYVKAETLLKDAL
                     SLSKDTEFVELSKEAELELKKAMSLKVQKQQQQDV"
     gene            complement(<335752..>336357)
                     /locus_tag="CAGL0K03619g"
                     /db_xref="GeneID:2890132"
     mRNA            complement(<335752..>336357)
                     /locus_tag="CAGL0K03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448382.1"
                     /db_xref="GeneID:2890132"
     CDS             complement(335752..336357)
                     /locus_tag="CAGL0K03619g"
                     /inference="similar to AA sequence:UniProtKB:Q04477"
                     /note="similar to uniprot|Q04477 Saccharomyces cerevisiae
                     YMR117c spindle pole body protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448382.1"
                     /db_xref="GeneID:2890132"
                     /db_xref="GOA:Q6FN12"
                     /db_xref="InterPro:IPR013252"
                     /translation="MASTEEIVQMMQEASAEFAEADDVSFLDKMNSNIAQLEQQLREQ
                     MDESRQNIAKLEINLIDTEKSIGSLRELMKDATDEATIMKGSDKLNNLIDELQATENE
                     IQMMNSEIEKKVSKLVEDEDNTSSEYEMISKELEQEYDPVFASNILKLKLYRSLGVRL
                     DLDNNQILIQNKELGTIDTLPLEDELTEFFKVKYIWSRIGK"
     gene            <336673..>338466
                     /locus_tag="CAGL0K03641g"
                     /db_xref="GeneID:2890133"
     mRNA            <336673..>338466
                     /locus_tag="CAGL0K03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448383.1"
                     /db_xref="GeneID:2890133"
     CDS             336673..338466
                     /locus_tag="CAGL0K03641g"
                     /inference="similar to AA sequence:UniProtKB:P54074"
                     /note="similar to uniprot|P54074 Saccharomyces cerevisiae
                     YMR119w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448383.1"
                     /db_xref="GeneID:2890133"
                     /db_xref="UniProtKB/TrEMBL:Q6FN11"
                     /translation="MNETFNELFPYLNQSSHSLLANDNPLARFPNVLYRLSLSFHDAI
                     NSQYMEVWSGQEISSTLQSFNDIIGFFFSEYSVLCFTIAVLLNRLITTISRRNRVNRA
                     NLRPEINTLSHVSCILLLTWVMYELIEGLIKVKIYNADVPKIPLSLYFMVFSWSYCVE
                     TVISLLSNSTPLEGSDYTIFEISIEFYLLQRKRINIIDQTEFLPDCLMAISNRVMIHV
                     LEMYKMRNYRLLGSASLNLVHITYLMYVSIKYGVSSIPILTRFRHFPKVFSLFIVLIS
                     LVSYLLAYIIRFDPFTNKNRNPDELQFYSFMKNWRKHLNFTGEEDFSPMLSKLAILLT
                     SASSISERGTRYEYPSVNINHELDTRYNEKLRAIQQVRFNETPRNGRRESVVRALTKP
                     ILEAKQNIPFLSNMLDSFKLVLVHLCEILRGNEEAEYIDTDDSDADKEVSETPTRRFS
                     LSKDTSWYDDSYSEDEDYQDSDATELSLEEDLADDDILELRDDMSTLLQDELDPLMLQ
                     DHLLHSRLTRSGLHKRHQEPSLGQVSDNREDTRDYSCVVCKTNDRNVIMWPCSCFAVC
                     DDCRVSLSVRGFNTCVCCRAPVSGHSKTHAT"
     gene            <339486..>339752
                     /locus_tag="CAGL0K03663g"
                     /db_xref="GeneID:2890134"
     mRNA            <339486..>339752
                     /locus_tag="CAGL0K03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448384.1"
                     /db_xref="GeneID:2890134"
     CDS             339486..339752
                     /locus_tag="CAGL0K03663g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448384.1"
                     /db_xref="GeneID:2890134"
                     /db_xref="GOA:Q6FN10"
                     /db_xref="UniProtKB/TrEMBL:Q6FN10"
                     /translation="MSSSSRVSSSLSSMSSRVSSSIGTNSALVTNGAVAASSVAASAN
                     STSSHKSSKTKNGAVSMIASPVSWKYGVAIGAFLAGSFVLGAGI"
     gene            <340046..>340306
                     /locus_tag="CAGL0K03685g"
                     /db_xref="GeneID:2890135"
     mRNA            <340046..>340306
                     /locus_tag="CAGL0K03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448385.1"
                     /db_xref="GeneID:2890135"
     CDS             340046..340306
                     /locus_tag="CAGL0K03685g"
                     /inference="similar to AA sequence:UniProtKB:Q03880"
                     /note="similar to uniprot|Q03880 Saccharomyces cerevisiae
                     YMR123w PKR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448385.1"
                     /db_xref="GeneID:2890135"
                     /db_xref="GOA:Q6FN09"
                     /db_xref="InterPro:IPR013945"
                     /db_xref="UniProtKB/TrEMBL:Q6FN09"
                     /translation="MSFFTSLWQSIFEPGTSPQLIIATHISFAALLVSLLWLIYSTHI
                     IHFYFLFVIAFLLWITVIWFIAELKSAKLKSNEELSKSTKAE"
     gene            <340734..>343466
                     /locus_tag="CAGL0K03707g"
                     /db_xref="GeneID:2890136"
     mRNA            <340734..>343466
                     /locus_tag="CAGL0K03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448386.1"
                     /db_xref="GeneID:2890136"
     CDS             340734..343466
                     /locus_tag="CAGL0K03707g"
                     /inference="similar to AA sequence:UniProtKB:P39523"
                     /note="similar to uniprot|P39523 Saccharomyces cerevisiae
                     YMR124w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448386.1"
                     /db_xref="GeneID:2890136"
                     /db_xref="GOA:Q6FN08"
                     /db_xref="UniProtKB/TrEMBL:Q6FN08"
                     /translation="MDAGITALNRKHQQQPQQFNIRNNLLKSDIGGIDITQELPVKNG
                     EKEEMPFPPHPPQQQYPPQYPPQYPPQHPQQHPQQHAQQHAQQQYQMPPVSAQRMYAA
                     PQQQQVQQQPYFQQNMYQRTPYAPAQGNPYPRSQSLTQKSSISGFFKQKGYHSPFGKS
                     KKGSSGGDDDDNEEGADIIEDPSASVITYNDIRKNANKGGDKYGYGGDTAPIIPTIVT
                     TDKNTSNTDYRKYMTTQKKLAMNRMAKQGTPQTPSPPSKLQQYQQYQQMMPPNGSNPR
                     AMSLQGFGSGSPFYQQSGPGNSPNNRLPNGQFMGDSRANSMMSAQNPMMRGPPQHAQP
                     MYQQPNFSGTMTTPGPRNTSPNRVPMNNQRPGPMNSQQSFNGPTGNISADRAMSLQTT
                     SSRPMVNMSEQKPVSDDLPPNPYLSQNARPYTEPINTNIDDNVKRNDNENHITATSPL
                     KNQLYVAPLSIPDDEEPTPGRSIAGSGKLNVLKLSKPQQEENMVKEIQVMKPSIEDHE
                     EQQKSSNNEDWNDIKKGLTEDALSHENRTSLVEDGLGSLKLDDRTKLGQPQRQSVDTY
                     SSTFSDSPSKKVNSNKVTGLYKLENMTDMDQYQTAQEFVDDTKLNSRANENRVESGSS
                     SVYDNPYGSTTSEKKIIDAEDERSKRRESLIKAKNILRNFSSEQRLSKRPTSETSVDS
                     DYSAQDDTFTYKQKDNKASASGNLTSTPTKSAQTNLQNEAETVDFVFSDTHSKAYEPI
                     YSKHDSSMSDHAKLKEKTFVIKEEQLNLLKENETLMREVTLVSTELAESIQRETVLEQ
                     KIRSLASGQKSSDVENSDNDFEREQEEQLSIVEFETEMRKKSAKIVELIQQLNDERLK
                     RFIAEEQILLQERGAKPSRPQLIYRIEQLNIQLEAKSQKLNDLQARLDKLEHNS"
     gene            <343858..>346921
                     /locus_tag="CAGL0K03729g"
                     /db_xref="GeneID:2890137"
     mRNA            join(<343858..343882,344361..>346921)
                     /locus_tag="CAGL0K03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448387.2"
                     /db_xref="GeneID:2890137"
     CDS             join(343858..343882,344361..346921)
                     /locus_tag="CAGL0K03729g"
                     /inference="similar to AA sequence:UniProtKB:P34160"
                     /note="similar to uniprot|P34160 Saccharomyces cerevisiae
                     YMR125w STO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448387.2"
                     /db_xref="GeneID:2890137"
                     /db_xref="GOA:Q6FN07"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR015172"
                     /db_xref="InterPro:IPR015174"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027159"
                     /db_xref="UniProtKB/TrEMBL:Q6FN07"
                     /translation="MFNRKRKGDFDDEDYHDYRPRMPKRQRIPPVVQLCKEMMPDIRT
                     IGESVKAFEEDIQFLSDAIVNEFGHEEYFNDALLQTFRAVVLEQPQKLPAIALLTMVV
                     NSRNEAAGKGVVNFFFSELQKYCNQSVDPEYKPESSDTGPWNKIKLILRFLATLSPML
                     LNDELISIFKDFLQLSIDLNQSDTNKRNPLSEALYTNTLLNIPYLFFFNRNDDDLKQK
                     VGSLLEFVEDNYKVKSTEINLLREYNNGAPFDSAELVQLVLSNVKKSLMDDLKDLEQL
                     FPDWIHLLTEQSGDQGFNDPLQLPSIEDLAEYMDLGHQRGSVDSMWHTPRYVFKVYVP
                     NETHDFETVIPITTYAGQLFNDIIIDLVESLEFNRKEVARQVVSLDLFFKKGIFAEPG
                     ISIAQLSNVYEENPLATTFKIEDLAIETIISLIFKLPDVSQPFAYFYTLLVEICQNSP
                     KAIAPVFGRAFRFFYSHLKNMDFELRLRYLDWFSIQMSNFNFSWKWNEWEDDSKNLSK
                     SFYDPNINFIRNLIHKELRLTSNPIDVEESLPEEFKQYLDSSYIAHDALVAYYQSFYV
                     DYTVEPINIKKNDFYFKHESSPLRDVVVELLDYIHKPNNTREVSELEQLLEKIKANHG
                     SIIKNFDRFIIVLIVQALLESGSRSLSHANKYISDLKDDFKYVLDKIELDQDQKEFII
                     IEAVIRFWNSNSQNGYLIVDAFKFAELVSSRSIINFALNEELANNYGLVDSTAIEAIF
                     RTLSHEITLEIEHADDFEFVLEKLCIIINNTVSQLNIQLDEDIDVPQIFELTDGDNAS
                     DLAAYDLKWKYYTSIVFIKSLLRKYSLKYKSLSDKILGNLDTAVPHQSTKEQIKIWLG
                     ELNSI"
     gene            complement(<347231..>348400)
                     /locus_tag="CAGL0K03751g"
                     /db_xref="GeneID:2890138"
     mRNA            complement(<347231..>348400)
                     /locus_tag="CAGL0K03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448388.1"
                     /db_xref="GeneID:2890138"
     CDS             complement(347231..348400)
                     /locus_tag="CAGL0K03751g"
                     /inference="similar to AA sequence:UniProtKB:Q04216"
                     /note="similar to uniprot|Q04216 Saccharomyces cerevisiae
                     YMR126c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448388.1"
                     /db_xref="GeneID:2890138"
                     /db_xref="GOA:Q6FN06"
                     /translation="MILQEQRRLRLWLYKSSLFISVLFLIGFSIVLPVDSIVQAIQSE
                     NNGFNTIIVIGSLAVFFVAAVTILIGRMLLHKSCLKDIPRRYIPVTNADLPHKSSRKM
                     VIHNMERSKKLSGLFKTPKDPVIHPGLEPPARCDDPNTPKILPEYLNYKICIKSATDR
                     LKYYGLFLNSASDDVKSSQTFTDLVKSQFIKGNHNKRQVQRAKDFIELYERIRFSGDE
                     VSRSEFIQFAENCIYFSDLMITMDITKVGLGNISTRSQLSFNIAGSSVDRKLRKLNTA
                     RSNQISRLSSGQYPDITAFRYDTSNSDYHRQETDEDDFALDDMDYFPSVPPYMIRRNS
                     TNTVSMRIPTSNSDDQYNLGFNEIGDEDIQNNDQIRRYMSNTSKTDSFKTVIHNG"
     gene            complement(<348963..>350024)
                     /locus_tag="CAGL0K03773g"
                     /db_xref="GeneID:2890139"
     mRNA            complement(<348963..>350024)
                     /locus_tag="CAGL0K03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448389.1"
                     /db_xref="GeneID:2890139"
     CDS             complement(348963..350024)
                     /locus_tag="CAGL0K03773g"
                     /inference="similar to AA sequence:UniProtKB:P40963"
                     /note="similar to uniprot|P40963 Saccharomyces cerevisiae
                     YMR127c SAS2 silencing at HMR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448389.1"
                     /db_xref="GeneID:2890139"
                     /db_xref="GOA:Q6FN05"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FN05"
                     /translation="MNVEENDDLYGILAEKNIKFVQLGLFKKFETWYGTAVYFNSENK
                     KLGFYDETQMKPGQQGNGYGRGSKIIKGKTVKKKKMTNKALSSLNDHALSNIQLKSNP
                     KTSDNQFWLDTLYVCEYCFKYTDVKDDFVNHVHQCSFKEKAPGRIKYKSPQYTIRRVK
                     GSKHQLFCQCLCLFTKLYLDNKSVFFKLDHYEFYIVYETGKTIPMAFFSKDLVSYNQN
                     NLACILTLPPYQRMGLGSLLIEFSYHLSRLEGIVSGPELPLSPFGLIGYLRYWSLVIC
                     WQLCEGDLSNFERLSIQDISLATGIRISDIIPTLKHLNCIIDENHINLKVLKQWLKTH
                     TKPGQNPFMINEEYLLIDD"
     gene            <350378..>354265
                     /locus_tag="CAGL0K03795g"
                     /db_xref="GeneID:2890140"
     mRNA            <350378..>354265
                     /locus_tag="CAGL0K03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448390.1"
                     /db_xref="GeneID:2890140"
     CDS             350378..354265
                     /locus_tag="CAGL0K03795g"
                     /inference="similar to AA sequence:UniProtKB:Q04217"
                     /note="similar to uniprot|Q04217 Saccharomyces cerevisiae
                     YMR128w ECM16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448390.1"
                     /db_xref="GeneID:2890140"
                     /db_xref="GOA:Q6FN04"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FN04"
                     /translation="MGTYRKRFNEKARAGQMAKLKELKRVRNKQFLRHLDDGSEEAKD
                     EKKQVEDTNSVLLKPMTEEEKEIKKRKLEELFTPKESKVSRTKKKRLEKFIEHQLKRE
                     EKKELIGKLQDYKIDTSLLTSSKKLGQGRQTKKERFAEALELEKQGRASELTKDILYE
                     EHDVKEWEGIEGEPKKRTPDYTYSDSDQDLSDNNNESGISNDDDEANDEEDFESKFGN
                     TASSFIDRRPASTGGMGGGFGFGFANVTKVKPLKQTSKKKYNWKQKVAMEEMKRKNVE
                     DMDDFDTSSETDGTDFDSEDNDVDQSMEGDHSEHNNEDREDESSDKEVSSEQEHSGDS
                     SSEISDLTDGIENTEKKNVAEEFKSWANNEIRRLEGRDVDVEMPSLSFKVEPTFRPED
                     MDDGLKQTHIPIDEGLKRKAFFVNVERKPEIMAQRLNLPVVAEEHTIMEAIHHNDVVI
                     ICGETGSGKTTQVPQFLYESGYGSPDSTEHGGMIGITQPRRVAAVSMAERVSNELGNH
                     GDKVAYQIRFDSTSKEDTRVKFMTDGVLLRELMEDFLLSKYSAIIIDEAHERNINTDI
                     LIGMLSRCVKLRAKKNNEDPKRYNKLKLVIMSATLRVSDFSENSSLFSSPPPILKIEA
                     RQFPVSVHFNRKTAFNYADEAFRKTCKIHQRLPPGAILIFMTGQNEITAMVKKLRKRF
                     PFKTKNKSLALEFEATKVKVDPRTAAMEEEDIDLTVHDKDEKRFLEDIEYENENENVT
                     DDNSDDEEGFDEELTDDQTPDDPLYVLPLYSLLPTKEQMKVFESPPKGSRMCIVATNV
                     AETSLTIPGVRYVVDCGRVKERKYNNSNGVQSFEVGWVSKASADQRSGRAGRTGPGHC
                     YRLYSSAVFDRDFEQFSKPEILRMPVESVVLQMKSMAIHNIVNFPFPTPPDKESLKKA
                     IELLQYLGALDDKEKVTEDGKKMSLFPLSPRFSKMLLVSNEHGCMPYIVSIISALSVG
                     DPFLTEQELGIQQAQVVKRDDGNESAQLEFIDSQEVERVKNLRNKFYKSRVKFSKLDK
                     YSDVFKLLSVTCAWNYVPNKQRDDFVRSNFLRRKVMDEIEKLRRQLTYIVKSNTSKES
                     IAINITNEDLRTDLPSEIQLKMLKQMICVGFIDKVAIRADALYPEEAKITNRTVINKI
                     PYLPVMGKLANDVNDSFVYIHPSSMINNIGELPPKFIVYNTLNLSANNVTRLVPLCDI
                     KSTPLANVARKGMLLSYSKPITGQGLKVINIAPTERYCYVVPRFGSQKDSDLQVGWDL
                     NPIPVHQVKQNGVWTVDKFITNKNYKNAEHQRK"
     gene            <354834..>358787
                     /locus_tag="CAGL0K03817g"
                     /db_xref="GeneID:2890141"
     mRNA            <354834..>358787
                     /locus_tag="CAGL0K03817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448391.1"
                     /db_xref="GeneID:2890141"
     CDS             354834..358787
                     /locus_tag="CAGL0K03817g"
                     /inference="similar to AA sequence:UniProtKB:P39685"
                     /note="similar to uniprot|P39685 Saccharomyces cerevisiae
                     YMR129w nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448391.1"
                     /db_xref="GeneID:2890141"
                     /db_xref="UniProtKB/TrEMBL:Q6FN03"
                     /translation="MSSNRWNMFSDTPRGDHWLNSPGMSSPKKRVHDPQIKTKEFKNA
                     EDGFLYNRKDVPTEMHFENSKKYDGVNTTAHVNNERKDNKLRKVDQLPLVSTEALDIS
                     RQRALVISVFFLIQAYKIYDNMALQSGLPISGFAIGSNMFNFLFKYLIVDAAFFFTLP
                     VLNIPKLTFPTWVVISQVLLVTSFNIALCNNKTTVLFGMLLSAWKKFNAKEFTITGNT
                     IKNRQAPDYSSHFKGALTVKILPENTAFLNPFQSSYCFPLDGVQGVDTSMNVPIRVNS
                     SSALELIQIEYTDLYTKERELLNFTSKSFSIMDDYHRKDSIDGTEKSSEVKYLTIPLK
                     RIGIYQLKTVIDANNLNLKIQPSQLIVPHCPTITVVGFGDRNRCVGDSDVMKMELHGV
                     PPLKLSYTKEVDGVQYTYFDSNLQPENFDSPLMNGQKAFFSDSHLNNPKWARSHPIVI
                     TLDNTIQKSGTYKYKINKLIDGFGNEMDYSTLTDSQLQEYDLTYDFFVHGIASAYLSE
                     KFNPNKLMKKSIFLNIKSDRLKKTEYTADLEFINERGVSKKFTVKTSSESKEIEVSEP
                     GLYKILKVKSEFCPGVVSGKSNVLVTKPVAPELNVVSKPILDECVGQVGLNFDLSFTG
                     VPPFTVPVKIYRIENNNRVIHDTKYIKSESSRKHFSYGPKHEGTYEIVFESISNNIFS
                     EAIPLQPGKDYTFQTSMRVKPGARISKNKNIELCLGHKNNVAVELRGEPPFELSYDIV
                     ETSSNKRSSYSKKDLNTNIHDIELPPFKLGGEYILSLVSVKDAKGCVVSLSEADAKIN
                     VRRDIPTVAFASTDREQNIFIKEGGTAKVPIKLGGIAPFKINYEQIDHEGNTIKTFKE
                     MFSSNSDFALSIQEAGLYKLTGVKDKTCEGKVEDKLASVAVKYLDKPSFVVQANKRTQ
                     KMDALTFKNDDVCELEEASVDLSLIGSPPFILKYDLITPAGKKSQEEIQVATKYVSLK
                     FPSSEAGVYTMIIKSLSDSNYDETSLQNIAHKSVTVAVRQSVNPAPMIELLDSGKIIR
                     TCFTNLEQADLMEPFKLKINRGKAPFVVTVNVYHESTSRVDQFVINDVDGEYLSASEI
                     YKDLKMGNHEIRIVKVVDANGCVNENMLSSVTTLQLSVVEAPKIHLLDSTSDYCVGDY
                     VSYQLNGVPPYQIGYEFNGIQLKFTEKSSQFVRYASEPGVISIRTLQDAASKCVVDFQ
                     KPGLATEHEKLSLIIHPIPSVTVSQGKYTVADIHEGDQVEVIFSFEGTPPFSLTYIRA
                     EDPTVNGKQQVIETHKITDIYEYEYRVVTSLQGTYEAIEVADAHCFAKNDAFFQM"
     gene            <359152..>360066
                     /locus_tag="CAGL0K03839g"
                     /db_xref="GeneID:2890142"
     mRNA            <359152..>360066
                     /locus_tag="CAGL0K03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448392.1"
                     /db_xref="GeneID:2890142"
     CDS             359152..360066
                     /locus_tag="CAGL0K03839g"
                     /inference="similar to AA sequence:UniProtKB:Q04223"
                     /note="similar to uniprot|Q04223 Saccharomyces cerevisiae
                     YMR130w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448392.1"
                     /db_xref="GeneID:2890142"
                     /db_xref="GOA:Q6FN02"
                     /db_xref="InterPro:IPR011949"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FN02"
                     /translation="MVFPKKIPIQNWNSKISLRTPKLITFDAYNTLYATVLPVMEQYS
                     NVASIYGVKVDPQELSANFPSVYSKLKLEHPNYGKNTGISAKQWWQIMITEVFKPIKL
                     SDDVVEAILDRFGSCEAFFVYPDLIALLKGIRQKYPDVIFGVISNADPYAGDVIKSFG
                     LDKYFDGNIYLSYDVGFSKPDQKIYEYALDDILNRFPDLIKNCSKEEFKQFCWHIGDE
                     KINDMEGPAKTGLVGILIDRVNKYGYFDGSFADIKHDLDMHKIDNNSLESWEIGIKQT
                     DTFQVSDREYVISNLRTLATILDVQVNE"
     gene            complement(<360277..>361818)
                     /locus_tag="CAGL0K03861g"
                     /db_xref="GeneID:2890143"
     mRNA            complement(<360277..>361818)
                     /locus_tag="CAGL0K03861g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448393.1"
                     /db_xref="GeneID:2890143"
     CDS             complement(360277..361818)
                     /locus_tag="CAGL0K03861g"
                     /note="highly similar to uniprot|Q04225 Saccharomyces
                     cerevisiae YMR131c Ribosome assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448393.1"
                     /db_xref="GeneID:2890143"
                     /db_xref="GOA:Q6FN01"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q6FN01"
                     /translation="MSKRSLDSSADERVVSARTGSQSVPKSYSTADGEQISDSGMIED
                     LSDNFESDEDIIEIDGEDDEDEDEITDESAFLQKKEAKAKETIEKDNQQEKGGEELYL
                     PHMSRPLGPDEVLEADPTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTA
                     TQASKKKENELMVLSLSNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIK
                     VSPFASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNV
                     EGYGLDWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKT
                     ESTVFATAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGS
                     WGVWDLRQFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLS
                     VEADDEEIKQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCLVSTGTDGLNIW
                     KTISV"
     gene            complement(<362204..>362818)
                     /locus_tag="CAGL0K03883g"
                     /db_xref="GeneID:2890144"
     mRNA            complement(<362204..>362818)
                     /locus_tag="CAGL0K03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448394.1"
                     /db_xref="GeneID:2890144"
     CDS             complement(362204..362818)
                     /locus_tag="CAGL0K03883g"
                     /note="highly similar to uniprot|P40206 Saccharomyces
                     cerevisiae YMR132c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448394.1"
                     /db_xref="GeneID:2890144"
                     /db_xref="GOA:Q6FN00"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="UniProtKB/TrEMBL:Q6FN00"
                     /translation="MVYFYESQPELGYDGYQVIIGKDKFENDLLIKYGYRELNYMWFH
                     TDKYSSGHVYLKMKESEKSLGDVPKAVVEDCLQLCKSESIQGNKMPECTIIYTPWHNL
                     RKNRYMKPGEVSFKSVKNCKKTVCYNRDNKILNRLSKTRVEIYDDVEKLLHEAKKSKD
                     PNYFTDYISRNRDSLVEAEKVRKQLSKLAKQKKKKETEEEFYNN"
     gene            <363233..>364318
                     /locus_tag="CAGL0K03905g"
                     /db_xref="GeneID:2890145"
     mRNA            <363233..>364318
                     /locus_tag="CAGL0K03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448395.2"
                     /db_xref="GeneID:2890145"
     CDS             363233..364318
                     /locus_tag="CAGL0K03905g"
                     /note="weakly similar to uniprot|P32841 Saccharomyces
                     cerevisiae YMR133w meiotic recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448395.2"
                     /db_xref="GeneID:2890145"
                     /db_xref="GOA:Q6FMZ9"
                     /db_xref="InterPro:IPR004354"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ9"
                     /translation="MNGYKECLRLSVMRYSKYQGQISAPHGFASAFAPLDLTLWSHIT
                     GTSECPMFLVLLVTSDSKACRLKILSMQIEHEDILIKDNTIVSFVQFSAQSPVISCKY
                     LTQVDKFQYLNRFQIEFNSNEYMVAYGILTQIGFKIKKARRVNSEENEVQDKLATSQQ
                     SQMLIFSQRENIIPSPNYKNINNLNYPSGDPPRHRQDLCSTHKNVDTTLLNSLPLVHI
                     GDNLRNSTSSSDKTPPIKKGGNQEIVNANHNIVKLSDKIHPYIIPNESAQLIIPEIKF
                     GNISDIIDSENNAPLNKQFLTTVNTEEICNTNTTDVTKHTKPVITKRLLKRKLRDKLF
                     MIWVRRIEKYFINIEKKSKHKSSRKHN"
     gene            <364639..>365346
                     /locus_tag="CAGL0K03927g"
                     /db_xref="GeneID:2890146"
     mRNA            <364639..>365346
                     /locus_tag="CAGL0K03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448396.1"
                     /db_xref="GeneID:2890146"
     CDS             364639..365346
                     /locus_tag="CAGL0K03927g"
                     /inference="similar to AA sequence:UniProtKB:P40207"
                     /note="similar to uniprot|P40207 Saccharomyces cerevisiae
                     YMR134w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448396.1"
                     /db_xref="GeneID:2890146"
                     /db_xref="GOA:Q6FMZ8"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ8"
                     /translation="MSSWKNQYFCFEEKVIEKLKETPYVHQFIHDQHSARITLFLLVI
                     GTIAFFNELWITIEMSLIQKETYDELNLGRIDEGLKLHRMIVSDEYHGREYKDEKSGI
                     VIEEFEDRDKFFAKPVFVSELTVDCNIEKNGKTILERPLSFHIEFTPEEWELEKRPEF
                     GCPLSLLRLKLYHLFRDSRFYTELVDPSTDSFTVSKGVIIYNKMGELLPASVDSVQLC
                     FLKIETGCHINATFVIN"
     gene            complement(<365526..>367043)
                     /locus_tag="CAGL0K03949g"
                     /db_xref="GeneID:2890036"
     mRNA            complement(<365526..>367043)
                     /locus_tag="CAGL0K03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448397.1"
                     /db_xref="GeneID:2890036"
     CDS             complement(365526..367043)
                     /locus_tag="CAGL0K03949g"
                     /inference="similar to AA sequence:UniProtKB:P40208"
                     /note="similar to uniprot|P40208 Saccharomyces cerevisiae
                     YMR135c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448397.1"
                     /db_xref="GeneID:2890036"
                     /db_xref="GOA:Q6FMZ7"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ7"
                     /translation="MSDIRTDDNSSKSESLGRSSRISDGYKVYGNVTFSRDEWKGIVR
                     KYAKLGEMYNNKSVGAFESTNSNLKGSTGTRLSSNPSTQAGTMDLPSVREPSIPKLLL
                     NYFVTMAFEESSLRMAKELGYIQTNKDSIEFNSYYKIKERAHIIHLIKTGSISQAMDS
                     ISTVFGVEVLENSVDTDLSVFAADKRSQVVQNINSKNDKNSLSSSDESEVDTYGDDDI
                     HFKLLLLNLIEMIRIQHIKIKSGEVTELDNKFILDLIAYSQEKLAMKAARNDKHMKEL
                     ELTMTLLLFPMQSLVDKKESPKLPESLRNLYSLSLRSHVADIVNRKLLKYIVNSNLMR
                     DSPGKEKFRDVSIIIDPRGYFLQSESMVNTNILKIKTKDEFKDDLYNDDRYKNNTKTF
                     EKYKNEFQNEDGSNNSLTGSNSYWAETTEMLRRQSNTTSSSDNDQSSYSENDNNDSKN
                     KKQTTHNASKNGLLKEDGNLSEFQFEPKLVQIMRLWAWTENQLHVNDIGIPRVEN"
     gene            <367761..>368840
                     /locus_tag="CAGL0K03971g"
                     /db_xref="GeneID:2890037"
     mRNA            <367761..>368840
                     /locus_tag="CAGL0K03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448398.1"
                     /db_xref="GeneID:2890037"
     CDS             367761..368840
                     /locus_tag="CAGL0K03971g"
                     /note="highly similar to uniprot|P28737 Saccharomyces
                     cerevisiae YGR028w MSP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448398.1"
                     /db_xref="GeneID:2890037"
                     /db_xref="GOA:Q6FMZ6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ6"
                     /translation="MSRKFDLKAIADISVLVGTGISLYYLINRLLNDVENGPMSGRSK
                     EAREQQSQKWDKLVELNPDLKKVQLSSYERTILSSVVIAEDIDVTFNDIGGLDNVISD
                     LHESVIYPLTMPEIYTNNPLLKAPSGVLLYGPPGCGKTMLAKALAKESGANFISVRMS
                     TIMDKWYGESNKIVDAMFSLANKLEPCIIFIDEIDSFLRERSSTDHEVTANLKAEFMT
                     LWDGLLNNGRVMIIGATNRINDIDDAFLRRLPKRFLVSLPNIEQRTKILEVLLGNTEL
                     DKANFDLSLIAKCSGGLSGSDLKELCREAALNAAKEAMKEKRNLIQKGLEATEVKLRP
                     LTTYDFLINMKTIEAVQMLSQAPQD"
     gene            complement(<369490..>369963)
                     /locus_tag="CAGL0K03993g"
                     /db_xref="GeneID:2890038"
     mRNA            complement(<369490..>369963)
                     /locus_tag="CAGL0K03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448399.1"
                     /db_xref="GeneID:2890038"
     CDS             complement(369490..369963)
                     /locus_tag="CAGL0K03993g"
                     /note="weakly similar to uniprot|P53218 Saccharomyces
                     cerevisiae YGR030c POP6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448399.1"
                     /db_xref="GeneID:2890038"
                     /db_xref="GOA:Q6FMZ5"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR020224"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ5"
                     /translation="MEGRVQYEGTNVEIDLSNFSQCSEYIKNQILPTMLGEPNTEFNY
                     ITTKVSKNDKIKDKVSSLEKNVKDNNFVIIASYGDHIQKMVTIVEILKKNFAKDTKLH
                     QWNRLHSFEHIKPEKNELLEVRTKVPIMVTALSLADEKEAPQKLTMASNQFYRQS"
     gene            <370244..>371089
                     /locus_tag="CAGL0K04015g"
                     /db_xref="GeneID:2890039"
     mRNA            <370244..>371089
                     /locus_tag="CAGL0K04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448400.1"
                     /db_xref="GeneID:2890039"
     CDS             370244..371089
                     /locus_tag="CAGL0K04015g"
                     /note="weakly similar to uniprot|P53219 Saccharomyces
                     cerevisiae YGR031w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448400.1"
                     /db_xref="GeneID:2890039"
                     /db_xref="GOA:Q6FMZ4"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ4"
                     /translation="MIAPLLRKYSSQASALQLAYDHLPGKNSQLSPVVILHGLFGSKL
                     NNRTIGRGINSNLGRDVYLVDLRNHGSSPQSPMHDYQSMRLDLEKFVDDHKLENPIVM
                     GHSMGAKVAMQACLYNPKRYKMLISIENAPVNVMPNGKFVQYIDLLERQVGHQVTLKT
                     VEERLSKLEKNELVLKFLMTMLRRDREGAIESKLPLGILREAIVKGKISEWDVKDRRY
                     NGPSLFIRGTESAYIADEYIVPISTYFPNFELRDVKGGHWINVENSSACIEYISEFID
                     RKEDI"
     gene            <373375..>379068
                     /locus_tag="CAGL0K04037g"
                     /db_xref="GeneID:2890040"
     mRNA            <373375..>379068
                     /locus_tag="CAGL0K04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448401.1"
                     /db_xref="GeneID:2890040"
     CDS             373375..379068
                     /locus_tag="CAGL0K04037g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448401.1"
                     /db_xref="GeneID:2890040"
                     /db_xref="GOA:Q6FMZ3"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ3"
                     /translation="MSYDQGGNGNWQNTDPNGNYYYNGAENNEFYDQDYASQQPEQQQ
                     GGEGYYDEYGQPNYNYMNDPQQGQMPQQQPGGYENDGYYDSYYNNQMNAGVGNGLGPD
                     QTNFSDFSSYGPPPFQNNQANYTPSQLSYSNNGMGSNGMNMSGSSTPVYGNYDPNAIA
                     MTLPNDPYPAWTADPQSPVSIEQIEDVFIDLTNKFGFQRDSMRNIFDLFMTLLDSRTS
                     RMSPDQALLSVHADYIGGDTANYKKWYFAAQLDMDDEVGFRNMNLGKLSRKARKAKKK
                     NKKAMEEANPEDAAEVLNKIEGDNSLEASDFRWKTKMNMLTPIERVRQVALYMLIWGE
                     ANQVRFTSECLCFIYKCASDYLESPLCQQRTEPIPEGDYLNRVITPIYQFIRNQVYEI
                     VDGRYVKREKDHNKIIGYDDVNQLFWYPEGITKIVLEDGTKLTDIPSEERYLRLGEVA
                     WNDVFFKTYKETRTWLHLVTNFNRIWIMHVSVYWMYVAYNSPTFYTHNYQQLVNNQPV
                     PAYRWASAALAGTVASAIQLFATVCEWWFVPRKWAGAQHLSRRFWFLCGILGVNLGPL
                     IFVFAYEKDTVQSKAGHAVAAVTFFIAVATVLFFSIMPLGGLFTSYMQKSSRRYVASQ
                     TFTASFAPLQGLDRWLSYLVWVTVFAAKYSESYFFLILSLRDPIRILSTTTMRCTGEY
                     WWGSKLCRHQSKIVLGFMIATDFILFFLDTYLWYIVVNTVFSVGKSFYLGISILTPWR
                     NIFTRLPKRIYSKILATTDMEIKYKPKVLISQIWNAIIISMYREHLLAIDHVQKLLYH
                     QVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPMPEPLPV
                     DNMPTFTVLTPHYSERILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKIL
                     AEETAAYENEETQDPEKSDALKTQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLY
                     RTVSGFMNYARAIKLLYRVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAK
                     FKPHELENTEFLLRAYPDLQIAYLDEEPPLNEGEEPRIYSALIDGHCEMLENGRRRPK
                     FRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEEL
                     NAEPVYPYTPGVKYEDQKTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFART
                     LAQIGGKLHYGHPDFINATFMTTRSGLSKAQKGLHLNEDIYAGMNALLRGGRIKHCEY
                     YQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHL
                     NNLFIQLSLQMFMLTLVNLHALAHESILCIYDRNKPKTDVLYPIGCYNFSPAIDWIRR
                     YTLSIFIVFWIAFVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSAALLS
                     DMTVGGARYISTGRGFATSRIPFSILYSRFASSAIYMGARSMLMLLFGTVAHWQAPLL
                     WFWASLSALLFSPFIFNPHQFSWEDFFLDYRDYIRWLSRGNNKYHKNSWIGYVRMARS
                     RITGFKRKLIGDDSEKAAGDANRAHRTNLILAELIPTAINAGSCFIGFTFINAQTGVK
                     ATDDDRVNSVLRVVLCTLGPIAVDVGVLFFCLGMSCCSGPLFGMCCKKTGAVMAAVAH
                     GVSVVIHIGFFIVMWVLEGFNFTRMLVGVATVIQCQRFIFQLMTILLLTREFKNDHAN
                     TAFWTGKWYGSGFGYMAWTQPMRELTAKVIEMSEFAADFVLGHVILFAQFPVLCIPAI
                     DKFHSIMLFWLKPSRHIRPPIYSLKQSRLRKRMVKRYLTLYIIIFLVFAGAIVGPAVA
                     ASHVPQDIGHTLTGPFHNIVQPRNKSNNDTGLQISTYSNHYYTHTPSLKTWSTIK"
     gene            complement(<379642..>380289)
                     /locus_tag="CAGL0K04059g"
                     /db_xref="GeneID:2890041"
     mRNA            complement(<379642..>380289)
                     /locus_tag="CAGL0K04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448402.1"
                     /db_xref="GeneID:2890041"
     CDS             complement(379642..380289)
                     /locus_tag="CAGL0K04059g"
                     /inference="similar to AA sequence:UniProtKB:P53220"
                     /note="similar to uniprot|P53220 Saccharomyces cerevisiae
                     YGR033c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448402.1"
                     /db_xref="GeneID:2890041"
                     /db_xref="GOA:Q6FMZ2"
                     /db_xref="InterPro:IPR013261"
                     /translation="MVLRSRPLASIPRVQFYSSKGKSKGKTSGEKKPEHKKIPVWHKL
                     KALTSFTASSLLVVGGVGVSGVVLYLILSELFSPSGDTMLFNRAVTLVEDNEEVRKLL
                     QCNDSSFKKERLKAYGELVTNDRWTRNRPIVSTQKIDKYGKCHHFMRFHLESKKKLGL
                     VHVEAVDSEQNYKPNFVSMYIDIPGEKRFYIIRPKLRQVVRPKSIFGFPWGSRKE"
     gene            380646..380717
                     /gene="tRNA-Arg (CCG)"
                     /locus_tag="CAGL0K04081r"
                     /db_xref="GeneID:2890042"
     tRNA            380646..380717
                     /gene="tRNA-Arg (CCG)"
                     /locus_tag="CAGL0K04081r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2890042"
     gene            complement(<381023..>381727)
                     /locus_tag="CAGL0K04103g"
                     /db_xref="GeneID:2890043"
     mRNA            complement(<381023..>381727)
                     /locus_tag="CAGL0K04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448403.1"
                     /db_xref="GeneID:2890043"
     CDS             complement(381023..381727)
                     /locus_tag="CAGL0K04103g"
                     /inference="similar to AA sequence:UniProtKB:P53223"
                     /note="similar to uniprot|P53223 Saccharomyces cerevisiae
                     YGR036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448403.1"
                     /db_xref="GeneID:2890043"
                     /db_xref="GOA:Q6FMZ1"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ1"
                     /translation="MNATTHRNIIPFDDTYILYDPDDVLSFLSAYFSLLPILILTFYL
                     SWFIITRELESCIIALGQLCNEIMNNIVKNIIKQDRPYWVGDSFQENSIRSGYGMPSA
                     HSQFMGFTLSYFTLSLLVAPLSTNRKRSRFEAVSLFLILVVLSACVTFSRVYLHYHSV
                     EQVLVGFTLGLFNGSAYLLVVRVIRSLGLWNWLLSWPIARILYMKDNFNLAPVTLKQE
                     YESFWKTISSKSQKKE"
     gene            complement(<381995..>382255)
                     /locus_tag="CAGL0K04125g"
                     /db_xref="GeneID:2890044"
     mRNA            complement(<381995..>382255)
                     /locus_tag="CAGL0K04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448404.1"
                     /db_xref="GeneID:2890044"
     CDS             complement(381995..382255)
                     /locus_tag="CAGL0K04125g"
                     /note="highly similar to uniprot|P31787 Saccharomyces
                     cerevisiae YGR037c ACB1 acyl-coenzyme-A-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448404.1"
                     /db_xref="GeneID:2890044"
                     /db_xref="GOA:Q6FMZ0"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="InterPro:IPR022408"
                     /db_xref="UniProtKB/TrEMBL:Q6FMZ0"
                     /translation="MVSQLFEEKAKAVNELPTQPSQDEMLKLYGLYKQATVGDNTKEK
                     PGIFNMKDRYKWDAWEKLKGMSQEEAEQKYIELVDELIAKYN"
     gene            <383129..>383776
                     /locus_tag="CAGL0K04147g"
                     /db_xref="GeneID:2890045"
     mRNA            <383129..>383776
                     /locus_tag="CAGL0K04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448405.1"
                     /db_xref="GeneID:2890045"
     CDS             383129..383776
                     /locus_tag="CAGL0K04147g"
                     /note="highly similar to uniprot|P53224 Saccharomyces
                     cerevisiae YGR038w ORM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448405.1"
                     /db_xref="GeneID:2890045"
                     /db_xref="GOA:Q6FMY9"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY9"
                     /translation="MSDYKPFPAYQGNSNVSAQGSRLRSSSQVSTGASDPVKDHRRKR
                     SSSIISHVEQETFEDDVDQQLLPNMNASWVNQRGAWIIHIVVIVLLKMFYNILPGITA
                     EWSWTLTNMTYIIGFYIMFHLVKGTPFEFNGGAFDNLTMWEQIDHETLFTPSRKFLLA
                     VPIALFLVSTHYAHYDLNLFLWNLAVTIFVGVVPKLAWAHRLRISIPGVMRAQIS"
     gene            <384567..>385763
                     /locus_tag="CAGL0K04169g"
                     /db_xref="GeneID:2890046"
     mRNA            <384567..>385763
                     /locus_tag="CAGL0K04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448406.1"
                     /db_xref="GeneID:2890046"
     CDS             384567..385763
                     /locus_tag="CAGL0K04169g"
                     /inference="similar to AA sequence:UniProtKB:P14681"
                     /note="similar to uniprot|P14681 Saccharomyces cerevisiae
                     YGR040w KSS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448406.1"
                     /db_xref="GeneID:2890046"
                     /db_xref="GOA:Q6FMY8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY8"
                     /translation="MPRTITFNIPKEYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRI
                     RFPDSPPSDDGQGVPRLEEDDEHDNIAKVALIRTIREIKILSHFNNHENIITIFEKIK
                     PMQSINFKEIYLVQELMETDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHR
                     DLKPSNILLNSNCDLKICDFGLARTYDPDDDASTMNGNNVGFLTEYVATRWYRAPEIM
                     LNFQDYSTAIDIWSCGCVLAEMLFRKPIFPGKDYHHQLLLILDTLGTPSPEDIEAINY
                     GRAKEYILSLPHFPKKDWSQLLGTDNEMLLDILDKLMIFNPKRRITAEQALEHPFLAT
                     YHDPKDEPNFPPLNFKGDEFWQLDNCMETSNGYGTDDSNNLRANVTRRKLREILYQEM
                     VTPAPR"
     gene            <386857..>388446
                     /locus_tag="CAGL0K04191g"
                     /db_xref="GeneID:2890047"
     mRNA            <386857..>388446
                     /locus_tag="CAGL0K04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448407.1"
                     /db_xref="GeneID:2890047"
     CDS             386857..388446
                     /locus_tag="CAGL0K04191g"
                     /note="weakly similar to uniprot|P53226 Saccharomyces
                     cerevisiae YGR041w BUD9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448407.1"
                     /db_xref="GeneID:2890047"
                     /db_xref="GOA:Q6FMY7"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY7"
                     /translation="MSTSVSETDNVSNNSSASDRFSSNEDSQESHNRASSQPIFIEIL
                     STNSNSENGSYQVILNDTVINSTRNTPTKSGIKIPSNSTTPQHIVNGRSLSNTPKSNS
                     SRIRLEQPIPRAPAQVVQRPSMDSIQLDRSIHNASHASSIGTIATTALMNKTLSSDSI
                     SVTQRNPNSSRISINQSKSPARKQSPSMAKPQLVHNKGKPILLSFDNKSPIEDSEDTP
                     EGRLKRNIKLEDSVRLLQEEFKSPSLHTAETATFSTKTKGVYPLEPEKALHSPKSPNR
                     LSRDKSSLLNDIPESELLEKIRNSQFLWSGLLKTDSDDTSSVNSEGSELSAQYNEKDV
                     INSNGKDSTRRNDGNAKDIPNIKQKRSSLSLNAENTKENTNNNSTFNLLSPEHFYNQN
                     NNVNYDEEKFIETSYHVHFKNTYQPIQYTDVYTVSSTDSETAGIFDMYSFWRLLILFL
                     VCLCVPPLFFLIAAGNRCGISDYRLMKMVILKKYRLYLYQGFIFNINLGWLRIICFVC
                     GVAELLAAFAGIAIGLGVGLT"
     gene            <388756..>389490
                     /locus_tag="CAGL0K04213g"
                     /db_xref="GeneID:2890048"
     mRNA            <388756..>389490
                     /locus_tag="CAGL0K04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448408.1"
                     /db_xref="GeneID:2890048"
     CDS             388756..389490
                     /locus_tag="CAGL0K04213g"
                     /inference="similar to AA sequence:UniProtKB:P53227"
                     /note="similar to uniprot|P53227 Saccharomyces cerevisiae
                     YGR042w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448408.1"
                     /db_xref="GeneID:2890048"
                     /db_xref="GOA:Q6FMY6"
                     /db_xref="InterPro:IPR018838"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY6"
                     /translation="MSAIVQEYCCQYTDQVRKKHKTWHDGKLKFYTENNRFILYSDPD
                     STLLSSAFVTNSKELESILDQGSFGSAEHRIFGRYIVILEDLISEQHNDPSSAVRKPV
                     VKITKKFHVPNLETTSPLKINNRLISGRFSSGDTKGKTSHMGIEASQLTLKFNKKYKR
                     PTIMRQTGNSLLDSDLSKTCDKNNALSAASLENNSKNKDPLLCDNSEPNCTNSERKKG
                     RPSSFKVQKRLGRIRKIEHKPINIPQ"
     gene            complement(<389609..>390607)
                     /locus_tag="CAGL0K04235g"
                     /db_xref="GeneID:2890049"
     mRNA            complement(<389609..>390607)
                     /locus_tag="CAGL0K04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448409.1"
                     /db_xref="GeneID:2890049"
     CDS             complement(389609..390607)
                     /locus_tag="CAGL0K04235g"
                     /inference="similar to AA sequence:UniProtKB:P15019"
                     /note="similar to uniprot|P15019 Saccharomyces cerevisiae
                     YLR354c TAL1 or uniprot|P53228 Saccharomyces cerevisiae
                     YGR043c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448409.1"
                     /db_xref="GeneID:2890049"
                     /db_xref="GOA:Q6FMY5"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY5"
                     /translation="MSTENGGNSTLENLRNAGTNVVTDTGEFELISKFKPRDSTTNPS
                     LILAATKNPNYASLIDVAIDYAKAKGGTIEQQTNNAADRLLVEFGKRITDLIPGVVST
                     EVDARLSFDKKGTVDKALQIIKLYEENGVSKDRVLIKIASTWEGIQAARELEAQHGIH
                     CNLTLLFNFTQAVACAEANVTLISPFIARVLDWYKANTKNDYNIENHPGVLFVKKTYN
                     YYKKHGYKTIIMGASFRTLDEIRALAGLDNATLGIPLLENLQNSTEKIDRVLTPEGAQ
                     KDGVDMITLIDDEAKYRYEFNSDAMAVEKLADGIRTFAKDTNTLYSLLRTKLEKAN"
     gene            complement(<392116..>393759)
                     /locus_tag="CAGL0K04257g"
                     /db_xref="GeneID:2889989"
     mRNA            complement(<392116..>393759)
                     /locus_tag="CAGL0K04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448410.1"
                     /db_xref="GeneID:2889989"
     CDS             complement(392116..393759)
                     /locus_tag="CAGL0K04257g"
                     /note="some similarities with uniprot|P32338 Saccharomyces
                     cerevisiae YGR044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448410.1"
                     /db_xref="GeneID:2889989"
                     /db_xref="GOA:Q6FMY4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY4"
                     /translation="MLRTKDSGFAFLYSNSKSDNDIIAFPSSFNVLTELQRKQPYDSN
                     DYFDMEYTGSNGLRLGEHDILPPNFTTIDIAIDNEDDEEEGDQNTICSNTLRRTCSAY
                     NTNSKDGLCSGDQNCMGGMNMMLMQFKNQYLAGQGISRANVPQQQQNDNTFDYDEQHY
                     TSGLPTPTESAGIIRSCLTSPLDFAATIKTEPYVNNTTLLLSQSGPPLSQSSNMPDLL
                     HRERSHTLANITPISLSSSSKDDSYFTATVDTKRHSIPMVNTRGVIKKEEPDYSVLQP
                     QHAHIDDVSGYGEISAGTSSYRNMVSQWTSGTEPTFNDAVSVGPLSCSMNNASRCDMD
                     VNCHTNSDELPLSNINLAMGPTVDSTTDYQSMKDNLSAGCSNDTNGKSLVKQLLEDPY
                     LSDIIQKPQKRGLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPFKNCAWRILGLPR
                     RSDLRRHCAIQHKYELYGQLKKDLNLTEDAYPVLRCPVMFCQKEFYRKDAYKRHIAIV
                     HENTSSRFNKRLKRIIKECPHFETEEERFNFIRDKVRNK"
     gene            <397602..>398156
                     /locus_tag="CAGL0K04279g"
                     /db_xref="GeneID:2889990"
     mRNA            <397602..>398156
                     /locus_tag="CAGL0K04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448411.1"
                     /db_xref="GeneID:2889990"
     CDS             397602..398156
                     /locus_tag="CAGL0K04279g"
                     /note="weakly similar to uniprot|P32564 Saccharomyces
                     cerevisiae YGR049w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448411.1"
                     /db_xref="GeneID:2889990"
                     /db_xref="GOA:Q6FMY3"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY3"
                     /translation="MTNPELITTTKCIGVTSLGLYAGLLTSTSLITSATPLDVLTGSL
                     KNLLCKIGCWATAFGSVSTISLAVSYFLSEKPQRSNTRLAGALIAPITGLYLYASSLA
                     NHGCCPSKAKESGLPEGHPQVGADAPVCPFSKTTDGSNGSFHKGSIKSDKCYNALLCH
                     LTVVTLTTCGVFAKSVFDGFQGLL"
     gene            <405248..>406315
                     /locus_tag="CAGL0K04301g"
                     /db_xref="GeneID:2889991"
     mRNA            <405248..>406315
                     /locus_tag="CAGL0K04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448412.1"
                     /db_xref="GeneID:2889991"
     CDS             405248..406315
                     /locus_tag="CAGL0K04301g"
                     /inference="similar to AA sequence:UniProtKB:P53233"
                     /note="similar to uniprot|P53233 Saccharomyces cerevisiae
                     YGR052w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448412.1"
                     /db_xref="GeneID:2889991"
                     /db_xref="GOA:Q6FMY2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY2"
                     /translation="MPDKSNKYKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKF
                     SQRGMANEYNVGKLLSKDEGCPFICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKK
                     KGDLNAPSIIKLNFQKVVLQLSYAIKYAHSMGIAHRDIKPENILINYHGDIKLADWGH
                     AISASSSNDNNIGTDNYRGPETFSAKVSYNTYRSDYWSMGVTLLYLLFSHCPFRCSNI
                     KNEKIVYKRLENGETLVYPNCHIFNNYVSDPYKFIYESFFSSVSLSRRRKLFKSSSTK
                     YVAPFLWQDMTDMHDMLQMTKIIVDNLMSPNPSKRSLTRFLKHFNAFWTAHQENDIES
                     ASSVRNIKSNNLKVLGVSGNY"
     gene            complement(<407084..>407905)
                     /locus_tag="CAGL0K04323g"
                     /db_xref="GeneID:2889992"
     mRNA            complement(<407084..>407905)
                     /locus_tag="CAGL0K04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448413.1"
                     /db_xref="GeneID:2889992"
     CDS             complement(407084..407905)
                     /locus_tag="CAGL0K04323g"
                     /note="weakly similar to uniprot|P53234 Saccharomyces
                     cerevisiae YGR053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448413.1"
                     /db_xref="GeneID:2889992"
                     /db_xref="GOA:Q6FMY1"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY1"
                     /translation="MLKRYHYARRIRLNHIRDLNQKRFIVSNYDDPNDVNYGQMTDYL
                     REKGVPLLLQENLKEETLDDAIVLRLLPSTHPYIPNLHGILQYKTSMNAIRLIMRKFV
                     LEENSRLKVLSSRRIRGDDDQIKYQCNISPYLTNHDKLLIRWQSCLPQTAGTVEPDEE
                     DMNKTISFSSNDVLRTQTSSGESPILDYILQKPAKTISTLAPNVLSKHITLGNRISAM
                     NNDDSLDNEYTRIVNGTFVFEFNEDNSKILVHTIENVELIDYERKINVPKNAFAC"
     gene            <409067..>411010
                     /locus_tag="CAGL0K04345g"
                     /db_xref="GeneID:2889993"
     mRNA            <409067..>411010
                     /locus_tag="CAGL0K04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448414.1"
                     /db_xref="GeneID:2889993"
     CDS             409067..411010
                     /locus_tag="CAGL0K04345g"
                     /note="highly similar to uniprot|P53235 Saccharomyces
                     cerevisiae YGR054w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448414.1"
                     /db_xref="GeneID:2889993"
                     /db_xref="GOA:Q6FMY0"
                     /db_xref="InterPro:IPR011387"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FMY0"
                     /translation="MSSQFFLKTSKDIELFQGYPDFTQSNSAANAKDDQVISSVLSPC
                     GRFFAISTKGNVKVFSGELLEVELLNLTINDVYEIQFSPSGNYMSTWERPSAKDAEHK
                     NVKVWYLNKVFTEGEEQEPVFQYQHKPQNGWFMQFSKLDDYALKMFKNEIRIVKINDA
                     NKTNFHFDQPFATLSKTQENDSQPFSTYQVSPADFPTICTFTPEKGGKPAQLSIWSIT
                     EGKITKKIASKTFFKADSCQLQWNPQGNAVLCVATTDFDSTNKSYYGENTLYLLSFQG
                     VNGAVGNNSVRVSLAKGPVHDISWSPTSRQFGVISGYMPATIQFFDLRGNVVHSLEKQ
                     PKNTILFSPSGRYILIAGFGNLQGSVQILDRHDKFKSLTVFNAANTSVCKWSPGGEFI
                     MTATTSPRLRVDNCIKIWHVSGTLVFAKEFEELLKVDWRNTCKYKTLKDHPHVIKDWT
                     PLNNTDAASLDPQIASPKKDLAIHESAKEYEAKHPKRDAKTGNGSTQSKSASTGGAYK
                     PPHARRAAAVANNRSVPGASPKVQRAIPGLIPGLPVNEGSAAANKNRKRRANKKANSG
                     TGEGAEKAESPAAPSITSTEPAKEASPEEKKIRSLLKKLRAIEMLKEKQAAGEKLQDL
                     QVKKIETEGKFREELAALGWKEE"
     gene            <413033..>414781
                     /locus_tag="CAGL0K04367g"
                     /db_xref="GeneID:2889994"
     mRNA            <413033..>414781
                     /locus_tag="CAGL0K04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448415.1"
                     /db_xref="GeneID:2889994"
     CDS             413033..414781
                     /locus_tag="CAGL0K04367g"
                     /note="highly similar to uniprot|P50276 Saccharomyces
                     cerevisiae YGR055w high-affinity methionine permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448415.1"
                     /db_xref="GeneID:2889994"
                     /db_xref="GOA:Q6FMX9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX9"
                     /translation="MTDNKRSFLSQLNVFNKDNYQISSKKSEEGVYSNETEEASDVET
                     GQQFTTELDQGEKRLGLFSCIGLICNRMLGTGVFAVSSTIYTLSGSIGLALILWAVGA
                     IIAISGLYVYMEFGTAIPKNGGEKNYLEAIVKKPKFFITCMYASYVFFLGWAAGNSVN
                     TAVMFLTAADAEITKWNQRGIGVAVVFFCFAVNAISVKAGLYLQNLLGIFKVGIVLFI
                     SVTGWVALGGGLKHGYQSHNFHNAFEGTNKATAYGVVNALYNVIWSFVGYSNVNYALG
                     EVKDPVRTLKIAGPTSMVCLAIIYIFVNIAYFAVVPKEKLISSKLILAADFFDICFGG
                     HSKRVAAALVGLSALGNVMSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLF
                     QHFIICMITIIAPPPGDAYNIILNLISYPMNIVNFVVSAGLLWIYWQRRQGKIEWNPP
                     IKAGVFVTTFFMLSNIYLIVAPYVPPTHGESVYEHAPYWIHCVVAWGIFAFGGFYWFV
                     WVKVLPKWGNYRLETKDILGEDGFWRVQVIKVPNETDKDHQEQSDESGTERADTFELD
                     YIHLEPSKDTAKSHLD"
     gene            <415639..>418443
                     /locus_tag="CAGL0K04389g"
                     /db_xref="GeneID:2889995"
     mRNA            <415639..>418443
                     /locus_tag="CAGL0K04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448416.1"
                     /db_xref="GeneID:2889995"
     CDS             415639..418443
                     /locus_tag="CAGL0K04389g"
                     /inference="similar to AA sequence:UniProtKB:P53236"
                     /note="similar to uniprot|P53236 Saccharomyces cerevisiae
                     YGR056w Chromatin remodeling complex protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448416.1"
                     /db_xref="GeneID:2889995"
                     /db_xref="GOA:Q6FMX8"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX8"
                     /translation="MSEEGEFGELRTDLRKQYEAIFSLKEESGANIFPIFNVLPIKKD
                     YPDYYAIIKNPISLNTLKKRLPHYTSPQDYVNDVSQIPWNAKTYNSKGSLIYIYADIL
                     EKFLRNVSVPQLQAKYTNVNYPNLGPLPDEIEEMKKKEAMMKIRTASASPVALGNANE
                     VPARSGSNSPLPLTSMSNTPQPVTEVKQPIPQQNGGINGYNTSRQNMAMQGNNSTANR
                     RMEQTVISMGPSRVPMAQISSRVSPHPILPNRSMSSTPISHSPGAILKPSIQQRLQTR
                     RGRPPIIDLPYLLRIKNIMKMIKREVDDNNQTLTLTFEKLPDPERHPAYRQIISNPVC
                     LDDIRRRVKTRKYKNFGSFQDDFTLMIENYKKYNQNNPMLLNTARLMEYHFRKLVEIE
                     LSKPDSDFLPEGELRYPLENIEVRGKIYEIGDWVLLNNANDPNKPVVAQIFKLWYTSD
                     GTKWLNACWYFRPEQTVHRVDRLFYKNEVVKTGQYRDHLINDLIGKCYVVHFTRYQRG
                     NPATPYEGPLFICEFRYNESDKVFNKIRTWKACLPEELRDQDEETIPVNGRKFFKYPS
                     PIRHLLRPDATPHDRIPEPTEGDPTAPPLVGAVYLRPKVERDDLGEYSTSDDCPRYII
                     RPGDPPESGIIDEVHGTIITSMQTANALPRTSQSTSRLPALKQTKSAASNENMVQPTK
                     GMSYQKPIPPVASNRTMQSHKVPVSTLPQRPEQTIQPQKLSTVEALRQGPIPTNISSV
                     SLNEAVNDMSQQAAKSGMRYVTIDVPHSYVLPMAGIPKHNEVMTTDDANRLRGSRYQA
                     NNSQSEILWFRGPSISIKERYVDSMNSFNSLDLNRLTVHKKRKLDYEEIEEQGVDTHM
                     SIDDKGNVTTEASPEGLLTQGNDMHMDSAHQSDDDDDNAEEEGHLSEKLISTSTIGLR
                     PSAKFIIHKHKYSTIENIIT"
     gene            complement(<418596..>419447)
                     /locus_tag="CAGL0K04411g"
                     /db_xref="GeneID:2889996"
     mRNA            complement(<418596..>419447)
                     /locus_tag="CAGL0K04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448417.1"
                     /db_xref="GeneID:2889996"
     CDS             complement(418596..419447)
                     /locus_tag="CAGL0K04411g"
                     /inference="similar to AA sequence:UniProtKB:P53237"
                     /note="similar to uniprot|P53237 Saccharomyces cerevisiae
                     YGR057c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448417.1"
                     /db_xref="GeneID:2889996"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX7"
                     /translation="MILISLGHFCDIHGPTIIIVTQEGEIGNSGNELLLPDYPTESYC
                     ESCMVKIPDCDGSDENGADVDTEAEVSTTDTISENTLLPASNVPRSIRSKLGEKSFVS
                     SQYSAIRYQLLTSMIRKAFSEETMIYDGSPSVFYDESKGLNLVMGFKLHDPNARGNER
                     RYCLILTIESVDETNAMGLIAAHWHFIVGGFSMMINAIKEKHAQNNDGLESNHDLQKN
                     FTQDIGNYLRANKGKCARNLSELTNDKFTFLRIHKWNTYMIDTLCSKLQRADQSSVIK
                     ERSKHAS"
     gene            <420248..>421333
                     /locus_tag="CAGL0K04433g"
                     /db_xref="GeneID:2889997"
     mRNA            <420248..>421333
                     /locus_tag="CAGL0K04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448418.1"
                     /db_xref="GeneID:2889997"
     CDS             420248..421333
                     /locus_tag="CAGL0K04433g"
                     /inference="similar to AA sequence:UniProtKB:P53238"
                     /note="similar to uniprot|P53238 Saccharomyces cerevisiae
                     YGR058w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448418.1"
                     /db_xref="GeneID:2889997"
                     /db_xref="GOA:Q6FMX6"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX6"
                     /translation="MCARKLKYAAGDDLLLYATPKEAMQNTKRNEEDKKPRVRKPNVR
                     TPSEPGMGQPMPTGRSSGDYVHGASYVPKHQSLSQPQLQQMPIPNAYSSSKTRPIPQQ
                     MIGNPVQNLRGNNYGGQGRIVSSPPAMVPPSAAMQRAQAQVSHTPPRIANKSPEVAQN
                     AMLSRTKGALRDSSQTLSEEDAKDTRIAIQLFHNHDVRGKERLTAEELQNLLQNDDNT
                     HFCISAVDALINLFGATRFGTVNESEFISLYKRVKKWRKIYVDNDINGSYTITMSEFH
                     NSLQELGYMVPVEVSEKLFDQYAEFINPANNAKELKFDKFVEALVWLMRLTKLFRKFD
                     KNQDGVAHIQYKEFIDVTLYLGRFLPH"
     gene            <421791..>423104
                     /locus_tag="CAGL0K04455g"
                     /db_xref="GeneID:2889998"
     mRNA            <421791..>423104
                     /locus_tag="CAGL0K04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448419.1"
                     /db_xref="GeneID:2889998"
     CDS             421791..423104
                     /locus_tag="CAGL0K04455g"
                     /note="weakly similar to uniprot|P41901 Saccharomyces
                     cerevisiae YGR059w sporulation-specific septin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448419.1"
                     /db_xref="GeneID:2889998"
                     /db_xref="GOA:Q6FMX5"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX5"
                     /translation="MIDDNSYELDSLDYLNDASFVLFGEGQIFKEDRRVKPAQDVQRR
                     KMLFEELDIGLSMILGQIDKRYAREGMIFNLMVAGRSGVGKTTFINSLFETELIPPTQ
                     HQEHGSLPLENYHFLLQNHDGSVNLKLQIVDTPGYANKINNNYCWVPLINYLDEQMTR
                     YVFQEEQPYREEEKRDSRVHCCLYFIEACDTQLHPIDIISMRELSSRCNLIPVLSKSD
                     YLTEAELTAVKQRVKDVIRLQNIKICRFFQSRDKTKEVYGNVPYCVKIQSMVYHWQKN
                     VIRPLEFKTSFDKLQFNELRDLIFGETCTEFVESTETYYERCRQYLLEYRIKNARDDV
                     ENNTDLRGLQEYLLYHSVAKSRVDEEMTVFTNPTYLDKVSALKQKYTERLIAEDGVFD
                     KWVERLARTQKNFNLEIKNLQSQINAIKETTKVRSTSNATLVQEM"
     gene            <424537..>425463
                     /locus_tag="CAGL0K04477g"
                     /db_xref="GeneID:2889999"
     mRNA            <424537..>425463
                     /locus_tag="CAGL0K04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448420.1"
                     /db_xref="GeneID:2889999"
     CDS             424537..425463
                     /locus_tag="CAGL0K04477g"
                     /note="highly similar to uniprot|P53045 Saccharomyces
                     cerevisiae YGR060w C-4 methyl sterol oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448420.1"
                     /db_xref="GeneID:2889999"
                     /db_xref="GOA:Q6FMX4"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX4"
                     /translation="MSAVFNNATLTDLVREDTYFKTLANIGKFQPQLNFMEQYWAAWY
                     TYMNNDVLATGLMFFLLHEFMYFFRCLPWFIIDQIPYFRKWKLQPTKIPSTKEQLYCL
                     KAVLLSHFLVEAIPIWTFHPMCEKLGITVEVPFPSIKKMSLEIALFFVLEDMWHYWAH
                     RLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPLETMSLGFGTVGMPILYVMYTGNLHL
                     FTLCVWITLRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWW
                     DYCLDTESGPEAKVAREERMKSKAEQKAKKTN"
     gene            complement(<425890..>429930)
                     /locus_tag="CAGL0K04499g"
                     /db_xref="GeneID:2890000"
     mRNA            complement(<425890..>429930)
                     /locus_tag="CAGL0K04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448421.1"
                     /db_xref="GeneID:2890000"
     CDS             complement(425890..429930)
                     /locus_tag="CAGL0K04499g"
                     /note="highly similar to uniprot|P38972 Saccharomyces
                     cerevisiae YGR061c Phosphoribosylformylglycinamidine
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448421.1"
                     /db_xref="GeneID:2890000"
                     /db_xref="GOA:Q6FMX3"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010073"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX3"
                     /translation="MAFVQPGPQALSPFRVENLIQDINNVTGSNSIKVVRSCYIHYAQ
                     VLTELSAEQKNVLEVLLTYDSPLDTQNDEYSKQLFDAIKEDKVGSDLGDDTYLIRILP
                     RAGTVSPWASKATNIAAVCGLDHSIKKIERGVALLIKVIPGFPIADHLNELSLKSVFD
                     RMTQTLYINEIPPMSALFHFELPKDITTFPLVSDEATGSPKELLQKTNKDLGLALDAG
                     EIDYLVHVFVEVLKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLKKDLSLFQMIR
                     NTHKTTPDYIISAYSDNAAVVDTENQGFFFAPDSTTKEWKATKETIPMLIKVETHNHP
                     TAVSPFPGAATGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPGHKQPWELDIGKPS
                     HIASSLDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVKNTQNKEEIRGFHKPIMIA
                     GGLGTVRPKFALKNKPITAGSPIIVLGGESMLIGLGGGAASSVASGEGSAELDFASVQ
                     RGNPEMERRCQQVIDACVSLGDANPIQSIHDVGAGGLSNALPELVHDSGLGAKFDVRR
                     VLTLEPGMSPMEIWCNESQERYVLGCSQKDLPIFEEICKRERAPYAVVGFATSENRLL
                     VEDSFLETTPINLDMSILFGKPPKMSREAKTEPLKLPTADLKVIPSLDEAVKRVLNLP
                     SVASKSFLITIGDRSVTGLIDRDQFVGPWQVPVADVGVTNTSLGDSICKTGEALAMGE
                     RPVNALISAAASAKLSVAESLLNLFAADVKSLKHVKLSANWMSPASHQGEGSKLYEAV
                     QAIGLDLCPELGVSIPVGKDSMSMKMKWDDKEVTAPLSLNITAFSPVSDTSKTWTPLL
                     KKDSDSVLVLVDLAAKKEKSLGGSALLQVFNQVGDSSPTVHDNRTLRGLLEAIIELHN
                     SDIVQAYHDVSDGGLLVTLLEMAFASRCGLNVKIPVQDDAVFKSLFSEELGAVFQISA
                     SKLETFQQILSKHNVTDEYIEIVGSPDFNSQQIKIADANDSVIFEDTRGKLQQVWSST
                     SYQMQRLRDNPKYADEEFANILDDKDPGLHYTLTFDPSDDLEIPKTLNTIRPKVAILR
                     EQGVNGQMEMAWCFQQAGFNSVDVTMTDLIDGRVHLDDFVGLAACGGFSYGDVLGAGA
                     GWAKSVLYHEGVRQQFVKFFQEREDTFAFGACNGCQFLTRLKDLIPGCENWPTMERNF
                     SEQYEARVCMVEITDETGNEKSVFLNGMGGSKFPIAVAHGEGRAKFANDGALQKFESG
                     DLGSIRYVDNYGNVTQRFPYNPNGSVNGIAGIRSPNGRVLAMMPHPERVCRLEANSWY
                     PEGKFGEWKGYGPWIRLFRNARKWVG"
     gene            complement(<430693..>431646)
                     /locus_tag="CAGL0K04521g"
                     /db_xref="GeneID:2890001"
     mRNA            complement(<430693..>431646)
                     /locus_tag="CAGL0K04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448422.1"
                     /db_xref="GeneID:2890001"
     CDS             complement(430693..431646)
                     /locus_tag="CAGL0K04521g"
                     /note="some similarities with uniprot|P53239 Saccharomyces
                     cerevisiae YGR062c Cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448422.1"
                     /db_xref="GeneID:2890001"
                     /db_xref="GOA:Q6FMX2"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX2"
                     /translation="MLRSTIVPRGFSQIPKRHILGNQPYFRPSSRRSISTFQTIADTF
                     TTLHDVSGIHWVVLIPVTTFALRTVFTLPLSIWQRRRIVKQQELRKLVAPISSIVKMR
                     LAVTSKSAKEKRLESGSDITIAKPVGGLSAENLTPEQITLLAVKETRKRQKLLFKKYG
                     VQMWKNAVLPLVQIPLWVTVSMGIRTLTENPLREKLYNNGWLSSVGIDENLYLSEPLE
                     AYPFAVPLVLGTLSMLNVEYNGKVIQGDSAKNLGLKLRADNSRLQLGIQTILNVTRIG
                     TVFMMGFSSQTALLLSLYWISSQLYSLLQNIFLNWLWPYQR"
     gene            complement(<432032..>432340)
                     /locus_tag="CAGL0K04543g"
                     /db_xref="GeneID:2890002"
     mRNA            complement(<432032..>432340)
                     /locus_tag="CAGL0K04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448423.1"
                     /db_xref="GeneID:2890002"
     CDS             complement(432032..432340)
                     /locus_tag="CAGL0K04543g"
                     /note="highly similar to uniprot|P32914 Saccharomyces
                     cerevisiae YGR063c transcription initiation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448423.1"
                     /db_xref="GeneID:2890002"
                     /db_xref="GOA:Q6FMX1"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /translation="MSSERACMLCGIVQTTNEFGRVGCPNCQGIFEEAGVSTMECTSP
                     SFEGLVGMCKPTKSWVAKWLSVDANIPGMYAVKVDGRLPPEVVELLPHYKPRDGSQVE
                     "
     gene            complement(<432738..>434600)
                     /locus_tag="CAGL0K04565g"
                     /db_xref="GeneID:2890003"
     mRNA            complement(<432738..>434600)
                     /locus_tag="CAGL0K04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448424.1"
                     /db_xref="GeneID:2890003"
     CDS             complement(432738..434600)
                     /locus_tag="CAGL0K04565g"
                     /inference="similar to AA sequence:UniProtKB:P53241"
                     /note="similar to uniprot|P53241 Saccharomyces cerevisiae
                     YGR065c Vitamin H transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448424.1"
                     /db_xref="GeneID:2890003"
                     /db_xref="GOA:Q6FMX0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FMX0"
                     /translation="MSISKVLKKVIPTVRILPEEMDDVSSTTSVASDLSSVEEIGTEV
                     VAKKDDNDKEQNTHGLNNVKKTQIEYTVESDIEDCSDSESDNAGYNAKHINLKKDMPY
                     ELRDEAKRSKWNFFYEYEYRFNKEYRKSRRWYEFLYPNHATKSKAERRLLYKIDFLIG
                     FYFLVVSWTRSVDSANYVNAYVSNMKEDLHMGGNDYVYTSTISTIGQIVFQIPFMYLM
                     PRVPPHYLLPFMDLGWSAFTLACFRAKTLKEMQGYRFMVGSFGAAYYPVSQYIFGSWY
                     APDELTSRVLLFSYGQLLGSVTSGLLQAKIFKSLDGVCGLAGWRWMFLIDAIAISIPT
                     AIMGFFLIPGIPSKCYSLFLTDEEIRIARARNRRNNITDGVDKSKLVPLYKPALWKKV
                     LFNPTFWILAIFDMLSWNVMTIYTGSYTQWLKSNPNYSIVKVNNLSALPACLGFIYIT
                     VCALGSDLFRSKWFFMVFAQAMNCISCGILMKWDVAESTKWFAFLISYFCIGASACLW
                     TFINDFLRFDPQIKAMSWICNYMFSQSSHAWIPMLAWKTVDSPRYKTGYTVSLVFSIL
                     YGLWTFVVLFFYKNNEKKHALDNGIILYDSSKGENPPAFVNEHMREEDGYFFVK"
     gene            <437099..>438263
                     /locus_tag="CAGL0K04587g"
                     /db_xref="GeneID:2890004"
     mRNA            join(<437099..437231,438004..>438263)
                     /locus_tag="CAGL0K04587g"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_448425.1"
                     /db_xref="GeneID:2890004"
     CDS             join(437099..437231,438004..438263)
                     /locus_tag="CAGL0K04587g"
                     /note="highly similar to uniprot|Q3E7Y3 Saccharomyces
                     cerevisiae YLR367w RPS24B and highly similar to
                     uniprot|P0C0W1 Saccharomyces cerevisiae YJL190c RPS24A"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_448425.1"
                     /db_xref="GeneID:2890004"
                     /db_xref="GOA:Q6FMW9"
                     /db_xref="InterPro:IPR000630"
                     /translation="MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQRH
                     GYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<438628..>440457)
                     /locus_tag="CAGL0K04609g"
                     /db_xref="GeneID:2890005"
     mRNA            complement(<438628..>440457)
                     /locus_tag="CAGL0K04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448426.1"
                     /db_xref="GeneID:2890005"
     CDS             complement(438628..440457)
                     /locus_tag="CAGL0K04609g"
                     /note="highly similar to uniprot|P53241 Saccharomyces
                     cerevisiae YGR065c H+/biotin symporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448426.1"
                     /db_xref="GeneID:2890005"
                     /db_xref="GOA:Q6FMW8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW8"
                     /translation="MGIKWKKFIPHLRVLPEDLEGDVSSDNNSSIEEHIHHDDSKSID
                     DDKYHESHVVYAVDTSSNNANGKSSLPINSAHGSVKLQKGIPYELRDEANKSRWKFFD
                     EYEYRLNKEYRKSRKWYEFLYPNHISQSKAERRLLYKLDIIVALYFLIVNWSRSVDSS
                     NYTNAYVSHMKEDLHFKGNDYIYTSTIANVGSIVFQLPFIYILPRFPAHYVLPIMDFG
                     WSWFTFACYRAKSLPELRAYRFILSSFGAAYYPVAQYLMGCWYAPDEISSRVCLFFCG
                     QLLGSVTSGLLQARIFKSLNGVHGLAGWRWMFLIDAIAISIPTAILGFFVIPGIPSKC
                     YSLFLTDEEIRIARARNKRNQIVDGVDRSKLPHIWSWKVWKKVFFTPTFWVLVIFDLC
                     SWNNMTAYSGSYTLWLKSNTSYSIEKVNNLSVLPACLGFAFVFFCAFGSDLFRNKWPF
                     MVFSQCMNCISCAILIKWDVASSTKWFAFLITYFSVAASPCLWSFINDFLRHDPQVKA
                     ITWIAIYSISQSTYAWIPTLTWKTVDAPRFKTGYIASLIFSAIYGLWTFVVLFFYKRN
                     EKKNALGNGIILYNSSKGESPPTFVETDMVLKNGYYYVKEDCE"
     gene            complement(<441550..>444591)
                     /locus_tag="CAGL0K04631g"
                     /db_xref="GeneID:2890006"
     mRNA            complement(<441550..>444591)
                     /locus_tag="CAGL0K04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448427.1"
                     /db_xref="GeneID:2890006"
     CDS             complement(441550..444591)
                     /locus_tag="CAGL0K04631g"
                     /note="some similarities with uniprot|P53243 Saccharomyces
                     cerevisiae YGR067c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448427.1"
                     /db_xref="GeneID:2890006"
                     /db_xref="GOA:Q6FMW7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW7"
                     /translation="MQDQPTGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQV
                     CSHSFVRRDLLQRHIRTVHRILLLRDTGAPSQENEKDATFNVNNVDKLINSMIIVNNT
                     VNVGNSTLDSNDTDSSNAQIGATGDHVDQTDDNNGKVTHYTFQPENGKLPQGQATDGQ
                     KVRSNSVASENRQSQRVSNGYNVKNRVKSKFLSFKQKDLTFGEHGDEAGIISIDYTNN
                     LVLSNFSESDISMIIESVESNPNLELLLLIIHIMERKYPHAETSKRILTRVLSFTGIT
                     FIESKLIAAIQVRYSLLSQRDENLLKFYSLYQDQILEFNDFSVFNLNQWTCLSDFLNA
                     SKNQNALVIYQQFKRKFLLDKKSILMPYEILNLLDIESKKKLRNLNNLDYFTNLTYWE
                     SVLLNDNNFDLLIQLNKNYMRVFENGQQSNLYCLTSFNSKPDGKHCYNYRILSESNWL
                     LLKLLCWNKDVNLQDSLNSVKHDICNALIPLMNTLIDSRERLFSIKNDNSKISLIIDA
                     LFFQLELFSVQLLPKTQENMEGISEFLCNESLQKLIYFWYMTITKTFGKFKTNDKRLK
                     LIKQFINSYIKSNTLISGNKKRKLNSGSGTDSPSHEENLKRLEDDLSVILYDMWSNEY
                     QGYHFLIDTVVKCIKDDLIEARVLQILDNDCEDVKVKLIDAALRAINNIEFAIKSSES
                     QYVSTLKHRRGSTSKSIALPISHDKPSPSLSLQRAMDQSTTYIDKSRLSTGSTQNSNH
                     LSTNSTPTRESFDWSGNSSSMYLTSPRVENLPRVRNSISGGMIGNGGRGFRSSNSKIV
                     LPPINLSAIHNPSGSPTTSRGSNSTIDGGHSSYVYGNVLMSPQSSVDHNTLPNSTTNH
                     NHNNQNTRLASMPESRPAGWGSDPTKDASGTSSTRIGIDVGTTAPNNFTYGILSGYSM
                     GESVNMQSNAASSHVRNKNNESALEPKDKSQVHLQTPKSLDNLLKDGSYDRSRKNSLM
                     DGNAVLSPNYQGKSAQSNDEVQKDRKIRLPPPSEILNTAST"
     gene            complement(<446732..>448486)
                     /locus_tag="CAGL0K04653g"
                     /db_xref="GeneID:2890007"
     mRNA            complement(<446732..>448486)
                     /locus_tag="CAGL0K04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448428.1"
                     /db_xref="GeneID:2890007"
     CDS             complement(446732..448486)
                     /locus_tag="CAGL0K04653g"
                     /inference="similar to AA sequence:UniProtKB:P53244"
                     /note="similar to uniprot|P53244 Saccharomyces cerevisiae
                     YGR068c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448428.1"
                     /db_xref="GeneID:2890007"
                     /db_xref="GOA:Q6FMW6"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW6"
                     /translation="MFSLKNLDKRLYDSHGRKKRKKKLVYIDVRTNSIYKDMILIQGT
                     PLESPPIPLSGNVVFSVSDNVKVKRIKLRLVCHYKLDFVQLVHDDMASIVKERTKILE
                     CTWANLLKNSEGETQFDFTKVHKSTKKKTGLLRGIKIWNTSDGDYSSGHHGTSASESV
                     ASSHSTGHTSSEHGKWYQAGNYEVPFQVQLPNDIPETIEGLQSGSILYNFILEIETEE
                     RNNKVDVTNKYNFYKYLRILRTLSMNHIAIQEEMMVSNTIRNMLQYQISIPSRAVSIG
                     DESMIGLSIKLIPFEKSYYQLDKIMVGLVQEYCVKDRHDEEYVDSSTINPITIASFRD
                     IEGIVPDTNELIDSTELKIQYEMPKNLKSITQDCDIMIGDERLGIKKQVMYVRHELSV
                     RIKFIKLKDDNKPLEIKLRLPVLLYVSPMKKLLGRRVYFNESTGRIHFRANDYVPLFT
                     PNTGNSTSLNQIGLNSAAGDSQGQSDVRDGSQEVPPPLYSEIDQDIVYTGDNVESQLF
                     VESTRRDGRNRDSDEIQMETNPGSQLRHYSSNDSNGYMRNQNQPVVATQPPVDTSTPT
                     YEEAQSATVEQRPAPTYE"
     gene            <455284..>455718
                     /locus_tag="CAGL0K04675g"
                     /db_xref="GeneID:2890008"
     mRNA            <455284..>455718
                     /locus_tag="CAGL0K04675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448429.1"
                     /db_xref="GeneID:2890008"
     CDS             455284..455718
                     /locus_tag="CAGL0K04675g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448429.1"
                     /db_xref="GeneID:2890008"
                     /db_xref="GOA:Q6FMW5"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW5"
                     /translation="MFLLSFLLFPANCSFWSQKSKRVSFAFFRNTPVLVAQKKKKFIP
                     LFRFENTLKNILEFISDDWNSLLWKKCRSILIYLFYTRYSSIKEVATLSVVFKLQRSQ
                     KTVPSATTTTITTKIPPLCSLFAMTWRQTGIVLYFQSPCLRT"
     gene            <459195..>460742
                     /locus_tag="CAGL0K04697g"
                     /db_xref="GeneID:2890009"
     mRNA            <459195..>460742
                     /locus_tag="CAGL0K04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448430.1"
                     /db_xref="GeneID:2890009"
     CDS             459195..460742
                     /locus_tag="CAGL0K04697g"
                     /note="some similarities with uniprot|Q07351 Saccharomyces
                     cerevisiae YDL048c STP4 or uniprot|Q05937 Saccharomyces
                     cerevisiae YLR375w STP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448430.1"
                     /db_xref="GeneID:2890009"
                     /db_xref="GOA:Q6FMW4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW4"
                     /translation="MTSVLSTIKILDTKTLNTVSEERSKSMHTNNFFTGNSTNSTLSP
                     TNSIIQNSQQTIISALTPQATNNYTTQTSVNCQNDSRYSYYNSASVIDRPKLKLPPIS
                     SLDNFVKTNIYNDSRLRNDTRMVRTVSVPYSATYDKKQVNPQIAPNNTSTQGAPTHAV
                     NRNVYTTDYRPLIKSEFSPTSLPTYLPLDTNTSRRESVYLATLKSSSSSPTPSCGSAI
                     KNSPPTYHMCPNILPSSDTCSSTNSSTTTNVSYRTSYYLPSNNTSFRSVSFTNKNVNT
                     SNESLTEINTLAGSIPNTTLPSSNNMTLQEINLKKALLADYSKTKKKRQCPICHKYFA
                     NLSTHKSTHLTSQDRPHKCIICQSGFARNNDLIRHRKRHWKDDIQNIANLGNTNQQCQ
                     NTIQGQRALKKNQLIQLHQIKCAFKCPYNANLIEVDLELNSPETSNSVLEFTPMDCHP
                     TGVFSRCDTFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHVGKS
                     CGFRYHS"
     gene            complement(<462359..>462817)
                     /locus_tag="CAGL0K04719g"
                     /db_xref="GeneID:2890010"
     mRNA            complement(<462359..>462817)
                     /locus_tag="CAGL0K04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448431.1"
                     /db_xref="GeneID:2890010"
     CDS             complement(462359..462817)
                     /locus_tag="CAGL0K04719g"
                     /note="weakly similar to uniprot|P40159 Saccharomyces
                     cerevisiae YNL208w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448431.1"
                     /db_xref="GeneID:2890010"
                     /db_xref="GOA:Q6FMW3"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW3"
                     /translation="MCEEEREREREREHHHNHHHGGDALAAIAGGLAGAYAGSHLSSG
                     HKKMGGALGAIGGAILGEKLAEHSHHKHHGQEYRDDGPSYNNPPPPMNNMGFAPQDNY
                     RRENNNDYQYDRRGGPARNEYDNYQYSDGQQTYGRPPQGYPGEHQGRQGW"
     gene            complement(<463860..>465701)
                     /locus_tag="CAGL0K04741g"
                     /db_xref="GeneID:2890011"
     mRNA            complement(<463860..>465701)
                     /locus_tag="CAGL0K04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448432.1"
                     /db_xref="GeneID:2890011"
     CDS             complement(463860..465701)
                     /locus_tag="CAGL0K04741g"
                     /note="highly similar to uniprot|P40150 Saccharomyces
                     cerevisiae YNL209w SSB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448432.1"
                     /db_xref="GeneID:2890011"
                     /db_xref="GOA:Q876N3"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MADGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDGA
                     PVIEVEYLGENKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGG
                     VYTVKSTSGNTHLGGQDFDTNLLEHFKGEFKKKTGLDISNDARALRRLRTAAERAKRT
                     LSSVTQTTVEVDSLFEGEDFEASLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQI
                     DEVVLVGGSTRIPKVQKLLSDYFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDET
                     KDLLLLDVAPLSLGVGMQGDIFGVVVPRNTTVPTIKRRTFTTVGDNQTTVQFPVYQGE
                     RVNCKENTLLGEFDLKNIPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITIS
                     NAVGRLSSEDIEKMVNQAEEFKAADEAFAKRHEAKQRLESYVASIEQTVTDPVLSSKL
                     KRGSKTKIEAALADALSALQIEDGSAEEYRKAEVGLKRVVTKAMSSR"
     gene            <466599..>466856
                     /locus_tag="CAGL0K04785g"
                     /db_xref="GeneID:2890013"
     mRNA            <466599..>466856
                     /locus_tag="CAGL0K04785g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448434.1"
                     /db_xref="GeneID:2890013"
     CDS             466599..466856
                     /locus_tag="CAGL0K04785g"
                     /inference="similar to AA sequence:UniProtKB:P53869"
                     /note="similar to uniprot|P53869 Saccharomyces cerevisiae
                     YNL211c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448434.1"
                     /db_xref="GeneID:2890013"
                     /db_xref="GOA:Q6FMW0"
                     /db_xref="InterPro:IPR020301"
                     /db_xref="UniProtKB/TrEMBL:Q6FMW0"
                     /translation="MRPPRNLEEWLYCKLLESEGFHRFVRKVYNKVNGIKETPLQHQA
                     NPSEFLYKPTRLHKFRAYRILFWDEMRASLNLPKKSSKFLK"
     gene            complement(<467118..>469508)
                     /locus_tag="CAGL0K04807g"
                     /db_xref="GeneID:2890014"
     mRNA            complement(<467118..>469508)
                     /locus_tag="CAGL0K04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448435.1"
                     /db_xref="GeneID:2890014"
     CDS             complement(467118..469508)
                     /locus_tag="CAGL0K04807g"
                     /inference="similar to AA sequence:UniProtKB:P40157"
                     /note="similar to uniprot|P40157 Saccharomyces cerevisiae
                     YNL212w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448435.1"
                     /db_xref="GeneID:2890014"
                     /db_xref="GOA:Q6FMV9"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV9"
                     /translation="MNIIKKFMQLGEKQEISMIPSGEFNLLRSRKSPKSSLECIYNDA
                     MLRIRKNGDWNFELVVNKIVEVGDNNNGDDSSDYTDDSVSVLSVASKRREEEWNFELK
                     KDLNFSKEWNKNGDAAFVWGNTLGDEEVEKVQFVITPQLSLTEIENFLLTVYRCMYEA
                     EHKKSASHVSREQLYKYRPEPPKELFVTESDSYDEENLGVSLSEVNPSQDNTSDNDDL
                     FVDAPDNLDSKAKGKKIKTPKKDKTKASSSSSEEHKENNKGVEGEKLCLLNAKVFVYD
                     PFEEKFMIQEENVPIALVQSGKYEFWLSMEGKDVDFGLAVSPQANPSFTLSNNSFTFN
                     YTVSRITLSYKIEFNDFKDFTIFENCWSKCIWMALNKKDWEELPKNEQKYIEDSIIAD
                     LERDLDTILKLDDEEEESEDEEDNEYSKSVVSSEAFEDPNSGSNKSNSSKGNSSLTVA
                     FRGNRSYVVRDDKIGVFKVDDDDDLEFVSAIKNISDKNKKILDPKDPMMYMEDRFMVL
                     SDSKNGDKLYKMDIERGKIVDEWEFKDKNVVQYAPTKKFDQLVAEQTLLGISDKSVFK
                     IDPRINTKNKIVQDESKDYASKYNFSSLATTKDGYVAVGSKRGDIRLYDRLGIRAKTL
                     IPSLGQAIKYITVSGDGRWLLATCDASLLLMDLSIKSGKNAGNISFLKSTPASENNKT
                     YILQISPEHATHILNYTKKPLCFTKAYFNTGINQKEDRILTSNGPFAISWSMKKVLAG
                     DEKPYKLDWYDSTVIENNFEYNNKQNVIVALKNDVSLSKIKHFKNVNKSIFKNEPK"
     gene            <469984..>470607
                     /locus_tag="CAGL0K04829g"
                     /db_xref="GeneID:2890015"
     mRNA            <469984..>470607
                     /locus_tag="CAGL0K04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448436.1"
                     /db_xref="GeneID:2890015"
     CDS             469984..470607
                     /locus_tag="CAGL0K04829g"
                     /inference="similar to AA sequence:UniProtKB:P40156"
                     /note="similar to uniprot|P40156 Saccharomyces cerevisiae
                     YNL213c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448436.1"
                     /db_xref="GeneID:2890015"
                     /db_xref="GOA:Q6FMV8"
                     /db_xref="InterPro:IPR010487"
                     /translation="MLIKVPTAVRLYSVKRTPIKPFKEVLKRIQPSNTELSEKSKKNN
                     IPEWKKQIISVKKKIGNERWSPSKRLSREEIESVRLLKRSFANITNTELSERFKVSPE
                     AIRRILKSNWEPNDEEWEKVQKRWQRRGERIKELYANGGNISSNGHQVVENLVPHKKV
                     IISSGRHMNTFDVIEKKVRSTKPTISIKDQKLKDKKLKLLEISATKR"
     gene            complement(<470774..>471409)
                     /locus_tag="CAGL0K04851g"
                     /db_xref="GeneID:2890016"
     mRNA            complement(<470774..>471409)
                     /locus_tag="CAGL0K04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448437.1"
                     /db_xref="GeneID:2890016"
     CDS             complement(470774..471409)
                     /locus_tag="CAGL0K04851g"
                     /note="weakly similar to uniprot|P40155 Saccharomyces
                     cerevisiae YNL214w Peroxisomal membrane protein PEX17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448437.1"
                     /db_xref="GeneID:2890016"
                     /db_xref="GOA:Q6FMV7"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV7"
                     /translation="MAYQESESIQWPDPQRIRNYKARNKTIRTIQSIFSNTGLLFTIF
                     YVAVSTIVQPSLERQYNQRIELTAGALLEVRRLTNKLLRRLKSKNSSELELRSNTQEY
                     ADRCTQTESRYITDDFESDDDMHNDSDDNSITWNIISKKLVEVKDSLNRYNESCDRPS
                     INMENLTFQSKLVVDQLSVAKDADKLGELSRTSVNNIREMKGWFVNGLVSL"
     gene            complement(<471872..>473896)
                     /locus_tag="CAGL0K04873g"
                     /db_xref="GeneID:2890495"
     mRNA            complement(<471872..>473896)
                     /locus_tag="CAGL0K04873g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448438.1"
                     /db_xref="GeneID:2890495"
     CDS             complement(471872..473896)
                     /locus_tag="CAGL0K04873g"
                     /note="some similarities with uniprot|Q07684 Saccharomyces
                     cerevisiae YDL233w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448438.1"
                     /db_xref="GeneID:2890495"
                     /db_xref="GOA:Q6FMV6"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV6"
                     /translation="MKNNSGLDDVKMAGVKVRNPTTGFNSTYIAKNHDIPTSFTTADV
                     GSHKSGSVNGSSPGAAFTLRGTPILGNSTTVSSNNNNKHITGTRQSPSSKLNNNNHYM
                     QAMTTQHLLHQQLKTKQNFQMQENSAQEAMKRQLNEGQGQGQYVPSSSVSNKSQTAQA
                     EPPQPRSSDTPASFEIETKDSPDYESYESGTTIPLNISLASTHPGENNSLKSNPTSSK
                     EVADKTTESNSNFNTGAFASDIKMKNRETNKSHSNKTSTSVSAHSTPLDNGKESNKNF
                     KDLGKPSRNNTNIGSDSSQGNGSERLPLNMDPAKQRYFLFQQQQQQMNKTLSFIHSYR
                     VRKYIANMANLRLYELVGILNRSAGQIGNPEYWNKFVSDVFVSNGLINFSRKLDNNFK
                     QFQFYSALLPMFAIASAELGLVRIETVIQQLITQVLSNGTIFFNCPRCTFTYHYSDGS
                     YVTHFTQLKGIFNRNFKIEWIDVCLHSFVPGVEWSFLEALVSDSNRSKEIFEKLSQDK
                     NQTDEEIKSGRSQNNFDAIMKLRSYFKVFKNLSIFGIPDDIIRKMQMGHVMSTLKNVM
                     IYDKQQALQNGLDGKRNPFDSYVSYVEEKYKPGPEGKDFEASEMQSNSGTPTANDTTT
                     RKRPYPPDGTSNTHDQIHSSTPSSAEILASIDIDAKRRRHSGISPRSTDS"
     gene            complement(<475558..>476625)
                     /locus_tag="CAGL0K04895g"
                     /db_xref="GeneID:2890496"
     mRNA            complement(<475558..>476625)
                     /locus_tag="CAGL0K04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448439.1"
                     /db_xref="GeneID:2890496"
     CDS             complement(475558..476625)
                     /locus_tag="CAGL0K04895g"
                     /inference="similar to AA sequence:UniProtKB:P40154"
                     /note="similar to uniprot|P40154 Saccharomyces cerevisiae
                     YNL215w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448439.1"
                     /db_xref="GeneID:2890496"
                     /db_xref="GOA:Q6FMV5"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="InterPro:IPR029523"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV5"
                     /translation="MDSELSDIELSNSRPSSIEDEDLYQEEEEEYQDAMDEDDEYNDD
                     GADDNDEEYIEGREAEIKKPKIATKQTIRPPVKKSERISSKRTAATGLQRVRPKRAVT
                     DKEVNYSEDSTSVDKAIEAAEAADEKEQELDQDAVNVDVDVEEEDDEEIRSPAKKRQR
                     TVLEDEEDAQTSTANNSGSEQLPEEDEEEDNGGISDSLRSDFSNGNGGENGIQEDLDA
                     EDNMSTPAGDEDNEEVEARENTEDASIIPSNLLPKNKMLISILDDNPFKKKLTEEEIQ
                     LRRAENARKRKNLSEKRLEEEKRETLNKLLKKRAGKSRSKVDKDEPENTASTIKPRRP
                     YNSNGMVRIIRKRDEDLYCIF"
     gene            complement(<477054..>479117)
                     /locus_tag="CAGL0K04917g"
                     /db_xref="GeneID:2890130"
     mRNA            complement(<477054..>479117)
                     /locus_tag="CAGL0K04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448440.1"
                     /db_xref="GeneID:2890130"
     CDS             complement(477054..479117)
                     /locus_tag="CAGL0K04917g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448440.1"
                     /db_xref="GeneID:2890130"
                     /db_xref="GOA:F2Z6A0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:F2Z6A0"
                     /translation="MSANDSEQFDTAPNEFVDALETNIHIDPPNQAQSKIDESSRKEK
                     NNNDLGVEMTSVDPALTGEDMNEAHTKETAAEQNGEKGIFNGMVFYLNRDSNAHDSII
                     IVEQLKNLILLNGGDIVNKLPNKDSAEAKHIIVVSPYNNTELKTVTSTFIRACVQSNK
                     LLDMKNYLVPYDSFNALLDDAMSPPSRQEPTISESSSVNEGQPTASKPPPQNIANKRD
                     IPTKKVSANTGVSKTSFTEEEDEFILDVVRKNPMRRTTHTLFDEISHYVPNHTGNSIR
                     HRFRVHLSKRLDFVYQVDQYGKLVRDENGNLIKTKVLPPSIKKKFTADEDYELAIAIK
                     QQFYKDIYQLDPVTGQSLISDNDPPARVAKRQMMMDPNVQRGSEPPFSKYRVGTRRGP
                     IAREFFKQFTENHPTHTESAWRDRFRKFLLEYGVDKYIEYYETQKANNDEPEAMKNLT
                     IRTKRDNFPTPGNYGNAAKRQKYEVSSNVENTLKSKGQAGDIPDAELLDEDTMKFISS
                     LKNDLSKIDNNFGFDYTNEIAEAIRNDFSEEEAIYDNIDPNTIPFPPPIATIDLFLPQ
                     FFRMSSTQEFIEKIREIIQRDYEPSQAELLMQDLNDEAGIRKTFTSSILGSLSGDLMV
                     LPRYFLNMFSKNQNPPIDIPGIWTSGDDDILRRGDEAEVSKLVKRQGAGRVEMRKKFL
                     ERNLI"
     gene            complement(<479758..>480720)
                     /locus_tag="CAGL0K04939g"
                     /db_xref="GeneID:2890497"
     mRNA            complement(<479758..>480720)
                     /locus_tag="CAGL0K04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448441.1"
                     /db_xref="GeneID:2890497"
     CDS             complement(479758..480720)
                     /locus_tag="CAGL0K04939g"
                     /note="weakly similar to uniprot|P40152 Saccharomyces
                     cerevisiae YNL217w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448441.1"
                     /db_xref="GeneID:2890497"
                     /db_xref="GOA:Q6FMV3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV3"
                     /translation="MIPRRIAVLILSLAIILVFFCSFLIDMSENNDNVNTGVRVLKSM
                     LDSPTLRALSVPEEHHDRQLVFIGDVHGMYDKLLELVDKLNFETTPEMELVFLGDFIT
                     KGPDSTKVLDWMIKHEGRVHFVLGNNEFSVIMGALDMGLLESKMLNNEQGHDVTGTFK
                     KSHAELAQQLNPSHYTYLFKNAAVVLEFDMEKTRQRFIAVHAGILPQDYDFERRHVIL
                     KSDVFSILNMKFVNEENSMETSREKQTKHWKRWYKLWEKELDNHHTKEQITILYGHDA
                     KKGLNLRKYTKGLDSACVKGGKLSAMHYMYDPHSNSYKETLVEV"
     gene            <481708..>482193
                     /locus_tag="CAGL0K04961g"
                     /db_xref="GeneID:2890498"
     mRNA            <481708..>482193
                     /locus_tag="CAGL0K04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448442.1"
                     /db_xref="GeneID:2890498"
     CDS             481708..482193
                     /locus_tag="CAGL0K04961g"
                     /inference="similar to AA sequence:UniProtKB:Q07688"
                     /note="similar to uniprot|Q07688 Saccharomyces cerevisiae
                     YDL235c phosphorus-containing groups transferase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448442.1"
                     /db_xref="GeneID:2890498"
                     /db_xref="GOA:Q6FMV2"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV2"
                     /translation="MTTVPSEIIDWTILNEIVSMDEDDPDFSKGLIIQYIDQATTTFS
                     EMDNLLGSIDNLKELDNLGHFLKGSSAALGLQRIAWACERIQNLGRKAEDSFPERTDI
                     LKNLPDKVSVDEEDKKEEKEEVPQDDKKYLYLIKKALAQARIEFKLARRELSDYYKTE
                     L"
     gene            complement(<483181..>484860)
                     /locus_tag="CAGL0K04983g"
                     /db_xref="GeneID:2890499"
     mRNA            complement(<483181..>484860)
                     /locus_tag="CAGL0K04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448443.1"
                     /db_xref="GeneID:2890499"
     CDS             complement(483181..484860)
                     /locus_tag="CAGL0K04983g"
                     /note="highly similar to uniprot|P40151 Saccharomyces
                     cerevisiae YNL218w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448443.1"
                     /db_xref="GeneID:2890499"
                     /db_xref="GOA:Q6FMV1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR021886"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV1"
                     /translation="MQSSGKEISQLIACPVCNEKIQFAKINSHLDNCTTGKAQNGQKS
                     ITSILGNSNKRKYDTADKASEIIDLDNENNADIPQKKIKIESTENTTNTTNTTNTIKS
                     SDYEFRYLQKISHLPLSEKLRPKEIRDYVGQQHILSQESGVLNKYVQEGLVPSMILWG
                     PPGVGKTTLARLLTKTASLHGSRYTMVETSATKANAQELRSIFEKGRKEYQLTKRRVV
                     LFIDEIHRFNKAQQDLLLPHVENGDIVLIGATTENPSFQLNNALISRCHVFVLEKLSE
                     TEVIIILSRGVALLNKLRNVIWNVKNPLKLSRSILVYLCDISVGDARRALNLLEMIEV
                     STRHVEKELTIEQIREIIKNNNSQGLNTYYDTKGDNHYDTISAFHKAVRGSDENASLY
                     YLGRMLQGGEDPLYIARRMIRIASEDIGIRDNSMLPLAIAAHDAVMKLGLPEADMALV
                     QCCVSLARAPKSVEIYRAWKNLRGMLAENKYNLASSEVPMHIRNAPTRLMEELGYHKG
                     YKYNPDYKDGIAKQDYFPQEVLDKCEDPNELKFLTGEHFGTKTDPDLNENK"
     gene            <485646..>487322
                     /locus_tag="CAGL0K05005g"
                     /db_xref="GeneID:2890500"
     mRNA            <485646..>487322
                     /locus_tag="CAGL0K05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448444.1"
                     /db_xref="GeneID:2890500"
     CDS             485646..487322
                     /locus_tag="CAGL0K05005g"
                     /inference="similar to AA sequence:UniProtKB:P53868"
                     /note="similar to uniprot|P53868 Saccharomyces cerevisiae
                     YNL219c ALG9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448444.1"
                     /db_xref="GeneID:2890500"
                     /db_xref="GOA:Q6FMV0"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:Q6FMV0"
                     /translation="MNNKYCTFVLVVLLVATRLYIQPFYSLISDCDETFNYWEPLNLL
                     LRGFGKQTWEYSPEYSIRSWSFLLPFYSLLYPLNAVAEIQANWNFYAVRILLGLFSLI
                     QEWKLFKEITGTTTLEIANFWLFYQLFNPGWFHASVELLPSAIAMILQLGSINYALKY
                     LSTSASSNFIGSLTFNMIAGILGWPFVLVLNLPLCIHYVWTHRIISSVRTAFDCSLIF
                     LLISVIVIGIDSLFYGKFAPVAWNIFFYNVLNADEEAGPNIFGTEPFSYYIQNLLLNF
                     PITTLGFAVLGVSHWRLWPLWTSAIVWFTVFALQPHKEERFLYPLYGYISLSASILTY
                     KALKVYKKYFSFAFVVKLIIVGTVILQSLLRIFALIENYRAPMTVYSELFSRESTSNS
                     TVNVCTGREWYHFPNSFYLPNAHRLRFVKSGFDGLLPGDFIEDESIFTAVRAVPKGMN
                     NRNMFDESKIWPLEECDYFVDITLPTDGEKDSFTGSNSANRWNAVVCQKFIDGSDSKF
                     LGRAFAVPEIIDCMMKEYIPELWTKLYHAKYIDYCLYEKLPSSEYQVNAD"
     gene            complement(<487675..>488973)
                     /locus_tag="CAGL0K05027g"
                     /db_xref="GeneID:2890501"
     mRNA            complement(<487675..>488973)
                     /locus_tag="CAGL0K05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448445.1"
                     /db_xref="GeneID:2890501"
     CDS             complement(487675..488973)
                     /locus_tag="CAGL0K05027g"
                     /note="highly similar to uniprot|P80210 Saccharomyces
                     cerevisiae YNL220w Adenylosuccinate synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448445.1"
                     /db_xref="GeneID:2890501"
                     /db_xref="GOA:Q6FMU9"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVNVVLGSQWGDEGKGKLVDILVSHYDVVARCAGGNNAGHTIVV
                     DGVKYDFHMLPSGLVNPNCKNLLGNGVVIHIPSFFKELETLESKGLNDARGRLFISSR
                     AHLVFDFHQRTDKLRELELAGRSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVNDN
                     PGAWELFESRYRRLLETRKQRYGDFDYDAEEELNRFKQYKESLKPFVVDSVDFLHKSI
                     ANNEKILVEGANALMLDIDFGTYPYVTSSNTGIGGVITGLGIPPQKIQEVYGVVKAYT
                     TRVGEGPFPTEQLNEQGEKLQSIGAEFGVTTGRKRRCGWLDLVLLKYSTLINGYTSLN
                     ITKLDVLDTFTEIPVGVSYKYKGETLNSFPEDLLTLGNVEVEYVTLPGWNQDITQIKK
                     YDDLPENAKKYLKFIEDFVKVPVQWVGTGPARDSMLEKQI"
     gene            <490007..>492580
                     /locus_tag="CAGL0K05049g"
                     /db_xref="GeneID:2890502"
     mRNA            <490007..>492580
                     /locus_tag="CAGL0K05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448446.1"
                     /db_xref="GeneID:2890502"
     CDS             490007..492580
                     /locus_tag="CAGL0K05049g"
                     /inference="similar to AA sequence:UniProtKB:P41812"
                     /note="similar to uniprot|P41812 Saccharomyces cerevisiae
                     YNL221c Ribonucleases P/MRP protein subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448446.1"
                     /db_xref="GeneID:2890502"
                     /db_xref="GOA:Q6FMU8"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU8"
                     /translation="MSGKKKLNDNQLFKRQKVRDARQIRTESIKNDREGDVSEAGGML
                     QVGNFINSRRYEIQSLQMAMKSSKSSSSTRVFQALPRKLRRRTASHNVRRIPKRMRNR
                     ALREMKKSNIDDNKGKNATTEKKPAKSKYKAHGLTKRQLYKIRMAIKLLRLASRSTSL
                     QLALPRNVTLKNTKIRNKINTLKKTIKSNSSRRLNSQALNNKMGSYDNIGINSLASAP
                     KMRVKYLKRQRFFTWLPSHIWNAKRSHMMKRWGYQIPWSPTQKCFKLTHRLGGSTAAS
                     DGALCMDSSFFGTMILEASNPESQNELDKLAGQLTANKVTKQKYKNGYKWYEGIFYDP
                     SQNFDNIIGIGEIMWITDSKLLIRLHPALYGKVFDELCATYSNKIKFTDSRFALASFT
                     VKGAKALTAIASVMRSAKPCESYKQLLSVAKLSDDSILPKYTMFAFDAIDPRYLSKPQ
                     LPNVTCDLNQITNNILNIQKSFPKEEISMVFNKLADSTSRYESYRNQHTLKMIAKKKS
                     IALRQNSNKTGTSNLLPFNDETDPKIPISIIKREKSDDWLVILPWFWFLPYWYQINKI
                     SKVYHIGLRQVQQLQYEKKQLYFPDDFPFTKQGYLENSVFKRESSYARWQRKPLGKRV
                     NYEKIRNIHSKCLPTIAGELGDPFSCDWKLLQILRNGLKFLSKQGTPIQYIDEKRTGQ
                     FDDNQNRIVRNVNDLFELYKDVKDNADIDSPTLPIQYRQGSKAYPAMDISKPDHILNV
                     PLSITPISATLIDKGRPSDNSRIYSIPDQDLNFWKQVAGGIYQANGKKLHEQQIPKPE
                     LTNLIGFATSGTFHLGLGRGMINGFIDSEALRDNKSRFVLIRNTGTDVYRLAKWESIS
                     I"
     gene            492841..493676
                     /gene="SNR19"
                     /locus_tag="CAGL0K05063r"
                     /db_xref="GeneID:2890503"
     ncRNA           492841..493676
                     /ncRNA_class="snRNA"
                     /gene="SNR19"
                     /locus_tag="CAGL0K05063r"
                     /product="U1 RNA"
                     /note="SNR19 (U1 RNA)"
                     /transcript_id="XR_002648370.1"
                     /db_xref="GeneID:2890503"
     gene            complement(<494132..>494746)
                     /locus_tag="CAGL0K05071g"
                     /db_xref="GeneID:2890504"
     mRNA            complement(<494132..>494746)
                     /locus_tag="CAGL0K05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448447.1"
                     /db_xref="GeneID:2890504"
     CDS             complement(494132..494746)
                     /locus_tag="CAGL0K05071g"
                     /note="highly similar to uniprot|P53538 Saccharomyces
                     cerevisiae YNL222w suppressor of cs mutant of SUA7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448447.1"
                     /db_xref="GeneID:2890504"
                     /db_xref="GOA:Q6FMU7"
                     /db_xref="InterPro:IPR006811"
                     /translation="MDQKQALKFCTVCASNNNRSMESHRILQEAGYEVSSYGTGSAVR
                     LPGLSFDKPNVYPFGTPYNDIYNDLLSQSAERYKANGLLQMLDRNRRLKKAPEKWQEG
                     TKTFDFVFTCEERCFDAVCEDLMNRGGRLNKIVHVINIDIRDDNENAKIGGRAILELA
                     NMLNEKVSECEQNDTLFEDCILDILTKWQEAHPQLPCLYAPSYY"
     gene            <495585..>497822
                     /locus_tag="CAGL0K05093g"
                     /db_xref="GeneID:2890505"
     mRNA            <495585..>497822
                     /locus_tag="CAGL0K05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448448.1"
                     /db_xref="GeneID:2890505"
     CDS             495585..497822
                     /locus_tag="CAGL0K05093g"
                     /note="highly similar to uniprot|P32795 Saccharomyces
                     cerevisiae YPR024w protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448448.1"
                     /db_xref="GeneID:2890505"
                     /db_xref="GOA:Q6FMU6"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU6"
                     /translation="MMLAGLPSVARTAMLRSVSVVGVRSVYSGRASLLRMCANRRYSD
                     MKKSGDEGATETSGAALGGGKSASANTNTTATTANSSANANANANANADASVSHALLA
                     TREQEANKDLTNPEAQATFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRI
                     GRHAEADSVRQNLLTASSAGAVNPSLASSSPGSSGYHTTFPSLYSPLYGSRKEPLHVV
                     VSESTFTVVSRWIKWVLFFGIFAYGVSEAFKYIAENTTLLKNSEVADKSVDVAKTNVK
                     FDDVRGCDEARAELEEIVDFLKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARATAGE
                     AGVDFFFMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKDQA
                     YAKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDVRGR
                     ADILKHHMKKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTHF
                     EWAKDKILMGAERKTMVLTEASRRATAYHEAGHAIMALYTNGATPLYKATILPRGRAL
                     GVTFQLPEMDKVDITKRECLARLDVCMGGKIAEEIIYGKENTTSGCGSDLQSATGTAR
                     AMVTQYGMCEDVGPVNLGDNWDSWSNNIKNTADNAVISILKESEERTRKLLEEKNEEL
                     HRLAQGLVEYETLDASEIEKICKGEPINKSKSSTNTVVEGPDSDERKDIGGGDKSKIP
                     TMLKV"
     gene            complement(<498091..>499194)
                     /locus_tag="CAGL0K05115g"
                     /db_xref="GeneID:2890506"
     mRNA            complement(<498091..>499194)
                     /locus_tag="CAGL0K05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448449.1"
                     /db_xref="GeneID:2890506"
     CDS             complement(498091..499194)
                     /locus_tag="CAGL0K05115g"
                     /inference="similar to AA sequence:UniProtKB:P37366"
                     /note="similar to uniprot|P37366 Saccharomyces cerevisiae
                     YPR025c Cyclin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448449.1"
                     /db_xref="GeneID:2890506"
                     /db_xref="GOA:Q6FMU5"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR027081"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU5"
                     /translation="MSESGVSTQSPQNSSTPDAKPVEHPPNYKRLTDDDLYRHSSQFR
                     LWSFTPDKLLQKRTETNARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKATPITTEE
                     ELKLVNFYAQKVQVIAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLA
                     CKSENYFISVNSFAEKAKATKETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKT
                     LHGKIDLKYMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLMIEDEALTTRYLELK
                     FHGQDAQTTDNTTDKSHSIHHINFERLLSVVQSCKEILEKPITISVQEAKGIMAKIYY
                     CENPEGLLNRLKREPPKDSEDSPAKKQKVLPPQ"
     gene            <500434..>504072
                     /locus_tag="CAGL0K05137g"
                     /db_xref="GeneID:2890507"
     mRNA            <500434..>504072
                     /locus_tag="CAGL0K05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448450.1"
                     /db_xref="GeneID:2890507"
     CDS             500434..504072
                     /locus_tag="CAGL0K05137g"
                     /inference="similar to AA sequence:UniProtKB:P48016"
                     /note="similar to uniprot|P48016 Saccharomyces cerevisiae
                     YPR026w Vacuolar acid trehalase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448450.1"
                     /db_xref="GeneID:2890507"
                     /db_xref="GOA:Q6FMU4"
                     /db_xref="InterPro:IPR005194"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU4"
                     /translation="MGFKDKILFWKDEVQYRTLAVADQVANRFFHSFENVYKGDESVE
                     DADSRPVGLTNETLSHSSDFFVLPEERISTRVKIRRQNILNTTLILGMLIALVIWTAI
                     LSTNSYFSSSLASASPLFNKEGRVVRPMRESNLGLHADPQTRKSSKTLYDLLSDFDNA
                     FYDDENMILGSLAFGENTYSRQPYVANGYIGSRIPNIGFGYALDTLNLYADAPGALNN
                     GWPLRNRRFAGSFVSDFYSLQAKLNSTNFPELDEKGYTTVISSIPEWTDLQFTVDLNG
                     TNWFNPQSVLIDDVINYNQNLSMKDGIVSTNMDWLNGMINIKSEVWAHRKIHSLGITR
                     LEISLNLDALPDEFTELPVTIYDIIDFNTSHRTTLYEKGQDEDNKAIYMIVNPENVPY
                     SNAVVYSTCTIKGTENNFSPYNFTSDDRIARNYMTNLTEENPKVVIYKYTSVVSSEYN
                     NDEPNPNVNLKFASNIANTAKGNYKSLLSNHKRAWYDLYNDAFIEIPSDSLLEMTARS
                     SLFHLLANTRQYNVSTTRGLPVGVGGLSSDSYGGMVFWDADVWMAPALLPFFPNIAMN
                     MNNYRNATHQQAIENAKQYNYPGAVYPWTSGRYANCTSTGPCIDYEYHINVDIALASF
                     SIYMNGAEGADEDYLRFTTWPMVKDAAVFFKAYVKYNETLGEYETYNLTDPDEFANHV
                     NNGAFTNAGIKTLLKWATDIGTHLGEEVDPKWMEIADNIHIPRSDSNITLEYSGMNSS
                     VEIKQADVTLMVYPLGYINDESILNNAIKDLYYYSERQSASGPAMTYPVFVAAAASLL
                     NHGSSSQSYLYKSVLPYLRSPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILF
                     GLTGLRYSYEVTPRTKKISRLLKFDPVKLPLLPGGIAIRNFKYMGQVLDIIIDDNNGT
                     IAHKGGDKPIRIKVPNRDILHDRNITSALYSKRDDDLSATDDYYGTYFTLYPNEELVI
                     PLYDTKLNIDGNIAESKQITNLTAGVPGDVGFSALDGNNYTHWQPFDKSDNAKLLIDL
                     GFNSTHVIKKGIILWGQRPAKNISLSVLPHSERIEQLFANITDLLETSSITKGGSLLN
                     QMLGQTQSNVTAEIDDDILALLNWKGDDLDQLIPYLPDMHLLQEKFIPILKDYPIKPN
                     QRYYKEIIDDDIIKLLPSNTTEFTIDYNSIPGGEKRARYVVLTVHGTYDDDDDLKGAT
                     IKEIVLQE"
     gene            complement(504318..504415)
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0K05159r"
                     /db_xref="GeneID:2890508"
     tRNA            complement(join(504318..504354,504378..504415))
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0K05159r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:2890508"
     gene            <505243..>505776
                     /locus_tag="CAGL0K05203g"
                     /db_xref="GeneID:2890509"
     mRNA            <505243..>505776
                     /locus_tag="CAGL0K05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448451.1"
                     /db_xref="GeneID:2890509"
     CDS             505243..505776
                     /locus_tag="CAGL0K05203g"
                     /note="highly similar to uniprot|Q12402 Saccharomyces
                     cerevisiae YPR028w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448451.1"
                     /db_xref="GeneID:2890509"
                     /db_xref="GOA:Q6FMU3"
                     /db_xref="InterPro:IPR004345"
                     /translation="MADVISSLQTQLKELDTKFAGNNVLNQLEQRTNLPKSYLVVGST
                     IFYLLLIFINVGGIGEILGNFAGFVIPAYYSILALKTTTTKDDTQLLTYWIVFSFLNV
                     IEFWSKALLYIIPFYWFLKTIFLLYIALPQTGGATMIYNRFISPLTDKYILGPKKTDG
                     VQQSVKEASRATGAATH"
     gene            complement(<505973..>508714)
                     /locus_tag="CAGL0K05225g"
                     /db_xref="GeneID:2890510"
     mRNA            complement(<505973..>508714)
                     /locus_tag="CAGL0K05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448452.1"
                     /db_xref="GeneID:2890510"
     CDS             complement(505973..508714)
                     /locus_tag="CAGL0K05225g"
                     /inference="similar to AA sequence:UniProtKB:Q12028"
                     /note="similar to uniprot|Q12028 Saccharomyces cerevisiae
                     YPR029c gamma-adaptin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448452.1"
                     /db_xref="GeneID:2890510"
                     /db_xref="GOA:Q6FMU2"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017107"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU2"
                     /translation="MMRRSSSKKGSSGTYNGSSSLRNFIKDVRNAKTLADERAIINKQ
                     AAKIRTKLRDDHLSSDKKRNNIIKLLYLYILGERTHFGQVECINLIASDQYIDKRLGY
                     LSTTLLLDESQDLLTLLTNLINNDLKHPNKYVVSLALTALGFLSSPELARDLYPDVEG
                     LLKTYSTDPYILKKALQCCAKLIAKDSQLLEIVPIDLFLTLLKEYRSSLTSLSAAHGV
                     LIGLSRLFQAIATAITNLVTPQETSESDPEDMAYRQNLAQQMIKIFSESSFLDDFYQV
                     LASLSSRNLDPQFDVQGVSDPFLQCEVITTLRLYFKAYHKLATEINQEQVDGFNDLLT
                     NIATNTDSTKSSGQAVLYEITRTIFDLQLPKPLQVLGINILGNFLSPRSVGGKKPTTA
                     VITAQNNTKYVALNMLLKVVPSEPEAVRRHRKFISRCLNDQDISIRMRALELTFAIMD
                     KDNLVELINEVLNFLAKSVMNNGSAKGGYSSSYKINSFGEDIDDSKDLIIFAVNHIVD
                     KFGEISEEQGENIDNNWRLSVFVKILKLVGSYIPVDRISDILIAFNNTLEVNYKTDVI
                     IRMLDISLREVMESTDKTTEDEFIEEGNLGWQLVSIWCIGEYGDIVLQALQSDSKLNE
                     TYGKTINEKTIVNYLKLKDTQYIRTNLKINHYVLTAALKLSVRIQDFALIEKLRQIIV
                     GQTKNTDLLLQAKATQYEIIFSQPESIRKQILDAMPQFERAVKTEKPVTSISHLDNGK
                     QSDRKHDPLLDLLGDTDVQDTKQQQKNNTNLLADLLLGENNNGIQSQGQTSKNNEDKL
                     TLPESCTLLQTIDCLEIYASKITKDDTSAHLEIYYKNNGDVEVSNLQCLVAVTKTLKV
                     VLGQLYPSVNIPANGIIKQTLKVSGTGNLKMRVKLSYSVGGSQQTQQFDHKFPELTL"
     gene            <509508..>513182
                     /locus_tag="CAGL0K05247g"
                     /db_xref="GeneID:2890511"
     mRNA            <509508..>513182
                     /locus_tag="CAGL0K05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448453.1"
                     /db_xref="GeneID:2890511"
     CDS             509508..513182
                     /locus_tag="CAGL0K05247g"
                     /note="some similarities with uniprot|P38167 Saccharomyces
                     cerevisiae YBL101c involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448453.1"
                     /db_xref="GeneID:2890511"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU1"
                     /translation="MLSHNYHSSNTTSARRSTGVPASPGTARSVIKSTLASLMDGPDM
                     QQRNYVLTSDTSAMKRSSSIPYGSQLAPPDGTRTRRHSIAEVTHRKRQPNLFAVNYLN
                     DFLMNRGFLPQRSLFHKDDCMTISMATTADPVFLPTTSIKDEEEYLSSISAPQRHEMQ
                     AHHSSSAAIAQEEDRDDYPPLNLDSADASTLTPAKKLNNPFLADLARGAPHYDTNPFL
                     NPPSIMDSLNENNDLSLASMDTLNTTPDQKKKTKRTHVSGSMTPMSIAVIVSIKEKPM
                     KMPRIIVNLSSNVSIHWYNGLPTNKSKYEEFYQLNSVNWKLSATNYNIYIPANSYSAD
                     DVQQNLDIDVIRDYVVFKNKKTSHRKYVENKASLNKELQDMLNATDSDDSKTSNSAES
                     SKSSSSQENDNSTISQSSETTSKGGNDRSTNNSNGQNELDDDELFMPGDYVFVIPVAF
                     ANRAPETLTMPSGRVFYRLKILTNAEAVDDNIAERLLNRPPLSTNASSNGAPVTISAN
                     DLDCFKSSGTMSHFSNVSTPPPLTVPPSSQLQACPPETFDSHLTPGQNYATSQHKARQ
                     LSLDYSNMHSNNNTLGTKNTRQRAHSSVDTNTMKEMRANRRGDQFESHQLSATNDMKT
                     DRRKRSGTNSWFKSIKDQFSTSVDNNTDTPDTKSLTGKISPISMSRKGSVTDQRRPSG
                     ELKANVEKNKYSIFIDEPINIVRMPPEQSLTTADKPVYVNKVWADSLAYEVSFGKKYV
                     PINSEVPLVIKLSPLVKDIEIKRIRVSVVETIKYSNINRKYEYDQLDPILKDPFSPYY
                     RDLIARKKKTRSLPLLEIRSREIGNKALCEEVVEGCLNDNLLSYSSVTDECTEFNRRK
                     NTTEKKTKSVPLIEPICVETTLKLPNHMDFDRTTAKNLPPYGIESFVSGNADDDWYSS
                     RQSSVFGFFKSQKSSNSVNSSPSKTMHKSRTKIFTEGGITVNTKTRHHESHRGLYLDS
                     SYFRNINSKHKLEIMLRIKKTDENDPTVAKNFEIVIDTPIYVVSEHCSNGNTELPTYN
                     MALSDSTKVMLASNNVPPPTFEEATSSYSSPFASPSASPRIAAIAGHYGGSYPDYSPL
                     DMSRSGSISVRSDLSVDTDLPNVDHLMASLPPVSTNNMIDSVRSTYNNLDGLLSSHSS
                     LANKRETSNRSGVDGFDTTSNNGSDMNKPRNFPIITVSAADELFKKDYSIMTTNGSGD
                     YPEPPKYETVVGGCDTQSNH"
     gene            <513673..>515958
                     /locus_tag="CAGL0K05269g"
                     /db_xref="GeneID:2890478"
     mRNA            <513673..>515958
                     /locus_tag="CAGL0K05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448454.1"
                     /db_xref="GeneID:2890478"
     CDS             513673..515958
                     /locus_tag="CAGL0K05269g"
                     /inference="similar to AA sequence:UniProtKB:Q12311"
                     /note="similar to uniprot|Q12311 Saccharomyces cerevisiae
                     YPR031w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448454.1"
                     /db_xref="GeneID:2890478"
                     /db_xref="GOA:Q6FMU0"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FMU0"
                     /translation="MSRASNDVGPKLREEKHFNDFYPDLDANDLIPILVSQETDQSQS
                     VDSQDEIIRKQHYKQLIFNGSITVEPITITKQATDVQQIPYPVNDFATFIDAKRYSKK
                     SVGNTLISKFYSQDHIQGKTKRRQQRIINAHDSDKIYKDKFMTHSNQIKRDKAIQSHF
                     EALSPNLSGFIPQYDMDEQDALYLEFLNQSLGEKYITAEVFEIIITILELEWYHLDKH
                     IPPKITDTNDSQLNSIQHHANKVRYELYGSDDGTGLTSDQACAVCDGTVSTTTNMIVF
                     CDGCDIAVHQECYGIVFIPEGQWLCRRCFISRNKQVNCVTCPSTTGAFKQTHTGSWAH
                     VLCALWIPELVFANLHYMEPIEGVENINKSRWKLVCYICKLRVGACIQCSNKNCFAAY
                     HVTCAKRAGLCLDTHDTSIAEMASKHYQMHHHVTSYCDKHSPPGWPSCAEGIMKTRRY
                     FANRDAISEVSKEKQLITKGVNSEDKNSAHWKTNKGTPIAPMYFTHIIQKVLVMFDIS
                     NEIPLSILLCKYWAMKRELRKGAPLVRVHTNLSYNSQNESYLNDRIQFIDSLLGDLQS
                     LGNISRLIKERVNATKSFRATNKKINEVFTSPKEYFFRRNVLSKFLHFNAFTSLLALL
                     DKHTIVDHSVNALRNSTSATFIENVEAFVNFASTKLDETRLTSDYIHRISNYAKELSA
                     QFDKVDYEREINMDFEVNKEHDKLSVSERLWKGPILQQEEGLSDVEELTPSESRIVNN
                     LPIEKEKPTKVKRRKKWKKSY"
     gene            <516470..>519616
                     /locus_tag="CAGL0K05291g"
                     /db_xref="GeneID:2890479"
     mRNA            <516470..>519616
                     /locus_tag="CAGL0K05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448455.1"
                     /db_xref="GeneID:2890479"
     CDS             516470..519616
                     /locus_tag="CAGL0K05291g"
                     /inference="similar to AA sequence:UniProtKB:Q12038"
                     /note="similar to uniprot|Q12038 Saccharomyces cerevisiae
                     YPR032w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448455.1"
                     /db_xref="GeneID:2890479"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013905"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT9"
                     /translation="MFKKGKLKGVSNPFKSSKSTESNKDDSAKAPKPKNIGPGNPMLA
                     PTSTMKKFTSSNPLNRLFTTEVVARYGFNGKVVKVAYDQTQSLMALATDMGEIHVCGR
                     QQVEVVFSPPERITEKISIKEMAFVKGIYLVIIDSKDTLVVISLHNKKILASTYLPVK
                     VSCMETDPTLDWVVIGLESGGIMIYDVDRDQMSDIRIENLQKGKFFPREKLSRVVSIQ
                     WNPRDIGTLLISYELVTVIYSFLEDDVKQSFIYELEEYAPGGNLSMDYTKRRRPKVIQ
                     SLYHPNSLHILTVHEDNSMVFWDANTGKLIQARTLLDVDVNVPQPDLTKARLEQPERI
                     KTVKWICQNNPEYTSLLITQIPLDKQPQHQNLTIIDLGGTPLYTITSYDKMSNYYSNM
                     TSQKLVPLPNKTPIVDVVPIARKSPFYAGCHDPAVVLLVLDDGCLETILYPSGSFTYK
                     ASLFPQSLSWARPETTAMVATSVPQKLWLGLLSSANNKDFILKGGMQAKKPARVHEYR
                     SALATGHANGSVRLWDASFGELDDNSVFEVNLARVLNMGSNLSISDISFATDTLELSV
                     ATETGVVALFKFEVNQFYDPEHKNKDRDMEMRFRRFSIGSSKEMLIDVRDRSPETVRQ
                     GFMPSTVVNAQHGPTSALTNSNIGFVAIAYEDGTFVVVDRRGPAIIYMQNVRGLPGIK
                     GRKFTAIEFAIMEYGDDGYSSILILCGTDVGELVTLKILPDSGGRFVVEFVEIKQTND
                     KSPILKIDTFEKKTTESCFATISKMQDLGKGVVINGMVVVTSETDIRFVDPGKSKEGH
                     KSFKHKIATSGISHITFINAVGQKQSLCVLIVLESNGTVKIFTTPDMKELKSMQLPFP
                     IQAQYIRESSVLRNGDIMTRTGKFQSYLFSTFDQRAIGLNKAYTQEQVEKQDTLYNPG
                     LKIPWRPQVNSLQLARGTSYCTREQLDLLLGGERRPQSKYEESEIAIGTISLRKETSA
                     PNSPNMQNDEHAYKKPVSRRGRNSGYEYFRSMSRAVENQWDAVEDGINEYATAIGQAM
                     NDTVEETSKDMVRGAFGF"
     gene            complement(<519751..>521304)
                     /locus_tag="CAGL0K05313g"
                     /db_xref="GeneID:2890480"
     mRNA            complement(<519751..>521304)
                     /locus_tag="CAGL0K05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448456.1"
                     /db_xref="GeneID:2890480"
     CDS             complement(519751..521304)
                     /locus_tag="CAGL0K05313g"
                     /note="highly similar to uniprot|P07263 Saccharomyces
                     cerevisiae YPR033c Histidyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448456.1"
                     /db_xref="GeneID:2890480"
                     /db_xref="GOA:Q6FMT8"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004516"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR015807"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT8"
                     /translation="MSAEQAPAHPQQNAKKEKKSKLQVSLKTPKGTKDWADTDMVIRE
                     AIFSSLSQLFKKHGGVTIDTPVFELREILAGKYGEDSKLIYDLKDQGGELCSLRYDLT
                     VPFARFVAMNNIQNIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDIAGSYESMVPDAE
                     ILSILVEGLTGLGINDFKVKLNHRKILDGIFQISGVKDEDVRKISSAVDKLDKSPWEV
                     VRKEITVEKGQSEETADKIGEYVKLNGTLKEIHTILSQDSAITGNELAKQGLDEIATL
                     MEYADAFGISKFISFDLSLARGLDYYTGLIYEAVTEASAPPENATELKKKSKSTDDAS
                     EYVGVGSIAAGGRYDNLVNMFAEASGKKSSSIPCVGVSFGVERIFSLIKQRTHLTNAI
                     KPTATQVFVMAFGGGKDWTGLLPERMAITKKLWEAGIEAEYVYKSKANPRKQFDAADK
                     AGCPIAVILGKEEFAEGKVRVKRLGQEFANDDGELVDSGDVIEAVKQKLSEVHKDGIN
                     DVTRLLKGL"
     gene            <521914..>523503
                     /locus_tag="CAGL0K05335g"
                     /db_xref="GeneID:2890481"
     mRNA            <521914..>523503
                     /locus_tag="CAGL0K05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448457.1"
                     /db_xref="GeneID:2890481"
     CDS             521914..523503
                     /locus_tag="CAGL0K05335g"
                     /inference="similar to AA sequence:UniProtKB:Q12406"
                     /note="similar to uniprot|Q12406 Saccharomyces cerevisiae
                     YPR034w ARP7 Actin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448457.1"
                     /db_xref="GeneID:2890481"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT7"
                     /translation="MTVDKKCVVISTGSHRTVAGFNNVDLPQCTIPSSYVRVLRDDDV
                     SMDDGEEDESRYEYVFGLFDMMDEAAFDVNGKGGREVFTIVDDHGIPYNWKALERLYR
                     YIYEKELKVDPSELPLVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGI
                     MLSTGKSSSLVIDVGATGCTVTPIIDGTILRNSIVKSRFAGDFLDFQTHKKLEELKKR
                     VAKDDMETDGMEETPQSSLQVWLNANTSIHEFKTSMVSVFDKDLKEVEKYYEEQMRLY
                     RQQQERMAEQQNSQTQQMNQYTIPMNNPNINNPLVQKQNYLLRVKDNKTGAMINRTVQ
                     VENKELYEIAEYLFQPKLASEDFSSKDGLGELIGKAIKKSGASVNSNTAGTQVSGSGN
                     SSGGNSGPQTNGPLIPLNGYSSIGFGTSATGAGSDGSATNNITPEHVYSLLLTNVIIT
                     GGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAWNGAVSLSNLPKWGLTQ
                     WFTKEDFNNHKLKKDNNNVSQ"
     gene            <525728..>526846
                     /locus_tag="CAGL0K05357g"
                     /db_xref="GeneID:2890482"
     mRNA            <525728..>526846
                     /locus_tag="CAGL0K05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448458.1"
                     /db_xref="GeneID:2890482"
     CDS             525728..526846
                     /locus_tag="CAGL0K05357g"
                     /note="highly similar to uniprot|P32288 Saccharomyces
                     cerevisiae YPR035w GLNA Glutamine synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448458.1"
                     /db_xref="GeneID:2890482"
                     /db_xref="GOA:Q6FMT6"
                     /db_xref="InterPro:IPR008146"
                     /db_xref="InterPro:IPR008147"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR027302"
                     /db_xref="InterPro:IPR027303"
                     /translation="MHEHSVEKTQILQKYLELPQNGKVIAEYVWVDGTGNLRSKARTL
                     NKVITSIEQLPEWNFDGSSTNQAPGYDSDIYLKPVAFYPDPFRRGDNITVLAECFNSD
                     GTPNKFNHRHEANKLFQAHKDEEIWFGIEQEYTLFDMYDNVYAWPKGGYPAPQGPYYC
                     GVGAGKVYARDVIEAHYRACLYAGINISGINAEVMPSQWEFQVGPCEGISMGDQLWMA
                     RYFLHRVAEEFGVKISFHPKPLKGDWNGAGCHTNVSTKDMRVPGGMKYIEQAIEKLSK
                     RHNEHIKLYGADNEQRLTGRHETASMTSFSSGVANRGASIRIPRPVAKEGFGYFEDRR
                     PASNIDPYLVTGIMCETVCGAIENANMSKEYERETNEQ"
     gene            <528006..>529523
                     /locus_tag="CAGL0K05379g"
                     /db_xref="GeneID:2890483"
     mRNA            <528006..>529523
                     /locus_tag="CAGL0K05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448459.1"
                     /db_xref="GeneID:2890483"
     CDS             528006..529523
                     /locus_tag="CAGL0K05379g"
                     /inference="similar to AA sequence:UniProtKB:P41807"
                     /note="similar to uniprot|P41807 Saccharomyces cerevisiae
                     YPR036w VMA13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448459.1"
                     /db_xref="GeneID:2890483"
                     /db_xref="GOA:Q6FMT5"
                     /db_xref="InterPro:IPR004908"
                     /db_xref="InterPro:IPR011987"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT5"
                     /translation="MIGDTRLLLDSIHFNEMRSVIRSRSVAWEALSRSEEISDEEATY
                     AKLVENVLVKKSVDSKELNVNENLIRSLVQLVGNTHNKDCRKSSLNLVAELLSSETHY
                     KQTVEVFQEDKQLMRDLFQNSFQSEQEINDSQFTLIAAFNMVSLLTQESLQDSKLVEE
                     LLTVSDGLLLKILTNLQELDTSYVCIRLLQELAVHKGYKLIIWKYESQILPTLFTILR
                     RAIDTKHKNTPLGFSSSTSTSSNSSHSFHRSASSALVPNANNLVIQIQYYSLLLIWVL
                     MFERKVQKEYVTKYLTEYLNLLKIMKVTIKEKISRVSISILLQCLVDENGEVKDKKLI
                     KQLLLLGNALPVVESLTERKYTDQELKDDLVLLKDILEQEYKELTSFDEYIAEVDSKL
                     LCWSPPHIDNGFWVDNIDKFKLNNWELFKKLINILEDIKRDTNVDINESKTKTIIEVA
                     LSDIAHVVELLPESIDVLGKTGGKLLIMELLNHSDSRVKYEALKATQAIIGYRFR"
     gene            complement(<531444..>532067)
                     /locus_tag="CAGL0K05401g"
                     /db_xref="GeneID:2890484"
     mRNA            complement(<531444..>532067)
                     /locus_tag="CAGL0K05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448460.1"
                     /db_xref="GeneID:2890484"
     CDS             complement(531444..532067)
                     /locus_tag="CAGL0K05401g"
                     /inference="similar to AA sequence:UniProtKB:Q12284"
                     /note="similar to uniprot|Q12284 Saccharomyces cerevisiae
                     YPR037c ERV2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448460.1"
                     /db_xref="GeneID:2890484"
                     /db_xref="GOA:Q6FMT4"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT4"
                     /translation="MAKRIGRFHGSHIVRAIAALTLVGLVWYFFNTDSSMSVSAPMAG
                     RLRDTVEPVSNVEKSGSGVSQEDKMKAIDDATIMPLMEDKQAKVELGRASWKYFHTLL
                     ARFPDKPTKEERQKLKTFLELYAELYPCGECAYHFVKLMDKYPPQTSSRTAAALWGCH
                     VHNIVNEYLKKPEYDCSTILEDYDCGCGDTSVKNNKVTVEKEGRQHG"
     gene            <532591..>533820
                     /locus_tag="CAGL0K05423g"
                     /db_xref="GeneID:2890485"
     mRNA            <532591..>533820
                     /locus_tag="CAGL0K05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448461.1"
                     /db_xref="GeneID:2890485"
     CDS             532591..533820
                     /locus_tag="CAGL0K05423g"
                     /inference="similar to AA sequence:UniProtKB:Q12199"
                     /note="similar to uniprot|Q12199 Saccharomyces cerevisiae
                     YPR040w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448461.1"
                     /db_xref="GeneID:2890485"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT3"
                     /translation="MSASDPSLPNGAKKPNRPGAERGPGINAIQINAAREMHAMSIRG
                     RNPRNANTTSGSSILTRTTIPVEASHTSTFATPSAPDTTINKSPKKKNDIPHHVCNNN
                     PNNPNCPHCGTVIIPSPRATLPLKDSPSITVADTWKVTTQKRPILNSQELDDWEANKL
                     QKLPLPEMIFGNNFVRIDNVKNGWYIEFNALDALRQVNLEDTGLRVAHSKVWMQSKQK
                     QQQQQQQQQQQQQEKTSSSESSSANPLEIAHPYDWTYTTLYKGTTPTDAKLPKFEEDI
                     GAELPIDKLSRPDKILFFDDMILFEDELADNGISVLNVKIRVMHERLLLLSRFFLRVD
                     DVLVRVIDTRVYVDFTDNIVIREFKKHECHYNELLAKHQRSNKKTLHDPKAALRDSNW
                     VVEHTPLIERKAEIIHF"
     gene            <534680..>536491
                     /locus_tag="CAGL0K05445g"
                     /db_xref="GeneID:2890486"
     mRNA            <534680..>536491
                     /locus_tag="CAGL0K05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448462.1"
                     /db_xref="GeneID:2890486"
     CDS             534680..536491
                     /locus_tag="CAGL0K05445g"
                     /note="some similarities with uniprot|Q08490 Saccharomyces
                     cerevisiae YOR073w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448462.1"
                     /db_xref="GeneID:2890486"
                     /db_xref="GOA:Q6FMT2"
                     /db_xref="InterPro:IPR011515"
                     /db_xref="InterPro:IPR011516"
                     /translation="MSNLYSAGTPHIQELQNILDSQQEEWAAIKENYTTQNSLIAKEN
                     CTLKMKLSELENKVSQLIRENVQLRSQVSLNKLEFQNKLASQINVLENGVIQRLEEVL
                     YMFDSIRKKESLPSRPTSTNETVDRIKKRRQSNEEARNRRRSRSVSTGSAHSTSSMKR
                     RSSTFGEDLIDASIKRALDNAQSNSLQTSDTLRLSELPGLNEIDTNNVNNDNLLSPIP
                     HKKRKSNRRKSIYVPELPKPNNEPLMENTIEQQENICSESLIQEGEQSEKLGENLDAD
                     QSHVEDQSFSFTNSVLEYSIPEENTLPKQDILDETEKRDTAVNQKKKLEIFHDPPVEE
                     LSSSKNEKPPENSITNDPAFITVTGNNKVKHSMKSRKPKKNKGSVDESMPCTQSTESV
                     DFDRPRRTRGKTVDYRLPSLRAKMRRPTEKLVDATTTVNIQDLQVKYKKSKKVLEKEL
                     KTDMKAMKSPKKNEKTFESGTIFKKISRDNESRPSSTHSTSSVDAECSHNNSHSENIN
                     SSINDTTHSSFNNSTKSVLSDITNISKNKQQQKTKKLLKTAIINDIYDDKTKNAQKTV
                     SFRVNEDDLSVFDLIQHNDTNKSSPKTYRSRSRKNKA"
     gene            complement(<536671..>537567)
                     /locus_tag="CAGL0K05467g"
                     /db_xref="GeneID:2890487"
     mRNA            complement(join(<536671..537347,537474..>537567))
                     /locus_tag="CAGL0K05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448463.2"
                     /db_xref="GeneID:2890487"
     CDS             complement(join(536671..537347,537474..537567))
                     /locus_tag="CAGL0K05467g"
                     /note="highly similar to uniprot|P06785 Saccharomyces
                     cerevisiae YOR074c CDC21 Thymidylate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448463.2"
                     /db_xref="GeneID:2890487"
                     /db_xref="GOA:Q6FMT1"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="InterPro:IPR020940"
                     /db_xref="InterPro:IPR023451"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT1"
                     /translation="MTVTNLEEKQYLDLCERIIKEGEFRPDRTGTGCTDAKKLSDQGV
                     KIWEGNGSREYLDKMGFVDRREGDLGPVYGFQWRHFGAEYKTCEDDYTGQGVDQLKEV
                     IHKLKTNPYDRRIIMSAWNPPDFPKMALPPCHVFSQFYVNFPKDGKPQLSCLLYQRSC
                     DMGLGVPFNIASYALLTKMIAHVCDMEPGEFIHTLGDAHVYKDHVDALKEQISRTPRD
                     FPKLRINRKVSDIDDFKFEDFVLEEYDPHPRIQMNMSV"
     gene            <538801..>539823
                     /locus_tag="CAGL0K05489g"
                     /db_xref="GeneID:2890488"
     mRNA            <538801..>539823
                     /locus_tag="CAGL0K05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448464.1"
                     /db_xref="GeneID:2890488"
     CDS             538801..539823
                     /locus_tag="CAGL0K05489g"
                     /inference="similar to AA sequence:UniProtKB:P41834"
                     /note="similar to uniprot|P41834 Saccharomyces cerevisiae
                     YOR075w syntaxin of the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448464.1"
                     /db_xref="GeneID:2890488"
                     /db_xref="GOA:Q6FMT0"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR019529"
                     /db_xref="UniProtKB/TrEMBL:Q6FMT0"
                     /translation="MSNLTPLFRQYVSIIADESTGLQEAQSETKSSLNEIVTRDSFLK
                     ECRSLAKFLFELNTVLKSVCEEYMNDFSMTEAEKDNFDAEARLQLQEYVKKLKHLEQY
                     EKGRRKLIDEQIRKISGSLNFFKYNNRNIDKRDFISYQNFNNDFRSGVLRSLNLWLKY
                     VSSEFSNMQQERLASQRKFQQSLSFSQPSQEVDLNNHSEVDLTESISLTVSQSQPVEH
                     IQDEIKQYEETISQLTQEQLQVLETEHEELINQKNEQLKKVGLINKTIMEIVGVQSEL
                     AAHLQVQSQNINSMLDNQDIIETNITKGNKELKKAQRAAGKTAKLTTYIAVIIGILIL
                     LLDYIS"
     gene            complement(<539944..>542127)
                     /locus_tag="CAGL0K05511g"
                     /db_xref="GeneID:2890489"
     mRNA            complement(<539944..>542127)
                     /locus_tag="CAGL0K05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448465.1"
                     /db_xref="GeneID:2890489"
     CDS             complement(539944..542127)
                     /locus_tag="CAGL0K05511g"
                     /note="weakly similar to uniprot|Q08491 Saccharomyces
                     cerevisiae YOR076c GTPase with function in 3 -to-5
                     degradation of mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448465.1"
                     /db_xref="GeneID:2890489"
                     /db_xref="GOA:Q6FMS9"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS9"
                     /translation="MSRLEELARQRRLKKAGSESSESSKNYEGTSKSASLLEKLRNRK
                     KTASESPHNSEANTEIANHGSQAALNQTSGKVRSTPIKTSSSSTLGSKLRELRSRKKV
                     EEAKQKESVDVTPEIDSLPNGQSNKQSRDQLKQQYLVEMAEFKALQGRLNINIDSSKT
                     IRRLSGHSKFLVNSRNKVHKLYKQKRDMLLTVFYPARNKSARKKSIEGFHKPSPDDIV
                     LAAQEQVFQAVTENVAQLSIKPIKIKERVSKRFTDNMTDQTKVQKQQLTVEDFINDRN
                     ATSFQVPMFGLPGSGKSTILGQLSFHLGLTTREDIRVIKTDMERMHFRRIDKLDTRLL
                     TTSPFCWVVDETTEERQFGHSNNIKPLHIKYNDTDIIINEVPGSFDLCSTIETKRYVG
                     NSVIIVVSAELGDYEANFDMKKRLIEKLIYCNGVGVRRILTIINKMDLIDWDMDRYTV
                     MKHELELIYQQVGIDILKCDFIGTSAITGEALTNDGDNRKRMFTKGSFSSLLNVLLSY
                     KLQFKKEVLESSLVNSQEQTLLDSEKLIAIQTGNKHEQQLSVPFYIERGLILKGQKLK
                     INRTGLEVVVKSIKESLRKKKSVNVAVVGQSVDLLFEPSEAITSSNINNILTSCNSPK
                     LIETSEFNMKMWSLKNCSKQLDFNNILIFCVGRFLNICISNVEQTENNEKLNNFQYIF
                     CRACLKSSENMLAFEPGYESAKSFVLFFENRAIGFGELLLNDRSF"
     gene            <542446..>543171
                     /locus_tag="CAGL0K05533g"
                     /db_xref="GeneID:2890490"
     mRNA            <542446..>543171
                     /locus_tag="CAGL0K05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448466.1"
                     /db_xref="GeneID:2890490"
     CDS             542446..543171
                     /locus_tag="CAGL0K05533g"
                     /inference="similar to AA sequence:UniProtKB:P40962"
                     /note="similar to uniprot|P40962 Saccharomyces cerevisiae
                     YOR077w Zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448466.1"
                     /db_xref="GeneID:2890490"
                     /db_xref="GOA:Q6FMS8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR019447"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS8"
                     /translation="MSEDFNSAKFLNKQLKARGLQKLRFYCQVCNKQCRDQNGFKSHV
                     KSPSHLKNISTVTQDDILEFTKLFEENFLNTLKTNHGEKKIAVNKLYNEIIKDRDHIH
                     MNATSFKSLTGFIKYLSKEGKIKVYDDNIGDMPEDQVDLTQLNISFIDNSDTNLRRKE
                     KLQEIEAEELTESKLEEYLRTKRQLREQEEEESDVQDTDLGSNTDIQRDNLTNLKIQL
                     KKTKIKQNKVKKPLNKNKNNVFG"
     gene            <543605..>544297
                     /locus_tag="CAGL0K05555g"
                     /db_xref="GeneID:2890491"
     mRNA            <543605..>544297
                     /locus_tag="CAGL0K05555g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448467.1"
                     /db_xref="GeneID:2890491"
     CDS             543605..544297
                     /locus_tag="CAGL0K05555g"
                     /inference="similar to AA sequence:UniProtKB:Q08492"
                     /note="similar to uniprot|Q08492 Saccharomyces cerevisiae
                     YOR078w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448467.1"
                     /db_xref="GeneID:2890491"
                     /db_xref="InterPro:IPR013268"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS7"
                     /translation="MTVSTRSKEHIKFDDNDETAHTETETQESVKSLRSKSVDVSDSD
                     SDSDDDAPEEEGLGNAKDEVEDQIKKQEQAAILEKQRIREKRKKENERLKEQQLEKKM
                     RTEEMQKQIAELEKLQSQTVESDEEELQELPEDLLAKINNVDPTAGQTIPKHINFNDI
                     DTQDFVPEVKEQIKKRKKNALKQLCKTTMNKGVVKVSVLSSNLSKSAPKKEGNVTNLR
                     NKWLKRRSLNRK"
     gene            complement(<544460..>545455)
                     /locus_tag="CAGL0K05577g"
                     /db_xref="GeneID:2890492"
     mRNA            complement(<544460..>545455)
                     /locus_tag="CAGL0K05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448468.1"
                     /db_xref="GeneID:2890492"
     CDS             complement(544460..545455)
                     /locus_tag="CAGL0K05577g"
                     /inference="similar to AA sequence:UniProtKB:Q12067"
                     /note="similar to uniprot|Q12067 Saccharomyces cerevisiae
                     YOR079c Metal homeostasis factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448468.1"
                     /db_xref="GeneID:2890492"
                     /db_xref="GOA:Q6FMS6"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS6"
                     /translation="MGINIAAVILLAILLLVATFSIGCLPFYYININSTYSNTQNGFL
                     KVFSQFGVGMLLGTAFMLVIPEGIKACTEEGGNVGFDLLAGFIGVYLFDRLGHSIMSN
                     TNAFLIQNPEESNDLPTSSAFRSNLNYSIKEILTKPRVVVARVLKNNVILAFVIHGIS
                     DGVALGTTSNNQRLLIVVFIAITIHKIPAVLSLSALMLTKQGLPMTECMTNLFAFSLS
                     TPVGYILLSLLNLRQSATMDYISSNLLLMSGGSLLYASFTAFSEDDHFIEQTSDPSTF
                     VNDEYNAASNDTESISVDVLEQNSKTSYFLKYDESLYILVGAFIPTLISFMVKDD"
     gene            <545761..>547893
                     /locus_tag="CAGL0K05599g"
                     /db_xref="GeneID:2890493"
     mRNA            <545761..>547893
                     /locus_tag="CAGL0K05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448469.1"
                     /db_xref="GeneID:2890493"
     CDS             545761..547893
                     /locus_tag="CAGL0K05599g"
                     /inference="similar to AA sequence:UniProtKB:Q08496"
                     /note="similar to uniprot|Q08496 Saccharomyces cerevisiae
                     YOR080w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448469.1"
                     /db_xref="GeneID:2890493"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS5"
                     /translation="MPDEEILNKAIELGTTYFKSEDYRKARSLFEKALKLVDSYSKDE
                     IKKLRGEIYHVDELPDELYKRVKCERIITHPKHVKILDNLSACWEKQNILDNALKLSH
                     KMVKLEPFNIKTYIRKGRILMKLTKYRDAYHNFKEGLTRIQYASQKYELIPSRKLMKY
                     CEQQKNIVRDMFLNKSKSLDLAGTNEKKRKLIDPILEQVQLKKQKESDAEEYFNIKEI
                     DFIEKLPIELTLKILRKIRPRQLAELMLVCRKWREVILQAPALFDEFLFQNITLRQMI
                     KFNAFIMKLSKINFYISGSNILHFKTLKISPKSPSEEFKITKILLESSSEIIRCNRLI
                     MAIPNTTTSHIAKMIPKSNEFTKSIRELSLMCTLRADKNYELDILESFEYLTRLEIMF
                     HNSLVPLSSSNEEVTGVGTQNAHWTRTLKYFSVICDTRKVPTFPFKNILQNKNFPSLK
                     KLCISGVTMSLQADQFDWLTNTPALNELWLENNNNAKLSHFFSTIRDIHIWDDLKRLT
                     FRENRNYDKVSLEANNRSYCYLSNLRSLETLDLMGGSITGLGLTRLFSYFMDCKITKL
                     NLGDCMNIQFTLLPPSHAMETALQPSFLLSSLPNLNNLQLPKMATLDDDAITLFSKFA
                     HLMSSMDILDISFNPSVTGVSVYSFLKNLNTYREKALGLLNIDNCNNISHITVGTILA
                     QGFVNKVSCVYEREHWHNFGSNSFRYMG"
     gene            complement(<548043..>550349)
                     /locus_tag="CAGL0K05621g"
                     /db_xref="GeneID:2890494"
     mRNA            complement(<548043..>550349)
                     /locus_tag="CAGL0K05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448470.1"
                     /db_xref="GeneID:2890494"
     CDS             complement(548043..550349)
                     /locus_tag="CAGL0K05621g"
                     /inference="similar to AA sequence:UniProtKB:P36165"
                     /note="similar to uniprot|P36165 Saccharomyces cerevisiae
                     YKR089c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448470.1"
                     /db_xref="GeneID:2890494"
                     /db_xref="GOA:Q6FMS4"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS4"
                     /translation="MVLTRRTLPVTEFLIDKYYEVAQYGRVLHEGEGSDTEGGEEEHT
                     KLEFETEEAVPDSRESTPSYSEMVYAQRAALNQRLANSQWLKIPMPLLDKLNSTLRWL
                     TGKDLTTWEIEYELKKNRQLARSYDDWKAISLQLDELQGKADWKVDDETDLYDYQAVR
                     ALTHKMKELRENKNYAELLYYIRTTWTRNFGNMGNVNLYRHTNHGTKKLIEAYLAESK
                     LCVEELVSKSGFENEYLLGILQQTRRNIGKSALVLSGGATFGMFHIGVLAALFEADLI
                     PRVISGTSAGAIVASIFCTHTTEEIPSLLESVLGMRFKIFRDEDDLETTENVFVQMAR
                     FFKHGTWFDNRHLIKTMKGFLGDLTFREAYNRTGKILNISVSTASIFEQPRLLNNLTA
                     PNVLIWSAVCASCSVPGVFPTCPLYEKDPITNQCTVWGGSTSVKFMDGSVDNDLPISR
                     LSEMFNIDHIIACQVNVHVYPFLKLSVSCVGGELQNETSARVKQHITGFCNYFSDELV
                     HYLEILSELGIAETLCNKLRSVISQKYSGDVTILPKLDMISCVNELLSNPSQEFLLKE
                     TTLGARATWPNIPIIKSNCTQEFILDKAIAYLKEQIIVSSSSDIPANISYGAMERVML
                     SNDPKKRQLSNQSTDDTFEENNVLDDNLMENEPTNSTLLLRENAFTTIHDPLFPREKY
                     LAPIPKKRRNHRKSEASTRVRSRYAVGSCSFSVGSATKTMEILQVKTSKSASPKKYQN
                     MRISPAIKTSDRVIFGSNRNVFDYLQRD"
     gene            <551022..>552314
                     /locus_tag="CAGL0K05643g"
                     /db_xref="GeneID:2890464"
     mRNA            <551022..>552314
                     /locus_tag="CAGL0K05643g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448471.1"
                     /db_xref="GeneID:2890464"
     CDS             551022..552314
                     /locus_tag="CAGL0K05643g"
                     /note="some similarities with uniprot|Q12416 Saccharomyces
                     cerevisiae YOR083w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448471.1"
                     /db_xref="GeneID:2890464"
                     /db_xref="InterPro:IPR013734"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS3"
                     /translation="MATRSREYTGAEGLGVRVGVEGDSDDESMGRDEDVPRGSRVTVF
                     GEGRVPETPSPPRNSSHARRSSTSLGFLGTPTHPGRYFDVPNSPSSNKGRKTSISHES
                     GSGRTRLLPPTTPKSRQTEVFMSPSPKLRSPQVSKEIEKKPIKEISNELKTRLNYALM
                     KLQNGWVDKSLPELEHTLATDRGDGINEIGQGQNSGEVFSKLDNNDAGKDFLQQRRKS
                     GYVNQFAGDDSSSATFKFEGLKGNTQSNDKGGDERAGTKTAIKTESNEMYSEVQSDSD
                     ENSNDEGNSAHSAFLKALSSPKKKQKSSSSTSYPVSPLRWTSTSRPKPLTLDTNLENT
                     KKNTKGPPLEVEAIETLMSLASPKKSSGSLDEALASNDSASGRPGSVTGKGATPIFLR
                     NDVLRQKNASNEGQLRLGNNEILAEKKSDVETEVDESD"
     gene            complement(<552804..>553943)
                     /locus_tag="CAGL0K05665g"
                     /db_xref="GeneID:2890465"
     mRNA            complement(<552804..>553943)
                     /locus_tag="CAGL0K05665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448472.1"
                     /db_xref="GeneID:2890465"
     CDS             complement(552804..553943)
                     /locus_tag="CAGL0K05665g"
                     /note="highly similar to uniprot|P38716 Saccharomyces
                     cerevisiae YHR112c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448472.1"
                     /db_xref="GeneID:2890465"
                     /db_xref="GOA:Q6FMS2"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS2"
                     /translation="MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQR
                     ENFDFMDEAPVYSREGHPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVF
                     LGQCYHGVHCISDMFTRNFNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLA
                     DLAHSKGAIVIIDSTFAPPPLQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEI
                     SRALKEDRINLGSMIGNLESYLLMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNV
                     LGDIYHSSIQSDAFVKDQLVGGYNSVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIES
                     LIEWRALSDDKIDQKLMRVSVGCESAKDLIDDLSQALQELENEYK"
     gene            <555370..>556536
                     /locus_tag="CAGL0K05687g"
                     /db_xref="GeneID:2890466"
     mRNA            <555370..>556536
                     /locus_tag="CAGL0K05687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448473.1"
                     /db_xref="GeneID:2890466"
     CDS             555370..556536
                     /locus_tag="CAGL0K05687g"
                     /inference="similar to AA sequence:UniProtKB:Q03558"
                     /note="similar to uniprot|Q03558 Saccharomyces cerevisiae
                     YHR179w OYE2 or uniprot|P41816 Saccharomyces cerevisiae
                     YPL171c OYE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448473.1"
                     /db_xref="GeneID:2890466"
                     /db_xref="GOA:Q6FMS1"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS1"
                     /translation="MGVSVKGAPNLDYFTPEQPILGKFIKYKEDEDGSSERDPPKLFK
                     PLKIRALEIPNRIGVSPMCTYSTNNYMPTDFHLMHYGSLATRGPGIIIVECSAVSEGT
                     AVTVNDMGIWNKEQASEHFSKIVKFAHSQNVIVGCQLGQFMRKVVQNVDEDNKAHNVE
                     VGKEAHDLSTEEIKTIVEQWGTAAKLAVEVAKYDFIEIQAGKGHITNEFFSRLTNKRK
                     DEYGGSFENRIRILLEIIDNVRKNIPEDTPLFIRLKACDNLDHPDAWSTDETIKLSFE
                     LAKHGVDVLDIAGRGLRIGPKSEKENKIIFLQQLKEAHKGKTNLLIASSGVISTADYA
                     SELLDKEAQDIILVGRPFLKNPNLVSFWADDVNITVTNAVQYSWGFYPTKSHLS"
     gene            complement(<556732..>560043)
                     /locus_tag="CAGL0K05709g"
                     /db_xref="GeneID:2890467"
     mRNA            complement(<556732..>560043)
                     /locus_tag="CAGL0K05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448474.1"
                     /db_xref="GeneID:2890467"
     CDS             complement(556732..560043)
                     /locus_tag="CAGL0K05709g"
                     /inference="similar to AA sequence:UniProtKB:Q12263"
                     /note="similar to uniprot|Q12263 Saccharomyces cerevisiae
                     YDR507c GIN4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448474.1"
                     /db_xref="GeneID:2890467"
                     /db_xref="GOA:Q6FMS0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FMS0"
                     /translation="MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQ
                     QAAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNS
                     DLYLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENL
                     LLDNKLNIKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVI
                     LFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRI
                     TIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGK
                     DAREIAAKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKIVQRNSTIRSTAPES
                     PSKKKTYTPQKKNKRASIIASSSKRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSA
                     RKRMSALYGTRDSPTKTSRSRRSSIITKDFLGNRPRDSVISMSHNKRASKSSKRISLV
                     PNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKE
                     KAELERKVRETKEREERERKERQEKELQERLERERIEKQKEDIARQMDEEISNLKKEL
                     VGDQDNEDKFRSVSEPLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFID
                     KPRQSEQHVPETVNLEPELEETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQP
                     IEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLS
                     MYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREER
                     LYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDGSTKETK
                     EQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTT
                     SEQVSADKKRNMSFLRKLSKGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGL
                     KGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLS
                     DEVKKVLSKEGVLRD"
     gene            complement(<561289..>561615)
                     /locus_tag="CAGL0K05731g"
                     /db_xref="GeneID:2890468"
     mRNA            complement(<561289..>561615)
                     /locus_tag="CAGL0K05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448475.1"
                     /db_xref="GeneID:2890468"
     CDS             complement(561289..561615)
                     /locus_tag="CAGL0K05731g"
                     /note="highly similar to uniprot|Q12306 Saccharomyces
                     cerevisiae YDR510w SMT3 ubiquitin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448475.1"
                     /db_xref="GeneID:2890468"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR9"
                     /translation="MSDTNENNASETPDVKPDLQGQGDAPKSETHINLKVSDGSSEIF
                     FKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGLRIQADQTPEDLDMEDNDLIEAHRE
                     QIGGAY"
     gene            <565111..>567093
                     /locus_tag="CAGL0K05753g"
                     /db_xref="GeneID:2890469"
     mRNA            <565111..>567093
                     /locus_tag="CAGL0K05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448476.1"
                     /db_xref="GeneID:2890469"
     CDS             565111..567093
                     /locus_tag="CAGL0K05753g"
                     /note="highly similar to uniprot|P48813 Saccharomyces
                     cerevisiae YDR508c GNP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448476.1"
                     /db_xref="GeneID:2890469"
                     /db_xref="GOA:Q6FMR8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR8"
                     /translation="MVFGGRRRNERSQSPDSEEADVSNYELHNIDDSKKGYDNLGSGS
                     RGATTSAVEYFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQ
                     HNLAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGI
                     GTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSM
                     LVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQI
                     FGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNG
                     IQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIA
                     LLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAF
                     YSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWL
                     LAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLAL
                     IAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLD
                     SYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDFWC"
     gene            <568119..>568532
                     /locus_tag="CAGL0K05775g"
                     /db_xref="GeneID:2890470"
     mRNA            <568119..>568532
                     /locus_tag="CAGL0K05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448477.1"
                     /db_xref="GeneID:2890470"
     CDS             568119..568532
                     /locus_tag="CAGL0K05775g"
                     /inference="similar to AA sequence:UniProtKB:Q04401"
                     /note="similar to uniprot|Q04401 Saccharomyces cerevisiae
                     YDR511w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448477.1"
                     /db_xref="GeneID:2890470"
                     /db_xref="GOA:Q6FMR7"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="InterPro:IPR008381"
                     /translation="MIGRRQLVTVFRRYASQNGVIGQDHTLLPPLMLYRRILRAHKLL
                     PPMQKEMGDKYVKSEFELHRTIDNPLHIVGFLASWQDYLHQITNGKWKEGSLSPAVLE
                     KMSPEQVGQLYELMKETEKVTKGDNPEEDKGKNKI"
     gene            complement(<568808..>569074)
                     /locus_tag="CAGL0K05797g"
                     /db_xref="GeneID:2890471"
     mRNA            complement(<568808..>569074)
                     /locus_tag="CAGL0K05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448478.1"
                     /db_xref="GeneID:2890471"
     CDS             complement(568808..569074)
                     /locus_tag="CAGL0K05797g"
                     /inference="similar to AA sequence:UniProtKB:Q04406"
                     /note="similar to uniprot|Q04406 Saccharomyces cerevisiae
                     YDR512c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448478.1"
                     /db_xref="GeneID:2890471"
                     /db_xref="GOA:Q6FMR6"
                     /db_xref="InterPro:IPR021475"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR6"
                     /translation="MSQENVKYPTTMSCREAFDQLTTCLSIGGQFRNYYRYGEFSACE
                     KQVNKFKFCILNAKDPVKVQEWYHNQVEENKLRRGSSDIVWKER"
     gene            <570054..>570482
                     /locus_tag="CAGL0K05813g"
                     /db_xref="GeneID:9488030"
     mRNA            <570054..>570482
                     /locus_tag="CAGL0K05813g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999532.1"
                     /db_xref="GeneID:9488030"
     CDS             570054..570482
                     /locus_tag="CAGL0K05813g"
                     /note="highly similar to uniprot|P17695 Saccharomyces
                     cerevisiae YDR513w TTR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999578.1"
                     /db_xref="GeneID:9488030"
                     /db_xref="GOA:B4UN35"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:B4UN35"
                     /translation="MISIDFSNLIVIIAVLLLTRYISQKFYSSLGNKMVSQDTVNSVK
                     NMIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEI
                     NGQNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQKVLA"
     gene            complement(<570750..>572231)
                     /locus_tag="CAGL0K05819g"
                     /db_xref="GeneID:2890472"
     mRNA            complement(<570750..>572231)
                     /locus_tag="CAGL0K05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448479.1"
                     /db_xref="GeneID:2890472"
     CDS             complement(570750..572231)
                     /locus_tag="CAGL0K05819g"
                     /note="some similarities with uniprot|Q04408 Saccharomyces
                     cerevisiae YDR514c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448479.1"
                     /db_xref="GeneID:2890472"
                     /db_xref="GOA:Q6FMR5"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR5"
                     /translation="MLSVARMSARRKRGGATKQAVVRLDNDVDMALLRRWMRGRVPMH
                     VRQVKEPLVRATNYNQLMKGVALDKGKDPRVSFLNELDHFKRIKSLKYEVPNRQRMKY
                     VDGYLQKLSESYHLTNKRANKLLNSELKTLEDNWIARHGKLPKIPNDSNISQTKKQHL
                     KEQLSAYNAEVRQIKDNQPVTVYSVPGGTNFDYLTNCIKLLNSDRAILFSIDIEAFEF
                     DTKIITEIGISIYDPRENLYSTAPITRNYHLIVSEVLQLRNSKFVCDYKDCYLLGESF
                     VMPLKECCAFVQALLNYYMKPSTDNERTWSRAFVGHNIKGDIKWLKDIGVDFRDIGEP
                     AGELRPYKEEADKNEPVYLLDTEKLYCANYGRKGSNLGRILQLLEIPHAFLHNAGNDA
                     HYTLELLKRMCDVQYRELKRLDDLEHIATKIEKLNKRAKEEPKILPMSYAIAVANKTV
                     KNFNDSNNGKKRNNLVQQTEFGGATFYNDPKEAFLSTFSNIKT"
     gene            <573144..>577262
                     /locus_tag="CAGL0K05841g"
                     /db_xref="GeneID:2890473"
     mRNA            <573144..>577262
                     /locus_tag="CAGL0K05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448480.1"
                     /db_xref="GeneID:2890473"
     CDS             573144..577262
                     /locus_tag="CAGL0K05841g"
                     /inference="similar to AA sequence:UniProtKB:P12351"
                     /note="similar to uniprot|P12351 Saccharomyces cerevisiae
                     YLR256w HAP1 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448480.1"
                     /db_xref="GeneID:2890473"
                     /db_xref="GOA:Q6FMR4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR4"
                     /translation="MNNTPMPPMNSAGVNMNSAMYALPMPQDNADVAKSSKDAGANMN
                     KNTSNIKNKEKEKEKVKRKRNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHY
                     MEQAWAEEAEKEISKEMELKQLRSKVKQLEETLSRYNSLTDVTSGLHMNTGSPYPHSR
                     DSSSNPTTATTTNNNSNYNTGTFNSPAVHDPKIKTEHNDFANNDSMTDAYMNSIFKKF
                     ESDELDLTREFDMLHLKKDYGLIHLGPTHWLAIMKGDPYLKLLWKHIFTMREKLVEWT
                     KMKQMGKVSKCPIDHSKLKQGQPQINNGQYTNVNGNAINPGKCPVKHDSTLSPGISKC
                     PVKHENGTDMNTINNLPMGPTTAVHPGVGANPPTSGCPVQHGGNSFIPGFIGGHQQAN
                     SNVPQMDAKGNSAGIGKCPVTHSVKQENEKSASPTLPEVSQPSFTKKEVMEQLQSSLP
                     PRGIVILFVNKFFETLYQLAPIIDETNFKNQLNIVFPELNIFEGHKAKDKTSRCPFDH
                     SKLSTINITKSSDYCLLGMLLIIMRLVWLQLPANVNILSFSDNSKITMSTDDKLLSGF
                     EIKTELIESLKTRLIEFDEISSVSNANVTISTIQFAIFYRIILLCNTNNAPSGGTLSA
                     LKTVNNDNETHQGLLSSIVQMAFSCGLHRDPDNFPQLVTVFPNQSADSSDSADNKDQS
                     RNSTKGNSKHHKENTIERYKHTWRKLWYYIISLDIQQSFSLGTPRLLRNLKDFSDTKL
                     PSSSKIDYKNDIKELVIVKNFTLIFKLDLCIMAVLNHILNLSIARSLKKKDLDSLIKL
                     LSDLIFGERNVNEVVSELIERNLLSSSELVATNMQENLLFEQSTHPVADDVKDAVLYG
                     LPTLESLYAKNEIPFKDIMLSKNSGYGGESKSENLSRSDKVKNTLTYSLLYSRHLTLR
                     LLVYIMNYILFTRYEPLGDSDPDTIIITKYYAQEALDFSVDCFKNSMIFFENINNPIF
                     KSASVLLLPQCLDVCHRSLQYFICLILRVKCGNITGNGGGQCPFFAVKNESGTESENE
                     KEADLNNPGFLNGKDIMSMSTSKIDLDDTDSLLQTLISNISSFYSLTQRLAKSYTLAI
                     RIMKSTGFFMTLLNDQSSKNQMNSFLPPKHPKIPSIASLLRNDGAAFLNADVSQLRRC
                     PVYQDTIGFDVTRNSSFPGPLRTSIDRIGTQLPPLKSYKPITYTSSDVRGCSSRGASR
                     GSSAISSPGVSNLDGPPIKRQRTMENITSIPRPTEKHMGRLNGFDMINNSNGNILDVN
                     NLPVPALNPLSPNGMLFQDLGATPNHTANGTAVGTPNDLENFLMANTNFNGINPSNIV
                     EAFGINKTDPNLGLTNMDFLPIDNLGFDYEPDLNNIFNGETGTLKFDTNETI"
     gene            complement(<577370..>578968)
                     /locus_tag="CAGL0K05863g"
                     /db_xref="GeneID:2890474"
     mRNA            complement(<577370..>578968)
                     /locus_tag="CAGL0K05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448481.1"
                     /db_xref="GeneID:2890474"
     CDS             complement(577370..578968)
                     /locus_tag="CAGL0K05863g"
                     /inference="similar to AA sequence:UniProtKB:P53109"
                     /note="similar to uniprot|P53109 Saccharomyces cerevisiae
                     YGL160w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448481.1"
                     /db_xref="GeneID:2890474"
                     /db_xref="GOA:Q6FMR3"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR3"
                     /translation="MGEIRRPAPLESITLQKRHGNTHFANINYGYIVFFVSVAYVVFL
                     ILLRRIIKSYPSNKNRTFFGGLCKRLYTIDPALHLLILFIPLIATFYYHYSIFSQTAV
                     YIMRLGRLSYVLLSLNLFLNLRPNIFFTDKYVYTDFIPFHKWLSRLIVIFGLLHGVFF
                     VIRWAINPKTDLDAKLSNKYNFAGIVIAGISIILIIASMNVARRSAYNLFYIIHNITL
                     FAFVFITPYHARPSVKTPYLFVNSVLIAVQVINKIVFTSRASLIEKIEDRKNTNLVVL
                     KFPRKALPDFFNPSSHIRLSAYRKLNPLYWILPSHPYTLATLPSDEIVELIVNEHTVP
                     QFNTSSFVVELGYSYTIQNPHNPSVPDVCLQNANRIAIVCGGSGIAFGLPLFRFFKSM
                     KNISYLRLVWLTKNSSQLSIITKSDSFRALISEDGKIDNLDIYLTNKTTAPTSSGTEE
                     TENDIELEDFELNTTEDLTEYKKLCNITEGERMDWTTELSSLVEEDTSKTWLLACGPE
                     GLVTDGKSYANANGIHFASEVYTL"
     gene            579660..579764
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0K05885r"
                     /db_xref="GeneID:2890475"
     tRNA            join(579660..579697,579719..579764)
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0K05885r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2890475"
     gene            580256..580364
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0K05929r"
                     /db_xref="GeneID:2890476"
     tRNA            join(580256..580292,580328..580364)
                     /gene="tRNA-Pro (TGG)"
                     /locus_tag="CAGL0K05929r"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:2890476"
     gene            complement(<580733..>582439)
                     /locus_tag="CAGL0K05973g"
                     /db_xref="GeneID:2890477"
     mRNA            complement(<580733..>582439)
                     /locus_tag="CAGL0K05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448482.1"
                     /db_xref="GeneID:2890477"
     CDS             complement(580733..582439)
                     /locus_tag="CAGL0K05973g"
                     /note="highly similar to uniprot|P19882 Saccharomyces
                     cerevisiae YLR259c Heat shock protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448482.1"
                     /db_xref="GeneID:2890477"
                     /db_xref="GOA:Q6FMR2"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR2"
                     /translation="MLRAVARSQVRSLRNARLYSSFKELKFGVEGRAALLRGVETLAD
                     AVSATLGPKGRNVLIEQPFGAPKITKDGVTVARSITLEDKFENMGAKLLQEVASKTNE
                     AAGDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQAAVEKVIQFLTENKKEITTS
                     EEIAQVATISANGDAHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGF
                     ISPYFITDAKSGKVEFEKPLLLLSEKKISSIQDILPALELSNQSRRPLLIIAEDVDGE
                     ALAACILNKLRGQVKVCAVKAPGFGDNRKNILGDVAILTGSTVFTEELDLKPEQATME
                     HLGSCDSITITKEDTVILNGNGSKDSIQERIEQIKNSIDVTTTNSYEKEKLQERLAKL
                     SGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALVKASRVLDEVK
                     TENFDQKLGVDIIRKAITRPAKQIIENAGEEGSVIVGKLVDEFGEDFAKGYDSAKGEF
                     TDMLAAGIIDPFKVVRSGLVDASGVASLLATTEVAIVDAPEPAPAAGAPGGGMPGMPG
                     MM"
     gene            <583945..>586329
                     /locus_tag="CAGL0K05995g"
                     /db_xref="GeneID:2890448"
     mRNA            <583945..>586329
                     /locus_tag="CAGL0K05995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448483.1"
                     /db_xref="GeneID:2890448"
     CDS             583945..586329
                     /locus_tag="CAGL0K05995g"
                     /inference="similar to AA sequence:UniProtKB:Q06147"
                     /note="similar to uniprot|Q06147 Saccharomyces cerevisiae
                     YLR260w sphingolipid long chain base kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448483.1"
                     /db_xref="GeneID:2890448"
                     /db_xref="GOA:Q6FMR1"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR1"
                     /translation="MIAKNRVDDDVYVTMKSKKKSKNSGRSQSVPISKNKRMISRGQL
                     VEDGVRIVGVTSLNTFQNKAPANMRSTTTNVYRPSTMMFSNDSSYSMGVGGRQYGDES
                     KEGPRLSIESRISSTDSFISANSYVRRSNSSVFETASLVSCVTCLSDSSYSTSSGSSS
                     LSLASSATGNSQKMRHRKKNHSGNDDTNNKLDTFLPINTVIPYARIINAKIFTTTPQN
                     QNQEPRTSNDFTNQSILSRDDVSSQASKFISVPDDRPRRKSFKRKPSNARITSMTSID
                     GDTDNNPFSTQPSSTSASASRTTTNNDNNDNVDLKNPFNTNDDDNVNNSKVSVKESEI
                     LYEGSQDEMENIKSLHLIEITFAKPRRQDVVPKKIVIAIETTELLRGPSEIVDAIMDR
                     SYKGTKQSRSILAIINPFGGKGKAKKLFMTKAKPLLSASRSTVEIKYTKYPQEAIDIA
                     REMDISKYDTIVCASGDGIPYEVINGLYRRPDRVEAFNKLAITQLPCGSGNAMSVSCH
                     WTNNPSYAALCLLKSVEARIDLMCCSQPSYADEYPKLSFLSQTYGVIAESDINTEFIR
                     WMGPARFELGVAFNVLQRKKYPCDLYVKYAAKSKNDLKVHYLEHKNQGSLTFEGDLNE
                     ESPETEDTKQISKSNENEISNEITEDSFKLKYPLKDGVPDDWERLDPSISNNIGIFYT
                     GKMPYIAADTKFFPAALPSDGTIDMVVTDARTSVTRMAPILLALDKGSHVLQPEVIHS
                     KILAYKLIPKLNHGLFSVDGEKFPLEPLQVEVLPRLCKTLLRNGSYVDTEFDTM"
     gene            complement(<586922..>587581)
                     /locus_tag="CAGL0K06017g"
                     /db_xref="GeneID:2890449"
     mRNA            complement(<586922..>587581)
                     /locus_tag="CAGL0K06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448484.1"
                     /db_xref="GeneID:2890449"
     CDS             complement(586922..587581)
                     /locus_tag="CAGL0K06017g"
                     /note="highly similar to uniprot|Q99260 Saccharomyces
                     cerevisiae YLR262c GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448484.1"
                     /db_xref="GeneID:2890449"
                     /db_xref="GOA:Q6FMR0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMR0"
                     /translation="MSGRQDKLLTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATI
                     GIDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFI
                     DKWIEDVKNERGAENVILCVVGNKSDLADERQVTAEEGEKKAQDLGAKIFMQTSTKVG
                     YNVKNLFKKIAKSLPEFQDSDANPLENTGGAAGNRNSNKAGVIDISTTDEDQSQSGCQ
                     C"
     gene            complement(<588340..>588534)
                     /locus_tag="CAGL0K06033g"
                     /db_xref="GeneID:9488031"
     mRNA            complement(<588340..>588534)
                     /locus_tag="CAGL0K06033g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999533.1"
                     /db_xref="GeneID:9488031"
     CDS             complement(588340..588534)
                     /locus_tag="CAGL0K06033g"
                     /note="highly similar to uniprot|Q3E764 Saccharomyces
                     cerevisiae YLR262ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999579.1"
                     /db_xref="GeneID:9488031"
                     /db_xref="GOA:B4UN36"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:B4UN36"
                     /translation="MSGRQGGKAKPLKQKKKQQQDLDPEDQAFKEKQKADAAAKKAMM
                     ANVKSGKPLVGGGIKKSGKK"
     gene            <589631..>592027
                     /locus_tag="CAGL0K06039g"
                     /db_xref="GeneID:2890450"
     mRNA            <589631..>592027
                     /locus_tag="CAGL0K06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448485.1"
                     /db_xref="GeneID:2890450"
     CDS             589631..592027
                     /locus_tag="CAGL0K06039g"
                     /note="weakly similar to uniprot|P14291 Saccharomyces
                     cerevisiae YLR263w RED1 meiosis-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448485.1"
                     /db_xref="GeneID:2890450"
                     /db_xref="GOA:Q6FMQ9"
                     /db_xref="InterPro:IPR012491"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ9"
                     /translation="MDAQSILARYFDVKVVDGFYYIQIQFSDTEFLERTIQNAIANLT
                     HKDIEVLFRFMLKEPLRSKKIWLLISIMFIELSHAKLQYKDIWIHLLRIQLTFNLEET
                     EVPESNDVIINTLIDRGTKKDITFKNWKYFFILLKTLAYIYTSPSDDIQQLIISKFDY
                     VKDFLTSNEIKDLNLLIMLISFLSLANGNAEHQEYPILRWKKQNIDKIFSNYKIMEFI
                     LDNFKEKLVNFVRIKKLFAVYESQNCQTKKIVGLSNSGSKRFCYSQFIHGNLYLWTGT
                     NTFIHLRKKNIFLKKSNNCLIEIGFPRDITPFTQMALNEFEKSHIPMKYLKKLELEFN
                     SEHECRIFLEPMDNYFRISEAKDYLLLNFTESDTSSQIDNISHSELEFKEKSVPIQLK
                     ESNTDKNNNGHFNMQDNSYRNTQLQTPERSDLKRNDKNDNDSIQNNKAHSNGEQYPSS
                     EYGILLKPQPALCSSPLSDLNKKRLQRSLSKSSKNLKLVMEQQFNTTLNQSIEVMKEN
                     IIIPSSVAYQDHLIDKDLGRHRLIEGGRLTSQFVGHKPNNIPKVTSVSKTKPKSVKTA
                     DINVLNTIFGSASCTVRSYKVGRSKGKNVKPTTRSINKGKKMIANNNSENIHSNKTVK
                     EKSNLVANLVPVETSTSQNRSKEIISHINSKVPNQEVSGIEDHTISLNNSGTLCDINT
                     SKDANLSLSKSISKGAFSKSIQDQLANSINAIANQMISRISIINELLNKKIMQELSEK
                     YEVLFSELHKSFKGDVERMVEFVGDLNKMSDLTEEEVIAEIRKRNIINSNITVETRRE
                     "
     gene            <592414..>592617
                     /locus_tag="CAGL0K06061g"
                     /db_xref="GeneID:2890451"
     mRNA            <592414..>592617
                     /locus_tag="CAGL0K06061g"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_448486.1"
                     /db_xref="GeneID:2890451"
     CDS             592414..592617
                     /locus_tag="CAGL0K06061g"
                     /inference="similar to AA sequence:UniProtKB:P02380"
                     /note="similar to uniprot|P02380 Saccharomyces cerevisiae
                     YOR167c RPS28A or uniprot|P02380 Saccharomyces cerevisiae
                     YLR264w RPS28B"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_448486.1"
                     /db_xref="GeneID:2890451"
                     /db_xref="GOA:Q6FLC3"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /translation="MDNKTPVTLARVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNV
                     KGPVRENDILVLMESEREARRLR"
     gene            complement(<593405..>594349)
                     /locus_tag="CAGL0K06083g"
                     /db_xref="GeneID:2890452"
     mRNA            complement(<593405..>594349)
                     /locus_tag="CAGL0K06083g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448487.1"
                     /db_xref="GeneID:2890452"
     CDS             complement(593405..594349)
                     /locus_tag="CAGL0K06083g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448487.1"
                     /db_xref="GeneID:2890452"
                     /db_xref="GOA:Q6FMQ7"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ7"
                     /translation="MVNAWKVGEIDGRYNLLKQDIDRDGTKLLKITIHMTEALLVPQS
                     STLKKSLKTYAVKLDSARKQLKSQGFDLQSSDNLIKIVIEFLNNLNCYTKNNYKDSKC
                     EMSLHKSDMKITIKLDATIKATINLGFVRLTDEQGLLILLELSHFLSETLWYWSRVCS
                     LIDSESNTKNLNNCLIELNRIAEAKESNQIYGRDLAKLFIIREKLLGRQAKLSGMIST
                     RSSKSDELPGEFSEFDSDDMSWRTNSVTPIEILRSEDINELSSQTDKIPAKRVRKEDS
                     IKMESRILDSNYEEAAISESPKRKKKKFGKIVVSPTKK"
     gene            complement(<594713..>596410)
                     /locus_tag="CAGL0K06105g"
                     /db_xref="GeneID:2890453"
     mRNA            complement(<594713..>596410)
                     /locus_tag="CAGL0K06105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448488.1"
                     /db_xref="GeneID:2890453"
     CDS             complement(594713..596410)
                     /locus_tag="CAGL0K06105g"
                     /note="weakly similar to uniprot|Q06150 Saccharomyces
                     cerevisiae YLR267w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448488.1"
                     /db_xref="GeneID:2890453"
                     /db_xref="GOA:Q6FMQ6"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ6"
                     /translation="MKGFEKSMLETLPLEVLDLILDRLGLDEYGDSLAILDCFSIMDA
                     VPRDTTLYSQIRSRFHLLSYVDDPSTRILNLLSGYQDNEKELNHENLIVAVDLDNWDI
                     ETVKIDLEELLHRCSEEHSMALHLLFPLASTDKAYDVAKFYSVIKSVLSEIASSKLFN
                     FESIIFDSISNKLVCDKNMFGILSYEFLETIESAHSDTFDISKVMLPLVTTLQVNYMT
                     LDTFFYNILTKYKGYQRSKSKLVKNFLANFKFYMPNVVNLQFFKTNGCEQIETCNFID
                     VSSLILKKCKENKINVVQMFKIHSLANWKLPNIRKFTGHRFKFDEIATAGSPERLVVS
                     LRENLKLLHDCAMSDTQDGVSYFRVNLIPEGVKKTKIINWVPTEISSNVFSKVEQYTT
                     PIMCVRCESLEELELKLLRFEKSSTIEIQGLYFPNLKKLVLSNKPRITSRPVISHRND
                     SFSLESERKPAHGYTANLEVTRRRMLTTSNRYNKAHNTAYSNVTFAENPSQITDMNPI
                     AFTSWNELPSCEFLGFVSEDSTNYIFNIQNLKEVLPNLNLKNSFPTFVDEKQKFIVV"
     gene            <597610..>598566
                     /locus_tag="CAGL0K06127g"
                     /db_xref="GeneID:2890454"
     mRNA            <597610..>598566
                     /locus_tag="CAGL0K06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448489.1"
                     /db_xref="GeneID:2890454"
     CDS             597610..598566
                     /locus_tag="CAGL0K06127g"
                     /note="weakly similar to uniprot|Q04110 Saccharomyces
                     cerevisiae YDR446w involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448489.1"
                     /db_xref="GeneID:2890454"
                     /db_xref="InterPro:IPR029178"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ5"
                     /translation="MCNCTKIDKTQALENLWSWCVINYISSAACVLVSVSSMFIKSEA
                     GAIENNDKKRYKVNKEKHDTHRKKKDKSILESFLLVPGQLDGASDPAKFVPGLGLKTP
                     IKDEGNISLPSINLPPSEMRSRWRSSGSLFGPQEVDNNLLPKVNKSPGVKTPTSTKQR
                     PHSTQPEETKPADTLVTPTSPLVEERQNNADSLKPAEDPGPFKKQTRLLYEVQNDMTI
                     DDDNMTEIFPGLEKEEEKTYCRQSSLWSLDQWIEEGENILRAHQEIFIKIIKKRIELS
                     YNFNSLITVLIDRAEALCKHGNVIDSKLEKVKKLGNEILNIL"
     gene            complement(<598820..>599625)
                     /locus_tag="CAGL0K06149g"
                     /db_xref="GeneID:2890455"
     mRNA            complement(join(<598820..599227,599623..>599625))
                     /locus_tag="CAGL0K06149g"
                     /product="40S ribosomal protein S17"
                     /transcript_id="XM_448490.1"
                     /db_xref="GeneID:2890455"
     CDS             complement(join(598820..599227,599623..599625))
                     /locus_tag="CAGL0K06149g"
                     /note="highly similar to uniprot|P14127 Saccharomyces
                     cerevisiae YDR447c RP51B or uniprot|P02407 Saccharomyces
                     cerevisiae YML024w RP51A"
                     /codon_start=1
                     /product="40S ribosomal protein S17"
                     /protein_id="XP_448490.1"
                     /db_xref="GeneID:2890455"
                     /db_xref="GOA:Q6FMQ4"
                     /db_xref="InterPro:IPR001210"
                     /db_xref="InterPro:IPR018273"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ4"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTMDFQTNKRLCDEIATIQSK
                     RLRNKIAGYTTHLMRRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSKGVLNV
                     DNQTADLVKSLGLKLPLSVINISAQRDRRFRKRN"
     gene            <601814..>603151
                     /locus_tag="CAGL0K06193g"
                     /db_xref="GeneID:2890457"
     mRNA            <601814..>603151
                     /locus_tag="CAGL0K06193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448492.1"
                     /db_xref="GeneID:2890457"
     CDS             601814..603151
                     /locus_tag="CAGL0K06193g"
                     /note="highly similar to uniprot|Q02336 Saccharomyces
                     cerevisiae YDR448w ADA2 general transcriptional adaptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448492.1"
                     /db_xref="GeneID:2890457"
                     /db_xref="GOA:Q6FMQ2"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR016827"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ2"
                     /translation="MSNKFHCDVCSSDCTHRVRISCAVCPEYDLCVPCFSQGLYNGNH
                     RPFHDYRIIETNSYPILCPDWGADEELALIKGAQSLGLGNWHDIAEHIGSREKDEVRD
                     HYIEYYINSPFYPIPDITKDIQVPQEEFLNERKTRIEKFRDRPLEPPKKPMASVPSCH
                     EVQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDLELKFAILDIYSSRLTVRAEK
                     KRLLFENKLMEYRKLQNIDKKRSKEAKDLYNKIKAFARVMTAQDFEEFSKDILEELQC
                     RTRIHQLQEWRSKGLTTLEAGLKYERDKQSRISTLERLGNYGDASLGNLGSSQAGTPG
                     VAGTRYRSTPGHRSNTDYSQNGTDSNGKKKGITISDIQHASDYGLLSPEEQQLCIQLK
                     ILPKPYLAIKEVMFRELLKTGGSMPKKNCRDLLNIDPVKANRIYDFFQLQHWI"
     gene            complement(<603441..>604802)
                     /locus_tag="CAGL0K06215g"
                     /db_xref="GeneID:2890458"
     mRNA            complement(<603441..>604802)
                     /locus_tag="CAGL0K06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448493.1"
                     /db_xref="GeneID:2890458"
     CDS             complement(603441..604802)
                     /locus_tag="CAGL0K06215g"
                     /note="highly similar to uniprot|Q02354 Saccharomyces
                     cerevisiae YDR449c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448493.1"
                     /db_xref="GeneID:2890458"
                     /db_xref="GOA:Q6FMQ1"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013949"
                     /db_xref="UniProtKB/TrEMBL:Q6FMQ1"
                     /translation="MSSRTRYYLEQCIPEINDLVEKELFTKNEVAKIMKKRTDFEHRL
                     NSRGSSIRDYMRYIDYETQVFKLRAKRCQRILQSKRTNSISDKSIEQRIAFIYQRGTN
                     KFPRDLKFWAMYLNFLKKMGTETSYKKVHTVYNQLLRLHPNNVDVWISCAKYEYETHA
                     NFKSCRVVFQNGLKFNPDSPKLWYEYIKFELNFVTKLINRRRVMKLINEREQELDMLN
                     EQSQSTKNAVNSKSMDDDNEENENGIKVPSTGDNMKDKLNELPEADMNMLGNAETNPA
                     LRGDIALTIFDIAMAELGKHYINKQKGYYANTDSSIDKELQKETVQYLYEKSLEIIQL
                     FDQFKDLQRDYLINHVIQFWKNEHFSVSVSNDMPEIYSDIIVTEVTLLLRYMDIKNLD
                     YDKLQLSVRNYMAYKNKTKEEANKKILQKKFKTFLESRFTENASDEEDNKLKILHQII
                     AKL"
     gene            <605408..>607399
                     /locus_tag="CAGL0K06237g"
                     /db_xref="GeneID:2890459"
     mRNA            <605408..>607399
                     /locus_tag="CAGL0K06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448494.1"
                     /db_xref="GeneID:2890459"
     CDS             605408..607399
                     /locus_tag="CAGL0K06237g"
                     /inference="similar to AA sequence:UniProtKB:Q04119"
                     /note="similar to uniprot|Q04119 Saccharomyces cerevisiae
                     YDR452w endopolyphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448494.1"
                     /db_xref="GeneID:2890459"
                     /db_xref="GOA:Q6FMQ0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR012358"
                     /db_xref="InterPro:IPR029052"
                     /translation="MAVNEKDVGRKSRVSVVLWVFIALGTLFLCKNAFTFSSESIHGL
                     KISSDDSDSVDIERQISLGLTPRKPVVITDLRTGNKRKLHGRFLHITDMHPDEYYVAG
                     TSIDNVCHSGEPTKGKDRAAKFGNAMSGCDSPMLLMDMTLDWIDKNLKDQIDFVVWTG
                     DNIRHDNDRTYPRTEDEIFRMNAEVAEKIKKIFRTPNSPDPRDFAVPVVPSIGNNDVF
                     PHNLFSLGPTLQTREYYRLWGDFIPEEQQRMFDRDASFFTEVIPGKLAVLSFNTLYLF
                     KANPLVDNCDSRKQPGYQLLLWLGYVLDEIRERGMKVWISGHVPPIAKNYDSSCYDKF
                     SLWMHEYRDVIIGGLYGHMNMDHFVPVDVQAIRENMEEQQMSLLSEDERLTKTIREHA
                     IAAREAHLMGAKPVNKESYLDGVLDTYYKGVLQEIEQAVDSDLDIEKKKKKKGKKKKG
                     KKEKRTLEEIYDQHSIVQVSGSVIPTFNPSIRVWEYNISDITDSSSIFGENQLEYQSW
                     DLFFEDLEHKMKNEFDDNESSFWAASAEQNKKKKKKNGKPDKSIPRKKPDELPAGPGH
                     IQQLFSPTKFVQYFADLDSINSEYEKLIDKGLAEHDAINKAFNYEVEYTSKDEPYPME
                     SLLVKDYLHLAADLARDNGLWKIFKERAFISTGYEDERN"
     gene            complement(<607703..>608299)
                     /locus_tag="CAGL0K06259g"
                     /db_xref="GeneID:2890460"
     mRNA            complement(<607703..>608299)
                     /locus_tag="CAGL0K06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448495.1"
                     /db_xref="GeneID:2890460"
     CDS             complement(607703..608299)
                     /locus_tag="CAGL0K06259g"
                     /note="highly similar to uniprot|P34760 Saccharomyces
                     cerevisiae YML028w Thiol-specific antioxidant protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448495.1"
                     /db_xref="GeneID:2890460"
                     /db_xref="GOA:Q6FMP9"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP9"
                     /translation="MVAQVQKPAPTFKKTAVIDGMFEEVSLDKYKGKYVVLAFVPLAF
                     TFVCPTEIVAFSEAAKRFEALDAQVLFASTDSEYSLLAWTNVARKDGGLGPVDIPLLA
                     DTNHKLSRDYGVLIEDEGIALRGLFIIDPKGIVRHITINDLPVGRNVEESLRLVEGFQ
                     WTDKNGTVLPCNWTPGSATIKPTVEDSKEYFKEANSKN"
     gene            complement(<609816..>610373)
                     /locus_tag="CAGL0K06281g"
                     /db_xref="GeneID:2890461"
     mRNA            complement(<609816..>610373)
                     /locus_tag="CAGL0K06281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448496.1"
                     /db_xref="GeneID:2890461"
     CDS             complement(609816..610373)
                     /locus_tag="CAGL0K06281g"
                     /note="highly similar to uniprot|P15454 Saccharomyces
                     cerevisiae YDR454c Guanylate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448496.1"
                     /db_xref="GeneID:2890461"
                     /db_xref="GOA:Q6FMP8"
                     /db_xref="InterPro:IPR008144"
                     /db_xref="InterPro:IPR008145"
                     /db_xref="InterPro:IPR017665"
                     /db_xref="InterPro:IPR020590"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP8"
                     /translation="MSRPIVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPG
                     EVHGKDYNFVTVDEFKSMIDGEKFIEWAQFSGNYYGTTVDSVKAVISSGKTCILDIDM
                     QGVKAVKTKDLNARFLFVAPPSMDDLKARLQGRGTETDESLQKRLAAADAEMEYANSG
                     AHDKIIVNDDLDKAYNELKQFIFEN"
     gene            <611434..>621177
                     /locus_tag="CAGL0K06303g"
                     /db_xref="GeneID:2890462"
     mRNA            <611434..>621177
                     /locus_tag="CAGL0K06303g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448497.1"
                     /db_xref="GeneID:2890462"
     CDS             611434..621177
                     /locus_tag="CAGL0K06303g"
                     /inference="similar to AA sequence:UniProtKB:Q03280"
                     /note="similar to uniprot|Q03280 Saccharomyces cerevisiae
                     YDR457w ubiqitin ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448497.1"
                     /db_xref="GeneID:2890462"
                     /db_xref="GOA:Q6FMP7"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR010309"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025527"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP7"
                     /translation="MVKLTRFEKLQKEKNAEYFKPFLDDLEQSSQDEFVKKLRDFDFN
                     DRPRNDLFVWIPVLNRIDDILSKFVEKYHYSYTKAPEPLKLMNDEDLNVTVELTEFST
                     KLLCNTENRYIYSSMDVMSNLLNCPNFEVKLGAIRVLATMGERYVIARERIDATKNVL
                     GTHPLKNKALKLALAIPSSAMDENGEHFALTDLYFEKKKYPSKWSKLRYTYYASPKTN
                     SASSNVKSVDCSDSNSHSSAQQGVSMLKFSMNSEELSKLTIQEILDKGMKVIPAEEWF
                     DFSLKAIAAKAFSDDSEDNLHLRETIIRTKMNAIALVNTVYLPPQVSSKFFEVDPYAF
                     NSLTDFISLSEVKISKNLRLDALFALECISLKHVWCSDIMRNLGGNMSHGLLFQILRY
                     LSKILREKSSEVDEIYNVRFFYLISNLADVKVLHEALLAAGLIPALLDIVSIKNLDYR
                     RTLASATHLLEVFINDSDSTNEFINNDGFTTLIKSIDEEINYAIENKGQFNPPEFIKV
                     YYAISFRQLSYIRSHLKLVIKLLKTDSGDRIRNLIDSPILGSLKKIMTNRELFGYTLI
                     TYTLDIIQRVINSEPTIYPILNEAGLIPYIIENFESLMGPYSELLTLLPDVISAICLN
                     TEGLQKVKDNGLIKSLFKTVTNLDYAIVLSWKEESVDFGTSMDELARHYPDLQDEICN
                     AFSDMVKTLPDIVKFNQPFLYQSNTGEDIIYRSKTDKVVRDEEGSQELAFWDIQKDSP
                     IVDCFSNVFYGMTLENSALHDLPEKLDFKTLFNAIVLNNVPFDFSMSQTMLNYTDVLQ
                     LFDEHFKDYAFPGILEIMDDQLKDLEEFINVTEQSTSILQDVGSIDLNQRVDSIISKL
                     SKLLATQYIVTNVYLNITTLTPNKFKEILTFFKKFGIGLIHRLRLLFQRCALEESFIR
                     KNLPDEVAKETMPDTIGGNTPPIQIHVSKPQKEETKDNGTSAKFKNTYQIRSILNKLQ
                     STSSILFRCFLRLKSTDANVESRQMELQIYDTVVENVLHLLTAVPLQGNLQYALVVLN
                     FNTYIFTFPKTSITANEVLQTVPSYLFLQKGGYDIYERLVVELFGEMSKFSNVASVEE
                     IDYVKDTQEVLILSCIINALTFFNKPTNMDTMELVPSIKYYYDGFEDNINLTKALMGP
                     VKISAATMIKQIDNKFNLFNPVSRTVPYAVFKQLLTLLKNLFSPGQETASGLFVLDCK
                     YFPTSENIREAIREKDLQNGNLKAIKAKLDDKTLTLSDVVKLIPDFGFYNSVPKLVTK
                     HTSVSLIGIKNDSFYKELPDKVFNILPYYPKLVNAFARTLLQILADWKISGETFAATV
                     LEKVEKTNIKDEATLSSFIHLFGIFLNEKIVYSKSEASVMHFLTYMRENLKPQYVNAS
                     WFSKALYAYEIVLAKSEIPQMEKLDEDVKARYKLWSPLVAHRIPDETKKAIFDILIRV
                     NDISSFYSALATSRILIFYARDEEYAKEITHSGILSRLLKVIGMFQKSEKINFLESSF
                     LLLIRRCFETTSIISTLIRNEIHKSFTTRPIGNYKERERELSGLLEEKPHVVMRSPSV
                     FVDILCENARFSEFDKSDYITNYIMRRNFDLDKKTTSITQNTNENEIIPSRRTNIVHL
                     LLSQLMAASEKDWISEPANHPPVDIPSKPSKVDPSKNPVCAYMICLLKMLLELIGSYK
                     QSKFEFLTYNRRNVYSEKPKPRVTALNFFLYKLIDRPAGTEKNVYAQRRREVISTLAR
                     SVIVAFISDTQIQITPKQDLTKQDPDMVFIRKFTIESVIKVIKNSTSSPKILENNVSR
                     LESWFKIIGSMVYVQAPYLRSILDTNKIEADQYQICKLMIELGVPTAITDCMANLDLN
                     YPFSRTLFNEAVDALNAINFTRNNFSDLFKVESHDDEDDVDEDSEKEENKDMFRNSAL
                     GMYDVEDIEEDDDDEEEEGSLIGEEDGIAFVDSEDGGFEVVFSDESDENNEHPSSEYG
                     ESDSENDGEIQVEIAEESISGDEHDEEMTNSSEGESSSYDSDDISIIDENGYEYDSDI
                     DLELEDYEVEDSDWESGLSDFSSSSNGDEDNHEDSEHDSGRRRWHVTHGVDLIEDSIS
                     DSERGVFQGIEHVFHTENQPLFRVQNDSVARHHDRSFRRNHGISFGSPALTLFNSSRR
                     SQNNLINPLGPTGLEQVENDITDQLATIGSGTRPRTERSNFDEVLFSGELFDERPLDG
                     IILKSSVARWKDIYDMFYDSKGYANCVVTKILNKIYKPSLDLFREEEKKYNEKLEEKI
                     RKVKEKQRRNSHLSHRSSFSVSDDSTIDHEPLGDTQGPINSEDTGETQQHRDPVYVNI
                     EGRDVDISGTDIDPEFLRALPEDMRAEVFAEHVRERRAEAFQNNIHLREIDSDFLDII
                     PDEIRNEILDEEAGEEHVSEIIHNARNSGDDRINLDEIESNTDEDHSDHEPVPEAATE
                     DKKKNGRIYFSPLVDRAGIAALMKAIFISQPYIQREVYHELFYRLCSSKQNRGDIVNI
                     LLFILSEAINDQASLEKVYNSISSRALGKSGGATATKQLPPDCTPLTVANQTIEILQN
                     LIDADGRLKYFFITEHDNLVVNKIGTKHKKESSTKAFQFPIQYLITLLSKKIITDETV
                     LMDLLTRILQVCSKPIATLAKKDKSNQKESKKLQIPNFKKEELRQLVSIIKLDSCNTR
                     VFQQTITILQNLSTIADNKDIFIKDLVENARNIVADLSEELRSLCKEGTVVESGAEIN
                     SDLVQKFTVPSSNQAKLLKVLTVVDFLYSDNISEEMIDTNKLSEIYKSMALGEIWVEL
                     SKCLFEFEKRKHLSTSATVLLPLIESLMIICRHCRPSIAPILKYEEEKNLDFKRMDTG
                     ELFLHFTDLHKRLLNQMVRSNPKLMSGPFASLVKNPKILDFDNKRYYFIAKIKSDKTE
                     APKLPIPVRRDQVFLDSYRALFFKSNEEIKNSRLEITFKGESGVDAGGVTREWYQVLS
                     RQMFNPGYALFTPVASDKTTFRPNRASGVNPEHLSFFKFVGMVIGKAIRDQCFLDCHF
                     SREVYKSILGKPVALKDMESLDLDYYKSLVWILENDITDIIEETFSVETDDYGEHKII
                     DLIDNGRNVSVTESNKQDYVRKIVEYKLHTSVKEQMDNFLSGFYALIPKDVISIFDEQ
                     ELELLISGLPDIDVDDWKNNTTYVNYTESCKQVSYFWRAVRSFDAEEKAKLLQFVTGT
                     SKVPLNGFKELSGVSGVCKFSIHRDYGSTERLPSSHTCFNQLNLPAYASYDTLRGSLL
                     IAINEGHEGFGLA"
     gene            complement(<621549..>623378)
                     /locus_tag="CAGL0K06325g"
                     /db_xref="GeneID:2890463"
     mRNA            complement(<621549..>623378)
                     /locus_tag="CAGL0K06325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448498.1"
                     /db_xref="GeneID:2890463"
     CDS             complement(621549..623378)
                     /locus_tag="CAGL0K06325g"
                     /note="weakly similar to uniprot|Q03281 Saccharomyces
                     cerevisiae YDR458c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448498.1"
                     /db_xref="GeneID:2890463"
                     /db_xref="GOA:Q6FMP6"
                     /db_xref="InterPro:IPR018996"
                     /db_xref="InterPro:IPR025856"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP6"
                     /translation="MSENRQGIDLSKLTAAQLRFVLAENKVSFPSKAKKADLLRLCNK
                     LIDESDAEEVSQRIGAAIAKERVDHETKLRLRQKKMKESAKANSEPAESLPAEKVSVQ
                     KSPNKKSVAGKKHSRTESEDEDSDKNKKKRAKSTDDNIKIKNNQSAAVNSTSALATPV
                     KAAESSSPSRNKLESKPDIPVTRGAMHDEIKKESSAKKGKKKLQEIENLVTSQTPKKL
                     SEQVQKISQKAEEVVEEIKEDIKEELCPTKDEFVKHKEEEPSKLFAVLDEIMIYLFKF
                     LVIVLPILFFLWYREQKIRVGFCGHELPVAKFAPYANSNKVWASVDKTLERFLPKCKL
                     CPEGAICKTHLQMSCKDGYVLRKSWWNLESLLPLADKCITKRKAANKKTPLLFALDLL
                     RTQNANTHCGSTLPDNYQAGMLEKDLFNNVYEEYRDMMTKESFEKEWAVLSNSLKRLP
                     EIYYKTFVSKNVAGNIENIQLFRSLSKQNVSYFCGIFKLLKEFPIEKNVLFVALTIFS
                     CTVTLEIILQKLWKCQNRENAFVEKSTEKALEKLREASRDPEVKFLDTVQLREFLLSE
                     TTNLKKKNQLWDKISSKLLENENVEKRQMELYGEVLGIWEWND"
     gene            complement(<624046..>625104)
                     /locus_tag="CAGL0K06347g"
                     /db_xref="GeneID:2890431"
     mRNA            complement(<624046..>625104)
                     /locus_tag="CAGL0K06347g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448499.1"
                     /db_xref="GeneID:2890431"
     CDS             complement(624046..625104)
                     /locus_tag="CAGL0K06347g"
                     /inference="similar to AA sequence:UniProtKB:Q03289"
                     /note="similar to uniprot|Q03289 Saccharomyces cerevisiae
                     YDR459c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448499.1"
                     /db_xref="GeneID:2890431"
                     /db_xref="GOA:Q6FMP5"
                     /db_xref="InterPro:IPR001594"
                     /translation="MGFAEWRLRNKYWTIYIVPLVVLLLMIYGTWAYCHKLCYERVYR
                     DFGHKATAIGLICTCCVLDALIIAIWVLIVSCGPGHQPGVAPHLLVDSADLENTTVAP
                     NCYQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFV
                     QFVFYFAVLLMIVWITISVYIRDIRQYHARLNANLIVLLIISGIGWLMTSGLFVSYIY
                     YMSQNLTSIEVIDLKKRKRTPELSMQRLYCYYNSDDHYRYVVKLDNDFKGSVYKKHWL
                     KNIKEFMGSNPMLWFIPLPQYWHESPLANGERDVNTIVSPYQEEVGPHTIDYIKKRIE
                     SGEYIHKFKEPGREKTHL"
     gene            <625535..>626527
                     /locus_tag="CAGL0K06369g"
                     /db_xref="GeneID:2890432"
     mRNA            <625535..>626527
                     /locus_tag="CAGL0K06369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448500.1"
                     /db_xref="GeneID:2890432"
     CDS             625535..626527
                     /locus_tag="CAGL0K06369g"
                     /note="highly similar to uniprot|Q03290 Saccharomyces
                     cerevisiae YDR460w TFB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448500.1"
                     /db_xref="GeneID:2890432"
                     /db_xref="GOA:Q6FMP4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /translation="MSSAVASKGMNQGSEFDDNKDMCPICKTDRYLSPDVRFLVNPEC
                     YHKICESCVDRIFSLGPAPCPYKSCDKILRKNKFKTQIFDDVGVEKEVDIRKRVFNVF
                     NKTLEDFDNDLEAYNKYLEEVEDIVYKLDNKIDVVETEEKLRTYEELNKQLIMNNMER
                     SKKDLENFEQRQQFEKEMRMKKRMLERQIESEDKMNKEWAKREIVNRLASSTNADDVI
                     EGVKNTVKLKKSSARRKLEEINRVLQNNPYSSLMLSQGLSRKEDNVPFTPFNGDRDLD
                     KRYTIDQESYDDPFIKDLENRKDYIASGFRSDFVYDRMLTEAFMGLGCVVAEEV"
     gene            <627730..>628170
                     /locus_tag="CAGL0K06391g"
                     /db_xref="GeneID:2890433"
     mRNA            <627730..>628170
                     /locus_tag="CAGL0K06391g"
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /transcript_id="XM_448501.1"
                     /db_xref="GeneID:2890433"
     CDS             627730..628170
                     /locus_tag="CAGL0K06391g"
                     /inference="similar to AA sequence:UniProtKB:P36527"
                     /note="similar to uniprot|P36527 Saccharomyces cerevisiae
                     YDR462w MRPL28"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL28"
                     /protein_id="XP_448501.1"
                     /db_xref="GeneID:2890433"
                     /db_xref="GOA:Q6FMP3"
                     /db_xref="InterPro:IPR019192"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP3"
                     /translation="MLRNTVGKSKTSIEQLMAKSQIVRYKRTKSQGGLSPLTQRVVTQ
                     LSVLSAARKQPKLLKLSKEDLVKHQTIERSWKLYQQQKTTRQLAQLKQQYLAMEEAME
                     TLKSVSPELYEEANISEEGKQFPLDIKITTDAPPNKIWHYNFKK"
     gene            <628640..>629719
                     /locus_tag="CAGL0K06413g"
                     /db_xref="GeneID:2890434"
     mRNA            <628640..>629719
                     /locus_tag="CAGL0K06413g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448502.1"
                     /db_xref="GeneID:2890434"
     CDS             628640..629719
                     /locus_tag="CAGL0K06413g"
                     /note="some similarities with uniprot|Q00947 Saccharomyces
                     cerevisiae YDR463w STP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448502.1"
                     /db_xref="GeneID:2890434"
                     /db_xref="GOA:Q6FMP2"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP2"
                     /translation="MLGREPWIVSSTFELDNKDVVGRKLVKEEEVSKTRHEQEEFVCH
                     YCDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAHMKT
                     RHIMYPSGVKSQERFKSSGHCSHCGEYSPNVEFWVEDHVESGQCTALPEEYILKQSKN
                     GKTERKVNRVKMIKTSNGQSRFISTTRSIMDSKVLLNEDAMEALTIVAEHAKRSDILT
                     KYGTNKILLDSADFDKDVLESKPKNRYTEEPLEDEEEEEEEMGGHPFFGRQKIPSFKP
                     LDTENTNKQDQCIKKNSADQHVPPLDSEQSSMNLDYLLEFEAGTQSVKNPLPRFNKDV
                     ISKQSQRSLEEYTTLYTEYFKDTFN"
     gene            <630381..>635204
                     /locus_tag="CAGL0K06435g"
                     /db_xref="GeneID:2890435"
     mRNA            <630381..>635204
                     /locus_tag="CAGL0K06435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448503.1"
                     /db_xref="GeneID:2890435"
     CDS             630381..635204
                     /locus_tag="CAGL0K06435g"
                     /note="weakly similar to uniprot|Q03291 Saccharomyces
                     cerevisiae YDR464w negative regulator of PRP3 and PRP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448503.1"
                     /db_xref="GeneID:2890435"
                     /db_xref="GOA:Q6FMP1"
                     /db_xref="InterPro:IPR021386"
                     /db_xref="UniProtKB/TrEMBL:Q6FMP1"
                     /translation="MSHNQQDEEDINFQELVGNLLSTHNEQINEDETDNQQNEDPHID
                     LPDLHTAEDDLVAVVANAIQNMDVVEGSHQIEQTPTQTHSSHDDQMEIDKDIELDEEE
                     RQHREWARLLRQGILETEKTETDNIDHIQENEENLDDEDENLRRAILESLNELNVPQS
                     TKQTKKASKKKKKEKDKDKNKKPEKGTEKKPDKKSEKKSEKKSEKKSEKKSEKKSEKS
                     TDKKSDRKQEKKSDKKSTKKSDKKLIKKSDNLVIPKTPSKIQQKSNNQSEQLKTIDDD
                     ISLLNFEDVIQGFMKEGEEAGNKYATAGDDNFAADEIVEATLKAFEKELLNVTEKDKK
                     KKKKPIRQSSTTKDTAISNLKSKTKKSKKDNKTITPNHISTVAKKHISNETPKANLQT
                     DDDEYAKALADVVEQVVSKSFVSNEKASEMKKKAETPRAVIPPIQKRISGPSSLQKQQ
                     QVIPKEKVAQKSKSVKETKHKKDVKKQKPEKTHKLEAAEEPFDMNAIMKNAMDMAFQN
                     HESNDLDTSVIEEFNRGLGDMTIADILAPKSLKAKKKTISKKKSSAELDDRGSDKSKS
                     KLIATKSKLPDKVDNNNHRLPSAAVVTPSVVHETNLEEKKKDLKAKDNKTELTDLRVK
                     TLPSSQQIKVFKVNAGGREAVNHDASAPILHKIKFSNRSDERQKTMPVTKTIETTRMK
                     LSKQYLAAVNEAVSLVKKKRAALNKQKKEEERRLRQERKEQKKLKKLQEKEKKEKESR
                     ELEEIVAKGPPYPADLRLTKSGRPKKPYRRWTKEEMEARVQKSTEEALKPKKVKKVKK
                     KKDKKPKKLSLNALKKIPLFNLSKGLTPLMASLSYLSDGKSSRKDSQNNNIVQKSNNM
                     SSEEMAMNAAKNQKNATNITYYDPSCDAIVRKEIIEYHPPWVIPNNPPLTLPVVTLLR
                     RDAIDKLVPSGKASKRKKKTSEYGTVSAREKMMSSILGPIVNTLKAAAKAKTASGASP
                     EEASKYLATIIQYTKNTIVKALLNARSSQLQSIKTETSVRLDSPSLTNGSQTIPIFNS
                     RKIVNSGNREGNLISPKKGTITIDDKEDTTKKHAVPIKIEEEVTIHDFTPVRTQIPWN
                     NYHILLSNNDAIKEYERLQLWREATVNDICHNNGHINDISNDDINMINSDHGDMTDDG
                     EMAIDPSLYGMDKSASHPIENNIEPVLSHNNKTSQPTSILIEDNELHPPSTKHIEKNF
                     KNTPNSVGNYAHIVDINDESHSITIDVGVDESVENPLSEINETHVKFDNPKPTSRDSD
                     AHISTGSNKADNHKSSDENNTSEEIGSQRNFNSNDNDKGPLINRLIREQLIDLDHESQ
                     KEGSMPDFSDLISNTLSSVLPEIEKSATTMKKPRKVNKETPNNVLNLDGLVPPVSKII
                     KKEESAERLSPTGRVNHTLPKKLVIPLNNISNSNNTLPSVKTEEKSVVKKEVVKIVKP
                     RPVTPTFSFNIPNLKNYPGMATLVTKLLKKYLTAEEFNQFKRESNKERKRKWREANSQ
                     KNWENDLRSRLKRRANEKFGPENNEAKQKWIQEEFDSRVSKDKIKLEGSETIDRSGNT
                     VMTDSDSLQILAGSFGKLDLARKIETEVNDIIEDFIENSNKKKRKVTKNKDIPAN"
     gene            complement(<635324..>636562)
                     /locus_tag="CAGL0K06457g"
                     /db_xref="GeneID:2890436"
     mRNA            complement(<635324..>636562)
                     /locus_tag="CAGL0K06457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448504.1"
                     /db_xref="GeneID:2890436"
     CDS             complement(635324..636562)
                     /locus_tag="CAGL0K06457g"
                     /note="highly similar to uniprot|Q03305 Saccharomyces
                     cerevisiae YDR465c N-delta-arginine methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448504.1"
                     /db_xref="GeneID:2890436"
                     /db_xref="GOA:Q6FMP0"
                     /db_xref="InterPro:IPR017408"
                     /db_xref="InterPro:IPR026480"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSELHSLLTFPVRPISEEHYLGELSRFLKAGIPATYTLEQVAAF
                     ERSELREDADEVSDEEEQSNTTPLHILARSLPGNLSDDEEQVVLHMMDMLFEYGAGWN
                     FIDFENKTVGDLILERNGGNRESPLYQRVVEAGVSAELLLRKLNGGDVEFIDENEIDI
                     CAEASAEVVPKDALDDSTGKVSSVSDDDATAADPDTYLNTKLKYTEDALITENNKDGV
                     MMDWETDIMKLAADTLVSRKPVGESVVLNIGFGMGIIDTFIQERNPKKHYICEAHPDV
                     LKKMKNDGWYQKPNVVILEGKWQDSLNKLLDEGNVFFDGIYYDTFSEHYEDMLDLYDI
                     VVGLVNPEGVFSFFNGLGADRPLCYDVYKKIVEVDVATYGMNCEYTYVDLKGKLPDWK
                     DVKRSYYNCEYYYHPKISFA"
     gene            <637125..>640100
                     /locus_tag="CAGL0K06479g"
                     /db_xref="GeneID:2890437"
     mRNA            <637125..>640100
                     /locus_tag="CAGL0K06479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448505.1"
                     /db_xref="GeneID:2890437"
     CDS             637125..640100
                     /locus_tag="CAGL0K06479g"
                     /note="some similarities with uniprot|Q03306 Saccharomyces
                     cerevisiae YDR466w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448505.1"
                     /db_xref="GeneID:2890437"
                     /db_xref="GOA:Q6FMN9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN9"
                     /translation="MTSRKRSPHEFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCS
                     KRHIIKEAKVKYVTIEKNTLNLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLS
                     LLHKMGTFTDSWAKHFAAQLVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAA
                     ATQNNFSDKDNTRSNANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGS
                     DIWALGCMVYQFIQGFPPFRGENELKTFEKIVSLDYSWNPERQTNFGTINIQVVNLVR
                     RMLTIDTTQRATIDQIKRDPWFANVDWGDKKKLWRGIWQIQNQITPTNAYISPSNMHT
                     NVSHQNILQNRQLHVIDTPLRNIPVTKQKRKKPAKEFNTTSSIVEWRKKLGIASSSTH
                     NSTQSISNIVVDSFKPELPTNKVIITKEIPVGNVSINQVGANLDSQSPIPTSMKLQNQ
                     PSNKELNRTPQTIHPIPAINSLNSPTLPNPNPNPIPPHQDLKGKINHSNEPAIVSASQ
                     SNFVNPAHIGHNSAVREIAETKKRDQQRNISNSNMNLNYTNSLEEVPQMNDGGLSNGV
                     QDENRSRQSSTSNVEASQSTMRIACDMPNGDSKLKNQSSQVEREETIKKPLKITPGLE
                     ILKQDFVYVKTISYDAAGPDMAINSYKTINDDLITSLVAKHKSSLRPINIFPQLLVLY
                     KDGSLAYKEVNTESRKGEKALNPMVNLGDVNLSMYDFEFDESLRRGFLILEKYKYKLW
                     FISLPSYSLLATFPRELTTRLLINNNEKWIDSFFRTRKIIENGFDIDKKIEGLDIKEK
                     KETPAGKPKDELISPTTEKNGSLPPKKADSIKSKKSISSSLNSSTPPVLKKKQATDVK
                     EKPLSKESMNSSTTKTKKPIKPKLRQPPHINTGHSSLVNTTNSGRKRSVSSTPSTPQS
                     PVPNMKVPPRPGSVSHGSPIQYSPSAFSPKPGANSEKIHVSSSRYEVIQSIKNNGNLI
                     DRNQASSGASAAFRSLQKR"
     gene            complement(<640440..>641117)
                     /locus_tag="CAGL0K06501g"
                     /db_xref="GeneID:2890438"
     mRNA            complement(<640440..>641117)
                     /locus_tag="CAGL0K06501g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448506.1"
                     /db_xref="GeneID:2890438"
     CDS             complement(640440..641117)
                     /locus_tag="CAGL0K06501g"
                     /inference="similar to AA sequence:UniProtKB:Q03322"
                     /note="similar to uniprot|Q03322 Saccharomyces cerevisiae
                     YDR468c t-SNARE activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448506.1"
                     /db_xref="GeneID:2890438"
                     /db_xref="GOA:Q6FMN8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR015260"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN8"
                     /translation="MSADPFQEVVDDTREQMKRLAQYLSQHESSSSISPQDEEVAEVQ
                     EIVDDIAETLVDLNRSVDVIEKNNANGVDIENRRETIAQLKDQYEKLKLRFKVQLDTH
                     NSQAEANITVDLEEPDDQNNMTGGQANPFQEQMLREQDTQLDDIHQTMKNLHLQAETM
                     GQELEDQGQLLDDMDQGMDTVAGKLARGRRQLEWVYEKNKERYNDCCIMLLIIALIVL
                     LVLAFIA"
     gene            <641399..>641737
                     /locus_tag="CAGL0K06523g"
                     /db_xref="GeneID:2890439"
     mRNA            <641399..>641737
                     /locus_tag="CAGL0K06523g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448507.1"
                     /db_xref="GeneID:2890439"
     CDS             641399..641737
                     /locus_tag="CAGL0K06523g"
                     /note="weakly similar to uniprot|Q03323 Saccharomyces
                     cerevisiae YDR469w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448507.1"
                     /db_xref="GeneID:2890439"
                     /db_xref="InterPro:IPR007858"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN7"
                     /translation="MEISDVLSKEPEACAPPPSEPVVKPEPEVKQEKQDIKTESPVAT
                     PAISLTEQKPATGSGINLVETIGGSQTRRYLNDKVTPVLLEGMRKIAVEQPADPLRVL
                     GEYLIERSDN"
     gene            complement(<641958..>643496)
                     /locus_tag="CAGL0K06545g"
                     /db_xref="GeneID:2890440"
     mRNA            complement(<641958..>643496)
                     /locus_tag="CAGL0K06545g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448508.1"
                     /db_xref="GeneID:2890440"
     CDS             complement(641958..643496)
                     /locus_tag="CAGL0K06545g"
                     /inference="similar to AA sequence:UniProtKB:Q03327"
                     /note="similar to uniprot|Q03327 Saccharomyces cerevisiae
                     YDR470c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448508.1"
                     /db_xref="GeneID:2890440"
                     /db_xref="GOA:Q6FMN6"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN6"
                     /translation="MDTAELRPYYNEDTFDAGYLVKFNPQKGVVDSNGFNIASKLSIV
                     KNSNSSAKNLDPATLFTTRSNSKGSLFNFSLNFGSRAKALKGSSGSLDSLVKEFEWVD
                     LLNVNKWIAVVSQLMELFVRKYFQLLIQQPFEVSRLLQQVGQFNGESVSHTEEQKKAR
                     HSGIILSDLDNEDEINYFPSTSTPDLLRDGTDNDERDDGEDQYTGQGQTDSVASIEET
                     HIRCLTPERSINPESKHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLEAWYTGL
                     ISPLLHIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRFIVTALYGTD
                     TEVSEEASEGAANKKHDSRSLRHWIRSWSWRHDALKLPSDMWLLTMLQSVSNVSFNKL
                     IDLVIYHKFHVDKYSQMTTYNTMKVLARIAELFVKLPIECLLRRCQLDFLVYKNSSLR
                     IEDTRQLIISPVKYQGVWKSIRDKSEYSSLWNGWRVGFMSIVCSYGVKLLNKFPEHTE
                     QEKF"
     gene            <644415..>644825
                     /locus_tag="CAGL0K06567g"
                     /db_xref="GeneID:2890441"
     mRNA            <644415..>644825
                     /locus_tag="CAGL0K06567g"
                     /product="60S ribosomal protein L27"
                     /transcript_id="XM_448509.1"
                     /db_xref="GeneID:2890441"
     CDS             644415..644825
                     /locus_tag="CAGL0K06567g"
                     /note="highly similar to uniprot|P38706 Saccharomyces
                     cerevisiae YHR010w RPL27A or uniprot|P38706 Saccharomyces
                     cerevisiae YDR471w RPL27B"
                     /codon_start=1
                     /product="60S ribosomal protein L27"
                     /protein_id="XP_448509.1"
                     /db_xref="GeneID:2890441"
                     /db_xref="GOA:Q6FMN5"
                     /db_xref="InterPro:IPR001141"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR018262"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN5"
                     /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKAHPFAHALVA
                     GIERYPLKVTKKHGAKKVAKRTKIKPFIKAINYNHLLPTRYTLDVESFKSVVSTETFE
                     EPTQREEAKKVIKKAFEERHQAGKNQWFFSKLRF"
     gene            <645736..>646401
                     /locus_tag="CAGL0K06589g"
                     /db_xref="GeneID:2890442"
     mRNA            <645736..>646401
                     /locus_tag="CAGL0K06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448510.1"
                     /db_xref="GeneID:2890442"
     CDS             645736..646401
                     /locus_tag="CAGL0K06589g"
                     /inference="similar to AA sequence:UniProtKB:Q03337"
                     /note="similar to uniprot|Q03337 Saccharomyces cerevisiae
                     YDR472w involved in fusion of ER to golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448510.1"
                     /db_xref="GeneID:2890442"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016696"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN4"
                     /translation="MNTIYNESLIFKKKEVSLSAMTFLYQEMISNIHNDCKDINEFET
                     RLSKMGYNIGLRLIELLNFRASATFTSKNFLSSGSNTSNGSSDATITASDQESSLTSF
                     INRMRRRDLKILDVLQFIHGSLWSYLFGHVSNDLVKSSERENEYMIVDNKPKLTQFIS
                     GKNVSCDYFVCGIIHGYLTSAGFPCKVTPHSMPQDGHDNRVVFLIQFDKQVLEREGLR
                     ISQ"
     gene            646893..646964
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0K06611r"
                     /db_xref="GeneID:2890443"
     tRNA            646893..646964
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0K06611r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2890443"
     gene            complement(<647277..>648233)
                     /locus_tag="CAGL0K06633g"
                     /db_xref="GeneID:2890444"
     mRNA            complement(<647277..>648233)
                     /locus_tag="CAGL0K06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448511.1"
                     /db_xref="GeneID:2890444"
     CDS             complement(647277..648233)
                     /locus_tag="CAGL0K06633g"
                     /inference="similar to AA sequence:UniProtKB:P38313"
                     /note="similar to uniprot|P38313 Saccharomyces cerevisiae
                     YBR211c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448511.1"
                     /db_xref="GeneID:2890444"
                     /db_xref="GOA:Q6FMN3"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN3"
                     /translation="MDRDTKLLARLRGSHSRNVKRSKSISFADVDADLDENANVDVDV
                     DVDADENANVDVNADVEPVFDNEYEATPDILDVPVPDTTPHTQGSETGNISTPDVPRY
                     TGVDAHIQSSAYDFEDIPVSRLYSSITSVTTIHVLQAIFTNLLQNDLIPQALTAFNGT
                     TNVPRLSQLKKMSHKLDMRIFQVLAEQLTADLDDLLDINKANNELCYQLKELTANSQL
                     LNKELIAVRKEHQTIKYGGKKHKLENDRANINSKIQLNAQLVELTEALLNDNEDDQAD
                     APLTINSLNLRHTCELLDPHNGLVKRLQSKINEIKSLQEDST"
     gene            <648911..>651319
                     /locus_tag="CAGL0K06655g"
                     /db_xref="GeneID:2890445"
     mRNA            <648911..>651319
                     /locus_tag="CAGL0K06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448512.1"
                     /db_xref="GeneID:2890445"
     CDS             648911..651319
                     /locus_tag="CAGL0K06655g"
                     /inference="similar to AA sequence:UniProtKB:P32831"
                     /note="similar to uniprot|P32831 Saccharomyces cerevisiae
                     YBR212w Negative growth regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448512.1"
                     /db_xref="GeneID:2890445"
                     /db_xref="GOA:Q6FMN2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN2"
                     /translation="MSATTVTDITGTGTGTGTGTTGSASTATAIPLPPTSTIQTSDEP
                     PRTLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIRAKKNLLIPCSSTSDPAPVPAASV
                     PSGQNGAQPPQEDTRDSPSNTTGSASNTPASDSGIQTSEGEQSTQQPLKININGVSFI
                     DPATTQLHHAGYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNW
                     ASGATLQSSIPTTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASR
                     CFGFVRFGNEEERRRALIEMNGVHFQGRTLRVAYATPRSTTVMHTQGNNPHDHHVDVR
                     NTISKAELEKSNLSQYLMNASNNSQRANQLRSANKMHNYPNASGFQQTHYSNDINSGN
                     GLQRGPPQRSYNPGQLHYNSYNQPEVNYGTDMSGGYPPNRADLGRKDGMINTSFVNTQ
                     VSEAALNDFFATDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVK
                     FEHKIDAEAAIQGLQGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQRQELRPQ
                     YQDPSTMLANNNINNQAYTYQHEQFYPSQQQIIYGKTNDFATKPDSLPLLTEVHQQGI
                     QGQPYNQYQQQPLPSQSHQQQSSQQYMQALQRRQQQDLVNQYQYNQMKHMQNTVAQQA
                     GMNVTSTTAWQLSNDIPANSMTNNIVSGADINNDVGNRILEMDAQLHSLNLNPQSAGL
                     NQLPNDNILNSSSPNSARNQINIYGQGDRTMAYPQQVDENSLGMNNVRRPSLTTNNDN
                     FAFT"
     gene            <652186..>652965
                     /locus_tag="CAGL0K06677g"
                     /db_xref="GeneID:2890446"
     mRNA            <652186..>652965
                     /locus_tag="CAGL0K06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448513.1"
                     /db_xref="GeneID:2890446"
     CDS             652186..652965
                     /locus_tag="CAGL0K06677g"
                     /inference="similar to AA sequence:UniProtKB:P15807"
                     /note="similar to uniprot|P15807 Saccharomyces cerevisiae
                     YBR213w MET8 siroheme synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448513.1"
                     /db_xref="GeneID:2890446"
                     /db_xref="GOA:Q6FMN1"
                     /db_xref="InterPro:IPR006367"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028161"
                     /db_xref="InterPro:IPR028162"
                     /db_xref="InterPro:IPR028281"
                     /db_xref="UniProtKB/TrEMBL:Q6FMN1"
                     /translation="MANSLQLAHQLKGKHVLLVGGGEVALTRILKLIKTDCKLTIVAP
                     VIHEKILRKYGGFDTASDGKVHRNEKWVPGCLKLYQYVEDTFNDDYFALDNKEGWSFI
                     MTAIPDQVESERIYKKAKSIYGPQQMVNVADNPPLCDFYFGANVEVEGLQLLISSNGS
                     SPRFAALIRDEVKRHLETLDLEKSVETLGTLRSRIRDLSPDMSQSKYRMQWIKQCTDI
                     FGIQNAARIDVDKLVQLYKTMSQEQSLTFPPRTEVLANYTV"
     gene            <653389..>655035
                     /locus_tag="CAGL0K06699g"
                     /db_xref="GeneID:2890447"
     mRNA            <653389..>655035
                     /locus_tag="CAGL0K06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448514.1"
                     /db_xref="GeneID:2890447"
     CDS             653389..655035
                     /locus_tag="CAGL0K06699g"
                     /inference="similar to AA sequence:UniProtKB:P38314"
                     /note="similar to uniprot|P38314 Saccharomyces cerevisiae
                     YBR214w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448514.1"
                     /db_xref="GeneID:2890447"
                     /db_xref="GOA:Q6FMN0"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR016711"
                     /translation="MTNPKNVVPNSGTSSRHASIVEMLSSPPLLPHQHAQHAHVHRSQ
                     GRSESIESIPLQRSASGTSSITSMGSNNDSSSANAQSANPSAGSATNVGASGTPHSGS
                     GLEAGNTDLSAVPMLQTPSQCLNSAHIHTWKHIQLSQLIEQNKLIFVPGSLSVEETFN
                     TLIKYHLTSIPVEAVPGDMNCLTFDYNDLNSYLLLVLNKITINNKQVTQDCQNGKPVA
                     VGDIVKLTPKNPFYKLPETENLSTVMGILGSGVHRVAITNPEMTQIRGILSQRRLIKY
                     IWDNARSFGTLEPLLNSSLQDLKIGVLNTNSKPTSRQSRVISIQGEEPLIMALYKMHK
                     ERISSIAVIDPQGNLIGNISVTDVKHVTRTSQYPLLHKTCRHFISVILNSRGLETGKD
                     SFPIFHVYPTSSLARTLAKLVATKSHRLWIVQPQEAPTATSSSSTSSSVNTGTISPNP
                     TPTTTSASPAPGATPNALNNHSPLLSTVDDGHTVINPATQATNTTVIQPNLFEKEYRT
                     GKLIGVVSLTDIINLLARKQTANTEVDPQTARRQRGPATQ"
     gene            <655617..>656933
                     /locus_tag="CAGL0K06721g"
                     /db_xref="GeneID:2890403"
     mRNA            <655617..>656933
                     /locus_tag="CAGL0K06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448515.1"
                     /db_xref="GeneID:2890403"
     CDS             655617..656933
                     /locus_tag="CAGL0K06721g"
                     /note="some similarities with uniprot|Q01448 Saccharomyces
                     cerevisiae YBR215w Histone promoter control 2 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448515.1"
                     /db_xref="GeneID:2890403"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM9"
                     /translation="MSNQDSFVSGVGNESHKRSNEVITIDEDTDVKKPKVNTGAKKIP
                     NIAEELAMNRQNVRSSSLSPLLNSDSSSNGSDKTSKSELPRPMIPETKPLPVASLLSG
                     PNNQKLNSTEPKSNSPQSPGSVSIPSLKRNDSESKLNKLKMRALLKNKSPANVRKSLS
                     STSEKSSTATKLDDTEISNAVKQDNKTSKVDKTPQGKKLEGTFKSSLKSKSFTEIDRI
                     GIVSKDKQSKKKDMNAVTPKPRSPKRALPTTKSPNIMSVLEKGKTDIKTLSRPDIIID
                     VPLSLDDSNAYLSEDNQVIFNFQKLIDEKYGISKKAKVPKKNLTMNLLQNLSNNRSGS
                     TLDDEINLSDDEDDFEEEESHIPVKPAVPVNGKKPHPSKGKNLIGKYDIEDPFIDDSE
                     LQWEEYRAATRDGFFVFFGPLVENEDSSAEAKLAPSNNKKLAGKNR"
     gene            complement(<657067..>659034)
                     /locus_tag="CAGL0K06743g"
                     /db_xref="GeneID:2890404"
     mRNA            complement(<657067..>659034)
                     /locus_tag="CAGL0K06743g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448516.1"
                     /db_xref="GeneID:2890404"
     CDS             complement(657067..659034)
                     /locus_tag="CAGL0K06743g"
                     /inference="similar to AA sequence:UniProtKB:P38315"
                     /note="similar to uniprot|P38315 Saccharomyces cerevisiae
                     YBR216c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448516.1"
                     /db_xref="GeneID:2890404"
                     /db_xref="GOA:Q6FMM8"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM8"
                     /translation="MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVK
                     EKEQFLELLLNLLEADTELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAI
                     FNLLALHAKPQECLVTTLELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMK
                     DRDQPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVK
                     FILRRVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAY
                     CVKFLNDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILR
                     ETRGIYEDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSG
                     FNYIENGDHLIDIDIADALYLYLRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNN
                     ILKEKLAELSPLVLHSVLNLLLVKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLM
                     DELDNCAVVFGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKT
                     FITLDPKRAGEIEDLAIKTLKETKKSMKKDYILLVLNYIKFFSTFAHKWNKSKLNEFT
                     TLVATNFSDSKMLPEINAIIDANEKLRSLTE"
     gene            <659308..>659853
                     /locus_tag="CAGL0K06765g"
                     /db_xref="GeneID:2890405"
     mRNA            <659308..>659853
                     /locus_tag="CAGL0K06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448517.1"
                     /db_xref="GeneID:2890405"
     CDS             659308..659853
                     /locus_tag="CAGL0K06765g"
                     /inference="similar to AA sequence:UniProtKB:P38316"
                     /note="similar to uniprot|P38316 Saccharomyces cerevisiae
                     YBR217w APG12 Autophagy protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448517.1"
                     /db_xref="GeneID:2890405"
                     /db_xref="GOA:Q6FMM7"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /translation="MSRLLESEQESESGSENLVSSGSIALSKHEEQKRELGVENRLEQ
                     YSRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSSSHGHTGAPQKVMIK
                     FQSIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQNVGDL
                     WNQFKVNDELIVSYCGSVAFG"
     gene            complement(<660119..>663646)
                     /locus_tag="CAGL0K06787g"
                     /db_xref="GeneID:2890406"
     mRNA            complement(<660119..>663646)
                     /locus_tag="CAGL0K06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448518.1"
                     /db_xref="GeneID:2890406"
     CDS             complement(660119..663646)
                     /locus_tag="CAGL0K06787g"
                     /note="highly similar to uniprot|P32327 Saccharomyces
                     cerevisiae YBR218c PYC2 Pyruvate carboxylase 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448518.1"
                     /db_xref="GeneID:2890406"
                     /db_xref="GOA:Q6FMM6"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003379"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR005930"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM6"
                     /translation="MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSM
                     RTVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPG
                     YGFLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIE
                     TVEEAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTC
                     FVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSI
                     LTDAVRLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQI
                     QIAAGASLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRL
                     DGGTAYAGAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTL
                     LTHPVFISGDYWTTFIDDTPQLFHMVSSRNRAQKLLHYLADLAVNGSSIKGQIGEPKL
                     KTHPQIPRLHDEDGSPVDVSVPPQKGWRYLLQSEGPEAFAKAVRHNQGTLVMDTTWRD
                     AHQSLLATRVRTYDLAAIAQTTAHAFAGAFALECWGGATFDVAMRFLHEDPWERLRIL
                     RKLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKV
                     GVDAVKKAGGVVEATVCYSGDMLQPGKKYNLDYYLDVTEKIVAMGTHILGIKDMAGTM
                     KPAAAKLLIGAIRAKFPDLPIHVHSHDSAGTAVASMAACALAGADVVDVAINSMSGLT
                     SQASVNAVLASLDGQIDTGINVKHVCELDAYWAEMRLLYSCFEADLKGPDPEVYDHEI
                     PGGQLTNLLFQAQQLGLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGDLAQFMVSN
                     QLTPDDIRRLANSLDFPDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRRKLNRRPGLE
                     LAPFDLAKIREDLEARFGDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTRNFLA
                     KPRVGEEIEVHIEQGKTLIIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQVVQ
                     TIAKPKADGHDPLQIGAPMAGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEG
                     LVKDVLVKDGENVDASDLLVVLEEEVKDE"
     gene            complement(<664264..>665967)
                     /locus_tag="CAGL0K06809g"
                     /db_xref="GeneID:2890407"
     mRNA            complement(<664264..>665967)
                     /locus_tag="CAGL0K06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448519.1"
                     /db_xref="GeneID:2890407"
     CDS             complement(664264..665967)
                     /locus_tag="CAGL0K06809g"
                     /note="highly similar to uniprot|P38318 Saccharomyces
                     cerevisiae YBR220c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448519.1"
                     /db_xref="GeneID:2890407"
                     /db_xref="GOA:Q6FMM5"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM5"
                     /translation="MDTPAKTLAKRDIPQFYLLICLYFLQGIPVGLAFGTVPFLLKSM
                     AKETTFTQLGIFSMATYPYSLKILWSPLVDSVYFKKIGRRRSWIIPIQLVSGVMLFFL
                     GTCISRGKVFNGVDDAFHGRNSGGLHNVNVPFLTWCFGTLVFLCATQDIAVDGWALTI
                     LSRDSISYSSTAQTIGLNMGYFLSFTVFIALNSSEFANKYVRNMPLPHGLISLGGYMK
                     TAGALYVLLTLYVIFFTKEVPNSVYDLPITDKVKEKDRELSADKALSPTITNIEYPDH
                     VTIKTENTSSIAYVYRGFLKILKLRSVRTLATIHMVSKFAFQCNEAATNLKLLEKGFK
                     REDLAVTVLIDFPFEIIFGYYVVKWSSANEQKRKLNLSRGNHHKTNRIVKFLVGDGGL
                     LTPWLWGFLGRLTAAMFGNYIVSMFPKDGQISTGYFLLVIIQHLLGSFMSTVQFVAIS
                     AFHSKIADPVLGGTYMTLLNTLSNFGGTWPRLMIMSMINYFTVYSCTLENGSVAILNR
                     GSNIQACTTALRGTAKVVTDGYYIANMFCIIIGTLLYFMFIKKKMLFLQTLPIGSWRC
                     T"
     gene            complement(<666501..>667577)
                     /locus_tag="CAGL0K06831g"
                     /db_xref="GeneID:2890408"
     mRNA            complement(<666501..>667577)
                     /locus_tag="CAGL0K06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448520.1"
                     /db_xref="GeneID:2890408"
     CDS             complement(666501..667577)
                     /locus_tag="CAGL0K06831g"
                     /note="highly similar to uniprot|P32473 Saccharomyces
                     cerevisiae YBR221c Pyruvate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448520.1"
                     /db_xref="GeneID:2890408"
                     /db_xref="GOA:Q6FMM4"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM4"
                     /translation="MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEE
                     LDRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGL
                     KPIVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDY
                     SAWYGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPD
                     FTLPYTAKVEKEGKDISIITYTRNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDA
                     IVKTVKKTNHLITVESTFPSFGVGAEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAK
                     ELEDFAFPDPETIVRAAKEVLSIE"
     gene            complement(<668252..>669865)
                     /locus_tag="CAGL0K06853g"
                     /db_xref="GeneID:2890409"
     mRNA            complement(<668252..>669865)
                     /locus_tag="CAGL0K06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448521.1"
                     /db_xref="GeneID:2890409"
     CDS             complement(668252..669865)
                     /locus_tag="CAGL0K06853g"
                     /note="highly similar to uniprot|P38137 Saccharomyces
                     cerevisiae YBR222c Peroxisomal-coenzyme A synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448521.1"
                     /db_xref="GeneID:2890409"
                     /db_xref="GOA:Q6FMM3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM3"
                     /translation="MTTATASFNDTFRVSDNVAVIVPETGLEVTYRDLSHMVGHFQTI
                     FKDPNSPLYGVVHRQSVIAMSMPNGLEFIVSFLATTMDAKVGAPLNSNYKEKEFDFYL
                     GDLKTSSICVPKGTVGTNAEVLKSAKNFNCFIIELELNPERFRVEYQVYSPKDNYKKA
                     IYSSLNNAKFVNNDNVRFPGYARSSDVALVLHTSGTTSRPKTVPLMHLNIVRSTLNIS
                     RTYKLNETDRSYVVMPLFHVHGLIGVLLSTFRTQGSVVVPPRFSAKRFWDDFIKYKCN
                     WFSCVPTISMIVLKTPKPANGIPHIRFIRSCSSALAPATFHKLEEELKAPVLEAYAMT
                     EASHQMTSNNLPPGKRKPGTVGQPQGVEVRILDDKDNILPQGEIGEVCIRGENVTPGY
                     ANNPKANEENFTKRENYFRTGDQGYFDAEGFLVLTGRIKELINRGGEKISPIELDGVM
                     LSHPKVDEAVCFGVPDEMYGQVVHAAVVLKKGEKMTYDELTAYMQDKVAKFKIPAKVY
                     FVETLPKTATGKIQRRIIAEAFATKKSKL"
     gene            complement(<670283..>671944)
                     /locus_tag="CAGL0K06875g"
                     /db_xref="GeneID:2890410"
     mRNA            complement(<670283..>671944)
                     /locus_tag="CAGL0K06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448522.1"
                     /db_xref="GeneID:2890410"
     CDS             complement(670283..671944)
                     /locus_tag="CAGL0K06875g"
                     /inference="similar to AA sequence:UniProtKB:P38319"
                     /note="similar to uniprot|P38319 Saccharomyces cerevisiae
                     YBR223c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448522.1"
                     /db_xref="GeneID:2890410"
                     /db_xref="GOA:Q6FMM2"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM2"
                     /translation="MKRTLSDAAAKCAERWSRVQYGGSEPVETERAERKTVGSDADTD
                     IEGDSDEDLVVVGEKKVEVHVLSDSEPDIEDARPSKRIKGTDGYVPFRLIRSEAYDES
                     TGHTPYMADLGDIFGDPELREVYLFSFQYDLSFVLRHFTTSIERITIVAQTGTIVPVS
                     SSELTHSPQFSQIFHRLVVKEIYMPPYSCHHSKMIIGIYRNGRGVRVFLPSNNFTWAE
                     TNWPQQVLWSSPFMSISDKAVEMNGFQRSLCDYLSFYKLKELNSLVKDTIMRTDFSGL
                     ADVEFIYSCPKTKGKNIETGLNMFLKSIEKVETELRDVDQISLNLFLCQSSTIGGPIG
                     RRKDNPSNLFTHVIVPTARGFSEAAKSDQQALLKAYHENKTYPCIIYPCMKEIRDASV
                     GINSAGWFNFNYTRNDTQLQQYDWLRNKIKVFYKYNRDYTTKQRLTTPSHTKFYLRFR
                     MPSQSMAQGMRVPEHIDWCLFTSANLSSNAWGTLGSQPRNYEVGVMYKNSNITTKAQD
                     SNLHCQSLQDIIYRKGQRPQTRSVLFPFPSHLQPYETNDQAFYQM"
     gene            <672527..>675097
                     /locus_tag="CAGL0K06897g"
                     /db_xref="GeneID:2890411"
     mRNA            <672527..>675097
                     /locus_tag="CAGL0K06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448523.1"
                     /db_xref="GeneID:2890411"
     CDS             672527..675097
                     /locus_tag="CAGL0K06897g"
                     /inference="similar to AA sequence:UniProtKB:P38321"
                     /note="similar to uniprot|P38321 Saccharomyces cerevisiae
                     YBR225w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448523.1"
                     /db_xref="GeneID:2890411"
                     /db_xref="GOA:Q6FMM1"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM1"
                     /translation="MDSEQGPYNACRYEHPEELEASQENSDNRIDLKVVTGPSPTSMP
                     SSGITTAHSNTSNDKSIQSDVPNTDKILVMDSPQPQLLPMSPSISVRSEQASANNIST
                     SGIRPQTLIVDNKRLSSPMPSPSLGPSQSAITNNSDENSLLMASKNDENPITSSEIFG
                     MIDPLPAVEKSGARQSSSHSHDITTNHNWSYDWNKLPALGTSILKKGPNYNQVLVHKD
                     GKKKELHYDPSYNQHLPEMHIFLNFNSDTSQGDALTYARERLTEYVRFVSDYLKVRKY
                     AFECYPFNIQLASTIETELREYVSYNATHIYNEMGMVIQMWYYQAQKLLLQSNSLLFS
                     TEVVQHLLKTKTSSRKHQQQINNQLAKDESSSVLSAKPDSFAHHRTGSKKTHHKLCTD
                     IDILVIRPQLIVQIGWQLACDEPSLNIGDFPLDLSPWLHDEEDRKIISQTASSVPKES
                     CYKLVSDESELEVLNDENAHSVLVDCMDRSYTLLQEQDKFEVDTNDKDSGLFNVEGEK
                     QHDELPKLKKSTTKTNKKSGFVNFFKRKHTHEDSTDNLTSPTIATNKPDHAKAKLKDL
                     SLGEPMVNLPSNLASPSLSIAPKSNKDNVNSLLNSTTWLVDYYSNLMNNYKKVTLPTQ
                     FIIPDEIQESVNTTNSSERPKSLQRKPSNALLYGKEYLQLRLPFKDNSLPAIYCPWVW
                     SELPHSKWKALLREMYRTVTPGGYVMAVAADISMSNTFSVNDPELNESTFKTTIERDK
                     TYDAVSLEAINRGLHIHTTKHLFKAFKESGFINIKSSILSLKTGDLDTQMGFLNEFLA
                     IVHWDHMMRKVFPDASNPPKDTDPTTLPMRYFEEHLGKVDDNAGCYRMLFLVARKPKK
                     "
     gene            complement(<675277..>676926)
                     /locus_tag="CAGL0K06919g"
                     /db_xref="GeneID:2890412"
     mRNA            complement(<675277..>676926)
                     /locus_tag="CAGL0K06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448524.1"
                     /db_xref="GeneID:2890412"
     CDS             complement(675277..676926)
                     /locus_tag="CAGL0K06919g"
                     /inference="similar to AA sequence:UniProtKB:P38323"
                     /note="similar to uniprot|P38323 Saccharomyces cerevisiae
                     YBR227c mitochondrial clpX-like chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448524.1"
                     /db_xref="GeneID:2890412"
                     /db_xref="GOA:Q6FMM0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMM0"
                     /translation="MLALNSYGCSRAASLVNRIAVNAIICRFMSSSDNASRLLVQQNT
                     NESIPPPRKLKAYLDEYVIGQEIGKKVLSVVVYNHYLRINDKQKKAELQRQREIIEES
                     NNIRAAESTKDGNDPDDNSSGKDDTSPISDVIQKPYKPSEKEAGMRNLKMQIDMKLDQ
                     EDQDLELSKSNVLVIGPSGSGKTLLAQTLARVLDVPIAISDCTQLTQAGYIGEDVEVC
                     IERLLVNANYDVAKAEKGIIVLDEIDKLAKSSSSFGTKDVSGEGVQQSLLKIIEGHNV
                     EITVKKPVKVGTDKNNNQTTAKKDETFVINTSNILFMIMGAFVNLDKIVAKRIRKLQN
                     KEEKDGEEEDMSKSSAYSNSIETINLENGKQTSALNLATPTDLVSYGMIPELVGRVPI
                     ITALEPLQSNDLFHILKEPKNALFDQYTYIFKQFGVRLCMTDKALKKVADFALKERTG
                     ARGLRGIMERLLLNVNYECPDSGISYVLVNEKTVDSLQQTEYSLATHVEAKYYSRGQA
                     DELIADVYAEDEALGRVLDKELGRTSTIAKRKEQSKLLQAQ"
     gene            <677317..>678255
                     /locus_tag="CAGL0K06941g"
                     /db_xref="GeneID:2890413"
     mRNA            <677317..>678255
                     /locus_tag="CAGL0K06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448525.1"
                     /db_xref="GeneID:2890413"
     CDS             677317..678255
                     /locus_tag="CAGL0K06941g"
                     /inference="similar to AA sequence:UniProtKB:P38324"
                     /note="similar to uniprot|P38324 Saccharomyces cerevisiae
                     YBR228w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448525.1"
                     /db_xref="GeneID:2890413"
                     /db_xref="GOA:Q6FML9"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR027520"
                     /translation="MEEFQQIPDFYGCYLLQSISKRQSFYIGSTPNPVRRLRQHNGSL
                     SRGGAYRTKRDGTRPWEMVAIVYGFPSRIAALQFEHAWQHGYQTRYIKSQDRVVKTRK
                     GGRSIHHKLAMITSLLKNEYFRYMDLTLHFFNQKVEEIWKNDKFNVSQTQESIDNNYT
                     VSLSQDALTEINNDTIDDIMDVNEKNMELVQNLYSTTLAEKTKTLLLYKEKIDTGINT
                     CQFCNKIIKHNLSGNISENLFAFCRDTSCTFVSHLACAYRYFMSNTELPKEDTIIPQS
                     PKCPKCYTLLKWCDVIYYSIKLNKDNTTADDKKKTI"
     gene            complement(<678336..>681161)
                     /locus_tag="CAGL0K06963g"
                     /db_xref="GeneID:2890414"
     mRNA            complement(<678336..>681161)
                     /locus_tag="CAGL0K06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448526.1"
                     /db_xref="GeneID:2890414"
     CDS             complement(678336..681161)
                     /locus_tag="CAGL0K06963g"
                     /inference="similar to AA sequence:UniProtKB:P38138"
                     /note="similar to uniprot|P38138 Saccharomyces cerevisiae
                     YBR229c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448526.1"
                     /db_xref="GeneID:2890414"
                     /db_xref="GOA:Q6FML8"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:Q6FML8"
                     /translation="MKLFNVLFFSLLFGYVTAFADYLLKSCNEAGFCVRNREYAANII
                     NSKASYYSIDPKSIDVDDSSGTLSANIIKTIKRPDRHTEITLPLKISFLKSHGASSKS
                     YFRFTIDELRQNVPQSNLLNKYRYNETAKWAFDPSKQWDNSHFTIEKKIKNGKKGIDQ
                     FLFGSTSKDEEYYLILPRDDENMAIELFLDSFQINVLSKGKSVMSINEYNLMNFEHFR
                     SIEDNFQNLLEEESTFNMFKDNFRYSQDDKIPFGPESVGIDFVFKNAKAVYGIPEHAD
                     SLKLKDTRETDPYRLFNVDVFEYFVDSPSPMYGAIPFMFGVSKDVTTGLFWVNSADTW
                     IDIHYSSVNTDQVNTHWFSENGVIDVVVFVAENPSDILEQYTDLTGRPFLPLQSSIGY
                     HQCRWNYNDEYDVLSVQNEMDKAHIPFDIIWLDLEYTDDRKYFTWKDESFPNPRRLLE
                     KLSQFGRQLVVLIDPHLKSRGNKVSDAVVKGKGATKNKKGRLFLGECWPGQSIWIDTM
                     GQIGRKLWKGFFNDFLYKGLSNLHIWNDMNEPSVFSGPETTAPKDVIHAGGFEERSIH
                     NVYGLTVHETTFNATREFYTDSETRPFVLTRSFFAGSQRTAATWTGDNVANWDYLRIS
                     IPMCLSNNVAGFPFIGADVAGFSGNPEPELLVRWYQAGLWYPFFRAHAHIDSVRREPY
                     LFDGPVRNMVKDTIRLRYRLLPTFYTAFYESSRTGAPIMKPLFFDYFAHEELLAIDDQ
                     FFVGNSGIMVKPIVQKGVKETTVTFPPKLYYDYETFALVNDDVSAITNKQVSAPLDTI
                     PIFLEGGHILFQKEKYRRSSELMSNDPYTIVIIPDENGIAIGNLYVDDGKTFAYSNNE
                     FLNTTLKFTSDGLFNRPHSEGNLSATAINTNVTAIKIVTSGLESSFKKQLISKFSSDD
                     NLNTNVESNHIVMKIRYDMSKPWDFVF"
     gene            <681944..>683734
                     /locus_tag="CAGL0K06985g"
                     /db_xref="GeneID:2890386"
     mRNA            <681944..>683734
                     /locus_tag="CAGL0K06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448527.1"
                     /db_xref="GeneID:2890386"
     CDS             681944..683734
                     /locus_tag="CAGL0K06985g"
                     /inference="similar to AA sequence:UniProtKB:P38140"
                     /note="similar to uniprot|P38140 Saccharomyces cerevisiae
                     YBR239c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448527.1"
                     /db_xref="GeneID:2890386"
                     /db_xref="GOA:Q6FML7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR013767"
                     /translation="MNNATSYYRTSGEQDGKLTSTLPSGSTSNTNVRYSSNDNSDGTI
                     QSDTSISQTSHTVKKKRKNTNVACVNCSRNHSSCEQKRPCSRCIKKGIANTCVDAPRK
                     KKKYLEGIDTLPIRVGSNTPHYGTPLQIGYHSASFIDNQQYGQTPRHSIGDFNDIYPT
                     SYKSYPENRYNVRNDQAHRFQSYAANSEYSVLSTIVRQNSLNNNNHQIIHRNRDTITS
                     PGPIQSYNSISSELNSPSSSSPKSNGLTRNNSMSPNAKNFDLNSQQHDTYAHKPPQPY
                     PSSKSHIYSILLGDYGKEILQSQVNLYANHFPLVPFLSVDGTLDFKRIYPSDPSKTEN
                     TDSFFNTKINQYYVNNEFLTFPELKYKIDSGKVEKVTDTENYAVSVSVECPPPDGSRL
                     YNNVEWDHSLKYGTPVEIYKLINEPFSHTPGFRHLLQYLRKRFSQKDLVSMCQNMAYF
                     RPIFIACSITLTEEDMIFMEQCYQRTLLQYVKFIQEIGTPTVVWRRNGQISYVNDEFE
                     ILSGWKREELLDKMSFIVEIIDDESVREYFKTFARIAYNNIKGSEQMDVCRLLTPIRN
                     QVIECKCIWTLKRDMSGLPLMILGNFLPVL"
     gene            <687697..>689907
                     /locus_tag="CAGL0K07007g"
                     /db_xref="GeneID:2890387"
     mRNA            <687697..>689907
                     /locus_tag="CAGL0K07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448528.1"
                     /db_xref="GeneID:2890387"
     CDS             687697..689907
                     /locus_tag="CAGL0K07007g"
                     /note="highly similar to uniprot|P38330 Saccharomyces
                     cerevisiae YBR238c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448528.1"
                     /db_xref="GeneID:2890387"
                     /db_xref="GOA:Q6FML6"
                     /translation="MFRFAQPANVLKGKAPSQIVPPHPKTNSFVHPSAHPLKFNPNSA
                     MTVEVPTHQNGPASNNQYNGNHSRPHFKNQFSSRNSSFTNVMNYGKNHGNNNMSPDSP
                     WYNEVVAFEDCVSQTLYMSQTPRRSNMRNNGNNNMNNGRRTEHPNTQANPLFWDSIGR
                     AMGLYHDLINTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKEMTNY
                     LCKSLREISEDVLNGKVELNEYGAMHLITAFKELLLFQEAVNIWKSAINGSNNYTSNI
                     FLNPRVVGVILPILYENGVSYPEIQSLYEKSSSMINYFHPNLSVGMIRASLSASENQM
                     ALKLFQKLCEESTEMKYGYLIETHLSFIGECKDLNVAQAFFDKALNDEMPYKIDLQVS
                     YVKSFLKNIWSQTGDFNHIYQIWYKSSLHYGRHVNHGISSSLNDTFFDIFFENYANDK
                     VQGFPMLQNIIQNYHNMKNIDEPFFNIILAKCTVWHDRTILEYIDNSYDAFNIPKTIV
                     AYRILLKSMGSIDDVTTQEILQRWINLICKSDEIGQRFIANADWAALRDATVTWTQRN
                     RGISSSSPMSAVNSLAPSTTNTPSPSLSPIPDRDTLSSARNTPNKIWSGTPVPPPSTE
                     MDFYSHPAFQAANASGAFDDMASATVNPTPRKNFTNGIVPNTPQPIDDRMVLYLKIVK
                     RYSPFCRDSRQLARLTTGTAVKYSVLQEVLNQFQSLNVNDIPVPELRNLKPTCV"
     gene            complement(<690501..>692951)
                     /locus_tag="CAGL0K07029g"
                     /db_xref="GeneID:2890388"
     mRNA            complement(<690501..>692951)
                     /locus_tag="CAGL0K07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448529.1"
                     /db_xref="GeneID:2890388"
     CDS             complement(690501..692951)
                     /locus_tag="CAGL0K07029g"
                     /inference="similar to AA sequence:UniProtKB:P21372"
                     /note="similar to uniprot|P21372 Saccharomyces cerevisiae
                     YBR237w Pre-mRNA processing RNA helicase PRP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448529.1"
                     /db_xref="GeneID:2890388"
                     /db_xref="GOA:Q6FML5"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTSIDKQKERLEKLARWKQKKSESKAVLNTQNVNTNSQSSNQNN
                     VSDIENKLEKVKAWKKRKLEVKSDQQTPPATQSEINHTSSVRLEENIQGIKRKKRQKR
                     VSNVFDEVKPINSTPTNDAQLSESDILEKVDLNTEDPLDSFFGNIETTEEFHFEVIDN
                     KVNNDELLDEDNSKFDALQKEQKKLAKAKKNKNKKLLTPVNFRNIDLDPISKCLYNEP
                     EEIKSYTEDEIADLRLDLDNIKIEGKDCPRPVTKWSQLGIPYDIIRFIKDVFSYKSLT
                     PIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAVIFAP
                     TRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDLLS
                     LNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN
                     FASRFLDSPLQITVNAEGMVNERINQKFTICSDESDKFKELLSLLKVFNSETVDEKTI
                     IFVSSQQICDIIEKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSR
                     GLNVPEVSRVILYNSAKTFAQYVHSTGRTARGTREGTSISLLLPNELSSAYILNKAMR
                     DKDFSECPVKEVKNLKQMAQKFEDGLKSGKYKLSTGLGGKGLENMDNSKETSNNDLDE
                     QLKHQDNISISQEADLPDDFKFDTSVETVTNADGTIATVCKFVVNDLPQLVRWEMTKN
                     TSISNMIRETGCSITLRGRYYPPSNVTNDNNTEPKLYLLIEATDDKAVRHCVDLLKDN
                     ARVGFMKATSESLRNTKY"
     gene            <693243..>694496
                     /locus_tag="CAGL0K07051g"
                     /db_xref="GeneID:2890389"
     mRNA            <693243..>694496
                     /locus_tag="CAGL0K07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448530.1"
                     /db_xref="GeneID:2890389"
     CDS             693243..694496
                     /locus_tag="CAGL0K07051g"
                     /note="highly similar to uniprot|P32783 Saccharomyces
                     cerevisiae YBR236c mRNA cap methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448530.1"
                     /db_xref="GeneID:2890389"
                     /db_xref="GOA:Q6FML4"
                     /db_xref="InterPro:IPR004971"
                     /db_xref="InterPro:IPR016899"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSVKPEKPVWMSQEDYDRQYGTVGDGENKTAIVEKTTITTQSSS
                     NVVVGEASKTSSDIGANKIQKRKRHDDFALEEKKRRERERRLREEQLKEHEIKLTAEK
                     ITNVNNLVREHYNERTYIANRTKRNQSPIIKLRNFNNAIKFMLIDKFTHTGDVVLELG
                     CGKGGDLRKYGAAGISQFIGIDISNASIQEAHKRYQSMKNLDFQAILITGDCFGESLG
                     VAVEPFPECRFPCDVVSTQFCLHYAFETEEKARRALLNVSKSLKVGGRFFGTIPDSEF
                     LRYKLNKIGKDVQEPKWGNQIYSIKFSNNDYHENGNEFPSPYGQMYTFWLEDAIDNVP
                     EYVVPFETLRSLADEYGMELILQMPFNQFFVQEIPKWVNRFSPKMREGLTRSDGKYGV
                     EGIEKEPAAYLYTVFAFKKVREHVE"
     gene            complement(<694653..>698015)
                     /locus_tag="CAGL0K07073g"
                     /db_xref="GeneID:2890390"
     mRNA            complement(<694653..>698015)
                     /locus_tag="CAGL0K07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448531.1"
                     /db_xref="GeneID:2890390"
     CDS             complement(694653..698015)
                     /locus_tag="CAGL0K07073g"
                     /inference="similar to AA sequence:UniProtKB:P38329"
                     /note="similar to uniprot|P38329 Saccharomyces cerevisiae
                     YBR235w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448531.1"
                     /db_xref="GeneID:2890390"
                     /db_xref="GOA:Q6FML3"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FML3"
                     /translation="MRASKFYDLPGAHRPSPRDSVNESSSLIGEFQRRTSTSSYNYYS
                     TPSGKAHKVSSRYDPDNPNKDKLGTFDGVFIPTALNVLSILMFLRFGFILGQLGILST
                     LGLLVLSYSINLLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFLGQVF
                     NSGMNAVGLVEPLLYNFGANKNLSDNLSAGVIWPLLPQGEVYSFIYATTILFICLMVA
                     LVGSQTVSRAGNILFFILFASIISIPISLLFKLPFTEGFVKYTGPSWKTFKNNLFPHF
                     TKGAAGSLLKGKENFSDIFGVFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLFTI
                     ICYSVVVMSMGCSIPRNTLYKELQVIQSVSVVQWLIFSGELATSLFSIIVGMVGAAYI
                     LVAIAKDSIFPGLKVFNKHPLSALLFTWFSTQLCLFLDVNKIANFITMTFLMTFAVMN
                     LACFLLSISSAPNFRPSFKYFNRYTALFGTISSVIAMLIVDGLSASELISAMTILFLL
                     IHYFCPPKSWGDVSQNLIYHQVRKYLLRLKQDNIKYWRPQILLFVDDPRSSWNLILFC
                     NHLKKGGLYILGHVTVVNNFQKQLDNIKKQQKAWMKIRDITKIKAFVQIGTGPSLNWG
                     VRNVFLGSGLGGMKPNITVLGAYYLKNYKNKGPESGSASLSQSRISMNSLKAIKSQKM
                     IDAKMNLPTALPTDAYENKVKVTPTQWVQMIEDLSLMQSNIAIAHGFRDLDIPQRDGI
                     KQASKRVIDLYPIQMCGKLESDGNRPSLVSTNLDTYTLILQLGAILVTVPDWKETHVL
                     RVILFAENVNTVKNDIENMQKLLDVLRIQAEVIAVTLDQFRVYNTIVHGEPSAFEYVN
                     RVLEDDDWWNDLVDARRTLNPKRRFSTADGGITGNKTIKTEKYKVAGLQKLGVNLKLS
                     SSVPNQQIISPYESEISDTESTTTSKPTSTSTLTLNGLFRNQNGIYHKNDRRVMSHNL
                     DSSSGKKTLPVFSTGKLPKTKVLEDGIGDKPTLIPVIDTNDPNERQSRKQDLPELSPL
                     NSNESLVKLMENIKFDDLPSRAQHLILNDVMINLSKHSSLLFSTLPLPQLGTHKDETA
                     SMEYIENLDIWLDGLPPTMLINAQMMTVTTAL"
     gene            <698857..>699972
                     /locus_tag="CAGL0K07095g"
                     /db_xref="GeneID:2890391"
     mRNA            <698857..>699972
                     /locus_tag="CAGL0K07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448532.1"
                     /db_xref="GeneID:2890391"
     CDS             698857..699972
                     /locus_tag="CAGL0K07095g"
                     /note="highly similar to uniprot|P38328 Saccharomyces
                     cerevisiae YBR234c AR41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448532.1"
                     /db_xref="GeneID:2890391"
                     /db_xref="GOA:Q6FML2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017383"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FML2"
                     /translation="MSDNSVLKVFKLVKAPIYSHCFSADRSVLAISCEANCLIYRVGG
                     PTPQLVATLANHDKLVTAVDISPHGRIVTCSQDRNAYVWEPLSDGSYKPTLVLLRINR
                     AATSVSWAPSGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHTNGV
                     LLAAGGTDGYMRVFSGFIKGLDSKESVAGSPWGDKFPFGSLVKEWYQGSYIHDVKWRS
                     SQEQIAFVTHDAKLNIVDSQNGYEFTDSPDGLPFKALVWINDNEILCGGYSCHPVLFS
                     KSSQGWKFSKNIDKIGAKTPTPQVGGEDEDENPTFGMSALKKFKELDLKGKVSVEVQE
                     SAHENTITELAPFAESNGQVTEVSSCGLDGKIVIYRI"
     gene            complement(<700195..>700476)
                     /locus_tag="CAGL0K07111g"
                     /db_xref="GeneID:9488032"
     mRNA            complement(<700195..>700476)
                     /locus_tag="CAGL0K07111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999534.1"
                     /db_xref="GeneID:9488032"
     CDS             complement(700195..700476)
                     /locus_tag="CAGL0K07111g"
                     /note="highly similar to uniprot|P69850 Saccharomyces
                     cerevisiae YBR233wa DAD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999580.1"
                     /db_xref="GeneID:9488032"
                     /db_xref="GOA:B4UN37"
                     /db_xref="InterPro:IPR013965"
                     /db_xref="UniProtKB/TrEMBL:B4UN37"
                     /translation="MDNTLTPLQQKVLARYKELVSCLRDLDSSIKDLNQQQLDTKGNK
                     DSSNSSPDEILKEMREIEVKIGLVGTLLKGSVYSLILQKQQTQKFNSES"
     gene            complement(<700931..>702313)
                     /locus_tag="CAGL0K07117g"
                     /db_xref="GeneID:2890392"
     mRNA            complement(<700931..>702313)
                     /locus_tag="CAGL0K07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448533.1"
                     /db_xref="GeneID:2890392"
     CDS             complement(700931..702313)
                     /locus_tag="CAGL0K07117g"
                     /inference="similar to AA sequence:UniProtKB:P38151"
                     /note="similar to uniprot|P38151 Saccharomyces cerevisiae
                     YBR233w PAB1-binding protein 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448533.1"
                     /db_xref="GeneID:2890392"
                     /db_xref="GOA:Q6FML1"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6FML1"
                     /translation="MMTIDKETMGSSSSNGLSPNVLKRKNEDCVDLEAEIKRVALDDE
                     EADNEGNSKSELSSDDRNSSYTSTKLDPKTNIQSQDISLRMLCLVKQASIIVGPKGES
                     INKLKEQTSTKINVSPNIRGVPERVIHVKGSCENVGKAFGKIARIIIEKDSKNNANQS
                     SSSLDSEASQNSSDAEDTTLILNLLISHALMGSVIGKGGSQLREIEERSAAKLYASPN
                     QLMMSNDRILSITGVPDAIHIATYYVAQSLLNCREELKQRKSIFYQPSQMGSALPNSY
                     GAQMYNKFPHQMHHQYHPMDKYNTPRNKKSHRLPRPQSMLANNVPPSINGHAFHDEYM
                     NRPESGQIHYTSANVASAPSFTPTRNIPNVRIVDNPENNMAYSNPIAPVKQDIYIDEN
                     FVGNIIGKEGKHINSVKESTGCAIFIDNRIEGVSERKLTIKGTYMALQAAIMLISNKI
                     EIDRANFEKS"
     gene            <703023..>703922
                     /locus_tag="CAGL0K07139g"
                     /db_xref="GeneID:2890393"
     mRNA            <703023..>703922
                     /locus_tag="CAGL0K07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448534.1"
                     /db_xref="GeneID:2890393"
     CDS             703023..703922
                     /locus_tag="CAGL0K07139g"
                     /inference="similar to AA sequence:UniProtKB:P38326"
                     /note="similar to uniprot|P38326 Saccharomyces cerevisiae
                     YBR231c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448534.1"
                     /db_xref="GeneID:2890393"
                     /db_xref="GOA:Q6FML0"
                     /db_xref="InterPro:IPR011421"
                     /db_xref="InterPro:IPR027124"
                     /translation="MEETDIAKLSEEEYNEEEDEDFDPTKGTAVAGAEVSDGEDDDED
                     DEDDSRVKDSYSHIVSESGGLVKTRRARQQEEEFKRKNKYEGIVEAAISEKVGSIWED
                     LKKESLSRLHNKENDSVISESSKLKKDNHVAGEEMVTIERVYKFAGETIREKKTVPIS
                     SAEAVEYLNNLKFRKSTDQAGSTKRKLEEIDVKENNNTNEDTSESGIDRKKLRRPLKR
                     PPFLEQIISGALKPKLSTLEKSKLDWATYVDKEGINDELSAHNKDGYLAKQDFLNKVD
                     SVKENEYKELRRKEMMIRLQETK"
     gene            complement(<704184..>705146)
                     /locus_tag="CAGL0K07161g"
                     /db_xref="GeneID:2890394"
     mRNA            complement(<704184..>705146)
                     /locus_tag="CAGL0K07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448535.1"
                     /db_xref="GeneID:2890394"
     CDS             complement(704184..705146)
                     /locus_tag="CAGL0K07161g"
                     /inference="similar to AA sequence:UniProtKB:P12904"
                     /note="similar to uniprot|P12904 Saccharomyces cerevisiae
                     YGL115w SNF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448535.1"
                     /db_xref="GeneID:2890394"
                     /db_xref="GOA:Q6FMK9"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK9"
                     /translation="MPGVQNTEGVIEEQRAALESCRHFLRGKSSYDILPVSYRMIVLE
                     SGLPVKRALNVLIQNKVLSAPIWDSKRSRFAGILTLMDFIGLVQYFFSNPDQFDTMDK
                     LRLKDLKEIEYSIGMHAPLENCTIHPERSLFEACELMLQSQTRKIALLDKEDFTEREL
                     VVGMLTQYRILKFLVLNYKDVHFMHRSINSLQLGTRKNIKSCKMETPLIDTIQLMTTH
                     EVSSVPILDENGVLLNAYEASDILGLVKGGIYNDLSLCVGEALMRRGDDYEGIYTCTG
                     EDKLATIFDIIRKSRVHTFYLVDENGRLIGILTLGDLLRYIIEG"
     gene            705518..705691
                     /gene="SNR20"
                     /locus_tag="CAGL0K07175r"
                     /db_xref="GeneID:2890395"
     ncRNA           705518..705691
                     /ncRNA_class="snRNA"
                     /gene="SNR20"
                     /locus_tag="CAGL0K07175r"
                     /product="U2 RNA"
                     /note="LSR1 SNR20 (noncoding RNA U2)"
                     /transcript_id="XR_002648371.1"
                     /db_xref="GeneID:2890395"
     gene            <705897..>706220
                     /locus_tag="CAGL0K07183g"
                     /db_xref="GeneID:2890396"
     mRNA            <705897..>706220
                     /locus_tag="CAGL0K07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448536.1"
                     /db_xref="GeneID:2890396"
     CDS             705897..706220
                     /locus_tag="CAGL0K07183g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448536.1"
                     /db_xref="GeneID:2890396"
                     /db_xref="GOA:Q6FMK8"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK8"
                     /translation="MGFSWLGFPKPARFHFYQFRFATNCPFIAFFMKQSRDGGAYIED
                     KKRLYMGNGSKFTLKKEVRFSLWNGPWLTRYGRVQGLYGTVPFSCHLSLSIGMILLSL
                     GVLYL"
     gene            complement(<707503..>708222)
                     /locus_tag="CAGL0K07205g"
                     /db_xref="GeneID:2890397"
     mRNA            complement(<707503..>708222)
                     /locus_tag="CAGL0K07205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448537.1"
                     /db_xref="GeneID:2890397"
     CDS             complement(707503..708222)
                     /locus_tag="CAGL0K07205g"
                     /note="weakly similar to KLLA0B00495g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448537.1"
                     /db_xref="GeneID:2890397"
                     /db_xref="GOA:Q6FMK7"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK7"
                     /translation="MLSETISKENQKILSSIVFKLFKSISEPLLEFLKDAMESLILLH
                     TNESQYPIFTLRSHVILKLISLHEKINKITKNFSNCENYEKLMRLISQTHKNLISIVS
                     LLSDQLSQYHIREEFSNSISVIFQQISSIFKSFNMFDDIVNQLYYHATATGGSDGSLF
                     YVTDPLLMDITQFNQFNDTLKNEIIMASSGFKEYLLIELNVFQLSKEKLLNHSMDTAI
                     TGDPKFKDFLAKRRQRLNIPN"
     gene            710349..710456
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0K07227r"
                     /db_xref="GeneID:2890398"
     tRNA            join(710349..710385,710420..710456)
                     /gene="tRNA-Trp (CCA)"
                     /locus_tag="CAGL0K07227r"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:2890398"
     gene            complement(<712294..>714624)
                     /locus_tag="CAGL0K07271g"
                     /db_xref="GeneID:2890399"
     mRNA            complement(<712294..>714624)
                     /locus_tag="CAGL0K07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448538.1"
                     /db_xref="GeneID:2890399"
     CDS             complement(712294..714624)
                     /locus_tag="CAGL0K07271g"
                     /inference="similar to AA sequence:UniProtKB:Q04233"
                     /note="similar to uniprot|Q04233 Saccharomyces cerevisiae
                     YML006c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448538.1"
                     /db_xref="GeneID:2890399"
                     /db_xref="GOA:Q6FMK6"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK6"
                     /translation="MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLL
                     KRFLNSNLLGNFSPESPTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQ
                     IHKLTQDKVYHHENHYFLMDELNNFEDPTFLEFGKSNWKMEGTAGTVYDPQNKENTTD
                     ALVTEATAKIDHKISSSNTDDSRFDTLVNDTKDDSSSHEYNAMNLNEQDSITSSNNND
                     SLLSSLSTGGEDSLNQELRRQSDHDESSSIIDQTNDNRKSYSNADTIRSKMIPSEGNI
                     SIDFDQGTDRESTNVDNSNKRTGLDDDGASSIVLNFSHNRNAHKRKTKIDSLLGERYP
                     SDFYTPPQSELVSINSCGSAEDYTGQSLRLMVTKNGTDSKDEQPGDNPNRSKTSVNGH
                     IASPLSDIQNVSINEANMGGQNDQASFSDNESESMYSSDLESEDGEMDHYNASGSDIT
                     LLSILPSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYD
                     AEFSMHNLQILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAPSPI
                     TNKSHEVEKEELDQPTEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAERTKSNMTTT
                     HRSIRTVNSIGDWSISRDTTGIATRAATNTSGQYDDHYQALKFDESSKERLIQGRKDG
                     SGGKYSKHQISRVNTNGSSMPLDSVERTKSLPLPTLLKTASGIETSHIETPSKWGFRS
                     IKRHKNKHKSKGSLTNGDKNRHRRTKKNENSACVLM"
     gene            complement(<718797..>720887)
                     /locus_tag="CAGL0K07293g"
                     /db_xref="GeneID:2890400"
     mRNA            complement(<718797..>720887)
                     /locus_tag="CAGL0K07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448539.1"
                     /db_xref="GeneID:2890400"
     CDS             complement(718797..720887)
                     /locus_tag="CAGL0K07293g"
                     /note="highly similar to uniprot|P47912 Saccharomyces
                     cerevisiae YMR246w Long-chain-fatty-acid--CoA ligase 4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448539.1"
                     /db_xref="GeneID:2890400"
                     /db_xref="GOA:Q6FMK5"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK5"
                     /translation="MVQVSAIYGKAANEHETAPRVNALRARDGPLTRPLDSNASTVYE
                     LALESFQKGGNRRGMGWREITEIHEEVKIIVKKIDGKNVPQEKTWLYYEMTPYRHNTY
                     RELISIMHNLGRGMVKAGIKPNGENKLHIFASTSHKWMKMFLGAQSQNIPVVTAYDTL
                     GERGLIHSMLQTESNAVFTDNDLLTKLINPLKEAKDLKFLIHSETINPKDTRQNGKLY
                     KNAKEALAKIKEVRPDLTIISFDELLRLGKKSKHEIEPHPPKPEDLSCIMYTSGSTGD
                     PKGVVLTHANIVAGVGGVCHNVYGDVGQNDRIIAFLPLAHIFELAFELAAFYWNGILG
                     YANVKTLTNLSVRRCQGDMVEFKPTIMVGVAAVWETVRKGILAKLGELPAYTQKIFWT
                     AYKSKVKLDEAGLPGGGLISKLVFKKVKEATGGCLRIIMNGGSPISEDAQRFLTNVLC
                     PMLIGYGLTETVANATVLSLKAFKYGIAGDLSGAIQVKLVDAAELGYLAKDNQGEIWI
                     KGAPVMSEYFKNEEETKKALTEDGWFRTGDIGEWNEDGQLIIIDRKKNLVKTLNGEYI
                     ALEKLESLYRSNKYVQNICVYADQTKVKPVGIVVGNMKPLEALANSLGLLTGEETIDS
                     VLHDKKLAAAVLKDMLATGKSQGLNGIELLQGIVFFDDEWTPQNGYVTSAQKLKRKEI
                     LEAVKDQVEAVYKN"
     gene            <722554..>722829
                     /locus_tag="CAGL0K07315g"
                     /db_xref="GeneID:2890401"
     mRNA            <722554..>722829
                     /locus_tag="CAGL0K07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448540.1"
                     /db_xref="GeneID:2890401"
     CDS             722554..722829
                     /locus_tag="CAGL0K07315g"
                     /inference="similar to AA sequence:UniProtKB:Q3E846"
                     /note="similar to uniprot|Q3E846 Saccharomyces cerevisiae
                     YMR244ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448540.1"
                     /db_xref="GeneID:2890401"
                     /db_xref="GOA:Q6FMK4"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK4"
                     /translation="MGLFSKEPKIENNRANRKKCWESRDKFFSCLDKNDILKPSDGVS
                     KCKAENQQYETDCVSSWVKYFNEKRIVDFKREQMLKQVEEQNAKLSK"
     gene            <724973..>725914
                     /locus_tag="CAGL0K07337g"
                     /db_xref="GeneID:2890402"
     mRNA            <724973..>725914
                     /locus_tag="CAGL0K07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448541.1"
                     /db_xref="GeneID:2890402"
     CDS             724973..725914
                     /locus_tag="CAGL0K07337g"
                     /inference="similar to AA sequence:UniProtKB:P25619"
                     /note="similar to uniprot|P25619 Saccharomyces cerevisiae
                     YCR021c HSP30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448541.1"
                     /db_xref="GeneID:2890402"
                     /db_xref="GOA:Q6FMK3"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK3"
                     /translation="MVDIFTDVIQNKGGNRAISVNPPHDLDFHITKRGSDWLWAVFAC
                     FGLLMVVYIFLFFIAELKGSRITRYAIAPAFLIAMFEFFGYFTYASNLGWTGVQAEFN
                     HVTVDTPVTGLVPGVRQIFYSKFCAWFLSWPCLLFLIELAGIGTTLNPGEEISALDLI
                     HSLLVQMTGTLYWVVALLVGALIHSTYKWGYFTFGAAAMLVVQGIQVRRQFFVLKTRG
                     FTACLLILSMLIVWAYFICWGVSEGGNKIQPDSEAIFYGILDLCIFGILPAYLVFITN
                     HYGLWPSFKLTKSGEQEMYPEKVEDPESVRASGETAI"
     gene            <731078..>732421
                     /locus_tag="CAGL0K07392g"
                     /db_xref="GeneID:2890374"
     mRNA            <731078..>732421
                     /locus_tag="CAGL0K07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448542.1"
                     /db_xref="GeneID:2890374"
     CDS             731078..732421
                     /locus_tag="CAGL0K07392g"
                     /inference="similar to AA sequence:UniProtKB:P20107"
                     /note="similar to uniprot|P20107 Saccharomyces cerevisiae
                     YMR243c Zinc/cadmium resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448542.1"
                     /db_xref="GeneID:2890374"
                     /db_xref="GOA:Q6FMK2"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK2"
                     /translation="MLSGKEIRIGALLTLDTVFFVIEITIGYMSHSLALIADSFHMLN
                     DIFSLLVALWAVSVAKNRGPDAKYTYGWKRAEILGALVNAVFLIALCFSIFIEALQRL
                     IEVQEIQNPKLVLIVGCAGLASNIVGLFLFHDDGHGHGHSHGGLGSDIEAGESHGHDH
                     GHSHGHDHSHQEEINAGLDPNCPAHRSDEELEEEDTESDGNGFYNNNIGDILTQTAMT
                     RLATENTSLLADSDEAAKKKAEAKKKSQKSLNMHGVFLHVLGDALGNVGVIVAALFIW
                     KTDYSWRHYSDPVVSLLITAIIFSSALPLSRRASRILLQATPSTISADEVQREILAVP
                     GVKAVHDFHIWNLTESIYIASIHVEIDCAADKFESSARKIRRIFRQHGINSATVQPEF
                     IRDDVSPDERRRFSMIAGGSEELPPEPLNPDHLKSSRYGTLSASNISEDAIADDN"
     gene            <734423..>734950
                     /locus_tag="CAGL0K07414g"
                     /db_xref="GeneID:2890375"
     mRNA            <734423..>734950
                     /locus_tag="CAGL0K07414g"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_448543.1"
                     /db_xref="GeneID:2890375"
     CDS             734423..734950
                     /locus_tag="CAGL0K07414g"
                     /note="highly similar to uniprot|P0C2I0 Saccharomyces
                     cerevisiae YMR242c RPL20A and highly similar to
                     uniprot|P0C2I0 Saccharomyces cerevisiae YOR312C RPL20B"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_448543.1"
                     /db_xref="GeneID:2890375"
                     /db_xref="GOA:Q6FMK1"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK1"
                     /translation="MKIVAHLREYQVIGRRLPTESVPEPKLFRMRIFAPNEVVAKSRY
                     WYFLQKLHKVKKASGEVVSINQIHEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSR
                     VAAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLSKDLKFPLPHRVQ
                     KSTKTFAYKRPSTFY"
     gene            complement(<735325..>736248)
                     /locus_tag="CAGL0K07436g"
                     /db_xref="GeneID:2890376"
     mRNA            complement(<735325..>736248)
                     /locus_tag="CAGL0K07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448544.1"
                     /db_xref="GeneID:2890376"
     CDS             complement(735325..736248)
                     /locus_tag="CAGL0K07436g"
                     /note="highly similar to uniprot|Q04013 Saccharomyces
                     cerevisiae YMR241w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448544.1"
                     /db_xref="GeneID:2890376"
                     /db_xref="GOA:Q6FMK0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FMK0"
                     /translation="MAQTIEKKPVSFSNILLGAGLNLSEVTTLGQPLEVVKTTMAAHR
                     EFNFLQATKHVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNF
                     GAGIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEG
                     IRGINKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIG
                     GGLSAWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRVGL
                     GIWQTVFMVGFGDMAREFVAKLTGEKPAAKH"
     gene            complement(<737165..>739279)
                     /locus_tag="CAGL0K07458g"
                     /db_xref="GeneID:2890377"
     mRNA            complement(<737165..>739279)
                     /locus_tag="CAGL0K07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448545.1"
                     /db_xref="GeneID:2890377"
     CDS             complement(737165..739279)
                     /locus_tag="CAGL0K07458g"
                     /inference="similar to AA sequence:UniProtKB:P12688"
                     /note="similar to uniprot|P12688 Saccharomyces cerevisiae
                     YKL126w or uniprot|P18961 Saccharomyces cerevisiae YMR104c
                     ser/thr-specific protein kinases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448545.1"
                     /db_xref="GeneID:2890377"
                     /db_xref="GOA:Q6FMJ9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ9"
                     /translation="MYGWKLHRFKFGRGKDDDSRKKKMIISSSQSSLNSADTAAGDSI
                     FSRPSVERRDTVTAANGSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDSFSP
                     FNSSSNSSSNLGSNRDSSMTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNF
                     TMPVPITSDQGILHNLLNSSISSLEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISN
                     AFSSTFIPAVIKVPGHDDYPLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRK
                     LPFLKCSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLD
                     MNSASNFRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVM
                     QVRKKDTQKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKL
                     YLVLACINGGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILL
                     DSQGHIALCDFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLY
                     EMLTGLPPYYDENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGAD
                     EIKNHKFFNDLIWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSE
                     SVQNQFKGWSYLGSEQLGSSMA"
     gene            complement(<740462..>742165)
                     /locus_tag="CAGL0K07480g"
                     /db_xref="GeneID:2890378"
     mRNA            complement(<740462..>742165)
                     /locus_tag="CAGL0K07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448546.1"
                     /db_xref="GeneID:2890378"
     CDS             complement(740462..742165)
                     /locus_tag="CAGL0K07480g"
                     /note="highly similar to uniprot|P37012 Saccharomyces
                     cerevisiae YMR105c PGM2 phosphoglucomutase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448546.1"
                     /db_xref="GeneID:2890378"
                     /db_xref="GOA:Q6FMJ8"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ8"
                     /translation="MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMD
                     AIPEGAKDAVLVVGGDGRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIR
                     SYAEKCTGGIILTASHNPGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKII
                     KDFPQVDFSKIGKDQQYGPLLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWK
                     LLFDSLNGITGPYGKAIFVDEFDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERV
                     DREKIEFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARS
                     FPTSGAIDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKDGV
                     WAICAWLNILALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYDYEGITTEKANKVVD
                     LLDKFVNDPKSKNAPFPGDESLTVSDCGDFSYTDLDGSVSDHQGLFVKLSNGARFVLR
                     LSGTGSAGATIRLYIEEYSDDKSTYTQSADQYLQKMIKSVTSFLNFKELIGTDEPTVR
                     T"
     gene            <742349..>742990
                     /locus_tag="CAGL0K07502g"
                     /db_xref="GeneID:2890379"
     mRNA            <742349..>742990
                     /locus_tag="CAGL0K07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448547.1"
                     /db_xref="GeneID:2890379"
     CDS             742349..742990
                     /locus_tag="CAGL0K07502g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448547.1"
                     /db_xref="GeneID:2890379"
                     /db_xref="GOA:Q6FMJ7"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ7"
                     /translation="MEVIHSVIAPALYSLLVSLPPLFVQSLPSTPQPHSLRHPFVAPL
                     PSPSRFTANSWSFSPFLLFSFSFSFSPPCPCPSNYRLPRKNSPYKLEGSPPPLTLCLW
                     SLYTVTVAPRTYYVNLDLSRLLALQSLRVLLIQRCGPPTNFTKHSVLHYTLHHIISTC
                     IAISMSSRVLGYNTWLLFPFVLATSNKHVGSELQRMCLPSSLRNYRTMEGEVG"
     gene            <743156..>744133
                     /locus_tag="CAGL0K07524g"
                     /db_xref="GeneID:2890380"
     mRNA            <743156..>744133
                     /locus_tag="CAGL0K07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448548.1"
                     /db_xref="GeneID:2890380"
     CDS             743156..744133
                     /locus_tag="CAGL0K07524g"
                     /inference="similar to AA sequence:UniProtKB:P36069"
                     /note="similar to uniprot|P36069 Saccharomyces cerevisiae
                     YKL128c suppressor of TPS2 mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448548.1"
                     /db_xref="GeneID:2890380"
                     /db_xref="GOA:Q6FMJ6"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ6"
                     /translation="MILHRLLLLLNLDWNREVEMTVQDLDVRALPGYFKGYSARDTPE
                     TRHNATELDFLAFDDQFTTWKQLYQAIPKDTDTHSYKLLVLARHGEGYHNAAEARYGE
                     KAWNEYWSKLEGDQYGSWLDAELTPLGKKQALEAGQTYLTNLTDGLQLLPHKFFVSPM
                     RRCLDTYIREWEPVFSTHRPSNATVNVKVIEYLRETLGVHTCDERVSHSQALSEYQDH
                     RYNNSDVTVHFDYPGNYSEKDQLWYPDHRETKAEMDRRTRIGLREMFSSVNTTDKVIS
                     LTCHSGVIASVLRNIKHPAIDHLQTGKLVYAVVELSKAPTDDQPMLVVS"
     gene            <745201..>746172
                     /locus_tag="CAGL0K07546g"
                     /db_xref="GeneID:2890381"
     mRNA            <745201..>746172
                     /locus_tag="CAGL0K07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448549.1"
                     /db_xref="GeneID:2890381"
     CDS             745201..746172
                     /locus_tag="CAGL0K07546g"
                     /inference="similar to AA sequence:UniProtKB:P36069"
                     /note="similar to uniprot|P36069 Saccharomyces cerevisiae
                     YKL128c suppressor of TPS2 mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448549.1"
                     /db_xref="GeneID:2890381"
                     /db_xref="GOA:Q6FMJ5"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ5"
                     /translation="MILHKLLLLLNLDWNPDNTAKDLEFTAMPGYFKGYTVQDTPDSK
                     INATAIDFLQFDDRFSNWQQLYQSIPNDTETHSYKLVILARHGQGYHNVAYDKYGEKA
                     WYDYWSRLNGDQDGNWFDAELTPLGKKQALETGNTYLTNMTDGLQRLPDKFFVSPLRR
                     CLDTCIREWEPIFAKHKPANSTVHVKVLEYMRETLGIDTSNERVVHSQALAEYQNHRY
                     NTSDVTVHFDYPEDYSERDQLWQPNHLETNDEIDRRTKIGLREMFSSVNTTDKVISLT
                     AHHDVIESILRNIKHPTIDDLETGKLVYTVIDVSKVPADDQSVIVVS"
     gene            <747658..>748629
                     /locus_tag="CAGL0K07568g"
                     /db_xref="GeneID:2890382"
     mRNA            <747658..>748629
                     /locus_tag="CAGL0K07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448550.1"
                     /db_xref="GeneID:2890382"
     CDS             747658..748629
                     /locus_tag="CAGL0K07568g"
                     /inference="similar to AA sequence:UniProtKB:P36069"
                     /note="similar to uniprot|P36069 Saccharomyces cerevisiae
                     YKL128c suppressor of TPS2 mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448550.1"
                     /db_xref="GeneID:2890382"
                     /db_xref="GOA:Q6FMJ4"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ4"
                     /translation="MILHKLLLLLNLDWNPDNTAQDLDFRALPGYFKGYTVQDTPDTK
                     INATIFDFLALDDRFSNWQQMYQAIPNDTETHSYKLVILARHGQGYHNIGYDRYGEKA
                     WYDYWARLDGDQYGNWFDSELTPLGKKQALEAGQTYLTNLTDGLQRLPDKFFVSPLRR
                     CLDTCIREWEPIFAKHKPANSTVHVKVIEYLRETLGIDKSNERVDHSQALAEYQDHKY
                     NTSDVTVHFDYPDDYAEKDQLWQPEHLETYPELDRRIKVGLREVFSSVNATDRVLSLT
                     VHSDVIESILRNIKHPALVGLQTGKVIYTVVETTKKPADDQSILVVS"
     gene            <749181..>752939
                     /locus_tag="CAGL0K07590g"
                     /db_xref="GeneID:2890383"
     mRNA            <749181..>752939
                     /locus_tag="CAGL0K07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448551.1"
                     /db_xref="GeneID:2890383"
     CDS             749181..752939
                     /locus_tag="CAGL0K07590g"
                     /note="highly similar to uniprot|P36006 Saccharomyces
                     cerevisiae YKL129c or uniprot|Q04439 Saccharomyces
                     cerevisiae YMR109w myosin like proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448551.1"
                     /db_xref="GeneID:2890383"
                     /db_xref="GOA:Q6FMJ3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR010926"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAIIKRVVRSKAGQAPVKKGAKIKKASYDSSRKKEVGVSDLTLL
                     SKISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLGIYTDDTMKSYQGKNRLEAP
                     PHVFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSESISKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITNYLLEKQRVV
                     GQIKNERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDDVEEFNET
                     LNAMRTIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAYLLEVQ
                     EELLIKALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVERVN
                     NSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYK
                     KEQIHWTPIEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLNLF
                     TTNPHFELRQNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVREIFP
                     DQPQTDSRRRPPTSGDKIIKSANELVETLSKAQPSYIRTIKPNDTKSSTIYDDQRVLH
                     QIKYLGLKENVRIRRAGFAHRQVFEKFVERFYLLSPQCSYAGDYVWDGETLDAVKLIL
                     QDASIPTTEYEIGVTQIFIKHPETLFALENMRDKYWYNMAARIQRAWRRYLQKRIDAA
                     IRIQNAIRGKSGVSTFRNDELRNAGDKVYGGKKERRNMSLLGLRGFYGDYLSCNESKT
                     RGSYIKRQANITERVLFSSHGNSLHAMYGGASQRLRKTFILTPTSLWIVGHTKARNAM
                     KYITDYRIDLGKIRSISVTNLQDDWMAVNLMDSPKPDPLINLPFKTELITRLTQLNPR
                     IHVKVSSTIEYLRGPKKLFVVKSQYSDSAPKYHDLYRNGTILVRHGNPPDSTAENRPA
                     FNNEDMYGNLMEAKHKTMKKKVGTKRTPQALPTSSLAASAAQAAYHPKGIRSPTSTEQ
                     KSPSKSKPITKTRKPPVSSPVRNTSKTISNSKVYSAPKASVTKRTQDTVSVSKTSVKD
                     DVTQEKNAIIQTEEKQNYSLPENIPQSSQTDSYQAAYDFPGSGNPSELPLQKGDIIYV
                     SKSDPSGWSLASTLDNSKEGWVPTSYIVKYNGNVTDPSAQHQDMNTMKIQEDNTTSIN
                     EPETHTNQGPSNTDLGANLASVLAARANKLRSESEEDISREEDDDDDW"
     gene            <753402..>754136
                     /locus_tag="CAGL0K07612g"
                     /db_xref="GeneID:2890384"
     mRNA            <753402..>754136
                     /locus_tag="CAGL0K07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448552.1"
                     /db_xref="GeneID:2890384"
     CDS             753402..754136
                     /locus_tag="CAGL0K07612g"
                     /inference="similar to AA sequence:UniProtKB:P36068"
                     /note="similar to uniprot|P36068 Saccharomyces cerevisiae
                     YKL130c SHE2 required for mother cell-specific expression
                     of HO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448552.1"
                     /db_xref="GeneID:2890384"
                     /db_xref="GOA:Q6FMJ2"
                     /db_xref="InterPro:IPR024261"
                     /translation="MSREEQPYIVATDGIVDALTKISSVFSAYLSANIHILNKYINYL
                     RRVTSLKNERSIMIKIVKKLRFFNDTLLSTDLAQLQTTYEGEEPELALNIQTFASYLV
                     KCLETIDLLNYFLLKPLQKELIAKTLNFDLVFPEDITDTVEDTYNHFVKFTQWSIESL
                     SIDDPLLDIEVVQFSLRCAEEDQSYAEETDNIFLQEVLPVKDSQEYETLTLQWLDVLN
                     GKLAILGERFEKVADDWYKKFGKNRS"
     gene            complement(<754675..>756054)
                     /locus_tag="CAGL0K07634g"
                     /db_xref="GeneID:2890385"
     mRNA            complement(<754675..>756054)
                     /locus_tag="CAGL0K07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448553.1"
                     /db_xref="GeneID:2890385"
     CDS             complement(754675..756054)
                     /locus_tag="CAGL0K07634g"
                     /note="weakly similar to uniprot|P43574 Saccharomyces
                     cerevisiae YFL021w transcriptional regulatory protein
                     GAT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448553.1"
                     /db_xref="GeneID:2890385"
                     /db_xref="GOA:Q6FMJ1"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ1"
                     /translation="MMYDISATSQFKQSALYKHNKQMSDQIKFDFNNFQFKNNQQLQN
                     RDLMNDHYDNTFANKTSMQTSFVGHAFNPSFQFDTIDFDDKGTFFDINKAQNPKNRIL
                     AMLENESRSNTATIDSNFQAGVSNSLNIDLLDDPFKVDEQITRSDDIFPNLPFPFSTE
                     DSNIITPSFESRSTSNDSNFEIVDVTTPVVSRSSNFSNADNIPMPKEFDIKHLHPTIP
                     PKTKEPTSKRQIKVKKEKTPVCVETAKPSDADNNKEDLICTNCGTTNTPLWRKDIDRK
                     PLCNACGLFFKLHGVMRPLSLKTDVIKKRKRTAKIKTNRHVTGKINLRDRKRKSNPSK
                     KDNKKSITKRQQPSNSKSSIGSKSTALFKSDKCSSSGCNETADLTTPGSESTSVSSTE
                     TIFDNSQSISLSSSSTDLKDSNHGFLPSNWSDFQSSDGDLPNFSVDFEFGVVDDHNSI
                     YPLPVFQYE"
     gene            <762217..>763710
                     /locus_tag="CAGL0K07656g"
                     /db_xref="GeneID:2890355"
     mRNA            <762217..>763710
                     /locus_tag="CAGL0K07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448554.1"
                     /db_xref="GeneID:2890355"
     CDS             762217..763710
                     /locus_tag="CAGL0K07656g"
                     /note="highly similar to uniprot|P15625 Saccharomyces
                     cerevisiae YFL022c Phenylalanyl-tRNA synthetase alpha
                     chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448554.1"
                     /db_xref="GeneID:2890355"
                     /db_xref="GOA:Q6FMJ0"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:Q6FMJ0"
                     /translation="MSDFQLDILKKLNELGEIKSTLQVFADKDSQDVLSALNSLKAHS
                     KLNYTKHDTILYDLSTEGQDILNNGSHEMKLLKLIKEVGNLKISDVNAKLGKDGKLGQ
                     ARAFKNGWIKKNENNELEVNEKGKNDVEDTTQVELKAIVEGKADSLDKNVVNDLKKRK
                     LITPKKLTDFEVVKGAEFSLEIKKLETDITSDMVVTGSYKDLEFKPYNFNSQGLEVQS
                     GALHPLSKVREEFRQIFFSMGFTEMPTNQYVETGFWNFDALYVPQQHPARDLQDTFYI
                     KDPLTSDLPDDKEYLNNIKAVHEGGKFDTIGYRYPWKQEESQKLVLRTHTTAISAAML
                     HKLAKDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFA
                     KMGVTGLKFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLEPMGLPRDLRV
                     LGWGLSLERPTMIKYKVQNIRELLGHKVSLDFIENNPAARLDEDLYD"
     gene            complement(<764196..>764843)
                     /locus_tag="CAGL0K07678g"
                     /db_xref="GeneID:2890356"
     mRNA            complement(<764196..>764843)
                     /locus_tag="CAGL0K07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448555.1"
                     /db_xref="GeneID:2890356"
     CDS             complement(764196..764843)
                     /locus_tag="CAGL0K07678g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448555.1"
                     /db_xref="GeneID:2890356"
                     /db_xref="GOA:Q6FMI9"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI9"
                     /translation="MEHIPSYDMGRDAWRSTLEELRTDNHYEDYTEMNQFNDNYFQFV
                     NTSEIEQEFKFDWNELELENGKKKIRFTDDDINHYTVTHRSGKDDSSLNNHQRGVEND
                     QNVERNINRSGNNAGSSEYVPLAEEQQPDSPVSFETAAIERNLQFEFDNNYVNDIVLA
                     LRRLKEVRARLQNLVRNVDNAISIDKSPNFDGLPDDVEINAVKSSLLSFLADGNN"
     gene            complement(<766120..>768867)
                     /locus_tag="CAGL0K07700g"
                     /db_xref="GeneID:2890357"
     mRNA            complement(<766120..>768867)
                     /locus_tag="CAGL0K07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448556.1"
                     /db_xref="GeneID:2890357"
     CDS             complement(766120..768867)
                     /locus_tag="CAGL0K07700g"
                     /inference="similar to AA sequence:UniProtKB:P43573"
                     /note="similar to uniprot|P43573 Saccharomyces cerevisiae
                     YFL023w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448556.1"
                     /db_xref="GeneID:2890357"
                     /db_xref="GOA:Q6FMI8"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI8"
                     /translation="MESLLESVQETNAGLKSKRDFLEEQREQYVNIRQHLIELPSRQT
                     TEAEISSNKGQVTGLVLGDVIISKMTNEMEGIESYRLFVNIGCEYYVEKDKIYTTRYI
                     EEKISLIEDAISKFNEKIQEANTTEKHLKEAIAFEKKENDQKFIHSKQETSSIGYNED
                     TDDIYEPMEIREELDEEGNVISGTVTPAATDKQASEIRDKLLDVGNAQNIKKLPNNRI
                     EEISEDNSDNQTDKDSDFYNNLKGKLVHTGSLNSSKQEKVINEKSSDEVPNKQHTQRI
                     STDEIYSFADLVEQLDKDDIEEGDNSLNELDFDEKAMDSWEINGDSPENYEDDEDEGY
                     YYDEDEEEDEEEDGDMSYSGFGVAASVLPTNARSSFMDQIMKLRGLKDDTAADTDKSS
                     SIKKSAIQSNDDTNSNRQLSGTKHHQTAVTKSILKKGGKQKAKKNVGFSKDLQIHEVE
                     SFKMENKKQRHVFNPANLFDPESYGAETEEKLDDPSSTADFDSDLFAELIGAKEADVL
                     HEKYEEEINENNRKQQEEKKANRVSRFKATRQSKSKTSFKTAETGDTTNVNKPTEYTK
                     KDLLESYHAESISPSTKKHSSITASNYNKHDSGYVPKKASPDKAVIQEVEDEVVERAV
                     EDEVVERAVEDEVVERAVEDEIVERVVEDEVVERVVEDEVVERVVEDEVVERAVEDEV
                     FERTVEDEVVERAVDEQIVNESISLDDDNAPANSQNTKERKVPVIPKELSRYIEKGEG
                     GDKFPKAKIDYQSLNENLDDMAMAYSMGLYDDDVDDPGVVLEHLNDFKQYNEQVKELE
                     SEIAEFKINNPMLSEDNEEDDDGPIMTDIQEKDIPESYGQDDNGDDYSLSQDQLAQSV
                     AIEYRNMKEKLVNKMRSDVSAIDPQTEEMKQIEPIDEHGNPVKQSRFRSQRKAIDKLI
                     R"
     gene            769505..769586
                     /gene="tRNA-Ser (TGA)"
                     /locus_tag="CAGL0K07722r"
                     /db_xref="GeneID:2890358"
     tRNA            769505..769586
                     /gene="tRNA-Ser (TGA)"
                     /locus_tag="CAGL0K07722r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2890358"
     gene            complement(<769801..>770490)
                     /locus_tag="CAGL0K07744g"
                     /db_xref="GeneID:2890359"
     mRNA            complement(<769801..>770490)
                     /locus_tag="CAGL0K07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448557.1"
                     /db_xref="GeneID:2890359"
     CDS             complement(769801..770490)
                     /locus_tag="CAGL0K07744g"
                     /note="highly similar to uniprot|Q01976 Saccharomyces
                     cerevisiae YBR111c ADP-ribose pyrophosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448557.1"
                     /db_xref="GeneID:2890359"
                     /db_xref="GOA:Q6FMI7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI7"
                     /translation="MFGRRVAISGHRFLSRMISAKGKPEAAKIVQKSQVKDTSECKWI
                     GLEKITYKDPNGNERVWDSAVRMTRSTGEIDGIGILAILKFPDGKPDEIVLQKQFRPP
                     VEGVCIEMPAGLIDANEDIDTAALRELREETGYIGKIVNKSPVIFNDPGFTNTNLCLV
                     TAEIDMSLPENQNPVTELEENEFIECFSVPLKEFPEKMIELDSQGYKLDARVQNVAQG
                     IILANQFNISQ"
     gene            <770866..>771312
                     /locus_tag="CAGL0K07755g"
                     /db_xref="GeneID:9488033"
     mRNA            join(<770866..771088,771233..>771312)
                     /locus_tag="CAGL0K07755g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999535.1"
                     /db_xref="GeneID:9488033"
     CDS             join(770866..771088,771233..771312)
                     /locus_tag="CAGL0K07755g"
                     /note="highly similar to uniprot|Q6WNK7 Saccharomyces
                     cerevisiae YBR111wa SUS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999581.1"
                     /db_xref="GeneID:9488033"
                     /db_xref="GOA:B4UN38"
                     /db_xref="InterPro:IPR018783"
                     /translation="MTISSNENSASLRAQIQQCLVESGNYEAISNELTERLLKDGWLD
                     EVKKLAREEISQEDSPNFSKALSQIEPQALDLVQQSTKDAIMRKITAFLEEIVETE"
     gene            <771764..>774256
                     /locus_tag="CAGL0K07766g"
                     /db_xref="GeneID:2890360"
     mRNA            <771764..>774256
                     /locus_tag="CAGL0K07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448558.1"
                     /db_xref="GeneID:2890360"
     CDS             771764..774256
                     /locus_tag="CAGL0K07766g"
                     /note="highly similar to uniprot|P31244 Saccharomyces
                     cerevisiae YBR114w RAD16 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448558.1"
                     /db_xref="GeneID:2890360"
                     /db_xref="GOA:Q6FMI6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI6"
                     /translation="MEEGGFIRRTRSRVGRAKQKKVSYVEVSSSEDEQSTLTSVSGGR
                     KDSSESTVVGSSADDPIDLDYEEEEDEEFVDAEEEVANHDAEDDTAAEMRTAKVKRGK
                     RSRRLKPTLMVDLSKVEFDEDGHARMKKEEPDNALPDVPDEPNIPEIKEDDEDDQPLS
                     KKRKTTAKKSRKKKEPKIKLTPYQRTTLRLFEHHPELANVFPDLQNAPKYEPHRAPQP
                     ADMGVKLLPFQLEGLHWMLSQEDSIYNGGVLADEMGMGKTIQTIALLMNDRSKKPSLV
                     VAPTVALMQWKNEIEQHTNGALSTYIYHGASRTINIHDLKDIDVILTTYSVLESVFRK
                     QNYGFRRKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRWCLSG
                     TPLQNRIGEMYSLIRFLDINPFAKYFCTKCECASKEWKFSDNMHCDSCGHVLMQHTNF
                     FNHFMLKNIQKFGVEGPGLESFNNIQTLLKNVMLRRTKVERADDLGLPPRVVTVRKDY
                     FSEEEKDLYRSLYTDSQRKYNSFVEKGVVLNNYANIFSLITRMRQLADHPDLVLKRFH
                     DDNAAGVIVCQLCNDEAEEPIESKCHHKFCRLCIREYVESYIESSGSNLTCPVCHIGL
                     SIDLSQPSLEVDLESFKKQSIVSRLNMKGTWRSSTKIEALVEELYKLRSPVKTVKSIV
                     FSQFTSMLDLVEWRLKRAGFQTVKLQGSMSPTQRDQTIKYFMDNIECEVFLVSLKAGG
                     VALNLCEASQVFILDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQ
                     EKKANMIHATINQDEAAINRLTPADLQFLFNN"
     gene            complement(<774352..>778476)
                     /locus_tag="CAGL0K07788g"
                     /db_xref="GeneID:2890361"
     mRNA            complement(<774352..>778476)
                     /locus_tag="CAGL0K07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448559.1"
                     /db_xref="GeneID:2890361"
     CDS             complement(774352..778476)
                     /locus_tag="CAGL0K07788g"
                     /note="highly similar to uniprot|P07702 Saccharomyces
                     cerevisiae YBR115c LYS2 Aminoadipate-semialdehyde
                     dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448559.1"
                     /db_xref="GeneID:2890361"
                     /db_xref="GOA:Q6FMI5"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR006162"
                     /db_xref="InterPro:IPR009081"
                     /db_xref="InterPro:IPR010071"
                     /db_xref="InterPro:IPR010080"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR014397"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /translation="MSWKERLDNPTLSVWPHDYLRPHAEPFVEQGTYSISIPQLSGDY
                     ATLLAAWTALLYRVTGDDDIVLYVRDNKVLRFTITPELTFTQLQNKINEQLAELANVE
                     GTNFDALSESLQKESGLERPPQLFRIACVTEDLQLDRYTHSPLDIGLQLHESSSDVSI
                     VFNKLLFSQDRITILADQLTLFLTSVLQNAKQVFTKVSLITDSSTSILPDPKANLDWC
                     GFVGCIHDIFQDNAEKFPERTCVVETPPINSTKTRTFTYKDINEASNIVAHYLINTGI
                     KRGDVVMIYSSRGVDLMVCVMGVLKAGATFSVIDPAYPPARQTIYLGVAKPKGLIVIR
                     AAGQLDQLVEDYITKELDLVSRIPSIAIQDNGTVEGGSLPSESGDVLASYTELKSTRT
                     GVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLAYYFSWMAKQFNLSENDKFTMLSGIA
                     HDPIQRDMFTPLFLGAQLYVPTQDDIGTPGRLAEWMGKYGCTVTHLTPAMGQLLTAQA
                     VTPFPKLHHAFFVGDILTKRDCLRLQTLAENCCIVNMYGTTETQRAVSYFEVTSRSQD
                     PHFLKKLKDVMPAGRGMKNVQLLVVNRNDRTQVCGVGEIGEIYVRAGGLAEGYRGLPD
                     LNKEKFVNNWFVEEGHWNYLDKDLEAPWKEFWQGPRDRLYRTGDLGRYLPNGDCECCG
                     RADDQVKIRGFRIELGEIDTNISQHPLVRENITLVRNNLEGEKCLVTYMVPRFDKPEL
                     ENFKIEVPSNISDDPVVCGLIGYSPFTKDLKAFLKKRLASYAIPSLIIVLPKLPLNPN
                     GKVDKPKLQFPTVKQLELVAKNSSIDINDSEFNQQEREIRDLWLECLPTKPTSISPED
                     SFFDLGGHSILATKMIFTVKKQLNVELPLGTIFKYPTIKAFAAEVSRLKSTDKIEEET
                     TALTADYASDAASLIDTLPKSYPAARALGSPSEMAGPTTVNIFVTGVTGFLGSFILSD
                     ILNRTVTGVNFKIFAHVRAADETSGLDRIRKAGTVYGTWKEEYANSLQVVIGDLSKKN
                     FGLTDDKWSHLSETIDIIIHNGALVHWVYPYSKLRNANVVSTINIMNLASEGKPKLFN
                     FVSSTSVLDTNHYFELSDKLQQSGKEGIPESDDLMGSSLGLTSGYGQSKWAAEHIIRA
                     AGKRGLRGSIIRPGYVTGASYNGSSNTDDFLLRFLKSAVQLGKIPDINNTVNMVPVDQ
                     VARVVVAASINPPCGDDLCVVHVNAHPRIIFKDYLYELKNYGYDVEIENYEQWKKTLE
                     EAVIERSEDNALFPLLHMVLGDLEDSTKAPELDDKNAITSLRADIEWTNEDRTKGMGA
                     TPEQIGIYISFLESVGFLPHPKHFGDKALPNIKISEQQKELVASGAGARSSSAA"
     gene            <780678..>782054
                     /locus_tag="CAGL0K07832g"
                     /db_xref="GeneID:2890363"
     mRNA            <780678..>782054
                     /locus_tag="CAGL0K07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448561.1"
                     /db_xref="GeneID:2890363"
     CDS             780678..782054
                     /locus_tag="CAGL0K07832g"
                     /note="highly similar to uniprot|P02994 Saccharomyces
                     cerevisiae YPR080w TEF1 or uniprot|P02994 Saccharomyces
                     cerevisiae YBR118w TEF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448561.1"
                     /db_xref="GeneID:2890363"
                     /db_xref="GOA:Q6FMI3"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004539"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI3"
                     /translation="MGKDKQHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW
                     DESRFAEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNASWYKGWEKETKA
                     GVVKGKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     AASFNATVIVLNHPGQISAGYSPVLDCHTAHIACKFEELLEKNDRRSGKKLEDSPKFL
                     KSGDAALVKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVDKTDKAGKVTK
                     AAQKAAKK"
     gene            complement(<782350..>782778)
                     /locus_tag="CAGL0K07854g"
                     /db_xref="GeneID:2890364"
     mRNA            complement(<782350..>782778)
                     /locus_tag="CAGL0K07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448562.1"
                     /db_xref="GeneID:2890364"
     CDS             complement(782350..782778)
                     /locus_tag="CAGL0K07854g"
                     /note="highly similar to uniprot|Q06819 Saccharomyces
                     cerevisiae YPR082c DIB1 required for mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448562.1"
                     /db_xref="GeneID:2890364"
                     /db_xref="GOA:Q6FMI2"
                     /db_xref="InterPro:IPR004123"
                     /db_xref="InterPro:IPR012336"
                     /translation="MEFLYNLHSGWHVDQAIVTEEERLVVVRFGRTADRECMLMDEML
                     ASVAEKVRNFVAIYLCDIDEVPDFNDMYELNDNMCLMFFYKNKHMMCDFGTGNNNKMN
                     FLPDDKQELIDIMETIFRGARKNKGIVVSPYDYNHKRPSD"
     gene            <783120..>784844
                     /locus_tag="CAGL0K07876g"
                     /db_xref="GeneID:2890365"
     mRNA            <783120..>784844
                     /locus_tag="CAGL0K07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448563.1"
                     /db_xref="GeneID:2890365"
     CDS             783120..784844
                     /locus_tag="CAGL0K07876g"
                     /inference="similar to AA sequence:UniProtKB:Q06820"
                     /note="similar to uniprot|Q06820 Saccharomyces cerevisiae
                     YPR083w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448563.1"
                     /db_xref="GeneID:2890365"
                     /db_xref="GOA:Q6FMI1"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI1"
                     /translation="MDPIISRFKELDFAVDTSERLKFLDRGDTNNESDEEHDVRESSA
                     GVAMIEEMILNERNNGSVYSHVLNQCESALQTYTDLLKLEMITTKSWYISALYDSVLI
                     RFNLKDNNNLEQTDEFFKDLALKSIKKCDKSAVGLESLYTSISSFRDFIASSTSGLSD
                     MSPLLSNSMTLLFEIWVVTNREIRHFQKVIAGIFMRSKLLLIDYELVKIWNLVRSKDK
                     NDSTNIDKENVKKLETTITSYRAFLKIFIAQLQDAECSNQDNSNQDAFEECLRVFFDI
                     ESMYQALNFNWLLKENKHLQDKNKMLDDKMSRSLPTINESKEVHNITAFVDDFLQQPP
                     VLQIPMDSKHTKTASASSSISSTSSYPFSPTSKSYHSLSTTSDDEKSPYPFYFDGNSS
                     DRFSMKNKNYTINDSSSTLHESTMSKVADRESETDTDSDMYLMMEKTNLSKELPKLLN
                     AFSNAKKLEQEIKTAKSTSAPSSSQESIRESQDNSSEKQHSPSPNNLSRSQLLSNSII
                     NKTLLDKKKEDLMHNMDNWVNHNNIKFSTLPTGLGNPLYTQLNNTHTKPHGFKSNFLN
                     NLYGLGHN"
     gene            <785395..>786837
                     /locus_tag="CAGL0K07898g"
                     /db_xref="GeneID:2890366"
     mRNA            <785395..>786837
                     /locus_tag="CAGL0K07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448564.1"
                     /db_xref="GeneID:2890366"
     CDS             785395..786837
                     /locus_tag="CAGL0K07898g"
                     /inference="similar to AA sequence:UniProtKB:Q06821"
                     /note="similar to uniprot|Q06821 Saccharomyces cerevisiae
                     YPR084w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448564.1"
                     /db_xref="GeneID:2890366"
                     /db_xref="GOA:Q6FMI0"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMI0"
                     /translation="MSEQRPIRVAVLGGDSTGKTSFVSRLTLNIVHEVHYPTRDQTNW
                     LFDFIPHSPVSRAILDAEAHERLAFRTPGSQVLEPIFSSPSVTDHVLLSPLVFQAFTD
                     EFTQVRNQNKGRTLSYIRPMESSKKKKPHLYKYSYNNGKAAEANDKGIYLRGPTFMEK
                     SPNNELPVNYVPPVYSPILIDIIDTPGFKPDMVVPFLEVSLFANLDKNILRGLADEPR
                     QPVSTTSLLVASGASELNGKIDGYVFVYSAIPELSHLISPPSYDFSNTNKDVANLSID
                     KTKTNESIPWSSYTKKKDGGFSLLDVIRDCILDAWAEFRDYQRRWEMGQEDDVYSLFY
                     TLKHMWKAEKDRSTKIQELRSYKTTLNSIETDPSSPDSPPPCLIVCTHTKDNMASPLL
                     IEKGRQLATQWKCGFVALDNLEDYNVDVALSLLIREIAEKEKLQIGRGNKMHQSIGKD
                     HSLHPSKSNPNNTESSSSGAVSMFKKFLRN"
     gene            complement(<786915..>788342)
                     /locus_tag="CAGL0K07920g"
                     /db_xref="GeneID:2890367"
     mRNA            complement(<786915..>788342)
                     /locus_tag="CAGL0K07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448565.1"
                     /db_xref="GeneID:2890367"
     CDS             complement(786915..788342)
                     /locus_tag="CAGL0K07920g"
                     /note="weakly similar to uniprot|Q06822 Saccharomyces
                     cerevisiae YPR085c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448565.1"
                     /db_xref="GeneID:2890367"
                     /db_xref="GOA:Q6FMH9"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /translation="MERAATHFLRLHKSGISALCSGVIDPDYGITSPVLFSGDIDGEV
                     TIWNLITRRPIFTSKICNEQVVDIQFLEGKYLSLLCKDHKLRLYELLKLGAIVKQSDF
                     GGGDKVDLKQIFEVPVNTLNFANYVLTYLGNNKFELVTCHTQDAHFIDIYEFETPELN
                     SLKRFSKAIDFLPMLRDRFGDNLLPKMDGLGIIMKFYKVNEVVYCGFESGYVIAFRRY
                     RNKPLYRKRVSGFIGKPINECASGISKLLQHENVETSSSVNDLELDNVIEIVLVDRAH
                     YPDPVLDMAPNPKKNGIICSSTTNKLVLTSVDEQYLAGPNSAYIFKSDEYLLDKKNCL
                     LMSTNLKIDGSAVKDMMCKNIGFVLSLGDYIITGNWSGKTYIGRIESDKAVLAAAKSR
                     SLIEVNESPVGNIQQDKSIQKSSKHTKIGAMTGFEVKDKEPDKLMCKNKELTPGKLRR
                     LNAFVQSKWYFIGYTDGTIGLYRAE"
     gene            complement(<788767..>789843)
                     /locus_tag="CAGL0K07942g"
                     /db_xref="GeneID:2890368"
     mRNA            complement(<788767..>789843)
                     /locus_tag="CAGL0K07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448566.1"
                     /db_xref="GeneID:2890368"
     CDS             complement(788767..789843)
                     /locus_tag="CAGL0K07942g"
                     /note="weakly similar to uniprot|P38272 Saccharomyces
                     cerevisiae YBR130c SHE3 required for mother cell-specific
                     expression of HO"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448566.1"
                     /db_xref="GeneID:2890368"
                     /db_xref="GOA:Q6FMH8"
                     /translation="MSLENAVRVVSTDEKGNQASSTKLIELLHSRVDALTTTNIELTT
                     KLQELLGNLDTVQQRERKLKESAASLRHEGDNVTLMLNRKERKLTEVKEAIVELTTKL
                     GEAKEVNHSLKQKFEDEGLTSEESLRESISEVKTEYDTLVKSHEIYESSNDIQCKSLE
                     DRFSQALLIHGENMKALDGTAEQILANNSELVSQLRATENKAESARTSIRNASIDTAA
                     KVDLEKWLFLYKEAQRICEEFASKTDTKLPDELQAIIDDPVLKELDARFALDEIQYGK
                     TRNKRIPSNPLLSNSQAAARRVASPSANYSPRVSSAQGSLPGITRTPSMKVNNKFSDS
                     NAQEVPTRLHSHGSRSKRSSMVFK"
     gene            <790905..>791996
                     /locus_tag="CAGL0K07964g"
                     /db_xref="GeneID:2890369"
     mRNA            <790905..>791996
                     /locus_tag="CAGL0K07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448567.1"
                     /db_xref="GeneID:2890369"
     CDS             790905..791996
                     /locus_tag="CAGL0K07964g"
                     /note="highly similar to uniprot|P29055 Saccharomyces
                     cerevisiae YPR086w SUA7 Transcription initiation factor
                     IIB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448567.1"
                     /db_xref="GeneID:2890369"
                     /db_xref="GOA:Q6FMH7"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH7"
                     /translation="MSAPVTSLRRSVGRKGPNLNIVLTCPECKVYPPKIVERFSEGDV
                     VCALCGLVLSDKLVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNNLSTKIGQGET
                     TDMRFTKELNRAQGKNVLDKKDNEIQAAFAKITMLCDASELPKIVKDCAKEAYKLCHD
                     EKALKGKSSESIMAASILLGCRRAEVARTFKEIQSIIHVKTKEFGKTLGIMKNILREK
                     SADGFIKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIEEIAGKSPI
                     TIAVVSIYLNILLFKIPVSAARVGQILQVTEGTIKSGYKILFDHKEKVVDPQLIASGV
                     VSLSDLPRVEKDRIAKSDKKRDTPTPGPA"
     gene            complement(<792641..>794239)
                     /locus_tag="CAGL0K07986g"
                     /db_xref="GeneID:2890370"
     mRNA            complement(<792641..>794239)
                     /locus_tag="CAGL0K07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448568.1"
                     /db_xref="GeneID:2890370"
     CDS             complement(792641..794239)
                     /locus_tag="CAGL0K07986g"
                     /note="highly similar to uniprot|P20424 Saccharomyces
                     cerevisiae YPR088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448568.1"
                     /db_xref="GeneID:2890370"
                     /db_xref="GOA:Q6FMH6"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR006325"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH6"
                     /translation="MVLADLGKRINNAVNSALSNTEDDYVNSIDGMLKGISTALLEAD
                     VNIMLVSKVRNNIRSVLLDNKTTNRSMNNVQTKKLVQKTVFDELCGLVDCTDHKVFQP
                     KKKATNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAVK
                     ARIPFYGSYTETDPVKVAGDGIAKFKKEKFDVIIVDTSGRHHQEEELFHEMVQISNVI
                     KPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHAKGGGAISAVAATNTPI
                     AFIGTGEHIHDLEKFSPKSFISKLLGIGDIEGLFEQLKTVSNKEDTKATMENIQQGKF
                     TLLDFKKQMQTIMKMGPLSNIAQMIPGMGNMMSQVGEEETSQKMKKMVYVLDSMTKEE
                     LESDGRIFIDQPSRLVRVARGSGTSVFDVEMILMQQQMMARMAQNAKMGKQGGGMPGM
                     PNMTGMPNMPGMPKMTPQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPD
                     MNEMMKMMQDPQMQDMARQFGMGM"
     gene            <794594..>797266
                     /locus_tag="CAGL0K08008g"
                     /db_xref="GeneID:2890371"
     mRNA            <794594..>797266
                     /locus_tag="CAGL0K08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448569.1"
                     /db_xref="GeneID:2890371"
     CDS             794594..797266
                     /locus_tag="CAGL0K08008g"
                     /inference="similar to AA sequence:UniProtKB:O13585"
                     /note="similar to uniprot|O13585 Saccharomyces cerevisiae
                     YPR089W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448569.1"
                     /db_xref="GeneID:2890371"
                     /db_xref="GOA:Q6FMH5"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH5"
                     /translation="MEWGSGRVSKEEKLNAARNAVISYLAGTKDNDEDPWTELVRLIS
                     DSSQGEVFTEFKSLLDSVRDVNDKKKLGIPLLHLTIIYDRASYIEFLYQGARSKLDFN
                     LCDDVAGYTPLMWCFLLERTDCCTELLTWSTEIDFHKVSKEEKLSAWDMVAKYSDFYM
                     FLEQNNMLQYQDIPTFQEKLTTENDNSSSALDQNALRNIDLHVAGLSLASTQNNEDIF
                     ASNATESRNDYLFGTEQIDSGINEQFDFTKLLPNQYVEFEDYDIKQLLDLLESLPKKE
                     PHMTTYAAALIFQMVRFAEHKKKQPQLVHTIMSLSLARILAAITTETDMTQESADTAF
                     SSGDIVSQSYWLGVLTFLYYYLTREEGFFKKYPEILQELINTIHSVIIELTLSIYSRL
                     TSIIQPTILSYTTISDVKETLYKRDWNFFKKRKHHKMMQKQKKQEEELRKQEEETLQN
                     NEDKLQISEALDESNDIDDEAEDKKKHSKLKLFKKKRHSGQLSTSMSNDSKLENSSIN
                     ENTDLYYDTEVIKHLYPPSMEEQMKPSPMKVVQIFGALMYVLNLHQIHPLFQQQCLSL
                     AIQWFSNNLFNQILKDKKKKSLSRAHAIQIRLNLSTFEAWAKNNDSKVPKPKMIDDFM
                     WERFPYTLVEDVANIDLSNPILNNVATVNKVDNSSGLNDDLPLIRDTDNSLFYYQSLH
                     RILQIHMEPVFQLLQWLQVATTIDSEDALDSTLDLLSRLTPTQLLKAADKYSYEIDES
                     KFNSKLKKKLSAMAKASNNKESPYLPERTVSLLVLPTIPEMTDIYARGVDHESYQPLL
                     PVSIQDMIYEIHSENAKLRMNASEFYDYQNEEQHEQEVDNEEAHEDSYKENSSANEDN
                     DLDNNNDRFEYQTVDTPAVASHWAPKEDFEENPW"
     gene            complement(<797486..>799762)
                     /locus_tag="CAGL0K08030g"
                     /db_xref="GeneID:2890338"
     mRNA            complement(<797486..>799762)
                     /locus_tag="CAGL0K08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448570.1"
                     /db_xref="GeneID:2890338"
     CDS             complement(797486..799762)
                     /locus_tag="CAGL0K08030g"
                     /inference="similar to AA sequence:UniProtKB:Q06833"
                     /note="similar to uniprot|Q06833 Saccharomyces cerevisiae
                     YPR091c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448570.1"
                     /db_xref="GeneID:2890338"
                     /db_xref="GOA:Q6FMH4"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH4"
                     /translation="MSWKLFFIVYLLGGLTFLPGLCALLVYIHLQLEKLKELAEKNAR
                     NELLCKDVDPNLKAGEVLDPIGVNVSKRGWITVTKEYYYHHTELQTPPIASETAKQDS
                     NNTPPKDLNESQIPQRSQLRKRHKFYGVLKHGNLFLYKDDSPHSDLVHAISLQKSFVT
                     MWPRDPKKEMSDSSLFTKRTCISILKTGLVSIDEEGKLVFNPSINAIQSGEEDGKQSS
                     QQSSSNLSSNTYFLYFDNNSEKEDWYFKLIDSSKSNDEKNNNEDPLSPNTSAKTAHLN
                     TRDMLYLIQSLNSTEGQLTTKWFNALIGRLFLALQQTNKLNEVLYAKIYKKLTNINKP
                     GFLDDLVVKKVDVGTSAPMITHPELRELTPEGEMKIAMNLRYTGNISVIITTNIGINL
                     GSHFKQREVSVQLSITLKELSGPLLIIMKPPPSNRIWYGFETDPYMNLDIEPMVSSSK
                     ISYNMVTNMIKGKFAEAIKESLVMPFMDDIVFYDTDHDVFRGGVWDRSEFSKPLLDML
                     RKQSSAEEKSIHSNDDIKEHETENNNKDDEREYEITKTSDTGILNKMGNVKNTLLNKA
                     NKQGSEESLEKGDDFNDTDSLTDSSIKPKKYIKNSIKKIGKWYKDNINSNDEEFDGNI
                     NETEPEQRRVSLDSGKSVQSPTMISNRRMRGKRPEPPFIGAEPGSPTTVTTEKQTSQK
                     SPIINATAMFANRNTELSVRGRSSISEGVNDEQGQPHGFIKMPTTNEFGGQLFEENIR
                     TFNGSQVTSPQSTQGEFS"
     gene            complement(<800991..>801908)
                     /locus_tag="CAGL0K08052g"
                     /db_xref="GeneID:2890339"
     mRNA            complement(<800991..>801908)
                     /locus_tag="CAGL0K08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448571.1"
                     /db_xref="GeneID:2890339"
     CDS             complement(800991..801908)
                     /locus_tag="CAGL0K08052g"
                     /note="weakly similar to uniprot|Q06834 Saccharomyces
                     cerevisiae YPR093c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448571.1"
                     /db_xref="GeneID:2890339"
                     /db_xref="GOA:Q6FMH3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH3"
                     /translation="MVSKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDL
                     KCPMCRIDAEELVVKLYGCAEKIIDLQKGFAVNQVVNHVINTEPDLIDELAEALDNNL
                     HISELRTDTQVEPEAPPSRPRLLQCGICGDQDDLVLEHYCEECQTLYHGSCLRVLAIE
                     TGERTDWCVCVDCRKELISRNDRLVIQNSQLASRDDGSLMYDTNNTMVFEGQLREKNS
                     VRAEQIYRDCYLESLKKTKTNIQKHVRKCLDTYYHSGKIDHMEYTRINKTVSRKLYTL
                     SNYTYSQELNYDHLAKQHIETELGTPLSI"
     gene            <802167..>802490
                     /locus_tag="CAGL0K08074g"
                     /db_xref="GeneID:2890340"
     mRNA            <802167..>802490
                     /locus_tag="CAGL0K08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448572.1"
                     /db_xref="GeneID:2890340"
     CDS             802167..802490
                     /locus_tag="CAGL0K08074g"
                     /inference="similar to AA sequence:UniProtKB:Q06835"
                     /note="similar to uniprot|Q06835 Saccharomyces cerevisiae
                     YPR094w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448572.1"
                     /db_xref="GeneID:2890340"
                     /db_xref="GOA:Q6FMH2"
                     /db_xref="InterPro:IPR005345"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH2"
                     /translation="MSRHQSDLMMCMNPAGINTGILCEKCDGRCPSCDSYVRPRSRVT
                     VCDQCSFGKQATQCILCGSTNGKVPAYYCWECCKLGKNRKGCPRIINIGSNKMDRYFG
                     TKKDT"
     gene            complement(<802510..>805929)
                     /locus_tag="CAGL0K08096g"
                     /db_xref="GeneID:2890341"
     mRNA            complement(<802510..>805929)
                     /locus_tag="CAGL0K08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448573.1"
                     /db_xref="GeneID:2890341"
     CDS             complement(802510..805929)
                     /locus_tag="CAGL0K08096g"
                     /inference="similar to AA sequence:UniProtKB:Q06836"
                     /note="similar to uniprot|Q06836 Saccharomyces cerevisiae
                     YPR095c guanine nucleotide exchange factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448573.1"
                     /db_xref="GeneID:2890341"
                     /db_xref="GOA:Q6FMH1"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH1"
                     /translation="MSQQFSSFIKLKIFQSNHAGHDSKNGSRSETSSAPSNENKSESS
                     LSGSPRKNKMVEALDNELNKLTIKTDDIRFEPPQLVRPATFSPESPQFNFDISNTDKD
                     NYSPSTDHTIHEDGEYDINNTKQDETTGALSEGHRNIKNVFHRRHTSDSLTDSDLSTN
                     QKKTHGKFRRIRHKMSLLDINFKLSPKGSSTDVTKLRDDDSNQQISRRGESKLKSMSQ
                     VNSNERLLAPKKQVAVQSFNPSKKSMDSTLSRSSGNPTMSSMTKVRSASSNGSSNLLV
                     KHYSNEKTNPLKLRSMKTASTISLDPIQTESIDENLENSKISQVSTNKLKTINRRRSR
                     TLDLSDYVKNRKGRTSKSVEINSNELSDIRSHSLSFSGRSPLILSRTNSQNQLTTSSE
                     RNSRDRPRSPYGNLPAPSSSSSATTASIGGGISSRRSSSIVNALSSLVNLKTSSVTSF
                     KQVPFSSNSGQPQVTLDDLPKPPPPEGSESHVDYLIRISPYGKFLGIILVKKDDPFNR
                     RALYHFLDKYFNLKTDPIDVALRKVLMFLELPKEAQEIDRLLTELGKVIFDQQSESYD
                     PCAWVDADQVYFLLYSLLVLHTDQFNTKNKFKMTKQDFVKLIREDTYSNGNKIPAEIL
                     SYYFDNITVRESPIFDLLPPVEVFPLEHVQYGVDRAEIAYSPMRILQDRTLNYEGDYQ
                     HVSTPPKLTSRPTSSSISSYFSQNSTTLSGSTIMPVTSDIDIYEKIFTNELREVSLEH
                     QVSKIWDYTEKDWHTVTASYTSNHVGFQNRYKKFYSILMDFKGGYIRIHKNILMKLNL
                     PKYELTKGEGIREDDYCYLKIIQMGEIQTFHQNRKIPLVGSKTSIWKSEYGVLTYIGL
                     LVFEKSDWINPQAEKDEHTGVTNYIIDFKPGFSFVSSNVECFHGMFAVREKNAVGRSH
                     FIKLLSPNSAGASSSRYNGSVGNDYLDSAMYGVDIAQSEKDQSDPNDPLADLCKEEME
                     GTLVFLHSAKRNLIFKCPSVSARDNWVDAINLISAYDGCDYDPACLDNTLVCKKKYSV
                     QERLVRLHSMDVEKSFKLHELETILMFFRQAIPITMKSRSTLISNIKQIATKMDWLLF
                     EIKRSQTFVNIISEVDGSYDNIFGITTNDYHNDDDISGMIPNINGSFLFTD"
     gene            <806504..>809671
                     /locus_tag="CAGL0K08118g"
                     /db_xref="GeneID:2890342"
     mRNA            <806504..>809671
                     /locus_tag="CAGL0K08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448574.1"
                     /db_xref="GeneID:2890342"
     CDS             806504..809671
                     /locus_tag="CAGL0K08118g"
                     /inference="similar to AA sequence:UniProtKB:Q06839"
                     /note="similar to uniprot|Q06839 Saccharomyces cerevisiae
                     YPR097w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448574.1"
                     /db_xref="GeneID:2890342"
                     /db_xref="GOA:Q6FMH0"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR024554"
                     /db_xref="InterPro:IPR024555"
                     /db_xref="UniProtKB/TrEMBL:Q6FMH0"
                     /translation="MSLDAVQEHYLKRELLKFQLDKEFELLNNKDGLRHFGYPFTSED
                     PRLQIKKGESYGTAISNALWSSATYFTGSGSGEETKVEEEAAVSILPRLEGTQYPLLS
                     YMLQEFIFSFPLLSKNLSVDERFWQGKVQVFFEHFMSMGFSDSYDREETTKRRKMGQK
                     MKKVIMLLFNSGIGTTLESSYYEHDKLTAQQENTRKRSNIEELTMPTKENLKFLVTHE
                     PVYFNTWDISIISVYDSSKASDELSNTLTKNNSSNSSSSSSIHSSSSYLFKSKDLKKT
                     SAYTSKMFKSAFGAASSTTSNMFSKLSGSTVYSSTPESKSYLSVNSNEKNGVRSKKSK
                     YYFVIRTRRLNEPDAISYNFKTYNSFKKFSHRLKKEFPSKKLPDLPSKKQDKKALRNI
                     KKEQLNNKTDQPNISSLMLDDSNSKDIDEPSPIDDNSMKDDLASNISSDDQDLDLDTQ
                     SIDSAEEETKFLPYETLRYTLRLYLRTLSKDSDVVQSSIWKEFFKEDVVDPETFDESL
                     MEDIKLREITDIKNLENQISFQKMALEKTVKLQASMKDFKTNLLEDEKYLLELVGEIK
                     AKKRFEDLSPSLQNFVEWCKIYLSSILYQMFLGNDNSYEFYRQIRRLHKLLPYTVMCQ
                     IMRFTNPVAIMKGMIDLFMAQPFGGQSLLQTMFSTILTEDIKHQKNAVKELERKVLSK
                     HSDSKQMLAFLRSCIFQDDSSNPLKFNDIQEESELMQMPVCLLLIMKGSEAGKIKKDV
                     VAELINSYSSWKSEQGNELQPSGEGNFYVNVHDLMKLYIKEHDKRLMRQLWQDPELQQ
                     LLKAIISLIYEPMLRIFKVARMDLAIKNFEKFMDDLVQLMDDVIAKQLHISSKFNIVE
                     SILDLVNKHQNSFLEFLHDVYNRDSEGIFEGFITWISKIIRFLQKSKFGSPEERVDLN
                     DFLNTTTDHLDKDLLLKQINEVIKKKIDARKVYWQILEEKISKKENTRRSMSPEVMEN
                     NWKTINSMIIPTHSDSFGVQDNDMIDLDIEMTEHTVQEETKETELDKEYRNILSRTID
                     ESEIEKLCGPGFDDLLRLKLSTYKV"
     gene            <809979..>810572
                     /locus_tag="CAGL0K08140g"
                     /db_xref="GeneID:2890343"
     mRNA            <809979..>810572
                     /locus_tag="CAGL0K08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448575.1"
                     /db_xref="GeneID:2890343"
     CDS             809979..810572
                     /locus_tag="CAGL0K08140g"
                     /note="highly similar to uniprot|P36149 Saccharomyces
                     cerevisiae YKR068c Transport protein particle subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448575.1"
                     /db_xref="GeneID:2890343"
                     /db_xref="InterPro:IPR007194"
                     /db_xref="InterPro:IPR016721"
                     /db_xref="InterPro:IPR024096"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG9"
                     /translation="MSRSQSISSQSKSLKITGEEIWKNKVEKVNSELFNLTYGSIVSQ
                     LCIDYKRDFKKVNEQLFSMGYNIGIRLIEDFLARTALPRCDTMLRTSEVISKCAFKVF
                     LNITPTVTNWSQSQDTFSLLIDENPLSDFVELPMDAVNQLWYSNILCGVLKGALEMVQ
                     LDCDVWFISDILRGDPQTELRIKLNKVLKDEIPIGED"
     gene            complement(<810899..>813049)
                     /locus_tag="CAGL0K08162g"
                     /db_xref="GeneID:2890344"
     mRNA            complement(<810899..>813049)
                     /locus_tag="CAGL0K08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448576.1"
                     /db_xref="GeneID:2890344"
     CDS             complement(810899..813049)
                     /locus_tag="CAGL0K08162g"
                     /inference="similar to AA sequence:UniProtKB:P36148"
                     /note="similar to uniprot|P36148 Saccharomyces cerevisiae
                     YKR067w Glycerol-3-phosphate acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448576.1"
                     /db_xref="GeneID:2890344"
                     /db_xref="GOA:Q6FMG8"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG8"
                     /translation="MPAHVPEVGHKYINDYNGYTYNIHTFLYDLIVFLFNAVITTFFR
                     EIKVRGGYNVPPRGVPTILVCAPHANQFIDPTLVMITTRQLGYIRGKLRSRQACFVTA
                     ASSLKMKFVGLFGNAMGSIPVPRIQDNLKDMDSNLIIYAPDFENNPTMLKGKCLDGSN
                     PGFTTKFTVKSLIGLPNYLSNANIAEIPDDSTIVLSAPFKNDKNGKVAELLTQGTTFK
                     YAEKIDNTETFQSVFDHLHTKGCVGIFPEGGSHDRPSLLPIKAGVAIMALGAAAADPK
                     MEVAVVPVGLHYFHRNKFRSRAVIEYGEPIMVNGDMGKEYKQQPRETVSRLLKKVSDA
                     LFTLTENAPDYETLMTIQAARRLFQTNNSRIPLPAVVEIQRRLLVGYKKFQSDPRIMH
                     LQNSVKEYNNKLYSMGLKDHQVMSLKTKPYETLRCAVTLLQRIFRVTLFFFLSLPGSI
                     MFLPIFVGSHFYSKKKQREGLKKSSVKIEGKDLIATWKLIVALLMAPSLYITYTIILM
                     VLHQRRSKYVWWVWVPTENKVIQFIYFYMLLVLVAYSSLKTGEIGFDLFKSLRPLMIS
                     LVYPQDYIHELQTRRKELSNEVTEICNELGPQVFPDYEKFASSYLIKKDKKDESKPEK
                     DYLSQNSTGLSGRSRSSSIYSMISNVSNSLSRVNSRGSLTDVPIFSDSRQGEWTNITS
                     DDEQSNSKEETPTNKLSSKITDLMRSKREKEKVD"
     gene            <813815..>814888
                     /locus_tag="CAGL0K08184g"
                     /db_xref="GeneID:2890345"
     mRNA            <813815..>814888
                     /locus_tag="CAGL0K08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448577.1"
                     /db_xref="GeneID:2890345"
     CDS             813815..814888
                     /locus_tag="CAGL0K08184g"
                     /note="highly similar to uniprot|P00431 Saccharomyces
                     cerevisiae YKR066c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448577.1"
                     /db_xref="GeneID:2890345"
                     /db_xref="GOA:Q6FMG7"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="InterPro:IPR019793"
                     /db_xref="InterPro:IPR019794"
                     /translation="MSATALRIAPIASRTFQRRLGYLLAGVATGAAATVAYKAQKNNN
                     YYKYNNNNNNNSGFKAGALAAAAGVVHLAHEEDKKTADYQKVYNLIAERLRDDDEYDN
                     YIGYGPVLVRLAWHSSGTWDKNDNTGGSYGGTYRYKKESQDPSNAGLENAAKFLEPVK
                     KQFPWISYGDLYTLGGVVGIQELQGPKIPWRSGRTDLPEDMTPDNGRLPDGDKDANYV
                     RNFYKRLDFNDREVVALLGAHALGKTHLKNSGFEGPWGAANNIFTNEFYLNLLNEDWK
                     LEKNDAGNLQYNSPKGYMMLPTDYALIQDSNYLKIVKEYAADQDAFFRDFSKAFAALL
                     ERGIDFPKNQPVHIFKTLDEQGL"
     gene            <815404..>818913
                     /locus_tag="CAGL0K08206g"
                     /db_xref="GeneID:2890346"
     mRNA            <815404..>818913
                     /locus_tag="CAGL0K08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448578.1"
                     /db_xref="GeneID:2890346"
     CDS             815404..818913
                     /locus_tag="CAGL0K08206g"
                     /inference="similar to AA sequence:UniProtKB:P53120"
                     /note="similar to uniprot|P53120 Saccharomyces cerevisiae
                     YGL140c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448578.1"
                     /db_xref="GeneID:2890346"
                     /db_xref="GOA:Q6FMG6"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG6"
                     /translation="MKIKQHAVHAYRLYQHYFPTDRILAQRIFKATVNTTVAFIFTLI
                     PKVRDHIGTEPAMLPLISVIVHPGRRVGGTIKGAMYCTTGLIFGLAYSLLGRFLAAQC
                     LGSTWNTLTEHEQLVLHFNRYRSALAILAMFETIMLFVHGWFRSVNHFYFGIVFPLFL
                     VVHFTFMAPLSETPGVIANSFSTPFYLGIAMSIFFNLILFPEFGSTYLGNAAVDTFKE
                     VRKSVKDSVEFFVNAPLPDSAAIEPVSLNKLLKYKTLVRSKISNCEVVLEECMYEISY
                     SYLSPVKLHPLIPSLKDMSIYITGLVNACQLEFMLLKELNLENIDKLKELVDIMKKRI
                     DDCLVADMILLAYGFDVDINRLEVPELKGKKLSQVAEEVDHSKHIELLEESLNAFKSK
                     VEEEILTVDIDLLKPDEELFLFSTFLINLKQAVESIIVLTTQVHSVYESRKRREVKRG
                     YFGRSLWIPFFQNYKNFPIFGTSKMTENDGLRGTLNGAGEKTEFVARRPSYEEDELLN
                     QQANTNRRNESDLVLPLIKTPTMSRTRKVLEDLPVKAHKFIIRSKEHFRFGFQVVVAL
                     MLASFPMFIPNIRSWYISYRGTWIGFVCILCLEPSVGGTFWVFFLRGVGVITGAAWGY
                     LSYAAGIHNTNPYLETVITVFGAVPGFYFLLGSPYVKAAIIQIISIYIVILAAMLPTD
                     NPSGILLSFAKRCLAVGYGGGIALIVQLFFFPVKARDQLNEEISFICGCISEIELLYS
                     VGLDGEEHETTLTQQRFEKIKKLSASAKAALTRATAYKGLTRQEPRLKGEYTGLENIF
                     TEVIFVLQQIVERMDNAAILRRHYGSSIAKGVNPIVYAYRRQLVGSTIALFRAAQEAF
                     NNKTPLPQFLPSARLAHRRLLVKISKVLPQIANIPSITTESSNKMQDSTSSSDSEEEL
                     TFTAKQSKLTRKVTFDRETYLTWNATSASTEEIIDYIEELIDLTKILVGVNEFKYGFL
                     SRPIYEDWATEAATGFDEFINSEKVSMLKNVPTFNEEDEYESVTNVETSKSSNFRHNT
                     NNTTSTEANASRHNNFDLYGMESASDLSSDMDSASAMSPRNPVALEDENHHGTANIHS
                     GTALNLARIASHKAGSKVDALPKNFRDRSFSIGSIAGQLPGLSRRRTLGEANDDYYDE
                     NASSDEELPLTLKKILSKGKKKN"
     gene            <819369..>820670
                     /locus_tag="CAGL0K08228g"
                     /db_xref="GeneID:2890347"
     mRNA            <819369..>820670
                     /locus_tag="CAGL0K08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448579.1"
                     /db_xref="GeneID:2890347"
     CDS             819369..820670
                     /locus_tag="CAGL0K08228g"
                     /inference="similar to AA sequence:UniProtKB:P36142"
                     /note="similar to uniprot|P36142 Saccharomyces cerevisiae
                     YKR051w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448579.1"
                     /db_xref="GeneID:2890347"
                     /db_xref="GOA:Q6FMG5"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG5"
                     /translation="MGVATLFAELLNGCLAKYSALFSMLAMFMALYTILRHLMNYRKP
                     YEQRLSIRILIVVPIFCITCLLSVLFPFYARRFVDPIREVYEAVVIYTFFSLLITYLG
                     GEYEIISRRGLKHQPVNHFVPLVGQLLKKVDISNPNDFLWIKRGILQYVWFKPIYSIS
                     MICIDIWGLKQFEIALVVLFNISVSLSLYELALFWKCLYQDLLPFHPWPKFLCVKLII
                     FVSYWQGLIIQVLGYYRLLGKSIEYKHSELGYIYRNALLCFEMIGFAYLHQKAFPWED
                     YSIKSIPMGARMKLRYAIRDCFGIQDLIWDSKQALNGNTYYNYRNFDPSVETSLLGGV
                     NRDTRIDRINEGLRFTNNGESRYWIDYGAIESGAQVSESIRNTDSAKDISADWDDSID
                     TSRYVQADPNYPVVWNIAGARYTNSTAQLRNEIIGRSSSTN"
     gene            complement(<821014..>821907)
                     /locus_tag="CAGL0K08250g"
                     /db_xref="GeneID:2890348"
     mRNA            complement(<821014..>821907)
                     /locus_tag="CAGL0K08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448580.1"
                     /db_xref="GeneID:2890348"
     CDS             complement(821014..821907)
                     /locus_tag="CAGL0K08250g"
                     /note="highly similar to uniprot|P23500 Saccharomyces
                     cerevisiae YKR052c Mitochondrial RNA splicing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448580.1"
                     /db_xref="GeneID:2890348"
                     /db_xref="GOA:Q6FMG4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG4"
                     /translation="MDEEIDYEALPPCAPLHHQLLAGAFAGIMEHSVLFPVDAIKTRI
                     QSSSSGAATQGLIKQISKITTAEGSLALWKGVQSVILGAGPAHAVYFATYEFSKSKLI
                     DPQDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESVWHVTKNIYHKEG
                     FAAFYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYNPFIHCISGGLSGATCAAI
                     TTPLDCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANM
                     PATAISWTSYECAKHFLVNSS"
     gene            complement(<822618..>823832)
                     /locus_tag="CAGL0K08272g"
                     /db_xref="GeneID:2890349"
     mRNA            complement(<822618..>823832)
                     /locus_tag="CAGL0K08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448581.1"
                     /db_xref="GeneID:2890349"
     CDS             complement(822618..823832)
                     /locus_tag="CAGL0K08272g"
                     /inference="similar to AA sequence:UniProtKB:P23501"
                     /note="similar to uniprot|P23501 Saccharomyces cerevisiae
                     YKR053c dihydrosphingosine-1-phosphate phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448581.1"
                     /db_xref="GeneID:2890349"
                     /db_xref="GOA:Q6FMG3"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG3"
                     /translation="MSVAATLIEKADLSIEDSNGCNAAKHHLSDPGNHPAEHFKKKMS
                     PLRFKMRQFLTRYTDHQSETLANIQHTLRNPVLDVYFKYSALMGAHTFYIIALPIPIW
                     FGHWELTRDLVYIFGYSIYLSGFLKDYWCLPRPRSPPVERITLSKYTTREYGAPSSHT
                     ANATGVSAYFLWRIWVESNFTLTSKALLSIGVMFYYLTLVVGRVYCGMHGLLDLYSGA
                     LVGLACFMGRIGFDYLFPTFKASEYNWVPVLSVIVSLFLLYKHIKPVDECPCFEDSVA
                     FIGVVSGLDCSNWLIAKFNLNLVCSFIDFEPKNCLHILARLLVGVLTVIVWKYVISKP
                     LVYFTLVKLVRLKDERKDYHERHEITKLAAECAEHIGVPNIELLGRFIIYAGVPSTVI
                     LVCPVIFKALQL"
     gene            complement(<825448..>837573)
                     /locus_tag="CAGL0K08294g"
                     /db_xref="GeneID:2890350"
     mRNA            complement(<825448..>837573)
                     /locus_tag="CAGL0K08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448582.1"
                     /db_xref="GeneID:2890350"
     CDS             complement(825448..837573)
                     /locus_tag="CAGL0K08294g"
                     /inference="similar to AA sequence:UniProtKB:P36022"
                     /note="similar to uniprot|P36022 Saccharomyces cerevisiae
                     YKR054c DYN1 Dynein heavy chain cytosolic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448582.1"
                     /db_xref="GeneID:2890350"
                     /db_xref="GOA:Q6FMG2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG2"
                     /translation="MVQRNIELARYITTLLIGVCPKLLDDSELRGGVVDKLSNDVHVI
                     EFSNNDNEGGKIDNQILRVTIAKSNNGSDIDDIWINDSIPTKVYEDNEWCSGLSFSSV
                     IVVKQSKLWLDDVPINTQLTAVTSPTLFDIKEFTNFIELQIKKLFQEITRMDTIEYSL
                     DSIKDTEQKLAETSASLYRLNDTIKSPDLLQLAHHIVRKAIQEGATVDNYKQYIPKNI
                     LNDKKFVNALNHISIQWIKSMKSLISLLDFPSKTDLSNEINMWQRLRYILVDIIGQTE
                     KSEFQITLKLLRDTNISNTGLDALVDTELQKTLNTVEGYIQFLTSFPSYISGQNFDEL
                     QVTLFNFFGNAQKFSQYGYPVNRTIELIVLFNNNLMQTINSRYQNSIALSLNEFNADY
                     THITMFLNSLKAQLEDFKLVLREYLRKNNNLNYKEIIEQLPENTTTIDQLKEVKNLKE
                     YQDILIRCIHALKYDGYISDINEIDHCFSSNYNNQITSNSLRNLQVTFHKISFDVENR
                     IILLFQDRDLKSDSRHILDAKHLFLCLKDLSRFSHIIRKKMQSYRDEYLNKLEKSILL
                     IIDNYYVQLVHLTNYYPTGNLSSFRQIYSIFSVKKQIQLKLRECDILFDKSWMSTPKG
                     HTIMSKIESIDIDKKIQQYLSDWVTAIKQKHNNLLDQTLFTIINNGYNKNELSIILPQ
                     FLLECYRDLRNITYLGIQTDMEFSHFLRGSNKWISNVEILKEDIKLFFVMIQDLDKTI
                     FTKIIICAEIYDIWTIVKKQLHITWQRIQTHNNFIEVFDTRLQPLLIKYDLSLGQETI
                     IGKSLKNLKTGKLSIDFINKELNLIERSLNFLKANKIERTNLTTHLVLQNLENSFMDM
                     IFHHMNDFNFSQITIRLSKYNDSIVFKPSLQEINSMRIMEVQSVLKSFTNIQENLSES
                     ISNHSFSQVILQNITCRYYIKESSNLIKEEMEAIKVRLKETTMKIMILEIDVQQYQQV
                     LHENIDAFLELCEDVVNLKLFTESNSHITITKSIKLDYSSLISDLKAKLKECFRILGN
                     SLQNHLMTLQTWLDEKYKEFNGGLEFNENAEYEPPHLLKFFQLYFCFIDSRTAINTNI
                     AKFKELIQLKKIVEETNHEKGQQIQKYINVYDRLENSFYKTICYIQENCQNEIKSLKQ
                     YCTTCYNSKLKEIETLWIQKSTFLKSKNLEFILPLIRQFQVLRSETANFKKMSIQVTN
                     HFKLSNDVESINSQPPMEKEIDKWIVCLEELVQVEDALKSFEMTRLKDLSKQLNTTAI
                     DKEKTKIEMLSTTLHETQAYKSIKQKILFYMNQTDILLGISSEQINERHMKELFDEIG
                     CPPNPHLNFSELKICDLPIEQLLLNRFKVDEIISKAKREAAIKDSLDEIEMYWSYFTL
                     LMDDSTAHIPILKDIDELRNKISEDMDILETMIISPFSVPYTTTIESWNTNLSNLSNL
                     LNQIEVSQSQWLEFNLLFTNSNICSSLPLEKAQFDQISESLLSLILYVKHAANIFDLI
                     RSGNVSKSYTEITSKLNKIKKKFSEFVESQRQQYPRFFFVNDQELVTILGAINDIDVL
                     SGHLRKLYFSISSFDIQNGKIHSVVSAEGEILKLSNEIELSIYKTVPELLRSLDLEIE
                     TTLKTSIRDCLMNSRSLDEIFESNVYQVLTLWLQVSLSEKLHSYKHSKSKDELLEMET
                     FLSRTCSWLNYKNVLSSDSGYKKLKIEGMLLEVLKYQSLFDQLSKCTSNIDVDIMLDD
                     WWMFRLIEGNEIAIECSRQDSIYPYAFNYLGVPEHLVFTKGLANVYNFLDESFHQNYG
                     VSIIGPAGTGKTESIKSFGYMFGIFVTVFNFDDLIDFSSLQRIIAGILKLGLWASFDE
                     FNRLEYTVMSAISEMISSIQHSLSNKNTTIDFLGMKLPIHSHTKLFLTMNPKYRGRRN
                     LPENLRRLFRVYYFGKSDSHHIVEIYLSMYGNKDKYLAPKLINFLNDLKMSCSQQDHY
                     DFGLRLIKAIFRQISAVPRATLDQNTIVSLMKVMILPRLTREDSKTFNKKLDEIFNYS
                     NDREDTSLSSNFMKIFKSMDLLIQGEQLQKCLQLRELYGSNTGIILLGESGCGKTTIL
                     NALHKSFEQDLHHKIEVYYLDPKAIPKDHFFGYYDKSTTEWQDGIFSSIIRASNSSTE
                     CVPLWIVVDSDLDSSTMEAMNSMLDDNKLLTLGSGERLKVGKNIKLICETDSVSKLTP
                     ATVSRCSVVHLPYLPANIDEYINHKIHLLTRYLNSNGYQSIQQDILFEVSRLCESDIY
                     KIVALSKDTTEAEINMNTQQLIDNFFYILIDFIGIYYSMSVKCADHANMTLVLRFQLR
                     KYLIFAFSGHLQQSVQLMFLHEYQRSCQEKFWGENETLADKAVDTILYTITDTYQLEL
                     KSTAIKNLSTDMDHLIQTSEISLYKEMINSYLFCNRSLLLIGPPGSGKTMLIRNIIEN
                     NENYSSYFMSLSADSQISDIIRIIKSKTKAISKASEVVLVPKQSKKFVLFLDEINLPR
                     LDEYGSHKVSLFIRQLIDKQGFWDFQTHQWLQIMNILIIGACNPLSYLGRVPLSNKFY
                     KQVSVLFVDYPSANSLVYIYSEKFRRIFSLIPHLEKLNVDILKATIEIFYKFKEAFDE
                     RRETIYICTPRELTKLCKGLLTTVLNINESINEDVLFRVWLFEIWHIFGERLMNADDQ
                     NILRDIIYKVSTQFEIKYTEPNELLFTSLISGEYQDVTKTNLMKFLKNRIPTYIEEYK
                     IPDFVIMDMMAGPIISIERILSKPNSHAILSGAPRLGKKTLTKLTSWLMGLTTLEILI
                     GDKDSFDQFFATLKNCIRDCISNDISYCLYVGCSADVETAYLEKINALIANADLPEIY
                     EESELNIFLGEVKENAKHNNIILENELEVQLFIKEKISKGLHIVFSVSDDNFDNNSNG
                     LLCSPTLVNRCTVVWFPSWSSEVYYEIATKNLNRLPLSFPVSESLGKSSNDTLKQLAQ
                     CIVEIDTYLRVNYLELKSTPSYFLDLLRVFENKYLAMLHQNDSSKSYCSRGLEKINDA
                     VLELKTLTSELENSRQQLSIKEDSARKTLDELLVDQNEVERKHEATIEIKKILEKQEA
                     EVADRKLKLMNQINKIEPVVSAAREGVKNIKKEYLTEIRSMAKPPNAVVLIMSAVCSL
                     LGISFNNWKDIQQYMRKESFVKDIITFEPKGDNFKDRRSIVQTSYFADKNFNFAAINR
                     ASRACGPLYHWIVAQIEYSEVLDECVPLENEIGDINLKSNHYKANILAAESMIIDLHT
                     KMKLAKENYANLIGEVENIKRQIKANTNSLNRAIKLVKTLSAERKRWTVNERDYSSNK
                     SCLIGDSLYLTCASIYFGQLSELNKEKVQNLIFQSFKKYNISHSTLALIEEVSVEDKA
                     QYLSCGLAEDPYVIGMFDLLIKSPQFTSIIIDPQNEIVEILKSYHNQNISIMSVNDPS
                     FTKRYLKAIDFGGPVLITECEYLGTTTLSTLFDARASRRKNHIYLHTTSSTHKFPAYL
                     LARVDIIDFSIKIGSIALRSLKATLDIIKPEYQKETEALRINKEQLKITLMHLEDRLL
                     KELSDSSGPMLENDELLRTLEQLKNDSEEINEKIIETENNTAILQQIIENIKIIGNHA
                     VQVYRILEAITILDKHYKISISRYLQYFALALKENDLSTFNVIEKDTSRLNELKKHLI
                     KMFYCNIYGIISPSLKSEHRVVLAIALYICYNKTNKEPNNNDWLIKAITHLSAQSAIV
                     TDKADNVDNIITENIDSLMQLKGMLDTFFKSKFSLENMINNKNFPNVVVINSHYQDGS
                     SYITRCYSRLIDNAISLGTKESLAWAEGKIQEGISKGGCVLLQNIELGEKWINSYVSS
                     ITKRPSEKLKLFMIYNPTIKSTIIPTISNCDKIRFEGNDNICMMVNELFTMVKEYASS
                     QRYVYLSYVLAWLHAIIVFKMRFAPNGGFRQLVAFSDNDFIFLFNIGQRILNRSNNDQ
                     LFWQFIKHAAHNHVYSIQLEDEKDKISMKRLIDEILPEEFYPKYMIVNEISISLQDSA
                     SCIEEQLASIKLPQEWETVWLGFNKDSLRTHKNDIESKVLDDTKQLLNSIEYV"
     gene            <839222..>840193
                     /locus_tag="CAGL0K08316g"
                     /db_xref="GeneID:2890351"
     mRNA            <839222..>840193
                     /locus_tag="CAGL0K08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448583.1"
                     /db_xref="GeneID:2890351"
     CDS             839222..840193
                     /locus_tag="CAGL0K08316g"
                     /note="some similarities with uniprot|Q00246 Saccharomyces
                     cerevisiae YKR055w RHO4 GTP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448583.1"
                     /db_xref="GeneID:2890351"
                     /db_xref="GOA:Q6FMG1"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG1"
                     /translation="MMQVDYFSGIGGIPRGGGRSNSRVSSTTLPESLVSGQSDDTLNT
                     YGATSLKLSRSRINPFDRTLSQVESFEHMKRAHKIPDYHLKIVVVGDGAVGKTSLLIS
                     YVEKVFKHENIPTIFENYVTNIQGPKGQIIELALWDTAGQEEYSRLRPLSYTGADVLM
                     ICYAIDSITSLKNVEDVWFPEVRHFCPGTPVMLVGLKSDLYEEESCDSKVDPAEADSI
                     AKKNGAFAHIQCSAKLRVKVDNVFYAAINELLAEQLISQNHNAPILKSIFKLKKLKLS
                     EPIDIEEQYYDGENGGDDNDGSSSGNVAALPSTIVKKNIRKSKCIVM"
     gene            complement(<840409..>841389)
                     /locus_tag="CAGL0K08338g"
                     /db_xref="GeneID:2890352"
     mRNA            complement(<840409..>841389)
                     /locus_tag="CAGL0K08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448584.1"
                     /db_xref="GeneID:2890352"
     CDS             complement(840409..841389)
                     /locus_tag="CAGL0K08338g"
                     /note="weakly similar to uniprot|Q08909 Saccharomyces
                     cerevisiae YOR385w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448584.1"
                     /db_xref="GeneID:2890352"
                     /db_xref="GOA:Q6FMG0"
                     /db_xref="UniProtKB/TrEMBL:Q6FMG0"
                     /translation="MPLFEKLIYSFSEKKTIPQQFPILLNNDQTLPPLVTYNMTRVMP
                     IVRKLASRSFMIFPSVQSYDIFKQKKGDSIDPDGMGIPLFEAVPSLLPTYIDGRPLLK
                     ISKFVLLPRDAPAPSSQYEIITQDDNYNLFKIPFCEVYYKLTGVASRRYEFQFSNPEI
                     LSPNYIQSEAFSYSHRGTAEGFDLNWDISRIPFLVGKLVITVKQDTPPTYQNAVKGEK
                     KQKPSSYNYKTKTCAYYTKRFQDEVPKLISRRADLIIGELNNSHSLGITNVSIYTEIF
                     ACHALMIHELEHTRNNKSEKRNRRIDARDIKKEQRRERKEIRREARRHQH"
     gene            <842615..>844372
                     /locus_tag="CAGL0K08360g"
                     /db_xref="GeneID:2890353"
     mRNA            <842615..>844372
                     /locus_tag="CAGL0K08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448585.1"
                     /db_xref="GeneID:2890353"
     CDS             842615..844372
                     /locus_tag="CAGL0K08360g"
                     /note="highly similar to uniprot|P33753 Saccharomyces
                     cerevisiae YKR056w RNC1 tRNA methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448585.1"
                     /db_xref="GeneID:2890353"
                     /db_xref="GOA:Q6FMF9"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF9"
                     /translation="MNLLVKGSLVNIGLRSGILRRSIKRCFKMEALNNQNIEDSKKRQ
                     ALQKNNQPLKKRPKLKRYKAKKVDPTSPLGVLQFEIDELLRENNLEKSQVENDVTAIL
                     NDTSFVTGPIASKYHREVSDVKVLKLGSNGDGLAIIPNPVETDKKQVAIVPFGLPGDL
                     VRIKVFKTHPLYVESDLLDVIEKSPIRKDELIKDKYFGKYSGSQFEFLDYSEQLKIKK
                     STIANAYKHFAPLLLAESLVPEISDTVASPLQYGYRTKITPHFDMPHKVKQLEVRPPL
                     GFGQKGRPKWRKETLEVGGTGPILDIEECALATDILNKGLSNERARFEKEFKNYKKGA
                     TILLRENTIILDPSKPTEEQLEEGSRDENGDISFIEVTDETTGVKLAKTCVTNTRQIV
                     TEYVDGYTFKFSAGEFFQNNNSILPLVTKYVRDNLQLGNGDKPRYLVDAYCGSGLFSI
                     CSSKGVDKVIGVEISADSVSFAERNAKNNGVENCKFIVGKAEKLFESIDTPADSTSVI
                     LDPPRKGCDELFLKQLAAYNPARIVYISCNVHSQARDVQYFLKDTPEGKNYRVESIRG
                     FDFFPQTHHVESVCVLSRV"
     gene            <845535..>846379
                     /locus_tag="CAGL0K08382g"
                     /db_xref="GeneID:2890354"
     mRNA            join(<845535..845558,846140..>846379)
                     /locus_tag="CAGL0K08382g"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_448586.1"
                     /db_xref="GeneID:2890354"
     CDS             join(845535..845558,846140..846379)
                     /locus_tag="CAGL0K08382g"
                     /note="highly similar to uniprot|Q3E754 Saccharomyces
                     cerevisiae YJL136c RPS25B 40S highly similar to
                     uniprot|P0C0V8 Saccharomyces cerevisiae YKR057w RPS21A"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_448586.1"
                     /db_xref="GeneID:2890354"
                     /db_xref="GOA:Q6FMF8"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /translation="MENDKGQLVELYIPRKCSATNRIIKADDHASVQINIAKVDEEGR
                     AIPGEYITYALSGNVRARGESDDSLNRLAQNDGLLKNVWSYSR"
     gene            complement(<846867..>849335)
                     /locus_tag="CAGL0K08404g"
                     /db_xref="GeneID:2890313"
     mRNA            complement(<846867..>849335)
                     /locus_tag="CAGL0K08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448587.1"
                     /db_xref="GeneID:2890313"
     CDS             complement(846867..849335)
                     /locus_tag="CAGL0K08404g"
                     /inference="similar to AA sequence:UniProtKB:Q06245"
                     /note="similar to uniprot|Q06245 Saccharomyces cerevisiae
                     YLR166c Exocyst complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448587.1"
                     /db_xref="GeneID:2890313"
                     /db_xref="GOA:Q6FMF7"
                     /db_xref="InterPro:IPR009976"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF7"
                     /translation="MNSLYELDPRWKKLIHDPNNFLGGLTVEEFVQEVGRDRDPVDST
                     AWNKKLDPKPYIRTFESILKELTSLQERMDNDKQMMADAVSKQELAYSSKVLNLSSGL
                     GKLVDNYNYLDNKLTSINQMVSPLSEKLQNSIKKKKNYIKSIELIIQYNTFLKNGKSE
                     YVDNMLNSKKLANRLNAAVLIKNQLLLARKIETNSIPATKSTTSTIEKYAEEMENEML
                     TKFNNAYRENNFTQLNEIALILNHYNDGINVIQSFINQHNFFLDSDEVNKSMTGESPY
                     LSEDVRDKLMDPNYHIIVYSQELVDMLKNIEEVIKNESKIVKRVFEDSASYVLQLFIQ
                     RTFAQKIEPQLEFLLNSALSFSHLAYVRTLHSLYSLLGKFVKDLTDYFQLLEVENEAN
                     LQAALEQCYTDFFSRWLFDRSKYFDIEKRSLEIILIEMTSRFNTLHEKDIRQRLLTNK
                     FKASTNDSPETRINELSTTNTANSKLSQITTFMKSRIDKDILPVSRSRSVKENENGSP
                     IDHAGDDGYNLETVDAIIKCIVEAIARVMELIPNKATSCIYEILELASMGIIGSYVKN
                     ALEVAYCSISKPEQNKVDEIDLSSMKYISITTEILSLLSTLIKSVCLPLLSNYPDVKK
                     KVIIATNSQVKNCEVMINLIMEEVFQQFSNKFIASLSKQKRKDFLPKSLDLLDQDTQP
                     AVEIVNLLNSTYSQVSQHLKSQNLTTFLSTIGEDLYRLLLDHYGKFQVNSTGGIIVTK
                     DIIGYQTTVDDWDIPDLSEKFATLRELANLFTVQPDLLDSLTKEGHLAHMSRGIIQTY
                     IANREDFNQDNFMSNMKQSLRQYT"
     gene            <850532..>851224
                     /locus_tag="CAGL0K08426g"
                     /db_xref="GeneID:2890314"
     mRNA            <850532..>851224
                     /locus_tag="CAGL0K08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448588.1"
                     /db_xref="GeneID:2890314"
     CDS             850532..851224
                     /locus_tag="CAGL0K08426g"
                     /inference="similar to AA sequence:UniProtKB:P32803"
                     /note="similar to uniprot|P32803 Saccharomyces cerevisiae
                     YGL200c Endosomal P24B protein precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448588.1"
                     /db_xref="GeneID:2890314"
                     /db_xref="GOA:Q6FMF6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF6"
                     /translation="MGNRIEKELRVVGGEDIVRFYSHSISYNKGKMLFGILVALFLSV
                     VSAHNVLLPPHGRRCFTEKLGKGDELSITFQFGDRDPESSHQLTGDFTLTGVDSNTLH
                     KTLRDVSHGDVVFSAPHSGNFEYCFSNENSNIKTKDVTFNMHGIVYVDLDDPNANTLD
                     SAVRKLAKLTNEVKDEQSYIVIRERTHRNTAESTNDRVKWWSIFQLGLVVANSLFQIY
                     YLKRFFEVTSFV"
     gene            complement(851546..851617)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0K08448r"
                     /db_xref="GeneID:2890315"
     tRNA            complement(851546..851617)
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0K08448r"
                     /product="tRNA-His"
                     /db_xref="GeneID:2890315"
     gene            complement(<851940..>852119)
                     /locus_tag="CAGL0K08470g"
                     /db_xref="GeneID:2890316"
     mRNA            complement(<851940..>852119)
                     /locus_tag="CAGL0K08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448589.1"
                     /db_xref="GeneID:2890316"
     CDS             complement(851940..852119)
                     /locus_tag="CAGL0K08470g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448589.1"
                     /db_xref="GeneID:2890316"
                     /db_xref="GOA:Q6FMF5"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF5"
                     /translation="MSMFAMGCPDVIQIIQLCGGKSTEGSSYHELIRGYSIACIDVLV
                     SRLLVDICRHSFSRD"
     gene            <852307..>854004
                     /locus_tag="CAGL0K08492g"
                     /db_xref="GeneID:2890317"
     mRNA            <852307..>854004
                     /locus_tag="CAGL0K08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448590.1"
                     /db_xref="GeneID:2890317"
     CDS             852307..854004
                     /locus_tag="CAGL0K08492g"
                     /inference="similar to AA sequence:UniProtKB:P34248"
                     /note="similar to uniprot|P34248 Saccharomyces cerevisiae
                     YKL100c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448590.1"
                     /db_xref="GeneID:2890317"
                     /db_xref="GOA:Q6FMF4"
                     /db_xref="InterPro:IPR006639"
                     /db_xref="InterPro:IPR007369"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF4"
                     /translation="MSSPFRAAAEQVLAKFLSPHSNETTTVDSELVDVFNKVNTFMST
                     NQSQLNKVFDRWVDRTTFSFTQLISTHPSLYACVGMLAFALTVVTLGSFTSIKSIPHT
                     ALPPTKYDPLFDPTDFDLDTESIIVHKNETDAQKKKDGHKLANYDKIDVRHSLLIPLS
                     CGAVLMTLYFFIKRLQVRWLSIIVKGLTYQSILSHTFAATFVYNYLIQSFIRNLSYLF
                     KFNPLKILPRCRLTVSDDNVEIHQTGAVSNLCYKNQISGKIQEAKRVEKIKKTSWESH
                     MYRRELKAPSSVKSDSQILNVYMSDATIYSFIFACIISALYFWFPRNWMLTNIVSLNL
                     SVWTISQLNLKNLKSGTMILLVLFFYDIYFVFYNDVMVTVATQLELPFKLSIPVKFNP
                     ASKKFDFSFLGLGDMIIPGMFIAMCYKFDIWKWHLKNVDREFHLLNWGYIGTYFKVAL
                     ISYALSMVTCMLCLNIFNVAQPALLYIVPFLLISISVVAKFNNDFKDMWNLQFDVIEI
                     DDEKLSSGRLEKEDQLTYSELLESDYIEDSDTDVNSDFTPESDDDLSLSDDDDEAED"
     gene            complement(<854143..>858612)
                     /locus_tag="CAGL0K08514g"
                     /db_xref="GeneID:2890318"
     mRNA            complement(<854143..>858612)
                     /locus_tag="CAGL0K08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448591.1"
                     /db_xref="GeneID:2890318"
     CDS             complement(854143..858612)
                     /locus_tag="CAGL0K08514g"
                     /inference="similar to AA sequence:UniProtKB:P34244"
                     /note="similar to uniprot|P34244 Saccharomyces cerevisiae
                     YKL101w serine/threonine-protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448591.1"
                     /db_xref="GeneID:2890318"
                     /db_xref="GOA:Q6FMF3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF3"
                     /translation="MSVLIPHQQQRLRASSAAKKAAWNAMNKTVNIVSPHNNVNYVKK
                     PSPKTNSNHLDRVIKSVNDATKRLSEAESINSNNTKSSKRKSRDTVGPWKLGKTLGKG
                     SSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPI
                     KNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLV
                     SKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAAL
                     ELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKK
                     LLLKVQAGRFQLPPYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIR
                     KLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQRLVERLL
                     VEGATEEKLFYSLLFQYKLKHSKPISATKLQKKIEDVVLENESTKTESKDSSNEPGID
                     NNNDTSDFTQDGNSSEMVNELHTSAPMLEQKSQFSQHSLKSKETVPISDLPPLPPVIP
                     TFAASSSKAFRRSKSNLSSYLKRPKLENARSRTSLFNSSSNTSITSSSISELNTRPRG
                     NIPLSPSNITLTSLVSSRSLHNSASKKSLKNLQKRTLQNSESKRSLYSQTSISKRSLN
                     LNDYLIGGPSNSAELPPLPKLDSNNEFEMLCDKILNTSALDNILEEEEEDITPSKNTT
                     QTNDVHNEDTIIRKEMHDFEINVNNHQPEFKRQPSDFSVNGPDTSIFSIEPMPEGLGI
                     SKKPVRVQPTFNFIIDEDKVDDSIKVKQVSGTGPSNNVLKDISNQINNGKGIENSKLH
                     PTSNNNYKNIRNVTAPEGNFTSKTFSLDPRRNVSQPPKESLFHSLLNNKSSKNAEENT
                     QFESKSKQYNFMNKTAHSEFEKERLNAHRDADRSNDQNVYNETSVLAQSSTIHESPLL
                     SIPSTLLNTSMTFKNLVDMLQENKLDDINETVAKESSAPLRKKSTKLSLAPHSNLVSD
                     LNKRTSGYNTLASVDRSSSDLSYAIDLPTNTNIAEIVYLSGNNKQSSEKNIFMLSNDN
                     NETELFHTDENKTSIKSAVNIFEDPPSDSTSLQTSSSESDSIPKVQRKAVSIETLNAS
                     NIITPAADVRVSLYGNNVSNSNTMPRETTEELISRFKLTPEKPQHQVQKRFSSLTQTG
                     RNTDSIALSQSMISMFKDAEENGNNKSVKVLDQVEEENASKLTPTSPKNRVTMLFDDY
                     EAQQNITSDQSNKSSKVIEIPNDSPIKVKVQKASTIFEKEIISAAEADENDHLRIPYE
                     SKSKKEIAQVHQQEQKEQQVRKPTESQEKAVQKTTKPSWFSKLIHGFKTTGGSGHTKL
                     IREHSTKMTFEEVHMITVKEFGNNGIDYQLRTLDKKGDREKVEYDCKFVKGNFEFKIK
                     IFNSGFPHQNTIITVKKKGKINSKETTDLFQRFNANIENLIKSAERNIESNPK"
     gene            <860741..>862270
                     /locus_tag="CAGL0K08536g"
                     /db_xref="GeneID:2890319"
     mRNA            <860741..>862270
                     /locus_tag="CAGL0K08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448592.1"
                     /db_xref="GeneID:2890319"
     CDS             860741..862270
                     /locus_tag="CAGL0K08536g"
                     /note="highly similar to uniprot|P14904 Saccharomyces
                     cerevisiae YKL103c Vacuolar aminopeptidase I precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448592.1"
                     /db_xref="GeneID:2890319"
                     /db_xref="GOA:Q6FMF2"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF2"
                     /translation="MEEQRQIIEQLKQTLNALTVSQNTTSNKTPADEPFYHINEHTYE
                     DCAQEFIDFTYENPTTYHVIEFFSKLLEGKGFKYLPEKKTWNDELEPGKPGRYYTIRN
                     GTNMTAWVIGKKWKPESGVGVVASHVDSLTAKLKPASLMEKVEGYKLFGVAPYGGTLN
                     ELWFDRDLGIAGRVLYKKKNSSKVESTLVNSAPHPIGRIPSLAPHFGQPSEGPFNKET
                     QAVPFFGWCCDIDDEGTITDEEKKCPLVGKHSILLLRYIAELAGIKVSEILQLDLDLF
                     DVQKGTFGGIKKDFIFSPRMDDRLCSFTAMIAMAYYGATVDLDELSSFNMVALFDNEE
                     VGSLTRQGAESTLLKTSICRTAKRFTNMEGLEPPTLFANSIVLSADVNHLFNPNFKEV
                     YLKKHSPKPNWGMTISLDPNAHMATDVVGLAFVEELARKNKDTVQYFQIRNDSRSGGT
                     VGPIVAAQLGARTIDVGISQLSMHSIRAATGTKDIAMAIKFFRGFFDNWREVYDNFGE
                     L"
     gene            <863000..>865171
                     /locus_tag="CAGL0K08558g"
                     /db_xref="GeneID:2890320"
     mRNA            <863000..>865171
                     /locus_tag="CAGL0K08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448593.1"
                     /db_xref="GeneID:2890320"
     CDS             863000..865171
                     /locus_tag="CAGL0K08558g"
                     /note="highly similar to uniprot|P14742 Saccharomyces
                     cerevisiae YKL104c GFA1 Glucosamine--fructose-6-phosphate
                     aminotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448593.1"
                     /db_xref="GeneID:2890320"
                     /db_xref="GOA:Q6FMF1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF1"
                     /translation="MCGIFGYCNYLVEKSRGEIIDTLVDGLKRLEYRGYDSTGIAIDG
                     DELDSTFIFRQIGKVSSLEKEIALQKPNRDVTFVSHSGIAHTRWATHGEPKQINCHPQ
                     RSDPNNEFVIVHNGIITNFRELKTLLLNKGYQFESDTDTECIAKLFKHLYDTNLKNGH
                     DLDFHELTKLVLLELEGSYGLLCKSNHYPNEIIATRKGSPLLVGVKSEKKLKVDFVDV
                     EFPDESMGKPDTPLVSASGEAINNNNVTVSGRNARHVEANAHNNNLMPIAANDFNLRH
                     SQSRAFLSEDGSPTPVEFFVSSDAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRKE
                     VGASMTRSIQTLEMELAQIMKGPYKHFMQKEIYEQPESSFNTMRGRIDFENKNVMLGG
                     LKAWLPVIRRARRLIMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRRSPVFR
                     EDVCIFVSQSGETADTMFALNYCLERGALTIGIVNTVGSSISRVTHCGVHINAGPEIG
                     VASTKAYTSQYVALVMVALSLSDDRVSKIERRKEIIDGLKLIPGQIKQVLNLEDKIKK
                     LCVTELKDQKSLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDEN
                     LPIIAFGTRDSLFPKVVSSIEQVTARKGKPIIICNENDDVWAKKAEQINLVTLEVPQT
                     VDCLQGLLNIIPLQLMSYWLAVNKGIDVDFPRNLAKSVTVE"
     gene            complement(<865470..>866831)
                     /locus_tag="CAGL0K08580g"
                     /db_xref="GeneID:2890321"
     mRNA            complement(<865470..>866831)
                     /locus_tag="CAGL0K08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448594.1"
                     /db_xref="GeneID:2890321"
     CDS             complement(865470..866831)
                     /locus_tag="CAGL0K08580g"
                     /inference="similar to AA sequence:UniProtKB:Q01802"
                     /note="similar to uniprot|Q01802 Saccharomyces cerevisiae
                     YKL106w Aspartate aminotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448594.1"
                     /db_xref="GeneID:2890321"
                     /db_xref="GOA:Q6FMF0"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FMF0"
                     /translation="MTLNYASVQCVLRMRSAVMLGRRRLSRKALKQSTLFDIPMAPPD
                     GVLGLTETFNADENPNKINLTVGVYKDGWGQVTTFPSVAQAQKIIDMDVGMNTDLSYL
                     PISGCEDFKKHTINFLYRDSCPQDGPALIKNDRISFIQTLSGTGALAVASRLLSSFIS
                     RKIWIPKPSWPNHTNIFTQNGFTNPRFYSYYDRGDLTIGRWLQELRHEVGKDSNTKTP
                     HCIVLHACCHNPTGLDPTKKQWEDIMDTIYELGMIPIIDMAYQGLESGKLIDDAYLLR
                     LCLDTSRYRSWDNGLYLCQSFAKNMGLYGERVGSLSIVAPEHVPGVKEVLDSQLKQII
                     RSMYSSPPGYGSRVAKLVLSNDKLKYQWYSDVETMVNRLKSVREMIHERLQWEEIVNF
                     EQQHGMFYFTKLGPDIVKKLREQYSIYLTNDGRMSLSGVNKSNVDYLCNSIKAVTSSK
                     TLL"
     gene            complement(<867311..>868363)
                     /locus_tag="CAGL0K08602g"
                     /db_xref="GeneID:2890322"
     mRNA            complement(<867311..>868363)
                     /locus_tag="CAGL0K08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448595.1"
                     /db_xref="GeneID:2890322"
     CDS             complement(867311..868363)
                     /locus_tag="CAGL0K08602g"
                     /note="some similarities with uniprot|P34252 Saccharomyces
                     cerevisiae YKL108w SLD2 chromosomal DNA replication
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448595.1"
                     /db_xref="GeneID:2890322"
                     /db_xref="GOA:Q6FME9"
                     /db_xref="InterPro:IPR021110"
                     /translation="MDMDVQQVKLKIKRWEHAFIAEHNRPPDKDDIRPLTEMKQLYKL
                     YSVLKSKERKAEPIQKQQTPRKDSNMVLGPTPQIYGKAVSIFEMKVSPLKVEETPTTE
                     VEEDIESEIESSVNRRNSDEASANEEKLGIHSVKKRLFESPKKTENTTHLAVPQVTRY
                     GPNSPLKLAQTVSIRQHLLTPKKKKAEPKSLYTPSPLLKRNSSKTLYELAHEHLQYVE
                     EIKELDQQFKSEIVPIRHGNGQDIGDESDEVPEKKKRRTGVLRRLQFDEDENDRTIKK
                     DLHKELLKLKSRKVKEFLGKEDNEPSEEEEEEQQKSEPLPVKKKKPKKYNLVSNNFRR
                     LKLPKKNRNPRFGRRR"
     gene            complement(<869340..>870380)
                     /locus_tag="CAGL0K08624g"
                     /db_xref="GeneID:2890323"
     mRNA            complement(<869340..>870380)
                     /locus_tag="CAGL0K08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448596.1"
                     /db_xref="GeneID:2890323"
     CDS             complement(869340..870380)
                     /locus_tag="CAGL0K08624g"
                     /note="weakly similar to uniprot|P14064 Saccharomyces
                     cerevisiae YKL109w HAP4 Transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448596.1"
                     /db_xref="GeneID:2890323"
                     /db_xref="GOA:Q6FME8"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="UniProtKB/TrEMBL:Q6FME8"
                     /translation="MHPVPIAPNLHRPSTGSARLVVRTSKNWVLPPRPRPNRRNTIHS
                     GANSSHTHTNNTHTNNAGNASSATTAVNSAATSAASTPAPPKRKRENSLPVNLKKVKK
                     DYNRVENCLAFLKFDDEEDTTTTSTDIDDDLFSNTSPVSSTCTPLTSASLNLKSVPFN
                     GASAVSGVGMLNLSAGKNGAQKKQQRAKSAQYSYKPSSKDDSKYGNESTLDGDLDLEM
                     EMSMNLDDNINATSFTTATESKPEFFTINNITNATTSASPALNDPVTTDSSLSAKELE
                     DFYNYIPPSLEELIDEQDAHSKNNNGLFRDSLMSKSYESMNLMMFNDPSNTARQQDDL
                     IVDTDGDMFAFI"
     gene            <873022..>873969
                     /locus_tag="CAGL0K08646g"
                     /db_xref="GeneID:2890324"
     mRNA            <873022..>873969
                     /locus_tag="CAGL0K08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448597.1"
                     /db_xref="GeneID:2890324"
     CDS             873022..873969
                     /locus_tag="CAGL0K08646g"
                     /inference="similar to AA sequence:UniProtKB:P34253"
                     /note="similar to uniprot|P34253 Saccharomyces cerevisiae
                     YKL110c KTI12 involved in resistance to K.lactis killer
                     toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448597.1"
                     /db_xref="GeneID:2890324"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FME7"
                     /translation="MPLVLMCGFPLSGKSTVARELAGYLREKGANVVVHSDETLGHKG
                     RETREEDYNDTHAERKLRNEIMSAVRRDLSRSTIVIVDSLNYIKGFRYQLHCECKNSN
                     TGFMLVHCMATYADILKRDENGEESPRWGKELLDQLIQRFEEPDASNRWDSPMATVVS
                     PETLLPTHKQLVDQVLLGISDKSSSRNGSPSPGPMNRLSQNNPTLLKAATGADFVRLL
                     DAKLTETVRIIVRECQAAQAIGGPQRIIVSEDVRDINDDRCLFLDIPADAPQLTLPRL
                     NRLKRQFVQMNKNLRDVDLERAAPLFVAYIGQTLQSGLA"
     gene            <875357..>876019
                     /locus_tag="CAGL0K08668g"
                     /db_xref="GeneID:2890279"
     mRNA            <875357..>876019
                     /locus_tag="CAGL0K08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448598.1"
                     /db_xref="GeneID:2890279"
     CDS             875357..876019
                     /locus_tag="CAGL0K08668g"
                     /note="weakly similar to uniprot|P40573 Saccharomyces
                     cerevisiae YIR017c MET28 transcriptional activator of
                     sulfur metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448598.1"
                     /db_xref="GeneID:2890279"
                     /db_xref="GOA:Q6FME6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FME6"
                     /translation="MGLENTELPSSVLGVSERIRSMIMENSELGSRLVSLLLVNSGNA
                     AEIIESINKGGASNVRSKSKHKSNEVKPVVAGAQSDRDYTYKNTTEDARVSGDDDEDA
                     VVTTSSQWDNRAITTTGGHSSANSEDEVEDNESLLLKALEKRRKNSEASARFRIRKKQ
                     RRMENLEKLAQLNSHIDDLNKKIDGLLQENRHWKSKLEEINEQKSKQLLEQIKKKNGI
                     LL"
     gene            complement(<877494..>879137)
                     /locus_tag="CAGL0K08690g"
                     /db_xref="GeneID:2890280"
     mRNA            complement(<877494..>879137)
                     /locus_tag="CAGL0K08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448599.1"
                     /db_xref="GeneID:2890280"
     CDS             complement(877494..879137)
                     /locus_tag="CAGL0K08690g"
                     /note="weakly similar to uniprot|Q08206 Saccharomyces
                     cerevisiae YOL036w or uniprot|P40572 Saccharomyces
                     cerevisiae YIR016w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448599.1"
                     /db_xref="GeneID:2890280"
                     /db_xref="GOA:Q6FME5"
                     /db_xref="UniProtKB/TrEMBL:Q6FME5"
                     /translation="MDYLQEIKEEVRLQERSESLGLGLQLMTPTESIHEAQEILESRD
                     ADITMADLSKALEIPTTPVVEIESVFADSPLLLHAVDTTPIAHGGSDIGLGFLPASPV
                     VQKLRSNSYSASINNNMTYHFNATILSNVADTTNTGTTASMGANSPNPNLLSPRSLGS
                     SFKKHVVQRGASVDAVSLDLHTREYTAESPGYFDIGDSKRNSLQKFRSSLNIATAHSS
                     SKLLQRRNSRASISASSPMSNLGYFEDYNHNYTRSRKGSIASATTTVTQRNTSLGSNV
                     RRSLSKIASTTGTIKRAFSSASLNANNAKTANPEGNSNDNGFHETMSHSFSRMSQNSG
                     RNSVADVRNGMFNLHISRENSAYLEPNTISDDELSNSSSTFTNKMLLEDGYSLQNSTP
                     VENWSNTGFVGIKSQGNYREDRGEDDKFLVDIDKLTTEVPVISVTDRLGSKNSTPLIE
                     QSSIVNAEVKCKGRNRNNSNASSLASGSTQKMGLDEYIKVLIGQQNLEDERLEYLEKR
                     FKECGWCSEEELQTIRRKRVMINRKWANKISRYQNKLEL"
     gene            complement(<879866..>880252)
                     /locus_tag="CAGL0K08712g"
                     /db_xref="GeneID:2890281"
     mRNA            complement(<879866..>880252)
                     /locus_tag="CAGL0K08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448600.1"
                     /db_xref="GeneID:2890281"
     CDS             complement(879866..880252)
                     /locus_tag="CAGL0K08712g"
                     /note="weakly similar to uniprot|P40571 Saccharomyces
                     cerevisiae YIR015w RPR2 RNase P subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448600.1"
                     /db_xref="GeneID:2890281"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:Q6FME4"
                     /translation="MAKVKKGKGKGNGGGREHFQRVNYLAQLSRHVAQATGDVSLTQL
                     YNRNLVQVSHKTKTRLSPSLKRSMCKQCKIAQIPTITTKVSVEKHTGCLAIECQCHQR
                     PHKSKRVNNKRSVKRFPINACRSLDH"
     gene            complement(<880549..>881325)
                     /locus_tag="CAGL0K08734g"
                     /db_xref="GeneID:2890282"
     mRNA            complement(<880549..>881325)
                     /locus_tag="CAGL0K08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448601.1"
                     /db_xref="GeneID:2890282"
     CDS             complement(880549..881325)
                     /locus_tag="CAGL0K08734g"
                     /note="weakly similar to uniprot|P40570 Saccharomyces
                     cerevisiae YIR014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448601.1"
                     /db_xref="GeneID:2890282"
                     /db_xref="GOA:Q6FME3"
                     /db_xref="UniProtKB/TrEMBL:Q6FME3"
                     /translation="MVLVVEAFGSENEVKGVSVMRNLHMLCYVVIYLRFVRDRSVLNM
                     LLVYIALSLAGFLKDLLVSYLHRQLETMRDGESYRRNSNDGNGLLETEVIRTILIKSV
                     RYLQILIVAEALYCVMYHGYSGSPLFYYDSPGKVGDVVEPAFHYKYGYFIMNLIGEEM
                     PYMSSRWKLLAIDVVLLILQLVVITKSLEPELDGIKLIIPELRTHQLGMASILLFNTT
                     SSQDSSRLITLCTCQEPDRCEHNTSPSALPRTERRSYGAT"
     gene            <881947..>882996
                     /locus_tag="CAGL0K08756g"
                     /db_xref="GeneID:2890283"
     mRNA            <881947..>882996
                     /locus_tag="CAGL0K08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448602.1"
                     /db_xref="GeneID:2890283"
     CDS             881947..882996
                     /locus_tag="CAGL0K08756g"
                     /note="weakly similar to uniprot|P40574 Saccharomyces
                     cerevisiae YIR018w YAP5 involved in transcription
                     activation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448602.1"
                     /db_xref="GeneID:2890283"
                     /db_xref="GOA:Q6FME2"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FME2"
                     /translation="MLTALGSMGENYPVLRPKDSVAEKMAMSKIHISKKWKLPPLRPK
                     GSHERAKPSPSMDAGAKVSPAGDSPTGEDSKHMSGPNRKRLQNREAQRAYRERSRNKL
                     QTLEDNVETLQGMVKMWQSKYKQLASEFDQYKQSSNEKIVELEKTISESKEDSKCYIC
                     MKNVDLDGLKENARNEDIKPFFQDEFLSNAIKNFQPMEAVSLKRKQEKNSSSPSITPR
                     SSTTSFAAVLNDVDKGNCGFCNDNTACVCRDITSTLSAKPPQRRSDILLDTMSKSGLS
                     TESIKSNYAVSALRSTHCSENPSKCTKCSDIDTSCLKSVPADNKRSSIYMEELPMEFE
                     VNLNDLFPSPKRQRT"
     gene            complement(883144..883216)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0K08778r"
                     /db_xref="GeneID:2890284"
     tRNA            complement(883144..883216)
                     /gene="tRNA-Thr (AGT)"
                     /locus_tag="CAGL0K08778r"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:2890284"
     gene            <883874..>884401
                     /locus_tag="CAGL0K08800g"
                     /db_xref="GeneID:2890285"
     mRNA            <883874..>884401
                     /locus_tag="CAGL0K08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448603.1"
                     /db_xref="GeneID:2890285"
     CDS             883874..884401
                     /locus_tag="CAGL0K08800g"
                     /inference="similar to AA sequence:UniProtKB:Q03677"
                     /note="similar to uniprot|Q03677 Saccharomyces cerevisiae
                     YMR009w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448603.1"
                     /db_xref="GeneID:2890285"
                     /db_xref="GOA:Q6FME1"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="UniProtKB/TrEMBL:Q6FME1"
                     /translation="MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQA
                     DVDILAKERNYKNRDIVTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGY
                     FDVRNGKDDVWVRCKVGPGDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRP
                     DADSLPVRHEYLQSI"
     gene            <884999..>886354
                     /locus_tag="CAGL0K08822g"
                     /db_xref="GeneID:2890286"
     mRNA            <884999..>886354
                     /locus_tag="CAGL0K08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448604.1"
                     /db_xref="GeneID:2890286"
     CDS             884999..886354
                     /locus_tag="CAGL0K08822g"
                     /inference="similar to AA sequence:UniProtKB:Q03687"
                     /note="similar to uniprot|Q03687 Saccharomyces cerevisiae
                     YMR010w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448604.1"
                     /db_xref="GeneID:2890286"
                     /db_xref="GOA:Q6FME0"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FME0"
                     /translation="MDGAELIQEHELAAVEQIAEAAAESAKNQDSYVVTLTSYLPKLD
                     QFYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIASILRI
                     SYFFFVPYEVTLLRQSIIMVLVQLLLLRTTLKYRPEEYKYDNLQSVEPFTQLIHDVWF
                     EYFAIRNKPRMFSDEWKNLLRSLSFERLMGFIFKIFLVFVYKFLKFFDPSFKRVGSFW
                     QWNDDRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQ
                     ISILHKLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGL
                     DFYIGGQYIYYKFYYNPEGTVVNGYRGTPVIGGSQDHEFMELQNEFADGPLNELNEKA
                     FNGKEHRSNSTPKRKLSYSQHLSKTPSSSRKASIGNIEVSSPRRGHSKSYTFSSEKSA
                     T"
     gene            <887412..>888938
                     /locus_tag="CAGL0K08844g"
                     /db_xref="GeneID:2890287"
     mRNA            <887412..>888938
                     /locus_tag="CAGL0K08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448605.1"
                     /db_xref="GeneID:2890287"
     CDS             887412..888938
                     /locus_tag="CAGL0K08844g"
                     /inference="similar to AA sequence:UniProtKB:P23180"
                     /note="similar to uniprot|P23180 Saccharomyces cerevisiae
                     YHL021c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448605.1"
                     /db_xref="GeneID:2890287"
                     /db_xref="GOA:Q6FMD9"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD9"
                     /translation="MIRSHMRRFRHNAATSLLRHTRLYSQASGKILDASFTDESTTVT
                     FLHESMVQPNDSVPTSLDATPDTQDKIRPFTVCFNNIFLRDASKSPKTVDPVSGQRLV
                     TTAELLDEHNGRRATVPRSVNISEDGKRLVVDWSDGDSYAYDLDFFFKYKGSSFLTKS
                     IRNQMSKHKRVFWNRDLLNSKIDKNRDGSFFSFDQVMNDDKLLYRTLVNLQQFGITFI
                     SGMPTIRDETDANDANIYMVRNLCERIGPLRKTFYGEVFDITNQNLKDYDQDLPPPHD
                     YNIPFENIASPLHMDLQFLENVPGFKILHALKNESENDTNIFVDSLYAARNIRETDNE
                     AYEALQHVPINYTFKNKNKRYYQSKPLVEEYESNEHNTLIGNYEYLVKCVNYSPPFQA
                     PFTYGIYNKLTNVPKIEGIEDPLTTSPGKVTERLVFRDFLRGLQQFEKMVYDHENQLR
                     INLPENTAVIYNNRRILHTRTNHNTRQSDLVWFKSCYFDLDTFKSKLKFLEEAFEKSK
                     "
     gene            <889559..>890548
                     /locus_tag="CAGL0K08866g"
                     /db_xref="GeneID:2890288"
     mRNA            <889559..>890548
                     /locus_tag="CAGL0K08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448606.1"
                     /db_xref="GeneID:2890288"
     CDS             889559..890548
                     /locus_tag="CAGL0K08866g"
                     /note="highly similar to uniprot|Q08723 Saccharomyces
                     cerevisiae YOR261c RPN8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448606.1"
                     /db_xref="GeneID:2890288"
                     /db_xref="GOA:Q6FMD8"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /translation="MSLHHDNVTIAPLVLLSVLDHYERTNTPEGKRCVGVILGDSQTN
                     TIRVTNSFALPFEEDEKNSDVWFLDHNYIESMNEMCKKINAKEKLIGWYHSGPKLRAS
                     DLKINELFKKYTQGNPLLLIVDVKQQDVGLPTDAYMAVEQVKDDGTSTEKTFLHLPCT
                     VEAEEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQKKLNDIVIYLNKVINNE
                     LPVNHTILGKLQDVFNLLPNLGYNEETDVSATSNDMVTASNNLQRALTVKTNDELMVI
                     YITNLVRAIIAFDDLIENKMQNKKLQEERNKELQADINKVESETAETEKVATD"
     gene            complement(<890872..>892476)
                     /locus_tag="CAGL0K08888g"
                     /db_xref="GeneID:2890289"
     mRNA            complement(<890872..>892476)
                     /locus_tag="CAGL0K08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448607.1"
                     /db_xref="GeneID:2890289"
     CDS             complement(890872..892476)
                     /locus_tag="CAGL0K08888g"
                     /inference="similar to AA sequence:UniProtKB:P09032"
                     /note="similar to uniprot|P09032 Saccharomyces cerevisiae
                     YOR260w GCD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448607.1"
                     /db_xref="GeneID:2890289"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD7"
                     /translation="MQIQAFIFCGRGHNLSPFAKHPNSAAVTQEDTILSDDTVPKALM
                     PLANKPMLEYTIDWCDQANFSEINIVAHHDQIDEIKQFLSTFLALRTQQFEIISKALS
                     AANHNHHLQKPKPINFISSKMNSNGEALQKELLDKIKGDFVLLPCDFITDIPPQVLLD
                     QFQNRDDDNLALTVYYKNNVESVDKKQFQRQQFFTIYSENEDTEKQPVLLDVYPKEDV
                     MKNKYLQVRNQMLWKYPNATVSTSILNSSIYMCSYDLCQLLREQTHQEKNNDDSEGNN
                     VNDSPRTKNSKGTEDYDDAQNSAHRNLSEIKPSYFKKKNELIRDNINCHKPLGKLFRD
                     LSRRSWQHSSKRETMGIFIIPEPCVFIRANNLNAYMEANRFILKIKAQATQSNVQTNN
                     LSTSAIGADSLVGGNVTILEKSNIKMSAIAGGCKIGNRCRVAGSILLANVELEDDVIL
                     ENVIIGPGAKIGKKSKLTNCYVEGSYVLPARSTHKGETLRKIILNTDTEMDSEVAYST
                     SDEDSSDVMTEEFTDEDFGDDDFFER"
     gene            <893007..>894317
                     /locus_tag="CAGL0K08910g"
                     /db_xref="GeneID:2890290"
     mRNA            <893007..>894317
                     /locus_tag="CAGL0K08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448608.1"
                     /db_xref="GeneID:2890290"
     CDS             893007..894317
                     /locus_tag="CAGL0K08910g"
                     /note="highly similar to uniprot|P53549 Saccharomyces
                     cerevisiae YOR259c CRL13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448608.1"
                     /db_xref="GeneID:2890290"
                     /db_xref="GOA:Q6FMD6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD6"
                     /translation="MSEEQDPLLAALNESNNNGGSGDNAAVSGEASAEPLEAAPEPEP
                     VDPEKEAYEKALRHFKKKLMEHRRYDDQLKQRRQTIRDLEKIYDKTENDIKALQSIGQ
                     LIGEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPR
                     ETDPLVYNMTSFEQGEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVL
                     LYGPPGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCI
                     IFMDEVDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDP
                     ALLRPGRLDRKIEIPLPNEAGRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRN
                     CATEAGFFAIRDDRDHIIPEDLMKAVRKVAEVKKLEGTLEYQKL"
     gene            complement(<894474..>895109)
                     /locus_tag="CAGL0K08932g"
                     /db_xref="GeneID:2890291"
     mRNA            complement(<894474..>895109)
                     /locus_tag="CAGL0K08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448609.1"
                     /db_xref="GeneID:2890291"
     CDS             complement(894474..895109)
                     /locus_tag="CAGL0K08932g"
                     /inference="similar to AA sequence:UniProtKB:Q08702"
                     /note="similar to uniprot|Q08702 Saccharomyces cerevisiae
                     YOR258w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448609.1"
                     /db_xref="GeneID:2890291"
                     /db_xref="GOA:Q6FMD5"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR026963"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD5"
                     /translation="MKWDSALQVYIDHPEKYGKDTVVYFDEDAVIIHDSFPKARFHLL
                     VLPRSNTLTKKHPTIGLNSSVKNQLENYVQRAIDYIYEGFTQHYQPSDKVQSIFADKD
                     TFIKNFLAVGIHSVPSMKNLHIHVITKDFDSPRLKHKKHYNSFNTNFFVNWIDLPLKS
                     IPNVKETELKYIKGSPLICSYCGQDYGSQFKKLKDHLTEEFNKHFTEIIEL"
     gene            complement(<895464..>895940)
                     /locus_tag="CAGL0K08954g"
                     /db_xref="GeneID:2890292"
     mRNA            complement(<895464..>895940)
                     /locus_tag="CAGL0K08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448610.1"
                     /db_xref="GeneID:2890292"
     CDS             complement(895464..895940)
                     /locus_tag="CAGL0K08954g"
                     /inference="similar to AA sequence:UniProtKB:P06704"
                     /note="similar to uniprot|P06704 Saccharomyces cerevisiae
                     YOR257w CDC31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448610.1"
                     /db_xref="GeneID:2890292"
                     /db_xref="GOA:Q6FMD4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR029530"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD4"
                     /translation="MSGIRMSPARGSQLTEEQRQEIFEAFSLFDMNNDGYLDYHELKV
                     AMRALGFDLSKREVLDLIDKHDNDRRRQIKYDDFFQEMGERMLKRDPVEEIKRAFQLF
                     DKNGDKKITVQDLREVAQELGENLTMEECHAMIDEFDMDDDGAINEEEFISICMDN"
     gene            <896389..>898770
                     /locus_tag="CAGL0K08976g"
                     /db_xref="GeneID:2890293"
     mRNA            <896389..>898770
                     /locus_tag="CAGL0K08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448611.1"
                     /db_xref="GeneID:2890293"
     CDS             896389..898770
                     /locus_tag="CAGL0K08976g"
                     /inference="similar to AA sequence:UniProtKB:Q08693"
                     /note="similar to uniprot|Q08693 Saccharomyces cerevisiae
                     YOR256c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448611.1"
                     /db_xref="GeneID:2890293"
                     /db_xref="GOA:Q6FMD3"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD3"
                     /translation="MDLPSEPPSYDVVNGQQSVRGEVGHASASASASASADIETGRTR
                     DDSFDMDIDESALYENEGDGMIGNLGSTSIPYISRIKNRLNDNIIEPVQNNIIDPLVG
                     LNYIVTDTVNYYVSKVGNPFILSRFIYIFIISIVAYGLLSREDPNKDHVSGTRGSFAD
                     HDAFLNYARLTADLSKFERDLEYLSSMPHMSGTKGDTAMRQYIYQSMKNNNIHLLREW
                     EAEGFANYPKDDGMSLRIRPQSGEPFSIELTDVNFNPGSPNGELRDINLIYGHYGSEQ
                     DLQLLKEAQLLKEDFVLLIKYDQYVSQQVLMAQNYGAKAIVFISDVINGNENVIKQNS
                     VSISQYGAGIMEIRYPNLKYSENSETYSKTMPSIPTLPLSYKQGRQLMELLHSGIKYE
                     DKYFSGKPGIVKVDMRVDNVLRTAQPISDFVGKIEGKEQSDRAIVIAARRNSIDNGAT
                     TSAFGTAMMLSLIQLFQEMKFRFNWKPLRNIYFISFGGSDFNFEGSNTLVEQRLSALK
                     EEIYAMVDISEVGLDFEDLGHLDIQCHPLMYDFFKSKSDHSQVDVNVLPVHDFGDWTP
                     YLTHGIPTATFSKSKLKSKLLAHTKADTFERVGHLLKQSNYQEKLLDVLIFLFRSALL
                     LVDKPVIPFEVSTFVTELDSMLNDLEISHKGQIRFDTIIKGLLMWKRLGKECTAWKHE
                     WSNIVENLDNGMEPSLFSVHRWAWNKKITNIGRRLCAPNGLTDRNNYKNVIFGPTLFA
                     NNKDLLNWSFPGVRDAIYKQDYNKAQEELDGIGEILMNAAKIFSEETTDSSYK"
     gene            complement(<898883..>899623)
                     /locus_tag="CAGL0K08998g"
                     /db_xref="GeneID:2890294"
     mRNA            complement(<898883..>899623)
                     /locus_tag="CAGL0K08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448612.1"
                     /db_xref="GeneID:2890294"
     CDS             complement(898883..899623)
                     /locus_tag="CAGL0K08998g"
                     /inference="similar to AA sequence:UniProtKB:Q08692"
                     /note="similar to uniprot|Q08692 Saccharomyces cerevisiae
                     YOR255w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448612.1"
                     /db_xref="GeneID:2890294"
                     /db_xref="GOA:Q6FMD2"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD2"
                     /translation="MRAPPPQRKSKSRYFAPYFVNIRELLRFRKIKAFWNRQKLFKKQ
                     FENLHQVYQQRYNSSIDSHPDGQVALCNHENLTQITPISGIRIEDMCCLSSTHESQSA
                     DKKPLLIATFPRGCNRSPTVRILKRNKWSWLPISKRKYKLSFFNNEIFDPQLHSKSIE
                     VKSHTCANTVRMIRKYAHEKANVKIIFHNRNIIKSKFLDGHEDAIRPPSYIEFGNNHT
                     LRIEDFRSLKRKRPRKNTHKQSYYQTIR"
     gene            complement(<899951..>900457)
                     /locus_tag="CAGL0K09020g"
                     /db_xref="GeneID:2890295"
     mRNA            complement(<899951..>900457)
                     /locus_tag="CAGL0K09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448613.1"
                     /db_xref="GeneID:2890295"
     CDS             complement(899951..900457)
                     /locus_tag="CAGL0K09020g"
                     /inference="similar to AA sequence:UniProtKB:Q08689"
                     /note="similar to uniprot|Q08689 Saccharomyces cerevisiae
                     YOR253w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448613.1"
                     /db_xref="GeneID:2890295"
                     /db_xref="GOA:Q6FMD1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD1"
                     /translation="MGRSIINLDNVYENNLGMMAKIAKIVYPNQQFEESFFSELFKGG
                     NDKKKEAYMAQIAYYSEIPVGTIKLLLLQKKKSDSLQKGLHIELLAVLEKYDDHEIKE
                     KLLEYALDECKKNHQHKLFTATRSSDEQLMNWYKEHGFTETGSKGEPVTLSDGTSEET
                     VLLIRELD"
     gene            complement(<900862..>901326)
                     /locus_tag="CAGL0K09042g"
                     /db_xref="GeneID:2890245"
     mRNA            complement(<900862..>901326)
                     /locus_tag="CAGL0K09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448614.1"
                     /db_xref="GeneID:2890245"
     CDS             complement(900862..901326)
                     /locus_tag="CAGL0K09042g"
                     /inference="similar to AA sequence:UniProtKB:Q08687"
                     /note="similar to uniprot|Q08687 Saccharomyces cerevisiae
                     YOR252w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448614.1"
                     /db_xref="GeneID:2890245"
                     /db_xref="GOA:Q6FMD0"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:Q6FMD0"
                     /translation="MRESKVQEKKRAHNEKRSNELARVKFIQDVIKSDSFKDKKNFSY
                     EEAAVFIEQFINRDDPELEQFKKKQRSNRPTPNRQLLLEQKKKLEMEEFKKGFLCPDL
                     ADEQSVVFLRNWNGTFGAMSTFKMIRINNEGKQVVGGHNKFTGSENNEIEMA"
     gene            <901778..>902686
                     /locus_tag="CAGL0K09064g"
                     /db_xref="GeneID:2890246"
     mRNA            <901778..>902686
                     /locus_tag="CAGL0K09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448615.1"
                     /db_xref="GeneID:2890246"
     CDS             901778..902686
                     /locus_tag="CAGL0K09064g"
                     /inference="similar to AA sequence:UniProtKB:Q08686"
                     /note="similar to uniprot|Q08686 Saccharomyces cerevisiae
                     YOR251c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448615.1"
                     /db_xref="GeneID:2890246"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC9"
                     /translation="MSLFKLITPCAFVELTKASKKVVPVDSTWYLPNLKRDGKQEFMD
                     VERIPGAVYFDIDDIRDSASEFPHMAPDLATFNEGMSQLGVNKEDILVVYDRIGNFSA
                     PRCAWTLVMLGHPEVYLLNNFNAYKKEGYPLDTTKWTKLTQYPKSNYKSETNLCPENV
                     ITYEQMLELVKSGELKKKYNVYDARALNRFEGKAPEPRPDISSGHVAGVQPLPFTEIL
                     DQPDLTFPQEQVDMEKKVQEAFKKLNNTYDPSKPTIVMCGTGVSACIIRTALEHSGVK
                     DIKLYDGSWVEWVLRSDPKLIAKDRE"
     gene            <903073..>904428
                     /locus_tag="CAGL0K09086g"
                     /db_xref="GeneID:2890247"
     mRNA            <903073..>904428
                     /locus_tag="CAGL0K09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448616.1"
                     /db_xref="GeneID:2890247"
     CDS             903073..904428
                     /locus_tag="CAGL0K09086g"
                     /inference="similar to AA sequence:UniProtKB:Q08685"
                     /note="similar to uniprot|Q08685 Saccharomyces cerevisiae
                     YOR250c CLP1 cleavage/polyadenylation factor IA subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448616.1"
                     /db_xref="GeneID:2890247"
                     /db_xref="GOA:Q6FMC8"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="InterPro:IPR029007"
                     /translation="MAEVEALPGLKQPVDDAGLLEDANQVHTLVIPSGHIWRVELSSD
                     EKLSLKVTAGIGEIFGTELANNVEYTFWDWKFGIYAVEELEIEWKCPQLHDRELSIVE
                     NTTAHNVYNLHFALEKMRSSTFDGPRIMVVGEKNTGKTALCRTLCSYAIKNKPYQPMF
                     VNLNPVEPIFSPPGCVTAVPISSTLDAQLPRWGETMTSGATRLHGKQPIIKNFGFETI
                     AENRSLYKLVTKKLFETVSERLQNDSLVHRSGCIVDSPPLENCDDEYSELVEAIVGLR
                     INYLIILCNDNDKGREIYTKVSKIVNTYVGERLLRVPTMAGVFEKDDVYIRAQQRAAI
                     REYFYGDTRTVLSPYNLGCDTSDITVWRPKSVLQGENTNLDTLEVAPVDSSTLQYALV
                     AITYASRKSDSEEVLQAPILGFGLITELNEKRNKLKILLPVPGRLPPNAMILTSFRYL
                     E"
     gene            <904808..>906784
                     /locus_tag="CAGL0K09108g"
                     /db_xref="GeneID:2890248"
     mRNA            <904808..>906784
                     /locus_tag="CAGL0K09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448617.1"
                     /db_xref="GeneID:2890248"
     CDS             904808..906784
                     /locus_tag="CAGL0K09108g"
                     /inference="similar to AA sequence:UniProtKB:Q08683"
                     /note="similar to uniprot|Q08683 Saccharomyces cerevisiae
                     YOR249c APC5 component of the anaphase-promoting complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448617.1"
                     /db_xref="GeneID:2890248"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC7"
                     /translation="MTQCPIKVSYTLTPYDLTILVLIYMYVFEGIHVPLKIFLRLIPE
                     YEDTTEELLLLHLEPVSSKSIEPVLPYLKDIIKLLETEKRVDIAKSLLGHLQNIDGLE
                     VINNLVWVLDKECLLKSNKNKDQIMIGSVNKLIAKKSVLGVYIRYCFKKYICGGFEER
                     EDLWNSFVFFRHQFLNDVDSLSYRSLDLEEYKFQYFEFGTTSKVVLPSYESQSDLKSI
                     ELMKKLIKKTNNTGLSKENTLIVSPDQLHNYINWEVSQVYFLKTKSSNYDNIFDNLTL
                     HDITRFPAIFFIRYLNAVNENRYQDALDFLHNYFDYTLTQSSENCYHISLLYLATFHA
                     SFGDANSALKAFEEATKIARENKDTSTLNVIMIWVINFLEKYPIFADRFYVTVDQIIK
                     YLKSSSDTDNAVILKNAYRFDSIMQMYKCTNAIDIFESTLKYMTIVFQSIKISDVPYK
                     YLNYASMMWKVLGQRLIADIYEKIIPINNNDGFREDILHYEHLLEKKDYTPIGEFIER
                     KKKCRLTFQQTLELRILEVRYLVVVREYWSAIEVIESSLVEFSRFISESKWQSLLEFE
                     KARILIECKASIRAIPLIQNLYDRAITTHDPYFASKAVLLLVHALAKIGKLDESRRLF
                     TANLGVMYQFHDLDDEINRISNVVNNIKYKNMTI"
     gene            complement(<907150..>907965)
                     /locus_tag="CAGL0K09130g"
                     /db_xref="GeneID:2890249"
     mRNA            complement(<907150..>907965)
                     /locus_tag="CAGL0K09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448618.1"
                     /db_xref="GeneID:2890249"
     CDS             complement(907150..907965)
                     /locus_tag="CAGL0K09130g"
                     /note="some similarities with uniprot|Q08673 Saccharomyces
                     cerevisiae YOR247w SRL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448618.1"
                     /db_xref="GeneID:2890249"
                     /db_xref="GOA:Q6FMC6"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC6"
                     /translation="MQLKQYISALALAISTASAASAYSNSTYQASYQNAPLSSVNPTA
                     AVSSVDANGNAAAAVPSSSSSSTFSATRGDTTTLQPPQSVVAQEVIITHSDETTTYYE
                     TSTLYSTVYLTNSKSKSVAAQDAAQQQKENVITVTKTDANGGVVTVVTTVTVGADSRP
                     TGTVISDGSSGTTTSTITSTLFVTVRQSAVSVGPSNAPIGKELAGINSVSSSQSASAQ
                     GCVPVTTTVTDTVTDTVVSTVTATPSPSIQYVTVTMASNGTIASNGTINGTHF"
     gene            <910285..>911268
                     /locus_tag="CAGL0K09152g"
                     /db_xref="GeneID:2890250"
     mRNA            <910285..>911268
                     /locus_tag="CAGL0K09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448619.1"
                     /db_xref="GeneID:2890250"
     CDS             910285..911268
                     /locus_tag="CAGL0K09152g"
                     /note="highly similar to uniprot|Q08651 Saccharomyces
                     cerevisiae YOR246c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448619.1"
                     /db_xref="GeneID:2890250"
                     /db_xref="GOA:Q6FMC5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC5"
                     /translation="MTWDPSELPYYNPQVDDRVAVVTGGNSGIGWFTVLHLYMHGFRV
                     YVCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLHDQKPTRYLGSLQYLHTDLTDLKCVD
                     RAAAKILRMENHLDVLVNNAGVMAVPYEITKDGFEIQMQTNYIAHFLLTMRLLPLLRC
                     SHGRVVTLSSLGHHIIFKYSKLDETWNYFPNFVFTWFRYAMTKVASIQYTKMLAIKNP
                     DILFVSVHPGLVMNTNLFSFWTRLPLVGIFFWLLFQVVGFMFGVSNEQGAYSTLRCSL
                     SQELTTTNDNGKYFTTGGKESRSSYVANNLDDAASTWIWTMKQLRNRGFDI"
     gene            complement(911560..911660)
                     /gene="tRNA-Ser (CGA)"
                     /locus_tag="CAGL0K09174r"
                     /db_xref="GeneID:2890251"
     tRNA            complement(join(911560..911605,911623..911660))
                     /gene="tRNA-Ser (CGA)"
                     /locus_tag="CAGL0K09174r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2890251"
     gene            complement(<911911..>913677)
                     /locus_tag="CAGL0K09218g"
                     /db_xref="GeneID:2890252"
     mRNA            complement(<911911..>913677)
                     /locus_tag="CAGL0K09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448620.1"
                     /db_xref="GeneID:2890252"
     CDS             complement(911911..913677)
                     /locus_tag="CAGL0K09218g"
                     /inference="similar to AA sequence:UniProtKB:P25639"
                     /note="similar to uniprot|P25639 Saccharomyces cerevisiae
                     YCR061w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448620.1"
                     /db_xref="GeneID:2890252"
                     /db_xref="GOA:Q6FMC4"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC4"
                     /translation="MRFWWIVTLANLCAAHMHMDDDEDMSNEMGMGVSDTNLTPVPHE
                     PKHLHGQPILDTHLTPAERLYWEKYDTTTFFTTDLGNRSAFKFHVATMFILLFLSYPV
                     CLILNSVASSWYLAALTANLALTVASLISLLVFSTTFPEEWYANNFYHKTSWTVLILM
                     LVHYIAAVGTLAAKRFGSGYVSLDIETVAYPLQDYDNYEIPDVVVNDGNTEDPSRLSP
                     PTTVTPNDDTQESSLSHSHSEESLRFTDDSHKKPRKDKLLNKIPVNSKLQTIMDKFGV
                     FFGIIFGFLNYPMLLILFVDACTGIAIGNLLGKGPRVFNLLAHWIKGGVFFVLGIVSL
                     ARYCGVGQKYGWAWNRLIIDRRSPYANSVWFKYSPIGGITMEGFESFLIFFYGSTNVF
                     LEHLAGAGGAWTAKDLQHVSIAFMFFGTGLCGLLVEGFLNKWRFTHALVRTDYKEEEV
                     LVANPGYSPNPFPTFTIFWTGILMSQHAQASETSTTIHVQWGSLLSYGSFFRLFTFLI
                     LYFSPEVNMEPFKPITELVSSFCLLAGGLIFMESTDQVVEGFEYRGFTPMFTFNISVG
                     IVSLIMAWEMILLFWRRYLASN"
     gene            complement(<914042..>914470)
                     /locus_tag="CAGL0K09240g"
                     /db_xref="GeneID:2890253"
     mRNA            complement(<914042..>914470)
                     /locus_tag="CAGL0K09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448621.1"
                     /db_xref="GeneID:2890253"
     CDS             complement(914042..914470)
                     /locus_tag="CAGL0K09240g"
                     /note="weakly similar to uniprot|P25638 Saccharomyces
                     cerevisiae YCR060w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448621.1"
                     /db_xref="GeneID:2890253"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC3"
                     /translation="MSWKSYKKPGHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNE
                     HFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLSYCKDT
                     KLRQKLQYRLELATTNKRPKTLQQLEIREVERIPPELASL"
     gene            <914614..>915393
                     /locus_tag="CAGL0K09262g"
                     /db_xref="GeneID:2890254"
     mRNA            <914614..>915393
                     /locus_tag="CAGL0K09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448622.1"
                     /db_xref="GeneID:2890254"
     CDS             914614..915393
                     /locus_tag="CAGL0K09262g"
                     /note="highly similar to uniprot|P25637 Saccharomyces
                     cerevisiae YCR059c PMN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448622.1"
                     /db_xref="GeneID:2890254"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC2"
                     /translation="MDELVVEELESLEAIYPDLLKRDDAENIFAMKVPQHEKFTVKIS
                     LPDKYPATEPPHVLEVSVAQGDYDSKYLTTLFQEVMDSMFHQGSVCLFDFFTELDGVL
                     YDDEEESSMDAAEVVDNSALVPVDPFEGWTASDPISDRGSTFMAFAAHVNSEEEAFQM
                     LDHLKTDSKMRRANHAMCAWRIKKQTDSNDIIYQDCDDDGETAAGSRMLHLVTIMDVW
                     NVIVVVARWFGGVHIGPDRFKHINSTAREAILRAGFTPAKK"
     gene            <915766..>918501
                     /locus_tag="CAGL0K09284g"
                     /db_xref="GeneID:2890255"
     mRNA            <915766..>918501
                     /locus_tag="CAGL0K09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448623.1"
                     /db_xref="GeneID:2890255"
     CDS             915766..918501
                     /locus_tag="CAGL0K09284g"
                     /note="highly similar to uniprot|P25635 Saccharomyces
                     cerevisiae YCR057c PWP2 periodic tryptophan protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448623.1"
                     /db_xref="GeneID:2890255"
                     /db_xref="GOA:Q6FMC1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:Q6FMC1"
                     /translation="MKSDFKFSNLLGTVYRQGNVQFSHDGNMLLSPVGNRISVFDLVN
                     NKSFTFAYEHRKNIATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFNFKDKCYSV
                     KFSPDGRYFALAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRF
                     LLTTSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTW
                     EYISKAQKEGLDEEDLEDEDLSKLSWRITKKNFFYANQAKVKCCTFHINSNLLIVGFS
                     NGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEWQSESYI
                     LKQQGHFDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFA
                     KKGQVLFSASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFD
                     VFVWSVQTGQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPL
                     EVFADILAITITPDGKHVAVSTLKGQLTIFDIASGKQIGNIDCRKDIISGRFLQDRFT
                     SKNSERSKYFTTINYSFDGKSIIAGGNNNSICLYDVPNEVLLKRFIVSRNMNLNGTLE
                     FLNSSRMTEAGSLDLIDSSGEYSDLEDRIDGSLPGSHRGGDMSTRSSRPEIRVTSVQF
                     SPTANAFAAASTEGLLIYSIDETLIFDPFDLDIDITPQATLEVLAEKDYLTALVMAFR
                     LNEEYLINKVYENVPVTQINSVCNQLPVVYVSRLLTFIGNFATTSQHIEFNLLWLKAL
                     LIAHGSFMKQHEHMFSSATRAVRRFIGRIAEDVTFLSATNKYAYRFLTSTSGKGADSS
                     EEEIQNISDSSSSDEDDVVMQSDDDEDGEWIGFQEKKQQLALSEDDSESEDELLQ"
     gene            <918817..>920409
                     /locus_tag="CAGL0K09306g"
                     /db_xref="GeneID:2890256"
     mRNA            <918817..>920409
                     /locus_tag="CAGL0K09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448624.1"
                     /db_xref="GeneID:2890256"
     CDS             918817..920409
                     /locus_tag="CAGL0K09306g"
                     /inference="similar to AA sequence:UniProtKB:P25355"
                     /note="similar to uniprot|P25355 Saccharomyces cerevisiae
                     YCR054c CTR86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448624.1"
                     /db_xref="GeneID:2890256"
                     /db_xref="GOA:Q6FMC0"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /translation="MSEKKKILQDIDRLLSEANSDPQLYHDNLGLLNDFVIETANNTA
                     IRDKFSRDKETWQLIKTILVNSHVEDISGWSAEVIFLYKRLLRGVFILARNLAVSGSE
                     IAQELLLQNIAYKIFNNSLKVGKLDDGMQLALYSTILSFLHNMSSKSVVFDRSSSKEL
                     FEFLHFPVKLNYEYTKDILLPYLLYFKDLIQHDDFLYYFLRYDKVDSILCGLILDKIM
                     RDESQIFEIVSGTRIVSPDVNLSDIDMILLRTFALISTHESFIPYLEDKENNSFNIFI
                     DLLKLMQLVVTNIDSWDKFQLTSIMTWTYKIFEKNADQIKNYFKNKLENEEIAKKLHA
                     KCVITLDIMAKLCQFNHVQKFIISYKGLDQLISLLNIFQDNLIRVNFTKTSQASDITG
                     VKATNKLGEKLAKDSLIEERIDLINMKIKETNFPECKLLIIEIIAMLTHENREIQNQV
                     RELGGLGVILSNCVIDDNDPFIKERSIMCIKFLLKDNKENQNFVANLESKRVANDETL
                     QEAGYEVDISKDGKLSLKSTNQ"
     gene            complement(<920567..>922105)
                     /locus_tag="CAGL0K09328g"
                     /db_xref="GeneID:2890257"
     mRNA            complement(<920567..>922105)
                     /locus_tag="CAGL0K09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448625.1"
                     /db_xref="GeneID:2890257"
     CDS             complement(920567..922105)
                     /locus_tag="CAGL0K09328g"
                     /note="highly similar to uniprot|P16120 Saccharomyces
                     cerevisiae YCR053w THR4 threonine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448625.1"
                     /db_xref="GeneID:2890257"
                     /db_xref="GOA:Q6FMB9"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB9"
                     /translation="MSSSQVYRSTRSAEQESKSFEEAVIQGLATDGGLFVPSTIPTVS
                     KDTLFSKWSKLSFQELAFEIMRLYIDSKEIPDADLKSLIERSYSTFRSDDVTPLVKNV
                     TGNEENLHVLELFHGPTYAFKDVALQFVGNLFEYFLQRINKDLPEEQRKRLTVVGATS
                     GDTGSAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVEDKNVQTLSVAGTFDNCQD
                     IVKAIFGDKDFNSRHNVGAVNSINWARILAQMTYYFYSYFRATDGKEGKVKFVVPSGN
                     FGDILAGYFAKQMGLPVEKLVIATNENDILDRFLKTGTYERSANVLATHSPAMDILIS
                     SNFERLLWYLAREFLAEKDDLKAGEIINTWFTQLKTEGKFVVDKSIIEGALQDFASER
                     VSNEETIQTIKKMYEISQNPKKYVLDPHTAVGVCATERLIKKDNDKEIQYVSLSTAHP
                     AKFAEAVNQALSSFDGYSFESDVLPAELKRLSTLPKKIKLVEKADVTLVKNTIEEELA
                     KMGL"
     gene            complement(<922651..>923949)
                     /locus_tag="CAGL0K09350g"
                     /db_xref="GeneID:2890258"
     mRNA            complement(<922651..>923949)
                     /locus_tag="CAGL0K09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448626.1"
                     /db_xref="GeneID:2890258"
     CDS             complement(922651..923949)
                     /locus_tag="CAGL0K09350g"
                     /inference="similar to AA sequence:UniProtKB:P34164"
                     /note="similar to uniprot|P34164 Saccharomyces cerevisiae
                     YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
                     YER027c GAL83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448626.1"
                     /db_xref="GeneID:2890258"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB8"
                     /translation="MGNNPSLDYQRTVKNSPRKHKEMVQVDDIEARVADIDLQNSEQP
                     PAERVLNRKKSTLLFDDESNNEEEYSEENEEEKVRYRAESISSTSSCSSHASDDIQQD
                     EVCDRTEEATKLERQSREDHSDEHIRTATQSESDLARTTTNTTEVGIDESRHEEKEKQ
                     ESSSSASNGMVPVEIRWEQGGEKVYVTGSFTNWRKMIGLIPVESEPGHFKIKLQLAPG
                     THRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEVSAVPKSDSTSSRTGKERKDKNKKS
                     VSKVSKDRSTVGPLSARSCIALEIEKEPDDFGDGYTRYHEELPQEPKYEFSSEIPAIF
                     VDQSIIEQLTMERQRKKSNNMSWLTPPQLPPQLENVILNKFGEPLSQSTENNAGALPI
                     PNHSVLNHLVTTSIKHNTLCVATNNRYRQKYVSQIYYVPL"
     gene            complement(<925647..>926837)
                     /locus_tag="CAGL0K09372g"
                     /db_xref="GeneID:2890259"
     mRNA            complement(<925647..>926837)
                     /locus_tag="CAGL0K09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448627.1"
                     /db_xref="GeneID:2890259"
     CDS             complement(925647..926837)
                     /locus_tag="CAGL0K09372g"
                     /inference="similar to AA sequence:UniProtKB:P53035"
                     /note="similar to uniprot|P53035 Saccharomyces cerevisiae
                     YGL209w MIG2 C2H2 zinc-finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448627.1"
                     /db_xref="GeneID:2890259"
                     /db_xref="GOA:Q6FMB7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB7"
                     /translation="MAKRPVRLPSDNKERPFKCEHCSRGFHRLEHKKRHMRTHTGEKP
                     HGCSFPGCGKSFSRSDELKRHNRTHTGVSQKKKKTKGKGAKIQDPMAGEEKLVELVNV
                     QFPVPYTSVQNGETNMSPPIPGSQPISIPIANPLPHPTSGVYFNVQPGTSPLVAIAQQ
                     QLGMVNYHGYPTVAASESITPVPILSTSASSVALSDMSHTSSAFSNIGGGHSGAGSLS
                     TSPSSMNDVYLNCNSNNLPHKVNNTTNPCAPTLPPVINITNSAVGYNNVLNSLQNKTS
                     KANSRVTKAEKGGPLLSTSPIDIKPLSTNNSSTSLVALLKSDASLAPLKKGPLQLASS
                     TRSTAKYLDGVSDGDDNRYYSQGDEDQDDDTDTCTTPRENIKITLPPLSNLIKGIEIF
                     NGQA"
     gene            complement(<930063..>930728)
                     /locus_tag="CAGL0K09394g"
                     /db_xref="GeneID:2890260"
     mRNA            complement(<930063..>930728)
                     /locus_tag="CAGL0K09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448628.1"
                     /db_xref="GeneID:2890260"
     CDS             complement(930063..930728)
                     /locus_tag="CAGL0K09394g"
                     /note="highly similar to uniprot|P51996 Saccharomyces
                     cerevisiae YGL210w YPT32 or uniprot|P38555 Saccharomyces
                     cerevisiae YER031c YPT31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448628.1"
                     /db_xref="GeneID:2890260"
                     /db_xref="GOA:Q6FMB6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB6"
                     /translation="MNSSEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNEFNLESK
                     STIGVEFATRTIKVEDKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSGTY
                     ENCNHWLTELKENADDNVAIGLIGNKSDLEHLRAVPTEEARGFASENQLFFTETSALN
                     SENVDLAFRELIEQIYKMVNKHQVDLGENAKGSSGAPKGPTISLAPVPGEKKKKSKSN
                     SCC"
     gene            complement(<931067..>932143)
                     /locus_tag="CAGL0K09416g"
                     /db_xref="GeneID:2890261"
     mRNA            complement(<931067..>932143)
                     /locus_tag="CAGL0K09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448629.1"
                     /db_xref="GeneID:2890261"
     CDS             complement(931067..932143)
                     /locus_tag="CAGL0K09416g"
                     /note="highly similar to uniprot|P53088 Saccharomyces
                     cerevisiae YGL211w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448629.1"
                     /db_xref="GeneID:2890261"
                     /db_xref="GOA:Q6FMB5"
                     /db_xref="InterPro:IPR000541"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012089"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020554"
                     /translation="MSYTAPTDPVNKQEVVKLSQLCELCHGRKAVLRRPKNLQKICKE
                     CFYYVFETEIHNTIVSNNLFQRGEKVAIGASGGKDSTVLAHILKLLNDRHDYGVKLVL
                     LSIDEGIVGYRDDSLATVKRNQKQYQLPLEIVSFRDLYDWTMDEIVAIAGIRNSCTYC
                     GVFRRQALDRGAAKLDINHVVTGHNADDMAETVLMNILRGDVARLERSTAIITQSAGS
                     PIRRSKPFKYCYQKEIVLYAHYKKLDYFSTECTYAPEAFRGTARELMKNLEAVRPSCI
                     IDIIQSGENLVLKKKKRHPNSKVEFKDGNRCERCGYLSSNKICKACMLLQGLEKNRAS
                     MSIDNDTNVDGAARVMRTLEKLSF"
     gene            complement(<932509..>934836)
                     /locus_tag="CAGL0K09438g"
                     /db_xref="GeneID:2890232"
     mRNA            complement(<932509..>934836)
                     /locus_tag="CAGL0K09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448630.1"
                     /db_xref="GeneID:2890232"
     CDS             complement(932509..934836)
                     /locus_tag="CAGL0K09438g"
                     /inference="similar to AA sequence:UniProtKB:Q12050"
                     /note="similar to uniprot|Q12050 Saccharomyces cerevisiae
                     YOR144c EFD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448630.1"
                     /db_xref="GeneID:2890232"
                     /db_xref="GOA:Q6FMB4"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB4"
                     /translation="MKKQISLSEVLTGRPTTTKTRKPRVKGTKNDTSCTNTTDMRVSE
                     DKLNTEEDARLRTRHIEPIVNSTKEPVSLKSFLMTRPQKPKTTEVIDLDEDGDVISIE
                     NESITMNSKAMEPENFKKTSHREMFNNFEKKKKTRGKNNELEITNEPYLGYEKIRRYN
                     DVSKLKELPTSLFPKVQLVAEKSMNIIDIGQEHFAEKRVRNRTADYNFSVDEYMQLNP
                     IRKLNPDAITDIPVSVSVSDSSNSQKLLWNDMMAPKNIQDVLLEPKLKEDVFMWISSA
                     FHKLKRPTTRNKLKKQTKNDRLRNEIEDFIVPDGMIVFGDDEDTTNSKVNESNHFDNE
                     VEFVPLMILHGEGIGKNTLIKNIANHLNSQIYEVASNCNRGKKEIKEMLLEFSTTHYV
                     KGTKDGIILIDDVDVIFREHDKFFWQALEKVLMVSRRPIILTTRDINFIPTYLLDICE
                     EEKSIFLAKRVSRGTVQKMLAKYIEVLNQPLNSALIEKAIEIHGADVRGCLLDLQFLD
                     GYKTGCDINTPCNLSVSIQDSNCINSQANVAELLSNSDIILNATEWNSNFITEPDSTL
                     MTRSALEYNAKQSDDTLKLKNDYLVDYQLHLNDELRQQRLPFEINIGHEIYKILVDSR
                     SHKTSSKPVKSKKYKIDKVVRASAEYLGTRIDSTQGKDRGNRARSSRRRIQEVLDRLS
                     SNYEYSADKEDEIMMDLEMYPYSTLSCEINPMIHEIAKRDNEIKSFNRQLFESETKGL
                     AKEEMNTVVYKLTNEGLLKPIFFRANPQSLLDYWK"
     gene            complement(<935326..>936111)
                     /locus_tag="CAGL0K09460g"
                     /db_xref="GeneID:2890233"
     mRNA            complement(<935326..>936111)
                     /locus_tag="CAGL0K09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448631.1"
                     /db_xref="GeneID:2890233"
     CDS             complement(935326..936111)
                     /locus_tag="CAGL0K09460g"
                     /note="highly similar to uniprot|Q99216 Saccharomyces
                     cerevisiae YOR145c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448631.1"
                     /db_xref="GeneID:2890233"
                     /db_xref="GOA:Q6FMB3"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /translation="MVAPTAVKRQEEATAGPSRILGDGAPTAMIDEDDDEILIDQDME
                     EEAPKKSKKEAAGVVLDESGKPRFGAAKDQATTKVKLESRKVPVPPHRMTPLRNSWNK
                     IYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIA
                     LLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKI
                     HILGGFTHIRMAREAVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <936377..>938326
                     /locus_tag="CAGL0K09482g"
                     /db_xref="GeneID:2890234"
     mRNA            <936377..>938326
                     /locus_tag="CAGL0K09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448632.1"
                     /db_xref="GeneID:2890234"
     CDS             936377..938326
                     /locus_tag="CAGL0K09482g"
                     /inference="similar to AA sequence:UniProtKB:Q12171"
                     /note="similar to uniprot|Q12171 Saccharomyces cerevisiae
                     YOR147w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448632.1"
                     /db_xref="GeneID:2890234"
                     /db_xref="GOA:Q6FMB2"
                     /db_xref="InterPro:IPR012571"
                     /translation="MIRRRIVGFLRRPLGSEGGPLVSPIVGLVRPLVYPVNRAASPVT
                     AVSPVVRPVGMRFISGPVEREAIRAGISNNTDFLHVQNILLQKDQERQRRELLLKDAD
                     NFFERFKVKTKWVLIRGNRPFSKDEIYTLFSWLLLSQIVWIVVGTTTFLSLVIMASNT
                     MFAKEFVGETLGNILNNNKYINGIDFTFKDAMVPEWKKKMIRFHNVTMKSNDKDDTKG
                     VSMNLKLNQVEVSLSVVKWLSGKGLVNDISIFGISGDISINDKKESNVESLINWVTES
                     NPTYELNNFTINDSSTVIHDKANNKHLNMNIYSLVIPRLRFDHLLTDIFSADVLVGSV
                     NDSLFNIHKRQNKLLPAFFSDKGRDNRSKTIDKNENDGRFTNLRLNAININELNLNRT
                     GAFNWIDDGTIEISADIMIPNTDENNEGNGLKTLLGYPGGDPLVNKNTPENKYVVIDV
                     KFKFKDLKTKFPNEEPKLSSGEKILSLNELKPVIAYVNSRSGFIHFLTSLEDSNQSRT
                     NVESVDDNKNWGLSNISIRRKKSYPNTTVISSKPYWNSTSEDNERNLPLPLNQEIIKF
                     HNISVQDDNELVLRCRIVQNVEQLENLSSLKISKMWDTITMEMYMDLLKVVEDWEYRN
                     KNDWMKQWGATFASQLLLVGFGAMV"
     gene            complement(<938579..>939088)
                     /locus_tag="CAGL0K09504g"
                     /db_xref="GeneID:2890235"
     mRNA            complement(<938579..>939088)
                     /locus_tag="CAGL0K09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448633.1"
                     /db_xref="GeneID:2890235"
     CDS             complement(938579..939088)
                     /locus_tag="CAGL0K09504g"
                     /inference="similar to AA sequence:UniProtKB:Q02521"
                     /note="similar to uniprot|Q02521 Saccharomyces cerevisiae
                     YOR148c SPP2 involved in pre-mRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448633.1"
                     /db_xref="GeneID:2890235"
                     /db_xref="GOA:Q6FMB1"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="InterPro:IPR026822"
                     /translation="MFSLKLGKNKKKKKVPKGDSELFGSEASVDDKVSLTQYNYADER
                     EKEKPKKRKIELATAESETIALKRAKNNIGDDSIVQELEALPEKVEDKEYEEMPVEEF
                     GAAMLRGMGWTDENELEDSKSHSKKLPHEQIHPEGLGIGAKSQEMSNPVSVKDLVNDF
                     MPVKKVPKQ"
     gene            <939503..>940798
                     /locus_tag="CAGL0K09526g"
                     /db_xref="GeneID:2890236"
     mRNA            <939503..>940798
                     /locus_tag="CAGL0K09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448634.1"
                     /db_xref="GeneID:2890236"
     CDS             939503..940798
                     /locus_tag="CAGL0K09526g"
                     /note="highly similar to uniprot|P33298 Saccharomyces
                     cerevisiae YDR394w YTA2 26S proteasome regulatory subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448634.1"
                     /db_xref="GeneID:2890236"
                     /db_xref="GOA:Q6FMB0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FMB0"
                     /translation="MEELGISGPLESNGHANGNGAGNGNVKSYANLLEQLGNSKVFSM
                     QGNNDVYLRLKKLEKELELLSLQEEYIKDEQRHLRLELSRAQEEVKRIQSVPLVIGQF
                     LEAIDQDTGIVSSTTGMNYVVRILSTLDREQLKPSTSVALHRHSNALVDILPPDSDSS
                     ISVMGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPP
                     GTGKTMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDE
                     VDSIATKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRP
                     GRLDRKIEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDAISGAVIAAIMQE
                     AGLRAVRKNRYVILQSDLEEAYAAQVKTDSDVDKFDFYK"
     gene            complement(<940917..>942407)
                     /locus_tag="CAGL0K09548g"
                     /db_xref="GeneID:2890237"
     mRNA            complement(<940917..>942407)
                     /locus_tag="CAGL0K09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448635.1"
                     /db_xref="GeneID:2890237"
     CDS             complement(940917..942407)
                     /locus_tag="CAGL0K09548g"
                     /inference="similar to AA sequence:UniProtKB:Q04174"
                     /note="similar to uniprot|Q04174 Saccharomyces cerevisiae
                     YOR149c SMP3 protein kinase C pathway protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448635.1"
                     /db_xref="GeneID:2890237"
                     /db_xref="GOA:Q6FMA9"
                     /db_xref="InterPro:IPR005599"
                     /translation="MDNKLIWLLPAIGLVVALQPSYIHPDEHFQTLEMLMIKFYGISG
                     TVPWEFEPTNNARSYFPLYAFYGPLFYLMRDILKVQNPLNILRIIRFYNFMLYLSVLY
                     YALPKLVNENKLQNKGRVNEALVFILSSYITWCYQCHSFSNSLETILLLLVLSNYTDI
                     LSNKAGLLQLVSTGFLISVGTFTRISFPAFLLLPSIQVFLKVLYRKWIQMVVIAVSMT
                     LSTSIIVYFDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVNIPLILGP
                     GLLMIRNTKNDFLNLPLLSIISSLFFLSALRHQELRFLLPVVPLFSTLLTRFRYRPYL
                     FRIWLVFNAAMCIIMGIFHQGGVIPMISNINAEQDLTIDIWWKTYSPPTWLYNNDILT
                     VSTTSIVNNIENLDLVQFNVKTNHVVDLKGCDFDLVLEAIQNFRINGVKSLRLIVPNS
                     MTSNVAALNQTYLVTKENSVFPHLDLDHLDSGIQNIIGLSEYKVSL"
     gene            <942861..>944054
                     /locus_tag="CAGL0K09570g"
                     /db_xref="GeneID:2890238"
     mRNA            <942861..>944054
                     /locus_tag="CAGL0K09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448636.1"
                     /db_xref="GeneID:2890238"
     CDS             942861..944054
                     /locus_tag="CAGL0K09570g"
                     /inference="similar to AA sequence:UniProtKB:P17898"
                     /note="similar to uniprot|P17898 Saccharomyces cerevisiae
                     YNL130c CPT1 Diacylglycerol cholinephosphotransferase or
                     uniprot|P22140 Saccharomyces cerevisiae YHR123w EPT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448636.1"
                     /db_xref="GeneID:2890238"
                     /db_xref="GOA:Q6FMA8"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA8"
                     /translation="MGYFIPKEAIANLKYYKYQSEDRSLISNYILRPYWRWFSQLFPM
                     WMAPNLVTLSGLGFIILNVLTVLYYDPYLNTETPRWTYFSYALGLFLYQTFDACDGMH
                     ARRTGQSSPLGELFDHCIDSLNTTLSLFPVCSMLGCGYSMILIGTQFMVLGNFYLSTW
                     EEFYTHRLFLSEFSGPVEGILLLVFQFILCGLFGTQRVWHTKLLSIHLPLTIGNSDIF
                     ELETVHLMICFSTFALLFNILAATSNVFQYFKEHNKKNDMEEVEAEKKEAMIALMPFF
                     IYFATVFALVAVDNLFISFPFIISVGLTMAFVVGRMIVGHLTKQKFPLVNFPMFIPIS
                     QLIMYIIFVCYFKSDRETMVLALLWGGFGVSLGIHAMFINEIIYEFTTYLDVYALSIK
                     HPKST"
     gene            complement(<944633..>945070)
                     /locus_tag="CAGL0K09592g"
                     /db_xref="GeneID:2890239"
     mRNA            complement(<944633..>945070)
                     /locus_tag="CAGL0K09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448637.1"
                     /db_xref="GeneID:2890239"
     CDS             complement(944633..945070)
                     /locus_tag="CAGL0K09592g"
                     /inference="similar to AA sequence:UniProtKB:P49334"
                     /note="similar to uniprot|P49334 Saccharomyces cerevisiae
                     YNL131w TOM22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448637.1"
                     /db_xref="GeneID:2890239"
                     /db_xref="GOA:Q6FMA7"
                     /db_xref="InterPro:IPR005683"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA7"
                     /translation="MVELTEIKEDTVQDPPVTPAGLGDVAVKGARVEDEEDDSDFEDD
                     FDENETLLDRVKALKDIIPPQHKNRICAVFSTSCSIIKSAFTRGSGLAWTLTTSALLL
                     GVPLSLSILAEQQLIEMEKTFDLQKDANDILAQGDEKNTVATA"
     gene            complement(<945448..>948609)
                     /locus_tag="CAGL0K09614g"
                     /db_xref="GeneID:2890240"
     mRNA            complement(<945448..>948609)
                     /locus_tag="CAGL0K09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448638.1"
                     /db_xref="GeneID:2890240"
     CDS             complement(945448..948609)
                     /locus_tag="CAGL0K09614g"
                     /note="highly similar to uniprot|P53914 Saccharomyces
                     cerevisiae YNL132w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448638.1"
                     /db_xref="GeneID:2890240"
                     /db_xref="GOA:Q6FMA6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA6"
                     /translation="MAKKAIDSRVPALIRNGVQTKQRSFFVIVGDKARNQLPNLHYLM
                     MSADLKMNKSVLWAYKKKLLGFTSHRKKRENKIKKEIKRGTREANEMDPFETFISNQN
                     IRYVYYKETEKILGNTYGMCILQDFEALTPNLLARTIETVEGGGIVVILLKSMSSLKQ
                     LYTMTMDIHSRYRTEAHDDVVARFNERFILSLGSNPNCLVVDDELNVLPISGAKSVKA
                     LPPADSDELTPKQQELKDLKESLEDVQPAGSLVSLSRTVNQAHAILSFIDAISEKTLN
                     TTVALTAGRGRGKSAALGIAIAAAVAHGYSNIFVTSPSPENLKTLFEFIFKGFDALGY
                     QEHADYDIIQSTNPDFNKAIVRVDIKRDHRQTIQYILPQDSYVLGQAELVVIDEAAAI
                     PLPIVKNLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRTQTVQTTDDATQTTVVSRD
                     SQKDTRSHLSRQLKEVSLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHP
                     SQCNLFIVNRDTLFSYHPVSESFLEKMMALYVSSHYKNSPNDLQLMSDAPAHQLFVLL
                     PPIDPKDGGRIPDPLCVIQIALEGEISKSSVRNSLSRGQRAGGDLIPWLVSQQFQDEE
                     FAGLSGARVVRIATNPEYSSMGYGSRAMELLKDYFEGKFTDLSEDTKPRDFSLKRVDP
                     KELEKANLLKDEVKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTPALHKFWKNNDY
                     APVYLRQTANELTGEHTCVMLKVLEGRESHWLVEFANDFRKRFLSLLSYDFSKFTAVQ
                     ALGVIESSKKPGKTLEEQHTVKELTKSQLDDIFSPFDLKRLDSYANNLLDYHVIVDLL
                     PMLSILYFGDKMGDSVKLSSVQSAILLAIGLQHKSIDDITKELNLPSNQTIAMFSKIM
                     RKFSVYFRNLLSETIEQQLPEQQDDELADMNGEDITTYDAAQAFDQMEEDLEEAGSEA
                     IKAMKEKQKELINSLNLNKYAIDENNEEWEKSKKSLEKAAKSEGVVSLQTGKKRTTES
                     ADSIMKQEMNAVKKSKKSKKSKK"
     gene            complement(948884..948981)
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0K09636r"
                     /db_xref="GeneID:2890241"
     tRNA            complement(join(948884..948920,948944..948981))
                     /gene="tRNA-Phe (GAA)"
                     /locus_tag="CAGL0K09636r"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:2890241"
     gene            <949389..>949853
                     /locus_tag="CAGL0K09680g"
                     /db_xref="GeneID:2890242"
     mRNA            <949389..>949853
                     /locus_tag="CAGL0K09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448639.1"
                     /db_xref="GeneID:2890242"
     CDS             949389..949853
                     /locus_tag="CAGL0K09680g"
                     /inference="similar to AA sequence:UniProtKB:P53913"
                     /note="similar to uniprot|P53913 Saccharomyces cerevisiae
                     YNL133c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448639.1"
                     /db_xref="GeneID:2890242"
                     /db_xref="GOA:Q6FMA5"
                     /translation="MSEEKKLQFVTEGQADVEKQSEREEAIQGAIETERKKRVRKTLR
                     DQLRANAIKKQKKSNRESAEVKKLNQLSKEETRYFKELEKNREQEIQRLTQFHKDKDY
                     EYEKKRQQLLSRSPDKQSGKPDTLSSNQNNGSTERVILKVKNKNRPRLVVKK"
     gene            <950337..>951458
                     /locus_tag="CAGL0K09702g"
                     /db_xref="GeneID:2890243"
     mRNA            <950337..>951458
                     /locus_tag="CAGL0K09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448640.1"
                     /db_xref="GeneID:2890243"
     CDS             950337..951458
                     /locus_tag="CAGL0K09702g"
                     /inference="similar to AA sequence:UniProtKB:P53912"
                     /note="similar to uniprot|P53912 Saccharomyces cerevisiae
                     YNL134c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448640.1"
                     /db_xref="GeneID:2890243"
                     /db_xref="GOA:Q6FMA4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA4"
                     /translation="MSIPATMKAAVIDGDHLTVKEVPVPEVRDGMVLIKTRAVAGNPT
                     DWKHIVSKIGPQGSISGCDVSGEIVKIGANVDTSKYKIGQKAYGLTHGSSVKHPDNGA
                     FAEYSLLDPKIAYFPNQDITMSGKDTIPEGTVKYFEDGASFPVSLTTAGAVLHSNLGL
                     DLKWEPSEPQRDHPVLFWGGATGVGQLLIQVAKKIHGFTKIVTVASKKHEAQLKTYGA
                     DEVFDYHDADVIEQIKKKYPDLQIVVDCVSNENTIKQVYKCATESKSATIVQLTHLSI
                     KDIPEEDRRDNKTIIGSMLYLATGEDVPFGPVHLPADPKFRKDVEEFVAFINPRINEG
                     IIHHIPIKIYKNGLDDVQQILDDIKFGKNSGEKLVAILN"
     gene            <951822..>952166
                     /locus_tag="CAGL0K09724g"
                     /db_xref="GeneID:2890244"
     mRNA            <951822..>952166
                     /locus_tag="CAGL0K09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448641.1"
                     /db_xref="GeneID:2890244"
     CDS             951822..952166
                     /locus_tag="CAGL0K09724g"
                     /note="highly similar to uniprot|P20081 Saccharomyces
                     cerevisiae YNL135c FPR1 peptidyl-prolyl cis-trans
                     isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448641.1"
                     /db_xref="GeneID:2890244"
                     /db_xref="GOA:Q6FMA3"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /translation="MSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNA
                     TLIFDVELLKVN"
     gene            complement(<952549..>955125)
                     /locus_tag="CAGL0K09746g"
                     /db_xref="GeneID:2890198"
     mRNA            complement(<952549..>955125)
                     /locus_tag="CAGL0K09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448642.1"
                     /db_xref="GeneID:2890198"
     CDS             complement(952549..955125)
                     /locus_tag="CAGL0K09746g"
                     /note="weakly similar to uniprot|Q12019 Saccharomyces
                     cerevisiae YLR106c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448642.1"
                     /db_xref="GeneID:2890198"
                     /db_xref="GOA:Q6FMA2"
                     /db_xref="InterPro:IPR012423"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA2"
                     /translation="MDWSIVDEIRLFRWVSEFKPCGSQNVGNVKKIVDRLNNPEKYPV
                     LMLQKDTSRRRISKVFTIEDVVRKLSQYYDLDEAGRVEDGVRDVGGADDDTSSLQLDI
                     PDLDHSDTKRHDNRERSLAETLGEGTLDHDHSFTIGSDRSIVRQDTKNSSFVSGVENS
                     IKDTSQFSANSSKGNADMAQEIKVTGTPKKTADNTISNFDDIEMPDAHQESEPDTPLE
                     TQEQNNVEESGNNNEEKAIEVDKDVGNESIGNSESVAEEPAHISSKEDIPSKETSNVD
                     HLSKATNSNEIEENSMHSGKGEKELAIELEKSNTQDEKTGLPTEDDIENNNDTNKSAV
                     SDTEQSKDESATIGDNKKENTAQEIQTSEQHSSRSPANDVNDDSLKSAHETQVNEFEK
                     DETSGTNQPIKEDSMSKKIPEEIKETTTAAGVNCGEESEIRKDDEETSTLSSVDESSN
                     MNDSNQLEEVDVEINKNSEEGSPISELNGKQITEENALANKDTPDGDTKEAAPTEKKT
                     ETQDIESTSEAGELRVHEGNEKETTSDSNNQEQENKESDLDIALAKNDVEQELQNDNV
                     TENTTIDRESNDGTLQESETQDKVEVAPIGNSDIKSEDKGEFQDTSIVNENNEDTQVN
                     SEEANDDRDISDNKGESNEKLEEGKKTEEDSGINDNQKVDLKDNDASDDVVGDQTTKV
                     GSNNDIEDKNDEEATVKETNNESSEEQDYMAANTEDKDTNEDEKLVDSKIEGPKTRKR
                     QREEEAKDKDETLDEKMSIRRSRRSATSNAITEAPASKSQATTPEPEAVSSKDTPQKQ
                     TKKPKLPDEPLAKRTRHSAALQSVVAEKEKEEEPKKKRKKNAKKAVQQPTRMSSRLRN
                     KK"
     gene            <955542..>956996
                     /locus_tag="CAGL0K09768g"
                     /db_xref="GeneID:2890199"
     mRNA            <955542..>956996
                     /locus_tag="CAGL0K09768g"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_448643.1"
                     /db_xref="GeneID:2890199"
     CDS             955542..956996
                     /locus_tag="CAGL0K09768g"
                     /inference="similar to AA sequence:UniProtKB:P27929"
                     /note="similar to uniprot|P27929 Saccharomyces cerevisiae
                     YNL137c NAM9"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_448643.1"
                     /db_xref="GeneID:2890199"
                     /db_xref="GOA:Q6FMA1"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA1"
                     /translation="MPRKAVLLNSLTRGRVRTSFNKYNLFNLYKKGNIDFRSKSLYQQ
                     KWSAKQETRAYHGEHITESRWQTMFSPKLDSVAQLDASLRGGVTKETPFLMQTFATLE
                     KRLDFAVFRAMFASSVRQARQFILHGNVYVNGVKIKHPGYTLKPGDTFNVKPEKVLQA
                     LGSKKPSFEEALKVDKKQVVLWNKYVKEAKTNPQKAWSDKVAKFESMLDTNEKKHEFL
                     KRLKKEDTNLQNEEYKILKALTPKDILAEIISIHLKKAKDDTTPVPIEEFKTLAKYDE
                     AILPTIHKIYETYLFSKTILLDKLKGKNKEEIKEFASSLISPKDDAKKDLIASSKTSL
                     REGKNQLSDFVKKYSQSVINHFKNKQTDGSIANSSFDPKWAENLKYHPRLDLEAIKED
                     EVKAREAINLPWQSKHLYGRKDSNKPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVY
                     LRDPVARPGHSEVISPFDIPVHERAYMYYIRRGK"
     gene            complement(<957215..>958792)
                     /locus_tag="CAGL0K09790g"
                     /db_xref="GeneID:2890200"
     mRNA            complement(<957215..>958792)
                     /locus_tag="CAGL0K09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448644.1"
                     /db_xref="GeneID:2890200"
     CDS             complement(957215..958792)
                     /locus_tag="CAGL0K09790g"
                     /inference="similar to AA sequence:UniProtKB:P17555"
                     /note="similar to uniprot|P17555 Saccharomyces cerevisiae
                     YNL138w SRV2 adenylate cyclase-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448644.1"
                     /db_xref="GeneID:2890200"
                     /db_xref="GOA:Q6FMA0"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028417"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:Q6FMA0"
                     /translation="MSDSKFAMQGYNLVKLLKRLEDATARLEDVTIYQEGYLQSKMES
                     GVIDHQSSGGSGIEAKAAGVKSESQEVPQAVASMPASIEKFDKFIKERVEPFVELSEK
                     IDPVVFQITELFKGAFDAQLEFLKVAVKSKKPDFTSQAFADALQPITKAITAIGDLKD
                     ANRQSKYFAFLNAVTEGAPLFSWITVETPVSLVGDFKEAAQFWTNRVLKDFKDTNPDA
                     STWVQNFMSIFDKLKEYVKEYHTTGVSWDAKGSDFETVFKNSKNTQSSTSSPAAPSPA
                     PSAGGPPPPPPPPPASVFEVKNDTAEKPAASGIDAVFAELNQGENITKSLKKVDKSQQ
                     THKNPELRASSVVASKAAPPPKPKKPSALTTKKPPRKELLGNKWFIENFDDESEPIVI
                     ETQKDESVFIGKCCKTLVQIKGKVNAISLSETESCSVVLYSSISGMDIIKSNKFGVQV
                     EGSLPQISIDQSQGGSIYLSKESMSTEIYTSCSTSINVNLPIGEDEDYVEFPIPEQLK
                     HTFDNGKMKSDVFVHAG"
     gene            <959122..>960138
                     /locus_tag="CAGL0K09812g"
                     /db_xref="GeneID:2890201"
     mRNA            <959122..>960138
                     /locus_tag="CAGL0K09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448645.1"
                     /db_xref="GeneID:2890201"
     CDS             959122..960138
                     /locus_tag="CAGL0K09812g"
                     /note="some similarities with uniprot|P38833 Saccharomyces
                     cerevisiae YHR127w HSN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448645.1"
                     /db_xref="GeneID:2890201"
                     /db_xref="GOA:Q6FM99"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FM99"
                     /translation="MAVRVRVRGRKSKGKGHGHGGERITVKQEAGEDIDQLVQVQKPR
                     AKLRVQEAATQKRREKPAARVTPAREVPLADRIEVKHKSVKTSRTGSNDRQRNRANGV
                     DPFERMIRHQLGVIGYTEITNPQMKRFLSLSTPNKINAMRGLGFTDERIMSLFNSTGV
                     KVTELSMKKADQMQKQKQNQKDSSDTGFGKRKEKSTNGVRNNTQSIEGTPSTIVDTPR
                     NGLEIPLMSPGLAITNRNKLVISTSTKPDNGNLLTIYNLTLGLDQEKLKDILESYGNT
                     EIDKVVVRDLPTGSAMATVHLKEPSTEELIRVRDFFHGATVDGRTIQVMISADPTKNL
                     SSAI"
     gene            complement(<960272..>960475)
                     /locus_tag="CAGL0K09823g"
                     /db_xref="GeneID:9488034"
     mRNA            complement(<960272..>960475)
                     /locus_tag="CAGL0K09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999536.1"
                     /db_xref="GeneID:9488034"
     CDS             complement(960272..960475)
                     /locus_tag="CAGL0K09823g"
                     /inference="similar to AA sequence:UniProtKB:P0C074"
                     /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
                     YNL138wa YSF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999582.1"
                     /db_xref="GeneID:9488034"
                     /db_xref="GOA:B4UN39"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:B4UN39"
                     /translation="MSQSSTSTEEWLLKVRRDTISSMIQHSGLNEYIMLAKGDDCRRT
                     TQIDLIEKYCNSFPAGHSYGQKK"
     gene            complement(<960893..>964855)
                     /locus_tag="CAGL0K09834g"
                     /db_xref="GeneID:2890202"
     mRNA            complement(<960893..>964855)
                     /locus_tag="CAGL0K09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448646.1"
                     /db_xref="GeneID:2890202"
     CDS             complement(960893..964855)
                     /locus_tag="CAGL0K09834g"
                     /inference="similar to AA sequence:UniProtKB:P53935"
                     /note="similar to uniprot|P53935 Saccharomyces cerevisiae
                     YNL091w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448646.1"
                     /db_xref="GeneID:2890202"
                     /db_xref="GOA:Q6FM98"
                     /db_xref="InterPro:IPR025279"
                     /translation="MPSGSKSKKKKSKSKGGVKKHAVEKVAPPIEAEIMDERDESDYP
                     TSRVIKRGPNGDVIVESLPDKSTSGKKSKKKGKLSDLEVSESAKQMGITLDSHWESLS
                     PDEKKNILRIEKEEVLEIIRNYQNDHNCSCSVCGRRHMAMNQEMERMYNLLYELEEQR
                     DPDMNPVKFHLGIIKELQISKNKQILDQTEGPNDNTTHEEVVKNFLSSDIADKLKEEV
                     HQFKQKQLSKQECNRPSSLANDNIEEEIPCAQIPQANEEAMTKDIQKTLEQLSVVEPV
                     SKINVIQEDDLGEIKEENKEYLKFTESFISSQPKIAQKFIQKLDENPCMKAITDEVMQ
                     NSSYEFLDALKNLWAPNLLKIVESEDDDNLVNLNETLDPIEFTTMLHHGNPLSQQDYY
                     DLQGAISRKVVNAFNFENRKLEHLSPLEVELFGRFMSSDQDNIFHNMLLEAYNERFKE
                     EPFKMMSNIPQIIKAVATLTNLDGRMMDDVDENHFTSEEERYDDDITDYSDSEYEDYD
                     SEYDDIDNGDIISDVDEPFSTLKSDQLRVNYDTNSGNINHSDNYESNSRLREVTDENE
                     ENLQYDTPQEKYNYSDHGKDHGTIADEDEDSIDEGYESSIDDMERLEEGRRLIQIAIT
                     KLLQGRIMESYHEKEADSNRLKLLKELEEEQMKKKEKEVKKIKKKEKEKEKRRLQQLA
                     KEEEKRKKEEEERSAREEQERREMERREAQRKKVEEAKRKKDEERRRKLEEQRKREEQ
                     QEKQRKAKEEQKRKREEEKKKKEELERQLREEELMKKKEEEERLLREKERAEILKKET
                     ELAMSMKENHSSQSLSIQNQFFSNPQNSNIGMQNYFNNDLDNTNAGLGNGGPTNLGVR
                     KNSHVLGLTQVYSDKANNSPGKNDDNNEINNEILNIINAATTAKSGSRTSMDMQALLQ
                     PPFTDNVNDQIRSSNLINDQASGMNSNGLSTNFHSPYGSNVFSGENQLSNNLQNDILT
                     GLNADTSSTNLASWTSLPALNNLNANQHILSNNQTPLHQQKGTSPISNTMMDTKRDYL
                     GDELSKLTTMLTTNSLNESPAFSSSNLQSSLWNDQNSSGKTPLGSNTTQIPLSQPAFL
                     GTEPPVHRSSIWGDSSASMFNFSQRLSVPTNSNSVSSQTVPNQNIGMGSSFTNPSIWS
                     TGSDFNVPSRDMNSGVAFTNSFSNTSPRNQFALNSGSMLQNQSQRQNIMDNIRLLSNS
                     PQNNGYIPIDLLYQSINKQSTSDFPSFLNNVIDLERSHNYDLVKDQTGVINGVRVGSE
                     NRPVSTAFSNFHQNMDPTMKGPEHLSNSIPGTARNFEGNSYLAKEATMNIIPSSSLDR
                     "
     gene            complement(<965222..>966433)
                     /locus_tag="CAGL0K09856g"
                     /db_xref="GeneID:2890203"
     mRNA            complement(<965222..>966433)
                     /locus_tag="CAGL0K09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448647.1"
                     /db_xref="GeneID:2890203"
     CDS             complement(965222..966433)
                     /locus_tag="CAGL0K09856g"
                     /inference="similar to AA sequence:UniProtKB:P53934"
                     /note="similar to uniprot|P53934 Saccharomyces cerevisiae
                     YNL092w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448647.1"
                     /db_xref="GeneID:2890203"
                     /db_xref="GOA:Q6FM97"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FM97"
                     /translation="MEDLTDEQVIEETLSAYKQYRDYALKEYYTPRLVKWEALPEIQR
                     KLVPSYSSYLSNLKRCISLNADFIEGAVEFFEHASGIQGSVSRPVSRSNMEKVVSMLA
                     QLYREWSAEASSERDILLSRLMPFLSELQGNSSSEEPLEILVPGLGTARLIADLVMHG
                     YRSEGNEYSYYMIIMSMFMLNGGLSSKGIEIYPFVHTNSHWKERNLMFKPIRIPDFDI
                     QSELAGNNLMQISMGSFVDCYGPNEGILGSSHYNINQEMNLKRLNSKSTKDVVVTNFF
                     LDTSGNVIDYLLAIEHVLRPGGTWINFGPLVYHHENDNDSDINYEVDPYSGERTDHSP
                     IPMKGIELTVDEIVAVALKLGFTMLKREDGILSGYGQLPFPESGLNGLPGYRCSYWVM
                     KKRTELMEGAL"
     gene            complement(<966692..>968584)
                     /locus_tag="CAGL0K09878g"
                     /db_xref="GeneID:2890204"
     mRNA            complement(<966692..>968584)
                     /locus_tag="CAGL0K09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448648.1"
                     /db_xref="GeneID:2890204"
     CDS             complement(966692..968584)
                     /locus_tag="CAGL0K09878g"
                     /inference="similar to AA sequence:UniProtKB:P53933"
                     /note="similar to uniprot|P53933 Saccharomyces cerevisiae
                     YNL094w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448648.1"
                     /db_xref="GeneID:2890204"
                     /db_xref="InterPro:IPR017210"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:Q6FM96"
                     /translation="MEGMDNGNSGNGSNGSKRQMLYDFVRKTKEVYIPNIRQMTSKPY
                     MPDGMARDGPSDISNSQYPENMFIQYYPSYYTRNDINDGRKALYDVVIRLNILEPGDI
                     TRRRNRVLLSLCKQYLKPGNSDPDAIQSETDLSQAKGFNEEELETLTNRIQGFLCARV
                     PGAPLLITLHGDTPNDIHKIEIQADNIGYVETSVMTEFEPRRINITVQTPDYFPAIVT
                     KDVSNLTYIKQDGWGLISDIDDTIKHTGITGNKKSMFRNVFVHEFERWKIDGMPSWYY
                     TLRDVYNFDFFYVSNSPLQLYPVLVNFIESNYPRGPIFLKQYTGNFMKSLMTSSANRK
                     SGKIRSILEDFPNKKFILVGDSGEQDLEAYTKLACEFPDQIRAIFIRCCSNSLSDFSV
                     EDKNIMKTLNELIQRLYFNKSVGSSTTSLPISRKSFRDDLVDNIRKIPPLPLRRRTTA
                     EVARPVDSFARDTPVSRRSTTDRLRRPPPPIPNKRIQLSREQEESIMATRHLNSDDHR
                     SNADESPKRPPALPPRRTDSTLYDTIQDKSSLSPSASSISSSAQSSVSEGFFIPSSQN
                     DMEGTGTIVDKRADNWQGRVINAIDELKSANVNVHFAFFMEPELCLEDSLSIIESTKE
                     RTPSEK"
     gene            <969098..>969703
                     /locus_tag="CAGL0K09900g"
                     /db_xref="GeneID:2890205"
     mRNA            <969098..>969703
                     /locus_tag="CAGL0K09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448649.1"
                     /db_xref="GeneID:2890205"
     CDS             969098..969703
                     /locus_tag="CAGL0K09900g"
                     /inference="similar to AA sequence:UniProtKB:Q02516"
                     /note="similar to uniprot|Q02516 Saccharomyces cerevisiae
                     YOR358w HAP5 CCAAT-binding factor subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448649.1"
                     /db_xref="GeneID:2890205"
                     /db_xref="GOA:Q6FM95"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:Q6FM95"
                     /translation="MEKMEKTYGQEPGQEPGQEPGQEQEQALEQSREQEQGRGAGMKG
                     EELDVQFDNGAHEDGLEFEEDEDVFRNVGLGLEGHYKEIMIEYWQQLINEIESTNEPG
                     SEYQDDFKSHSLPFARIRRVMKTDEEVKMISAEAPIIFAKACEVFITELTMRAWCVAE
                     KHKRRTLQKADIAEALQMSDMFDFLIDIVPRSTIGAQNNSS"
     gene            <970442..>972091
                     /locus_tag="CAGL0K09922g"
                     /db_xref="GeneID:2890206"
     mRNA            <970442..>972091
                     /locus_tag="CAGL0K09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448650.1"
                     /db_xref="GeneID:2890206"
     CDS             970442..972091
                     /locus_tag="CAGL0K09922g"
                     /inference="similar to AA sequence:UniProtKB:Q08831"
                     /note="similar to uniprot|Q08831 Saccharomyces cerevisiae
                     YOR359w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448650.1"
                     /db_xref="GeneID:2890206"
                     /db_xref="GOA:Q6FM94"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /translation="MLANKFDEMHHPVPDSSMNGNPLCNSSANVGQGNRNSNPIQSRG
                     TGHSSSPIYNNPLRTAHPGAVLLSPQSSSLNIIDTTVGNAMSPTVPSSAASSIFFNDF
                     GLDSSTNLNKSAMNANSNRPMTTIPLSSNSTSQSYTLSFQQENKKTNSNSTLNNVNNG
                     LVTAGSVSNSHNNIFLDSFLSHDNTMQPNNSSNNNNNNNQNANNSLNFNTDVNQLCTW
                     MSMLTANQQSVVMDNIISVLNESTLNYTKMKLDTMFGTTSSSPTSAEAMQNLGQPKES
                     GNQNSNQNNIASPIPSTLDSVFANNSMKYLQSQSTSGSNHFHQAFNSKGSSMNWSSQA
                     SNIQNPAYDYLNDYRQRPKSAEPPLSHQTHYQPSNLSISQFKPQNSNGNSSNTNTNRN
                     LNNSNNSNNNSTANNNNIGSNNTKRMNDITNSADVPVTSSFQNLTLNNQNGSTTTSSN
                     NGNSSSGASSNSSMNPKSLTDPKLLNNIPIWLKTLRLHKYSDILNDLSWEKLIYLEDE
                     DLLKRGVLALGARRKLLKAFTIVRDYKNRDLIDNSAYLNIK"
     gene            complement(<972332..>974059)
                     /locus_tag="CAGL0K09944g"
                     /db_xref="GeneID:2890207"
     mRNA            complement(<972332..>974059)
                     /locus_tag="CAGL0K09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448651.1"
                     /db_xref="GeneID:2890207"
     CDS             complement(972332..974059)
                     /locus_tag="CAGL0K09944g"
                     /inference="similar to AA sequence:UniProtKB:P06776"
                     /note="similar to uniprot|P06776 Saccharomyces cerevisiae
                     YOR360c PDE2 high affinity 3 5 -cyclic-nucleotide
                     phosphodiesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448651.1"
                     /db_xref="GeneID:2890207"
                     /db_xref="GOA:Q6FM93"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:Q6FM93"
                     /translation="MTTLFIIGTEPQNIAENSAQVDVFDRIITLKDVDSLIDKIYTDR
                     LAPRLKAFAYETSLSVVCFNGNNISGISPDNLDRILKRFLPALNITVVQSIEFLNDKD
                     FMDSIRNNKVIGNDTILRINHWVYHQHDKPTGDSNDTCYTNLYSLMSHLTTSNSFAKN
                     EPIPRIIRNINFREYFNDIYGQYDSDTVMEKHFIDTLSTWNFCAIKFTTKELILCAFF
                     LLRSLSKRANVLISDNKLLLLLITIEASYHQINKFHNFRHAVDVMQATWQICSNLGGN
                     GSIDLSPLTVLLLSMSAIGHDIGHPGTNNQLLCQHESFLATNFDNKSVLENFHNTLFQ
                     NLLVDHWPQILKAARYKTVQSGEINVTDIPFVNLKKSNNINENDDNDKKMTINVITNA
                     ILATDMAMHAKYVDKLDELLKVPQHLLPLPTLIAVIIKAADISNVTRPLSISARWAFL
                     ITLEFNDCSLLDKYASDVKEDGTSSKTACYNSNGKQRVTDPEYYKRNSPEYIVDLVLN
                     REEEDDEKYLKRLLQSYPNIPQGQIFFINTFAGKFFGRLGELFPELQFLSNNVNSNKS
                     YWESMVAKN"
     gene            complement(<974931..>977090)
                     /locus_tag="CAGL0K09966g"
                     /db_xref="GeneID:2890208"
     mRNA            complement(<974931..>977090)
                     /locus_tag="CAGL0K09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448652.1"
                     /db_xref="GeneID:2890208"
     CDS             complement(974931..977090)
                     /locus_tag="CAGL0K09966g"
                     /note="highly similar to uniprot|P06103 Saccharomyces
                     cerevisiae YOR361c PRT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448652.1"
                     /db_xref="GeneID:2890208"
                     /db_xref="GOA:Q6FM92"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /translation="MAAAEIKLEDIPVDDIDFTDLEKEYSVDDEFKFDNYVVVTGAPV
                     IPESKVPVLKKALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFH
                     GKRLDLKHRLFLYSMRDVEKLSEQGAGEFVEPELPGFVPTSTLKSWLADEDGRDQFVI
                     QKDNLTGIFWNSMHESEDDVVESRTNWSTNYVRFSPRGTYLFSYHPQGVTSWGGPQFD
                     RLRRFYHPNVRTSSVSPDEHYLVTFSPEPIELDDSVPESPFTKRNEGHHICVWEIDTG
                     LLCASFPLTKNPNLQWPFVKFSYNDKYCARFVGDRLAVYDCTNKFSLLEAPALKVSGI
                     RDFSFAPTGVELQPFNKNDEPSVLLSYWTPETNNSACTASVVQVPRGRVLKTVNLVQV
                     SNVTTYWPEGGEYLVFNVERHTKSKKTLFSNLQICKLTEKDIPVEKIEVKDRIMEVGW
                     EPHGHRFITISTTEGPDDNIAIPKNVVRFYAPEKKEGVKNKIVVKRWVVIKEIEKKFY
                     NTVSWSPAGRFVTVCALVKPNMRKSEFQFFDLDYPGEKNLNERKDVLATLKDVGESNY
                     GAATDLCWDPSGRFLTAWSSSLKHKMENGYKMFNIAGVIIKEDILPNMKNFAWRPRPE
                     SLLSNAEKKKVRKTLKEWSAEFDEQDAMANDSAVRDLILKQRAMLKEWREYRAAKAQT
                     TTIFDIAPWLDTTKDHEDFVKIEEIKEEIVEEIKEKL"
     gene            <977846..>978436
                     /locus_tag="CAGL0K09988g"
                     /db_xref="GeneID:2890209"
     mRNA            <977846..>978436
                     /locus_tag="CAGL0K09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448653.1"
                     /db_xref="GeneID:2890209"
     CDS             977846..978436
                     /locus_tag="CAGL0K09988g"
                     /inference="similar to AA sequence:UniProtKB:P38962"
                     /note="similar to uniprot|P38962 Saccharomyces cerevisiae
                     YDR084c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448653.1"
                     /db_xref="GeneID:2890209"
                     /db_xref="GOA:Q6FM91"
                     /db_xref="InterPro:IPR008564"
                     /translation="MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFT
                     ALFITIVLLLAADFYFTKNISGRRLVQLRWWYDSSATSTETFTFESHKQYTAGPPINP
                     IDSKLFWWSMYLTPAIWFVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNP
                     NNSQSTEPFFQLPSIPGLDNITRLARFQSFFQSAAN"
     gene            complement(<978660..>979838)
                     /locus_tag="CAGL0K10010g"
                     /db_xref="GeneID:2890210"
     mRNA            complement(<978660..>979838)
                     /locus_tag="CAGL0K10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448654.1"
                     /db_xref="GeneID:2890210"
     CDS             complement(978660..979838)
                     /locus_tag="CAGL0K10010g"
                     /inference="similar to AA sequence:UniProtKB:P38961"
                     /note="similar to uniprot|P38961 Saccharomyces cerevisiae
                     YDR083w protein involved in cleavage at site A2 in
                     pre-rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448654.1"
                     /db_xref="GeneID:2890210"
                     /db_xref="GOA:Q6FM90"
                     /db_xref="InterPro:IPR007823"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FM90"
                     /translation="MFKVEGWDIKTDKVAFSDSKKEKKAKNKKEKRTKSKKFENRDGA
                     DITDVADVQDAEARDVQDVEARNAYVDKRKVEYDKKEETNSKKRKVSKDKEEAPQPTI
                     AQSQVAKKLTPLQQKMMAKLTGSRFRWINEQLYTISSKDALQLVKDQPQLFDEYHDGF
                     RSQVQSWPENPVDVFVDQVRLRAKKPVNAPGGLPGLKDRKIVIADMGCGEAQLALDVN
                     TFFKKYNKKAKKSHQRNWEVHSFDLKQANERITVADIRNVPLPDNSCTIVIFCLALMG
                     TNFLDFIEEAYRILAPRGELWIAEIKSRFADGKGDEFVNTLKLMGFFHKKTDDENKMF
                     TRFEFFKPPAEIIEERKAKLERRQKFIEVETEKEELEKKRSKIAEGEWLLKPCIYKRR
                     "
     gene            complement(<980068..>981372)
                     /locus_tag="CAGL0K10032g"
                     /db_xref="GeneID:2890211"
     mRNA            complement(<980068..>981372)
                     /locus_tag="CAGL0K10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448655.1"
                     /db_xref="GeneID:2890211"
     CDS             complement(980068..981372)
                     /locus_tag="CAGL0K10032g"
                     /note="weakly similar to uniprot|P38960 Saccharomyces
                     cerevisiae YDR082w STN1 involved in telomere length
                     regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448655.1"
                     /db_xref="GeneID:2890211"
                     /db_xref="InterPro:IPR018856"
                     /db_xref="InterPro:IPR024263"
                     /db_xref="UniProtKB/TrEMBL:Q6FM89"
                     /translation="MEHGELVSEYRCYSERVSRGLYHAEVCMTVRMLHSCLDQSHARV
                     LGGKLYWKNRAIRRLKFVGTVIGVKYMWLKGDDYAVIHLDDSSDSSILKCKCEVNQLN
                     SFGININAGFIGSRVEVCGVYNTEFNELEVGFIGVLPSTLFSEIEHWRKCCLLLRMPD
                     DLTDEELKASGIGDDEMQDGRDSPLDEYFSTPPQNKAQFIEKLVLRDVKDKLEITSPD
                     PVRNESISVVDDTCDNTTLGSNTIDLRTAIEPITQPEVSGNDNFYKPATGSTSKRKLY
                     RKLFIAIYLIPEEECTINDLARDIGITSVLKGFLDGQGHISNDDMQIILQEYLSQLIT
                     GDVLVITARNRVSLKKLHALKAYTQKRINLLLKIQALLGTVRYQDVLQSTSMAIPAET
                     IIDAFKESLRTIDAGVAWFIETHQHSFTIHFTYSQSTQTCNN"
     gene            <981723..>984107
                     /locus_tag="CAGL0K10054g"
                     /db_xref="GeneID:2890212"
     mRNA            <981723..>984107
                     /locus_tag="CAGL0K10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448656.1"
                     /db_xref="GeneID:2890212"
     CDS             981723..984107
                     /locus_tag="CAGL0K10054g"
                     /inference="similar to AA sequence:UniProtKB:P32896"
                     /note="similar to uniprot|P32896 Saccharomyces cerevisiae
                     YDR081c PDC2 pyruvate decarboxylase regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448656.1"
                     /db_xref="GeneID:2890212"
                     /db_xref="GOA:Q6FM88"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q6FM88"
                     /translation="MLSIEQRYNICLMAERHPRWTQLELAKWAYDTFQLDKVPSQGTI
                     SRLLSRKSTYMNCKEHERDATRLRTPNNLLVRRIIQEWISQSLWNGIPITSPIIQETA
                     HSVWQRIPPEFREGNGSFSYKWITNFLAKMDVNISALDEELPKTPKVWTFEERSALKD
                     LFAKVPPKDLFTLDETFIAYNLPLDYAQYEASRIQRKIEVATVMLCSNLDGSEKIKPM
                     VVGRYNSYKSFRNYFPSEPIDPVSQSMLGQKMAEKFNVTYHSNRKSWLTSNLFHNWLA
                     QWDKRLGAYNRKIWIVLDDSCSHRIVNVHLKNINLVYTSANSRFLPFNWGVLDEFKTR
                     YRIQQYQALIELQRRLESKLKSKEILISFEQSQLTMSNAFKFISRAWSDIPVDTIKAN
                     WKSSGLLPNDMIKLNETVSMAFKKNEALEAKLEKLCNEYHCEKKWDYEMLLDLNIENK
                     NTNFLSTEELVESAIIENYEPDGVDNDAQPSTNEFNAQLPESENTKQFIEGQNGYTHL
                     ESRKNSLNIGDPKSNYNSDFLNLITSGYHANQNSTSSNNDAFTQTNIFDVSTLIDKSN
                     IFMDANDDNIDFNNVNVDLPLGNEEYLNDLFPQSIDVSHTTTKPIDIHDNSAIIEQTF
                     DDLTTGKTDRTNSVEHDDSTNQLDNNVQQILDFYGTSPESHTSSNGLKSVQTSDSSSP
                     LDTIQEGNSLKTDIEIASSLQVLLKHINHNTLKFNKRTVKQLSNTYQELVKKVKKNQN
                     QQKQKPEQFKFEDIFFNNSNSDNPTTNESNYDLALEKTNGGTSQFQVKEVDPFF"
     gene            complement(<984275..>987301)
                     /locus_tag="CAGL0K10076g"
                     /db_xref="GeneID:2890213"
     mRNA            complement(<984275..>987301)
                     /locus_tag="CAGL0K10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448657.1"
                     /db_xref="GeneID:2890213"
     CDS             complement(984275..987301)
                     /locus_tag="CAGL0K10076g"
                     /inference="similar to AA sequence:UniProtKB:P38959"
                     /note="similar to uniprot|P38959 Saccharomyces cerevisiae
                     YDR080w VPS41 required for the vacuolar assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448657.1"
                     /db_xref="GeneID:2890213"
                     /db_xref="GOA:Q6FM87"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016902"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FM87"
                     /translation="MASKPDQIEPTGVKDEVNSTNDMTTRVISRNDLQINNENDVNEN
                     TTDANTNDECMTTVPSTIDESPKDSRIENKDFGSKNNVAFLEDTVSTEDDQISRAANH
                     IGRDESVDTETAESVVLGKVYTDIDKSSPVSEAATNNNNADTSIIETQTSKGDDDKDD
                     EDDEDDLEDEDGEDDEDEEDDEKEDDDDDEDDDGDEPPLLKYSRIKNLFVDLPKRDSI
                     STCCFGETFFAFGTHMGLLHITKPDFSAIKTLKCHRSSILCINIESDTIATASIDGTV
                     IIISMDDLQNLTAYDFKRPVNAVALHSNYSTNKLFISGGMAGDVILTQRNWLGNRSDI
                     ILDSKKGPIMGIFIVDDMLIWMNDDGITICDIPSRTIMLTTKFPIGLEYERPDLFKPF
                     LHKIDTDRFMVGWGRHLWAFKFSKITDPKNESAKLVSLISSAASSLKITPEKNVVLES
                     HHCLDQYLAGIASFKGDQLMCLGFPVSENNDPLKGILPQISIIDLWDASEIYSNDIVT
                     KDYDKSNLNDYHLGVQLNNDINEYYLISKFDYIKIDTLTLKDHYDWYYEKKNYTRAWE
                     VGKVILPPHSLFGLGVKAVNDLIHKKQILNALEMSRRVFDTIDQLHNQELRSDNDLDW
                     GKLYEHFLQISQAYQLSDFLPNSKRIPSQIYEKILSSLIDNNKIEDLKDCIIKWGDKI
                     TNIETIETKLLQLKSAQQTSNSKKELIDSLVSLNLEAKRFSKVIPYMIENKDDRIFEI
                     LVRNKLTSHFLSDITSIILVPLGDKDINKLDIKDLRQILKKSTDFICTSLRTIRLSYL
                     IERLSADTNLSKLKLVVLEEIFTRDPSLLRGNEDTMVELYALCDPPKLLPFLKEYDGY
                     SNTKAIDICKGRKDLYHELIYLLGRVGETKRALSIIIDELNDPQLAIQFVKSWGDQEL
                     LDFMIGYSLDKPDFVIALLQCEDQSGNMHVKVLKGVPENLEIEGIAPILKNMTKEDML
                     EIVSKQILASIVEEDTENYAKDWIKYRKLGRVFDVH"
     gene            <987635..>987856
                     /locus_tag="CAGL0K10098g"
                     /db_xref="GeneID:2890214"
     mRNA            <987635..>987856
                     /locus_tag="CAGL0K10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448658.1"
                     /db_xref="GeneID:2890214"
     CDS             987635..987856
                     /locus_tag="CAGL0K10098g"
                     /note="highly similar to uniprot|Q3E7C1 Saccharomyces
                     cerevisiae YDR079ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448658.1"
                     /db_xref="GeneID:2890214"
                     /db_xref="GOA:Q6FM86"
                     /db_xref="InterPro:IPR009400"
                     /translation="MVRARRGVLLKCDPSIKALIVQIDSERHDIILEELDETHLLVHP
                     TKVEFIKMELNRLLSKNIYNPLDEEEEEH"
     gene            complement(<988255..>988584)
                     /locus_tag="CAGL0K10120g"
                     /db_xref="GeneID:2890109"
     mRNA            complement(<988255..>988584)
                     /locus_tag="CAGL0K10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448659.1"
                     /db_xref="GeneID:2890109"
     CDS             complement(988255..988584)
                     /locus_tag="CAGL0K10120g"
                     /inference="similar to AA sequence:UniProtKB:P38958"
                     /note="similar to uniprot|P38958 Saccharomyces cerevisiae
                     YDR079w PET100 cytochrome-c oxidase assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448659.1"
                     /db_xref="GeneID:2890109"
                     /db_xref="UniProtKB/TrEMBL:Q6FM85"
                     /translation="MKLPFRYTRAQLEIFRFSFCLLAPVAVMYYIGTDTDKKLNVPGF
                     WPDPESLNQIPKEPYEIKAELARMKKERLEKRLKLEKRLKEEFGLDVEAEKAKMREEL
                     GLTSKTE"
     gene            <988919..>989686
                     /locus_tag="CAGL0K10142g"
                     /db_xref="GeneID:2890110"
     mRNA            <988919..>989686
                     /locus_tag="CAGL0K10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448660.1"
                     /db_xref="GeneID:2890110"
     CDS             988919..989686
                     /locus_tag="CAGL0K10142g"
                     /inference="similar to AA sequence:UniProtKB:P38957"
                     /note="similar to uniprot|P38957 Saccharomyces cerevisiae
                     YDR078c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448660.1"
                     /db_xref="GeneID:2890110"
                     /db_xref="GOA:Q6FM84"
                     /translation="MNEDASVINYSEIFSTLVKDDGVDDMVASFLYYMFPRELFIRGL
                     SLLESSDMFIYVFDAMKGESSESEVNTDVDTSVNLSSKENIATSTTATQINAKDNSVD
                     VTKNYLNKLYEDDDLLQYRLIVKSSSSDGIETPVYVDLHNWLCSCEEYTEIMRECLLA
                     DKDLVQEFVQLIDDFSCFRDDTFGQIEAHSLSLQKYVNTKKLLCPHLLAYSIILLSSP
                     KVLRHYTVEKPGVIVIPITSIDEWLKLHINVLYSEKK"
     gene            complement(<990287..>990940)
                     /locus_tag="CAGL0K10164g"
                     /db_xref="GeneID:2890111"
     mRNA            complement(<990287..>990940)
                     /locus_tag="CAGL0K10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448661.1"
                     /db_xref="GeneID:2890111"
     CDS             complement(990287..990940)
                     /locus_tag="CAGL0K10164g"
                     /note="weakly similar to uniprot|Q01589 Saccharomyces
                     cerevisiae YDR077w SED1 abundant cell surface
                     glycoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448661.1"
                     /db_xref="GeneID:2890111"
                     /db_xref="GOA:Q6FM83"
                     /db_xref="UniProtKB/TrEMBL:Q6FM83"
                     /translation="MKFTTAFATLAIASSAVMGQFSNSSIPIDPSTSVPSQNTTTVSS
                     TTTPPTTSSTTTIPAPPPGFNSTTTETEIEVVTAYTTYCPYPTTFTQNGVTYTVTSAT
                     TLTITDCPCTITKPKPHPQPQPQPTTKPAPGPEPKPQPQPQPQPSTKPAPKPDTTTTV
                     RQSVAPHPTTILSTQRSSLAAQPTSSQHVIVTQHVNGAANLAASSVMGLAALLALFM"
     gene            complement(<993120..>994133)
                     /locus_tag="CAGL0K10186g"
                     /db_xref="GeneID:2890112"
     mRNA            complement(<993120..>994133)
                     /locus_tag="CAGL0K10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448662.1"
                     /db_xref="GeneID:2890112"
     CDS             complement(993120..994133)
                     /locus_tag="CAGL0K10186g"
                     /inference="similar to AA sequence:UniProtKB:P38953"
                     /note="similar to uniprot|P38953 Saccharomyces cerevisiae
                     YDR076w RAD55 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448662.1"
                     /db_xref="GeneID:2890112"
                     /db_xref="GOA:Q6FM82"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FM82"
                     /translation="MSFGVPLSQLIVNAPKPISTGLTALDNELDGGFRYKSSYEIYGI
                     PGIGKTWLASETVKTYLQENDDGKVLWITTSGVAPQMLLRSEAEVKERIEYIRITKFT
                     ELLYFYQKQVMSEPDSISQSQSPAESAMPSTGTEAITNDTNSNDSYRLVIIDGLSRLL
                     NLQLHSLSKKNCTTLHDTKCRYLIILMTLITKYNNKNNACHVILNDSMNTTYVPENNG
                     GAEDELEMVEDGFNFFVKSHNYLYENNKRRRVYAPNVIRSALVANNALGNRDSRWEIF
                     IKRRIGIFWEWEDKVTRNLDTECSKKATGNGRCRVALVHKDRQKSSQSLNFSVVPFDI
                     DLD"
     gene            complement(<994696..>995625)
                     /locus_tag="CAGL0K10208g"
                     /db_xref="GeneID:2890113"
     mRNA            complement(<994696..>995625)
                     /locus_tag="CAGL0K10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448663.1"
                     /db_xref="GeneID:2890113"
     CDS             complement(994696..995625)
                     /locus_tag="CAGL0K10208g"
                     /note="highly similar to uniprot|P32345 Saccharomyces
                     cerevisiae YDR075w PPH3 protein ser/thr phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448663.1"
                     /db_xref="GeneID:2890113"
                     /db_xref="GOA:Q6FM81"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /translation="MLVDLDEILVSLKEGRHIPEETVYALCMDSQELLMNESNVARVD
                     TPVTICGDIHGQLHDLLTLFEKSGGVEKTRYVFLGDFVDRGFYSLESFLLLLVYKLRY
                     PDRITLIRGNHETRQITKVYGFYDEVMRKYGNSNVWRYCCEVFDYLSLGAIINDSIFC
                     VHGGLSPDITTLNEIRAIDRKQEVPHEGGMCDLLWSDPDEVDTWSMSPRGAGFLFGKG
                     EVDEFLHVNNVDLIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIEDN
                     LERKYTIFEAVQAQNGVGNTIIPTKKAQMDYFL"
     gene            complement(<996303..>997643)
                     /locus_tag="CAGL0K10230g"
                     /db_xref="GeneID:2890114"
     mRNA            complement(<996303..>997643)
                     /locus_tag="CAGL0K10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448664.1"
                     /db_xref="GeneID:2890114"
     CDS             complement(996303..997643)
                     /locus_tag="CAGL0K10230g"
                     /inference="similar to AA sequence:UniProtKB:P38439"
                     /note="similar to uniprot|P38439 Saccharomyces cerevisiae
                     YOR123c LEO1 extremely hydrophilic protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448664.1"
                     /db_xref="GeneID:2890114"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:Q6FM80"
                     /translation="MSEEEKHNMSEEQVELAPEEPPKEEAEDSVEDGKDQEETMPEKE
                     EEMDDLFGDDEDDEDEEEITTGRGRNGTTGISDDEEDDDEEGITRRSREREDYDMEDY
                     DDEAKEQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIF
                     YAKVPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQ
                     HVFKESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEIT
                     KTMMFIPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIR
                     ERRKRQQKEIETRENAENGFAETGEFKRGNTPSRSSRQNEYEDDGFLVDDEDEEDFID
                     DGEEEEEEEEDDDLDADRLRNAKRQGEHAFTEDDDEEDDNKRRKTAIISSEEDD"
     gene            complement(<998144..>1001947)
                     /locus_tag="CAGL0K10252g"
                     /db_xref="GeneID:2890115"
     mRNA            complement(<998144..>1001947)
                     /locus_tag="CAGL0K10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448665.1"
                     /db_xref="GeneID:2890115"
     CDS             complement(998144..1001947)
                     /locus_tag="CAGL0K10252g"
                     /inference="similar to AA sequence:UniProtKB:Q01476"
                     /note="similar to uniprot|Q01476 Saccharomyces cerevisiae
                     YOR124c UBP2 ubiquitin-specific proteinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448665.1"
                     /db_xref="GeneID:2890115"
                     /db_xref="GOA:Q6FM79"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FM79"
                     /translation="MRMNDDAVTGMGVHFGGDPPEADLQGEPIPSADVTNIEDDGRQL
                     LYPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNKSILNSNTLEYSKQRPHIKGSAVGF
                     FQDQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISEVTEIPIYHVKI
                     SVKVRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSALYATDDTNKI
                     VLIEIYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFK
                     GPLKRKSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNENIPGGEYMAPDLVNYL
                     GDPNIQKLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFS
                     WLQLLGDFKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDI
                     IQNYERLITLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGI
                     DYTKVTLESLDENLLLSVYKHEWKENPDNNRISDLKNALRLLAKYFTSDYLKFYVDYE
                     PYRIIQKAYDLLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLF
                     NFLFDQCPEFQRYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEPDQL
                     LKYRAALTKIALERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQFY
                     FAISPLREYIVQYQKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYN
                     DMIFSSQRCVTPKRELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPSTG
                     ENIDHNMDIEQEERNNEEINSTNNIESNDLVSNNHDIEMLDTDKENEGNMEIEDTAIK
                     VAKIDPEQLENALELGRQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGE
                     TNQHIKPLKADSVTRTKVERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVKR
                     ELAIKKFPTILQIQIQRVYYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKRE
                     ETAELKRQLRSFKERQKELLSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLL
                     ATKLEESASKVADELSDLYVKITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHY
                     WVYIKDFVNSIWRKYNDETVTEVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKR
                     MIEKN"
     gene            complement(<1002502..>1003200)
                     /locus_tag="CAGL0K10274g"
                     /db_xref="GeneID:2890116"
     mRNA            complement(<1002502..>1003200)
                     /locus_tag="CAGL0K10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448666.1"
                     /db_xref="GeneID:2890116"
     CDS             complement(1002502..1003200)
                     /locus_tag="CAGL0K10274g"
                     /note="highly similar to uniprot|P41735 Saccharomyces
                     cerevisiae YOR125c CAT5 involved in coenzyme Q
                     (ubiquinone) biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448666.1"
                     /db_xref="GeneID:2890116"
                     /db_xref="GOA:Q6FM78"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:Q6FM78"
                     /translation="MMIRNTVTKSSKRSFSVLSSLKATEQSSSKTKSTKEVKYENLSE
                     AQRAYLSRVIRVDQAGELGANYIYAGQYFILANKYPHLKPVLKHMWEQEIHHHNTFNN
                     LQIKNRVRPSLLTPFWKVGAFAMGAGTALISPRAAMACTEAVETVIGGHYNEQLRCLN
                     NQYNLDKSDNSGVGQTEEVKSLIANIKQFRDDELEHLNTAIEHDSHLAVPYYLLTESI
                     KGICRVAIWGAERI"
     gene            complement(<1003568..>1004314)
                     /locus_tag="CAGL0K10296g"
                     /db_xref="GeneID:2890117"
     mRNA            complement(<1003568..>1004314)
                     /locus_tag="CAGL0K10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448667.1"
                     /db_xref="GeneID:2890117"
     CDS             complement(1003568..1004314)
                     /locus_tag="CAGL0K10296g"
                     /inference="similar to AA sequence:UniProtKB:P41734"
                     /note="similar to uniprot|P41734 Saccharomyces cerevisiae
                     YOR126c EST2 isoamyl acetate hydrolytic enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448667.1"
                     /db_xref="GeneID:2890117"
                     /db_xref="GOA:Q6FM77"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:Q6FM77"
                     /translation="MLQVKKLLLFGDSITQFSCGRCESVEEAGRIDGFSLGSGLGAVY
                     NRKLDVVTRGFSGYNTRWCLPVLDAVLDAELQGQNEVALSVIFFGSNDSVSDGPQRVP
                     LEEYCQNIVKMVGKMKAAKIKTVLVTPARVDKQQWSHHFAEDAKVGYVRSDALYKEYR
                     DQLLKIGEQEGIPVVDLYTEFGKHDVSSLLTDGIHFSSEGYRVFFLALMKTIRENLPE
                     LAPENLPWHLPYWRDVTEDPTSVIAALNKY"
     gene            <1004753..>1007506
                     /locus_tag="CAGL0K10318g"
                     /db_xref="GeneID:2890118"
     mRNA            <1004753..>1007506
                     /locus_tag="CAGL0K10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448668.1"
                     /db_xref="GeneID:2890118"
     CDS             1004753..1007506
                     /locus_tag="CAGL0K10318g"
                     /note="weakly similar to uniprot|Q06407 Saccharomyces
                     cerevisiae YDR379w RGA2 and weakly similar to
                     uniprot|P39083 Saccharomyces cerevisiae YOR127W RGA1
                     GTPase-activating protein for the polarity-establishment
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448668.1"
                     /db_xref="GeneID:2890118"
                     /db_xref="GOA:Q6FM76"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FM76"
                     /translation="MSVSVDSVISGDSKELPVCVKCKEPITTGHAYELGYDRWHIECF
                     ACHKCDRLLTCDSDFLVLGTGALICFDCSDSCKSCGKKIDDLAIILSSSNEAYCSDCF
                     KCCKCHENIQDLRYAKTKKGLFCLHCHEKLLAKRRTYDEKKRKLLEKKNLPKIPKITD
                     DDVESPSLNPIMKSRQTDDDMKKSSSSLEIPKRSVNRPRSAIRDAQIMKENGLVKSTS
                     DSIITHYLDVDETKENESKDVIDKSSSRKNSAVSEKQLLSPNRPAHLRKSSLSAPAEE
                     FYTATEFQSPLRNNIIRSPLRDQSQKSPFRGSKTDILLKSPKSHRRGMVLDTDDENSP
                     ESFNILDCFDPSDGSSLMAPPIVGSSNHTSLGNSESPRTFPTSLTKELSNDKLRNDKS
                     AVMEGIVNGELDTSSIHSFEGEQDNLKNEDDKGHSQDNVLSKGRIGELNLNSSRLGNS
                     DSDSLYEGSKQYNSSSEILKQNGSLSKPPLNHDRDYNDSDYFYEKEIKREIMRSEMHL
                     RKLRHEVDVYRNKKKKYQKEIDEMKLARKELKLSLDNLQQEWNQLRAQIDESIIDHND
                     EDLSMISEARGKGTQPELAEVASVARTSNSKPRFWKLFSSSKETVIPPLISQPMQFPM
                     QAVNYGINSTSAMFSLGSNSDDNPLKLDISHPVLKNVNEFDDLKLISLQNTNDQSMAN
                     RSSSPITSDGSKLYGSSLAARAQFEGNSIPFIIRACISFIESSDEFLTSEGIYRKSGS
                     QLRIEELEKKFADYPVNKDSVEAPPPRFLEDQDIHTVTGVLKRYLRKLPNPVLTYQVY
                     EPLISLVRDENLIEALPLINSKMTTESKSSERYFFMVETIRKILLNIPESHFDVLRLL
                     SKHVCKVSSYSSINLMTIRNLALIFAPNLLRDYTGMKEIEDMREKDYLMTFLFTYHEE
                     ILH"
     gene            complement(<1007620..>1009332)
                     /locus_tag="CAGL0K10340g"
                     /db_xref="GeneID:2890129"
     mRNA            complement(<1007620..>1009332)
                     /locus_tag="CAGL0K10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448669.1"
                     /db_xref="GeneID:2890129"
     CDS             complement(1007620..1009332)
                     /locus_tag="CAGL0K10340g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448669.1"
                     /db_xref="GeneID:2890129"
                     /db_xref="GOA:O74197"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /translation="MDSRTVGILGGGQLGRMIVEAANRLNIKTLILDAPNSPAKQITN
                     ASDHVDGSFANKEDIEALAAKCDVMTVEIEHVDVNALKEVQKQFPKLEIYPTPETIGL
                     IQDKYVQKQHLVKNRIPVVPSITVENSKESLIKTGSSLGYPFVLKSRTLAYDGRGNFV
                     VKSEEDIEKGLEFLANRPLYAEKWASFKKELSVMIIRSLDGRVYSYPIVETIHKNNVC
                     HLCYVPARVPDSVQHKAKLMAENAIKSFPGCGIFGVEMFLLDDDSIVLNEIAPRPHNS
                     GHYTINACVVSQFEAHLRAILDLPMPKNFTSLSTNSTNAIMLNLLGDPETKDKELQIC
                     ERALNTPGASVYLYGKESKPNRKVGHINIVCSSMKECDKRLQFIMGLKTDPIKHSVME
                     ILNAEEVRKPLVGVIMGSDSDLPVMSAACKMLEQFEVPFEVTIVSAHRTPYRMNKYAS
                     EAVSRGIKVIIAGAGGAAHLPGMVAAMTPVPVIGVPVKGSTLDGVDSLHSIVQMPRGV
                     PVATVAINNSTNAGILAVRMLGIHNYDYVKKMEEFLNKQEEEVLQKAAKLESIGYEKY
                     LESK"
     gene            complement(<1009984..>1010889)
                     /locus_tag="CAGL0K10362g"
                     /db_xref="GeneID:2890119"
     mRNA            complement(<1009984..>1010889)
                     /locus_tag="CAGL0K10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448670.1"
                     /db_xref="GeneID:2890119"
     CDS             complement(1009984..1010889)
                     /locus_tag="CAGL0K10362g"
                     /inference="similar to AA sequence:UniProtKB:Q12375"
                     /note="similar to uniprot|Q12375 Saccharomyces cerevisiae
                     YOR130c ARG11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448670.1"
                     /db_xref="GeneID:2890119"
                     /db_xref="GOA:Q6FM74"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FM74"
                     /translation="MSGAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQ
                     GRHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYT
                     NVSDLTNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRI
                     IPTIQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPN
                     DNKTWELLASGASAGLAFNASIFPADTVKSMMQTEHLGLKTAIKKIFVEKGLRGFYRG
                     LGITLIRAIPANATVFYVYETLSKL"
     gene            complement(<1011380..>1017694)
                     /locus_tag="CAGL0K10384g"
                     /db_xref="GeneID:2890091"
     mRNA            complement(<1011380..>1017694)
                     /locus_tag="CAGL0K10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448671.1"
                     /db_xref="GeneID:2890091"
     CDS             complement(1011380..1017694)
                     /locus_tag="CAGL0K10384g"
                     /inference="similar to AA sequence:UniProtKB:P34756"
                     /note="similar to uniprot|P34756 Saccharomyces cerevisiae
                     YFR019w FAB1 phosphatidylinositol 3-phosphate 5-kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448671.1"
                     /db_xref="GeneID:2890091"
                     /db_xref="GOA:Q6FM73"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q6FM73"
                     /translation="MAIGQGTLPKDDQIEYNNEAGGTSTISEPIDLITRTGLVPKTTT
                     TTEITTEDILSNDITVPRVNDKSSNQLINDEMENHSYKESLSVNKLPHELNDNADHMD
                     IKSKNIEPINTIVIPDTSNFLPISNDIDKQEYISDPTSDKEEPPVESNTFLRSERNGE
                     ITSNDLRSELRVDKNIQLRASPNQNKTLLFALANDMNSKRSSTYASKSTVKAIPIRNH
                     SSHSMARGFNSYYDNDDVSSLKSRSSSMAASFSKGFLLGFYNNRNKHANNQKVVLSKE
                     YWMKDESARECFTCGKRFNTFRRKHHCRICGQIFCKNCTLIINGERFGYDRSLRVCQN
                     CYKHADNYQDSSDEEYYEEENSVITREPSTNLMNEHLSKKEEQDSMNDFNIQEEGDSS
                     IFNTPNKNNEVLFIHDDDVHSIITSKQDSKLFISTPPPPPKMAIPATKQGESLEIAFN
                     NNLVNRNSNKTISHDGNNEKITIRDLDDPTSYKPNEKKNPNSTPSLRRSLFQYMGKTN
                     RDQANNHMPSNPLPDSSLLNNRNFQFKFNFRPELYNERRKSFGADKFNSNENKNAINV
                     SQSPKLSLEYDNNDLEDEASMSLYSSLHGSIPTDKPIGFVRTSSKSDQRAMASLHRIR
                     HKRTGKSKSISMTYPSNLDSDFISQSSPNLLSVVSDELPLPQPTSILYRTGWDKASTG
                     TNNAWKRHSSLTSVRPSAEPKPELNKVAQIHLNSLLDQVLGDQDIADKELWKNKLLSL
                     LSQIQNIILSAKDLNTLDYRQNYLKIKRITGGSIDASEYINGIVFSKNLPNKHMSRKI
                     ENPRILLLMFPVEYERSENKFLSIDSVIAQEKEYLNKLVSRILSLSPDIIYVGANVSG
                     YALDLFCNAGIVIQYNMKPQVLERIAKYTDADIALSIEKLATNIKMGECQLFEVKSYL
                     YDKHISKTYTFLRGCEPTLGGTILLRGANETVLRKIKQIVEFMVYATFSLKLESSFFN
                     DNFLQLSVEHYLLAKTESKNQQPEGYYSDFVEKFNNRLLSVSPTVSFPLPFLLKQARN
                     LERELRLLEDQESTVHAAKEEYQIGLLSDISNKLTKMELVNLGRYIMEKEIQDLKNEY
                     KKRARQWEVYYSLTRNMLGTGSHQSITVLYSMVSIKTATPCIGPQLMTIDYFWDSDIS
                     VGQFIENIVSTAWHPCKQGCNTYLFDHYRSYVHGDGKVDVMLERFETKLPKLRDIILT
                     WSYCKKCGCSTPILQISQKTWNYSFGKYLEIMFWSERHSLLGVGKCGHEFTKDHVKYF
                     SYNDLVVRLEYSDLEIHELITPSRRIRWKPNRDIIMKVELYYGILDKINYFYSNVSER
                     LDRIKLDGLVVDKMEPGKQKLNEMKIMLENNKRNLLEKLEKQYKDTPGTEHLHLNSIL
                     RSLYNQTNFWNNEFKEFGETYLPSENDITRITTSQLKKIFGEPKKPDLIPESTHLNVS
                     DRSNELERISESQSFISESKEDSVDNNRAAERINALREHTKKPSISTSMINLSKHDQP
                     SFIEHSVPPTTYNDSGYDSRVGKLTNFFDQLHFDALTKEFELERELQKLQLNKSKSRK
                     FRLQNSTPIVEIYKDVKDAVDEPLHNDEKIQNDDSNEVESVDYSNSSKAHRSTQQKKV
                     SEMLESELKNSINRWGEAYINSDSNLASMEHLEKKGETDITKDNNKILDTDQKSVEVA
                     PQPEKSTLMKTLATFWADRSAYLWKPFSFPIGANEHVFTDSDVIIREDEPSSLIAFCL
                     STSDYNNKMASIKDDTDVAPVEKVVNNQDHKKSSNQQNISDSSEKTHANSNIESVNET
                     SSVLTEEKASVSDKYFDPAKNLEAIMTKKTAIHLRYQFEDGLVVMSCKVFFAEHFEAF
                     RKICNCDENFIQSLSRCVKWHSNGGKSGSGFLKTLDNRFVIKELTHSEVDSFIKFTPS
                     YFEYMAQAMFHDLPTTLAKVFGFFQIQVKNPISGSKNYKMNVIIMENLFYNKKTSRIF
                     DLKGSMRNRHVEQTGKANEVLLDENMVEYIFESPIHVREYDKKLLRASLWNDTLFLAK
                     MNVMDYSLVVGINNDDYTLTVGIIDFIRTFTWDKKLESWVKEKGLVGGGNSIMKQPTV
                     VTPKQYKNRFREAMERYILMVPDPWYQDTN"
     gene            <1018029..>1019090
                     /locus_tag="CAGL0K10406g"
                     /db_xref="GeneID:2890092"
     mRNA            <1018029..>1019090
                     /locus_tag="CAGL0K10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448672.1"
                     /db_xref="GeneID:2890092"
     CDS             1018029..1019090
                     /locus_tag="CAGL0K10406g"
                     /inference="similar to AA sequence:UniProtKB:P43599"
                     /note="similar to uniprot|P43599 Saccharomyces cerevisiae
                     YFR018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448672.1"
                     /db_xref="GeneID:2890092"
                     /db_xref="GOA:Q6FM72"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6FM72"
                     /translation="MQLFNSWLLFCLAVVLASKGNDYGIHHLDYHIDNLQEKLTINRK
                     EYRKHVKSNLIVPFNSTRIPGSTEAIKIQDFIIHNFNQSMWNVEIDNFTEKDYNFTNL
                     VFTFEPDEDFADDDYIVLAAHYDTMILPEGFVGAMDSAASCAILLYIGQFLEYVHGTD
                     DQLFDPILKNASKGIKLIFFDGEEALVEWSDDDSIYGSKHLAAKWEKSGQLKDIHLLA
                     LMDLIGGRDRLPIPSYFRNSHEYYKMLSDIEHSYLQLIKDETQDVKPLRNLGYAKRKS
                     LNINDDRFLIHDKNFMGDDHVPFYEKNVPILHLIPSSFPSTWHTINDDFRHLDQQTIY
                     KWAVMMSEFIIRSVESDTQ"
     gene            <1019646..>1020206
                     /locus_tag="CAGL0K10428g"
                     /db_xref="GeneID:2890093"
     mRNA            <1019646..>1020206
                     /locus_tag="CAGL0K10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448673.1"
                     /db_xref="GeneID:2890093"
     CDS             1019646..1020206
                     /locus_tag="CAGL0K10428g"
                     /note="weakly similar to uniprot|P43598 Saccharomyces
                     cerevisiae YFR017c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448673.1"
                     /db_xref="GeneID:2890093"
                     /db_xref="GOA:Q6FM71"
                     /db_xref="UniProtKB/TrEMBL:Q6FM71"
                     /translation="MSQLEQASVTMNSSLEFINMQNPPPPKDSPYLAYIDKGCGESPT
                     NIKSVPYPTRRRSTNYVNTLRDKGLLREMEEVRTDVDKVSSKGDNNYTYGNLTSMSQQ
                     DMKHESSKYFMAGSSHIPPQFDKLVYMGDSIDYDGPRRQYMEAEDAMDPLYKGYNGKV
                     YKRRPSFQYEDFKKDVYDKLHIFNDN"
     gene            1020559..1020629
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0K10450r"
                     /db_xref="GeneID:2890094"
     tRNA            1020559..1020629
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0K10450r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2890094"
     gene            <1020845..>1023103
                     /locus_tag="CAGL0K10472g"
                     /db_xref="GeneID:2890095"
     mRNA            <1020845..>1023103
                     /locus_tag="CAGL0K10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448674.1"
                     /db_xref="GeneID:2890095"
     CDS             1020845..1023103
                     /locus_tag="CAGL0K10472g"
                     /note="highly similar to uniprot|P43535 Saccharomyces
                     cerevisiae YFR009w GCN20 positive effector of GCN2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448674.1"
                     /db_xref="GeneID:2890095"
                     /db_xref="GOA:Q6FM70"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FM70"
                     /translation="MASIGTQVRKTCTSVDPIVTDYAVGYFNHLSGLTFDAVMSKQLD
                     LDSEVQFVSEMLVSAGADKEKVKDLSANILEQLNTQLKENASKLELTGDTSKRLLDIN
                     VLKSHNNKANLNASLSLLGVGGDIEHAGRQMETRVDLKKLAKAEEKIAKKVAKRNNKF
                     VKYEASKLIGERKDEDYDSFFLEINPLDFGSSAGKSKDIHIDTFDLYVGDGQRILSNA
                     QLTLSFGHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSV
                     LDADVWRKQLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEK
                     LVDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLD
                     EPSNMLDVPSIAYLAEYLKSYPSTVLTVSHDRAFLNEVATDIIYQHNERLDYYRGQDF
                     DTFYTTKEERRKNAQREYDNQMAYRKHLQEFIDKFRYNAAKSSEAQSRIKKLEKLPVL
                     EPPEQEKSIDFKFPDCEKLSPPIIQLQDVSFGYSPDKLLLKDVNLDIQMDSRIALVGA
                     NGCGKTTLLKVMLEQLRPLSGYVSRNPRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPG
                     KTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLD
                     TTGIDALVDAMKNFTGGILMVSHDISVINNVCKEIWVSEKGTVNRFNGTIYDYRDYIL
                     SAADAAGVVKRH"
     gene            <1023698..>1025185
                     /locus_tag="CAGL0K10494g"
                     /db_xref="GeneID:2890096"
     mRNA            <1023698..>1025185
                     /locus_tag="CAGL0K10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448675.1"
                     /db_xref="GeneID:2890096"
     CDS             1023698..1025185
                     /locus_tag="CAGL0K10494g"
                     /note="highly similar to uniprot|P43593 Saccharomyces
                     cerevisiae YFR010w UBP6 ubiquitin-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448675.1"
                     /db_xref="GeneID:2890096"
                     /db_xref="GOA:Q6FM69"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FM69"
                     /translation="MSNDTFSFNIKHAGKVLPITLSNDATALDLKTQVEELTQVPRSR
                     QKFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQ
                     QFNSTPLGLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVL
                     ELKRTFETLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHT
                     LTVVFGDKFANQFQINFRATIKDTANEDDVTVREDESDMKLQCHISGTTNFMKNGLIE
                     SLNEKIEKRSDITGLNSTYAVQKQITKLPKYLTVQYVRFFWKRSSGKKSKILRKVVFP
                     FQLDVADLLTPEYANEKIKVREELREVEKAKNEKEREAKKRKVEQTDVVMTPKEEYET
                     KKALEESEREYWLNEFKKRFPSNLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRD
                     ESDENKWYKFNDDKVSPIEKEKIEALAGGGESDSALILLYKGFGL"
     gene            complement(<1025428..>1025913)
                     /locus_tag="CAGL0K10516g"
                     /db_xref="GeneID:2890097"
     mRNA            complement(<1025428..>1025913)
                     /locus_tag="CAGL0K10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448676.1"
                     /db_xref="GeneID:2890097"
     CDS             complement(1025428..1025913)
                     /locus_tag="CAGL0K10516g"
                     /inference="similar to AA sequence:UniProtKB:P43594"
                     /note="similar to uniprot|P43594 Saccharomyces cerevisiae
                     YFR011c ochre suppressor tyr-tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448676.1"
                     /db_xref="GeneID:2890097"
                     /db_xref="GOA:Q6FM68"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="UniProtKB/TrEMBL:Q6FM68"
                     /translation="MGAQASKSTDPVAPTLFTPQSKIEFSQALLSQLEDVSEMDYSRK
                     EYAEKCIEQKISSRLSELEVETLRKFKDTLNDSMQTDSDDGSNKNTACTGKLNEKLTD
                     LSQKLEAFKKLEEDKKQKFGLEEKEGPRAKLTECLIKNKGKPLNCVDEIAAFKEFMDS
                     K"
     gene            1026436..1026523
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0K10538r"
                     /db_xref="GeneID:2890098"
     tRNA            join(1026436..1026475,1026487..1026523)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0K10538r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2890098"
     gene            <1027333..>1029588
                     /locus_tag="CAGL0K10582g"
                     /db_xref="GeneID:2890099"
     mRNA            <1027333..>1029588
                     /locus_tag="CAGL0K10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448677.1"
                     /db_xref="GeneID:2890099"
     CDS             1027333..1029588
                     /locus_tag="CAGL0K10582g"
                     /inference="similar to AA sequence:UniProtKB:P43596"
                     /note="similar to uniprot|P43596 Saccharomyces cerevisiae
                     YFR013w IOC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448677.1"
                     /db_xref="GeneID:2890099"
                     /db_xref="GOA:Q6FM67"
                     /db_xref="UniProtKB/TrEMBL:Q6FM67"
                     /translation="MNSDETNGVGEASTTSPLSNDSNNQASSSMHNQNDPTTEYGFGL
                     RRSARERVPRKRDIYEIDPSVYLPKKKKPKSKATKKVVASKSKDAKAKNAKVKPQQSD
                     KSKVKKSSTPKPPVRTPEIPIPVVNNKDWTANIPLYNSELRNQNAKISRLKNENMKAV
                     PYAGDILKIMSFVNKFNYFFVNELQSLSFQDFEIGLDLYPDPLINTGKEIQRLYADYI
                     PVKEVVGCQDKMNLLLLTIMDLLFRPVETEREPQVEWSDLKSTSKKTFQSYIEKIRLY
                     APEWGYPKEWRKNISTETLMKPASSTFEKDDIGPAVDQKHKEILTPNIYQWPANEPID
                     IDQDPLQTKGLQRTGILALEAKDRIVFLRTLVDWCCSYSPLLHHEIYILTHYKRDPPF
                     GIQTKHVPRYLLQGLDETFSYYKKLCNLVQSRLEIRSKKKHVKKQMKEGKNDEIVHRL
                     EILQKLKTQMKGKTEDEKLKLMIENYEDWEKVFKGETPENPLSNPYEDKIYKLRSEEF
                     FIGRVPHVGDFYLPRMQTYEYMSSMNTYTDLKTLDNIFNTFESKKYNPFTLFENDSPF
                     MSSNFKILFHDKIALIQDVISGADMTEKNYWYEMCYDSETLLKFIDFIDQKIQQPSTA
                     EPEKEEIRSENGDPSSLINGVSTKSDVSPTSGQNTKKKQEKSEESSKDASKINPLPKN
                     PQFNSSRRKFAMLQTYLRRIQPILAEFEEMKTKFGDINPTKRQSRRSQRREINYKIEN
                     SDDEYAMEDSE"
     gene            complement(<1030055..>1031395)
                     /locus_tag="CAGL0K10604g"
                     /db_xref="GeneID:2890100"
     mRNA            complement(<1030055..>1031395)
                     /locus_tag="CAGL0K10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448678.1"
                     /db_xref="GeneID:2890100"
     CDS             complement(1030055..1031395)
                     /locus_tag="CAGL0K10604g"
                     /inference="similar to AA sequence:UniProtKB:P27466"
                     /note="similar to uniprot|P27466 Saccharomyces cerevisiae
                     YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
                     kinase type I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448678.1"
                     /db_xref="GeneID:2890100"
                     /db_xref="GOA:Q6FM66"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FM66"
                     /translation="MEELCDIPNESLEALKIEACTTTTTRVCDLEVEENKFNVVVEDE
                     EKIICESEEVVQDMDHKKAGYLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALE
                     KNGGLEPIYDELNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKY
                     TEEDAVNIVVQILKAVEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLEN
                     DDDVIYRPAGSLGYVAPEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLD
                     EVTSDENPVKFQRPYWDGISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLRT
                     DLYHNMRKNLSAKKKLQKAVELIKLNQRIKKLRQLYLLANETDSDLEEEERSSSASLS
                     SLPSSQSSLSLSNEYGSKSKREQDEFISSLRQQTLAQIIKVATVNKDTVRKFEK"
     gene            complement(<1032533..>1034623)
                     /locus_tag="CAGL0K10626g"
                     /db_xref="GeneID:2890101"
     mRNA            complement(<1032533..>1034623)
                     /locus_tag="CAGL0K10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448679.1"
                     /db_xref="GeneID:2890101"
     CDS             complement(1032533..1034623)
                     /locus_tag="CAGL0K10626g"
                     /note="highly similar to uniprot|P23337 Saccharomyces
                     cerevisiae YFR015c GSY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448679.1"
                     /db_xref="GeneID:2890101"
                     /db_xref="GOA:Q6FM65"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:Q6FM65"
                     /translation="MPRDLQNHLLFEVATEVANKVGGIYSVLKSKAPVTVAQYQDNYT
                     LIGPLNKGTYQGEVEELDWEDPSIFSEELQPVQQALKYMREKGVYFVYARWLIEGAPR
                     VILFDLDSVRYKLNEWKADLWSLVGIPSPENDWETNDAILLGYTVVWFLGELTQLDHK
                     HAIIGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGDVDFYNHLQYFDV
                     DQEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKF
                     QAVHEFQNLHALKKEKINDFVRAHFHGNFDFDLDNTLYFFIAGRYEYKNKGADMFVEA
                     LARLNYRLKMAGSKKTVVAFIIMPAQNNSFTVEALRSQAVVKSLENTVNEVTSLIGKR
                     IFEHAMKFPHNGITNEIPNNLEELLKPSDKVLLKKRVLALRRPYGELPPIVTHNMADD
                     ANDPILNQIRHVQLFNNHSDRVKVIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYY
                     EPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIETNQAKDYGIYIVDRRYKAPDESVE
                     QLVDYMEEFVNKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLGLRRAYPDQFKE
                     IVGEDVNDSSMEALAGGKKLKIARPLSVPGSPRDAAKSPSTVFMTPGDLGTIQDANNV
                     DDYFHLSVNDNEEE"
     gene            complement(<1036025..>1039063)
                     /locus_tag="CAGL0K10648g"
                     /db_xref="GeneID:2890102"
     mRNA            complement(<1036025..>1039063)
                     /locus_tag="CAGL0K10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448680.1"
                     /db_xref="GeneID:2890102"
     CDS             complement(1036025..1039063)
                     /locus_tag="CAGL0K10648g"
                     /note="weakly similar to uniprot|P43597 Saccharomyces
                     cerevisiae YFR016c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448680.1"
                     /db_xref="GeneID:2890102"
                     /db_xref="GOA:Q6FM64"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FM64"
                     /translation="MSDVETSKMDTSNNGGKEMDLDQMINATEQLLSEAPKTTTKKKK
                     NKKKKKKKVTTTDSKPVVDTVADPEQQIPTEDKPGKDIDESVSETGDTIPEKIDAQKV
                     SDLDSSSGNLAIERKPKKKGSKQSRPVSLSKLERDSIKRKSSDLDSILVGIEEYLQTD
                     EDINVNVVDGSAVPNGRDSSSDTSKASKNLKKKPVVKGMKRSNTAKQSLSSKIVESSA
                     ESASDANKVVGTHVEETNAYEPIDKEAKPLTEKTADEKNESISNELATEKEQSPSTAV
                     LSDDLKKNQDNVQGEKQSIEKGSKADADILIKPETNSKLVKDAVIANESDADKKSISD
                     TTIKEIGESNAEIKEKQTTQSRSEKEIISLTAEENNNKVTISDTIPDLNDDTMKAASP
                     NIDEIKSVQQESYDSKSKETKSEPEEQEEDMNKGQLEPENKVSSSPSSSKKQALKEPA
                     LESETEQEHEGNLLPTGNKTDVLEENLETVSAVKPSLADVNKDLPLKEGVNHGKTVDV
                     QELHTTSKPIEELSQAESPKKTSLDAMKKEDKLKDSRKTESTIEAHLDNRINEKSEAE
                     EVGDDGPVDKKSEDLKDTPEKSLSTEAVTQSPKVHNVNEVSKVNEEEDKAAESLTVDK
                     AGAENSHKPSNLKVLEAKDTLSDTMNETKQDETMDKEPKSTAKLIKLNDEVDEEASTL
                     ADDVSDLTEEKLKVKDNVMHTTAEIPNNDAQTDSDLPKEKEDLNEFNEDKNNEDPVKK
                     GDGDVLSKIMTENNETPEKRVVISILDDLPSRHDNGNEKETHDTVPKIDLESKLKEAL
                     DEIETSDVSVPTVDPKKDVKETADEIEGLDLGDQEEKEPEEHKHSADVQSPSDNVTAK
                     NSGGIQDILDETDKLLEELNFVDDSEINALLDSFDKPASKKKAVVKETPQNTIKASDI
                     IKANEELPVYIYTSLAGGGFHMIPRTNRLSTILTANRIKFEYRDLGTDDEARKVWKTY
                     GRGRTLPGVVRGRDDIIGNWEEIEEVNENYGLRDLIYNSI"
     gene            complement(1039465..1039535)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0K10670r"
                     /db_xref="GeneID:2890103"
     tRNA            complement(1039465..1039535)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0K10670r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2890103"
     gene            <1040242..>1041759
                     /locus_tag="CAGL0K10692g"
                     /db_xref="GeneID:2890104"
     mRNA            <1040242..>1041759
                     /locus_tag="CAGL0K10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448681.1"
                     /db_xref="GeneID:2890104"
     CDS             1040242..1041759
                     /locus_tag="CAGL0K10692g"
                     /inference="similar to AA sequence:UniProtKB:P43601"
                     /note="similar to uniprot|P43601 Saccharomyces cerevisiae
                     YFR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448681.1"
                     /db_xref="GeneID:2890104"
                     /db_xref="GOA:Q6FM63"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MPNKAVSIYYLNFNQTGTCISMGTSNGFLIFNCAPFGKFYSEDS
                     GGYGIVEMLFSTSLLALVGIGDQPMLSPRRLRIINTKKHSIICEVTFPTKILSVKMNR
                     SRIVVVLKEQIYIYDINNMRLLHTIEIAPNPEGLVALSCNTDTNLLAYPSPPKVISSD
                     INPNVNTNTINIARSKSEELIANSKDNNLQNKFGTTLEGQQNIDEDKAANGYQVDQNT
                     DTAENDINSGDVIIYDMSTLQPLMVIEAHKGEIAALNFSFDGSLIATASEKGTIIRVF
                     STSSGAKLYQFRRGTYPTKIYSLSFSQDNRFLSVTCSSKTVHIFKLTKTGEERTSGGA
                     DDADSDDSGNENDGDNNSVGNGDVSSLLSDNDIESTREPYVDASRKTMGRMIRNSSQK
                     LSRRAAKTLGQLFPIKVTSILEPSRHFASLKLPTDSNISGNVKTLCSIGNEMEVDKVE
                     YPELFDGQDQGDRTKVTMLPIRVISSEGYLYNYVLDPERGGDCLLLSQYSTAIDQ"
     gene            <1042853..>1044970
                     /locus_tag="CAGL0K10714g"
                     /db_xref="GeneID:2890105"
     mRNA            <1042853..>1044970
                     /locus_tag="CAGL0K10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448682.1"
                     /db_xref="GeneID:2890105"
     CDS             1042853..1044970
                     /locus_tag="CAGL0K10714g"
                     /inference="similar to AA sequence:UniProtKB:Q02805"
                     /note="similar to uniprot|Q02805 Saccharomyces cerevisiae
                     YOR018w ROD1 or uniprot|P43602 Saccharomyces cerevisiae
                     YFR022w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448682.1"
                     /db_xref="GeneID:2890105"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6FM62"
                     /translation="MTSPDQELLFDIQVDNDRDGGVVLLKGCPDEAASVLLSGNIMLS
                     VKEPIRIKNLSLKLCGKLKLRLPDTNNKRERYYRKVFFEHEWNSFDIHGCTTSSYNSI
                     GPNGSLVHGANDDQNKTMKSLVCRGAKSTTSLHNMAFDSTSSKYYTLIKGNYELPFNI
                     VLPGTLPESIEGIPGVLLTYNLIANLEQMNPTATILCQKHLRVIRTLSADTVELSESV
                     LFTNTWPKKVEYSISVPTKAVAIGSTTPVNILLVPLLKGLKLGSIRMTLIEKYSYGSK
                     SDPKQVEKERKVTQMKIRNPLKELARNVNFQDDEDNSEFKDSWDLQAYLKIPPDLMKC
                     SPDCFTLERIKCRHQIKVVASLINPDNHISELRATLSIQLYVSPYIELFTKPYNSLYV
                     TVEGDENSLKKEHRWSSTPFNQDDRKIFMNSGNNAKINCTSLAHNRSMNGLMAPPNYE
                     MHFYDKLCHDTPVGGSALHSPIHMTNDSIISNEDSLHKLDGTLRDLHLEDRDSDYYSN
                     MNGLSLPTSAGEFNKIDEIQELPSDINLSYFSNDYILKDRDAAKCLSQSSKDSNPDLR
                     KFSRVPSYDMAVLTPTIDEELPPVYSDNPSPVVNTPQSRTAKSFTHEKHHPGLHMNLA
                     RCNSAGLGTSRPWPKSTSPVGKGPLVNMGMEFNTLQTRISTRSRSRTVHSVANEKSSS
                     PLSLSPRQRSTSFVSIRNILNKR"
     gene            <1046127..>1047908
                     /locus_tag="CAGL0K10736g"
                     /db_xref="GeneID:2890106"
     mRNA            <1046127..>1047908
                     /locus_tag="CAGL0K10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448683.1"
                     /db_xref="GeneID:2890106"
     CDS             1046127..1047908
                     /locus_tag="CAGL0K10736g"
                     /note="highly similar to uniprot|P00175 Saccharomyces
                     cerevisiae YML054c CYB2 lactate dehydrogenase cytochrome
                     b2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448683.1"
                     /db_xref="GeneID:2890106"
                     /db_xref="GOA:Q6FM61"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6FM61"
                     /translation="MQRYIFKTPHSRVLRSLPRHAINSTTKRGIVSTRSSLNNQFFNS
                     ERQRKSYKWFWSIGLTVGLTAAIADNLHNKKDIYNDAKFDSSKPKISPSEVIKHNTPE
                     DCWVVIDGYVYDLTNFIALHPGGPDIIKTNAGKDVTAIFDPIHPPDAIEKYIKPEQHI
                     GPLDGKLDAEYICPPYAPGETPDDIARKAALRARLPPLSSIMNLYDFEYLASQILSKQ
                     AWAYYSSASDDEVSYRENHNAYHRIFFNPKVLVDVSKVDTSTEMLGHKVDVPFYVTAT
                     ALCKLGNPKEGEKDIARGCGQGPNKTPQMISTLASCSVDEIVNAAPSKDQVIWYQLYV
                     NSDRKITENLIKHVEDLGVKAIFVTVDAPSLGSREKDKKVKFNNTMSGPKSMKKSDVG
                     ESEGAAQTLSKFIDPSLSWQDIKILRKKTKLPIVIKGVQRVQDVVKAAEIGCNGVVLS
                     NHGGRQLDFARAPIEVLAETMPVLKEKKLDKNFEVFVDGGVRRGTDVIKALCLGASGV
                     GLGRPFLYANSCYGKDGVQKAIDLLKTEIEMNMRLLGVTSIKDMNPELLDLSSLHGRT
                     VNVPKDSLYVNVYNKPELAEFLDDASD"
     gene            complement(<1048208..>1048711)
                     /locus_tag="CAGL0K10758g"
                     /db_xref="GeneID:2890107"
     mRNA            complement(<1048208..>1048711)
                     /locus_tag="CAGL0K10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448684.2"
                     /db_xref="GeneID:2890107"
     CDS             complement(1048208..1048711)
                     /locus_tag="CAGL0K10758g"
                     /inference="similar to AA sequence:UniProtKB:Q04969"
                     /note="similar to uniprot|Q04969 Saccharomyces cerevisiae
                     YML055w SPC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448684.2"
                     /db_xref="GeneID:2890107"
                     /db_xref="GOA:Q6FM60"
                     /db_xref="InterPro:IPR009582"
                     /db_xref="UniProtKB/TrEMBL:Q6FM60"
                     /translation="MSKSINVYSTSEAQKALDELLPSVFARLGYREDHTALDIKLALG
                     YTMAAIAVGSFLLDKKFEKKEIMHYQLILTVLYFALSLVYWVYQKTVNKNAIYHGKKT
                     SGENIKVITSIGKTDPNYKVTVIRNNKNKELELVLPITEVFTEKGFLQGDLVYNWFSK
                     HLSEKDE"
     gene            <1048733..>1052049
                     /locus_tag="CAGL0K10780g"
                     /db_xref="GeneID:2890108"
     mRNA            join(<1048733..1048754,1049922..1050368,1050935..>1052049)
                     /locus_tag="CAGL0K10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448685.1"
                     /db_xref="GeneID:2890108"
     CDS             join(1048733..1048754,1049922..1050368,1050935..1052049)
                     /locus_tag="CAGL0K10780g"
                     /note="highly similar to uniprot|P50094 Saccharomyces
                     cerevisiae YML056c IMD4 or uniprot|P50095 Saccharomyces
                     cerevisiae YLR432w IMD3 or uniprot|P38697 Saccharomyces
                     cerevisiae YHR216w PUR5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448685.1"
                     /db_xref="GeneID:2890108"
                     /db_xref="GOA:Q6FM59"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001093"
                     /db_xref="InterPro:IPR005990"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR015875"
                     /db_xref="UniProtKB/TrEMBL:Q6FM59"
                     /translation="MSRTAAVVRDYTTALEYLKTIERKDGLSVSELMDSMTRGGLTYN
                     DFLVLPGYVSFPSSVVQLQTKLTKKITLNTPFVSSPMDTVTEAEMAIYMALLGGIGII
                     HHNCTPEEQASMVKKVKNFENGFINFPIVIGPEVTVGEVKTMREDYGFSAFPVTAEGK
                     VGSKLLGIITSRDFQFLEDDSMKVKDVMTTELVTGKAGITLSEGNEILKTTKKGKLLI
                     TDDNGNLVSMLSRTDLMKNQNYPLASKSATTKQLLCGAAIGTIDADKERLRLLVEAGL
                     DVVILDSSQGNSIFQLNMIKWIKKEFPELEVIAGNVATREQAANLIAAGADGLRIGMG
                     SGSICITQEVMACGRPQGTAVYNVCKFANEFGVPCIADGGVQNIGHITKALCLGASTV
                     MMGGMLAGTTESPGDYFYRDGKRLKVYRGMGSIDAMQKTGKKGNASTSRYFSETDSVL
                     VAQGVSGAVVDKGSIKKFIPYLYNGLQHSCQDIGVQSLDSLRSEVDNGNVRFEFRTAS
                     AQLEGGVHNLHSYEKRLHN"
     gene            complement(<1052591..>1054801)
                     /locus_tag="CAGL0K10824g"
                     /db_xref="GeneID:2890074"
     mRNA            complement(<1052591..>1054801)
                     /locus_tag="CAGL0K10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448686.1"
                     /db_xref="GeneID:2890074"
     CDS             complement(1052591..1054801)
                     /locus_tag="CAGL0K10824g"
                     /inference="similar to AA sequence:UniProtKB:Q99296"
                     /note="similar to uniprot|Q99296 Saccharomyces cerevisiae
                     YLR149c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448686.1"
                     /db_xref="GeneID:2890074"
                     /db_xref="GOA:Q6FM58"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019417"
                     /db_xref="UniProtKB/TrEMBL:Q6FM58"
                     /translation="MTIDDTSRRFEEDDASAPVFDKVYQNYMMPGLELYDARVTINHW
                     QLRDCIKPSSGNHSKLYYIYDHSIRVLDTDLEGLRSYRSHRMSESHVSGSEGEKRRLS
                     SKLKKDVVSYRNRDMLKGNLNVPSEKLVEFYFKPRCFTELNGLTACGGLVGSDDRGFP
                     TNWNRLNHNAGATSPPTDRNATSVAGSNINTQNTTDSSPPAQPIKLARRDVLLDRSNY
                     SNPNIWKGILSLYNQNTNVSMTFVLGQFINNCVTLNDRSNNQYDLYTCNNDGHMYQCD
                     ISNRDVQLVRRFSDLKFPLNNAALSHDSKTMIVSGDSNKFAIYRQENLSEQFTLNYDN
                     QAQWGNSHSKIKRIHRYSSGDNTGYIDNIFEAPNGDHGFYNSFSENDLQFATLFQNGV
                     CLIYDVRRLDSPLAEISSTRPHSHNGAFRVCRFSYGLDDLLFISEHQGRVHVVDTRNF
                     VNHQIILIPDKVTPPMDTEDQNTYNTTQSTQQQAADYQSSVSNYMSTYNNARRRYSFP
                     SVGVKNWEPWITPANYIPLQYLEPKILPFPKVIDKLTNESIISHYNSSQYGSSRQNSG
                     SYYAASTDSDNRVSKRRDARNSFRIRRVSTSSKRTIPQEGNNSGLLRAQNQQTNQQQE
                     LHTSSGSSNGNTVFDDDDIYDAYQDVNTNENMYPLSGRFEPTINEISGRYNPVNNTVV
                     DYSSTDFTEENNISGIDWVEDRNGSSLIIGTDYGIMRWNINSWARRSFSSYDFC"
     gene            complement(<1055535..>1056518)
                     /locus_tag="CAGL0K10846g"
                     /db_xref="GeneID:2890075"
     mRNA            complement(<1055535..>1056518)
                     /locus_tag="CAGL0K10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448687.1"
                     /db_xref="GeneID:2890075"
     CDS             complement(1055535..1056518)
                     /locus_tag="CAGL0K10846g"
                     /inference="similar to AA sequence:UniProtKB:Q12524"
                     /note="similar to uniprot|Q12524 Saccharomyces cerevisiae
                     YLR151c PCD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448687.1"
                     /db_xref="GeneID:2890075"
                     /db_xref="GOA:Q6FM57"
                     /db_xref="InterPro:IPR000059"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6FM57"
                     /translation="MLKSSLLLENIRKFNRFRSPYRLQDVWPLGRRSAVLVLLFIGNQ
                     GELRVLLTKRSRSLRSFSGHVSFPGGKADDAKETPEQVARRETCEEIGLPQDAAQLKR
                     DYGMEIENLLTEMPCYISRTLLSVKPVVCLLKNTHKSDLDILEASKFAAKLNPGETSS
                     LFSVPLRDLAPRHLRRGMATEYVDHREESLEWGGLPWLVDHFYYPVENPQEAPWLTDV
                     QDLSSEENEVEVLRDASSHRVQCRDLWGLTAKIISDLAAIATGLITTDTSRQATVGHE
                     DLIYGLYTNGQMQPERSQWESDMIRAKRDTNYTDVIPEAYMSDLHSRGVTF"
     gene            complement(<1057135..>1058658)
                     /locus_tag="CAGL0K10868g"
                     /db_xref="GeneID:2890076"
     mRNA            complement(<1057135..>1058658)
                     /locus_tag="CAGL0K10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448688.1"
                     /db_xref="GeneID:2890076"
     CDS             complement(1057135..1058658)
                     /locus_tag="CAGL0K10868g"
                     /note="highly similar to uniprot|P15202 Saccharomyces
                     cerevisiae YDR256c CTA1 catalase A or uniprot|P06115
                     Saccharomyces cerevisiae YGR088w CTT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448688.1"
                     /db_xref="GeneID:2890076"
                     /db_xref="GOA:Q6FM56"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:Q6FM56"
                     /translation="MSANPTNTSDVRGDRVVTNSTGYPYNDPFATQRVGQHGPLLMQD
                     ANLIDSLAHFNRERIPERNPHAHGSGAFGYFEVTDDITDICGSAMFSEIGKRTRFLTR
                     FSTVGGEKGSADTARDPRGFATKFYTEEGNLDWVYNNTPIFFIRDPSKFPHFIHTQKR
                     NPQTNLKDPNMFWDYLTTPENQVAVHQLMILFSDRGTPASYRHMNGYSGHTYKWSNKK
                     GEWHYVQVHILTDQGIKNLTNDEAVEIAGKNPDYCQQDLYENIAKGNYPSWTVYIQTM
                     TEEQAKKLPFSVFDLTKVWPHKDFPLRRVGKMVMNENPLNYFASIEQAAFSPANTVPY
                     QEPSADPVLQSRLFAYADAHRYRLGANFHQIPVNCPYASKFFNPVIRDGPMNVDGNFG
                     NEPNYYASNKQYQIPNQDRPIQQHQEVWNGPAQPFHWATSPGDIDFVQARDLYKVLGK
                     QKDQQEHLAYNIGTHVAGADPEIQQRVIDMFSRVDEGLGANIRKEIEKNASAPTAKI"
     gene            <1063220..>1064422
                     /locus_tag="CAGL0K10890g"
                     /db_xref="GeneID:2890077"
     mRNA            <1063220..>1064422
                     /locus_tag="CAGL0K10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448689.1"
                     /db_xref="GeneID:2890077"
     CDS             1063220..1064422
                     /locus_tag="CAGL0K10890g"
                     /note="highly similar to uniprot|Q03558 Saccharomyces
                     cerevisiae YHR179w OYE2 NADPH dehydrogenase or
                     uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448689.1"
                     /db_xref="GeneID:2890077"
                     /db_xref="GOA:Q6FM55"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FM55"
                     /translation="MSFTTDFEPVSLKGTNLFKPLKVGNNTVLHRAAFPPLTRMRAES
                     PGNIPNREWSVEYYRQRSQRPGTLVITEGTFPSAQAGGYDNAPGIWSEEQLVEWRKII
                     DAIHSNKSFAWVQLWALGRLAMPNLLARDGLRFDSATDNYYASPEQEELAKKSNNLQH
                     GLSREDIKQYVNDYVQASKNAISAGADGVEIHSSTGFLLNEFIDPISNHRSDEYGGSI
                     ENRARFVLEVVDAVVDAIGAEKTAIRFSPYGNYGGMSGGTDPTIIAQYAYIIGELEKR
                     AKGGKRLAYIHFMEPRVLDPFLPEGESVYNEGTIDFAYSIWKGVIIRTGNYAIHPEVV
                     KDVVNDDRTIIGYGRYFISNPDLVDRLEKGLPLNKYDRSYFYTMTAEGYIDYPTYAEA
                     IKKGWDKK"
     gene            complement(<1065616..>1066602)
                     /locus_tag="CAGL0K10906g"
                     /db_xref="GeneID:9488035"
     mRNA            complement(join(<1065616..1065902,1066587..>1066602))
                     /locus_tag="CAGL0K10906g"
                     /product="60S ribosomal protein L36"
                     /transcript_id="XM_002999537.1"
                     /db_xref="GeneID:9488035"
     CDS             complement(join(1065616..1065902,1066587..1066602))
                     /locus_tag="CAGL0K10906g"
                     /note="highly similar to uniprot|O14455 Saccharomyces
                     cerevisiae YPL249ca RPL36B or uniprot|P05745 Saccharomyces
                     cerevisiae YMR194w RPL36A"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_002999583.1"
                     /db_xref="GeneID:9488035"
                     /db_xref="GOA:B4UN40"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:B4UN40"
                     /translation="MAVKTGIAVGLNKGTKVTQMTPAPKISYKKGAASNRTKFVRSLV
                     REIAGLSPYERRLIDLIRNAGEKRARKVAKKRLGSFTRAKAKVEEMNSIIAASRRH"
     gene            complement(<1067535..>1068338)
                     /locus_tag="CAGL0K10912g"
                     /db_xref="GeneID:2890078"
     mRNA            complement(<1067535..>1068338)
                     /locus_tag="CAGL0K10912g"
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /transcript_id="XM_448690.1"
                     /db_xref="GeneID:2890078"
     CDS             complement(1067535..1068338)
                     /locus_tag="CAGL0K10912g"
                     /note="highly similar to uniprot|P36525 Saccharomyces
                     cerevisiae YMR193w MRPL24"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL24/YmL14"
                     /protein_id="XP_448690.1"
                     /db_xref="GeneID:2890078"
                     /db_xref="GOA:Q6FM54"
                     /db_xref="InterPro:IPR001383"
                     /db_xref="InterPro:IPR026569"
                     /db_xref="UniProtKB/TrEMBL:Q6FM54"
                     /translation="MINLLVGPLLGSLKLSVPFSRNFSVTANAMRRWKLVECRRVAKQ
                     PEYKVGDVRPNYVPKERKEFPDYKYGEALVFKQSNKGLYGGSFVKYGNKISESKHKTR
                     RTWHPNVIKKSLWSETLNRSINIKMTAKVLRTIIKEGGIDNYLIKDKSARIKELGPTG
                     WKLRYRIMQRKEQLNNPPHHDKPVVKLADGTEAKVLYEQEIDGESYRIKVGRRKLMTY
                     LYPLEKLEHKADGKPLNHKEFIDKFGDLKAEQIIQRLHKYNFDLKTISV"
     gene            complement(<1068680..>1070479)
                     /locus_tag="CAGL0K10934g"
                     /db_xref="GeneID:2890079"
     mRNA            complement(<1068680..>1070479)
                     /locus_tag="CAGL0K10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448691.1"
                     /db_xref="GeneID:2890079"
     CDS             complement(1068680..1070479)
                     /locus_tag="CAGL0K10934g"
                     /inference="similar to AA sequence:UniProtKB:Q04322"
                     /note="similar to uniprot|Q04322 Saccharomyces cerevisiae
                     YMR192w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448691.1"
                     /db_xref="GeneID:2890079"
                     /db_xref="GOA:Q6FM53"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FM53"
                     /translation="MKAHTGQDMEGEQDMDQASENQLEKVTTGIEQELQDENENIKKA
                     LEEYSSPPLPPRDHIATESVVPELPPRNHDEAEKNDVIRSESEGTGKGTGKDTGKATV
                     EANSDAEPTLPPRNIEEQRNVVVNTDFLAYNNKRIRDLVAREGPDREEEIYVNIGTLK
                     EKYKEQISKLEEGQYNPIVATFIQCLPDISLRDLIEEEKILLSTDLKFRDIVWPILSF
                     NYVKSENLNKGSNEAITKFLERHNITDEETLTRYTTVLTTYYSETFQGELCDDIVILL
                     NAIDIVTKDEQDFYIIFESLLNKFNMKEVYYSNNDKDIELCYIFERFLEDNHKALYNH
                     LSREGLSTKMYLPVWIRTLFRKQLNEDIAVKIVDIILLEGLEGLLRIALALIVGNEDK
                     LLRSKFEDILSIIKNLDPMAELSSEFITEAMASIELKPKAVIGYKYEYEEIHRLERER
                     EEQFDYVKNKNKNLQEKVKKLEHDYTFLNREHVTIANELVNSQLNIEQISVQNNELRI
                     ELINLRKELAELTKQKDIETGKAVPDDMKKELTNILAKNSRVMTENLQLQDKVSELEK
                     TAEDIKRCTEEGKLYEDPSASSWTGLKKISTKF"
     gene            complement(<1070703..>1070906)
                     /locus_tag="CAGL0K10956g"
                     /db_xref="GeneID:2890080"
     mRNA            complement(<1070703..>1070906)
                     /locus_tag="CAGL0K10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448692.1"
                     /db_xref="GeneID:2890080"
     CDS             complement(1070703..1070906)
                     /locus_tag="CAGL0K10956g"
                     /note="highly similar to uniprot|P39103 Saccharomyces
                     cerevisiae YML129c COX14 cytochrome-c oxidase assembly
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448692.1"
                     /db_xref="GeneID:2890080"
                     /db_xref="GOA:Q6FM52"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="UniProtKB/TrEMBL:Q6FM52"
                     /translation="MARYAWYTRATDTLHRLTVLTIIGGSLYMTGGLVYTLYMNGKRY
                     EQKVITDKKDEMNQLEGAVSSSE"
     gene            <1071625..>1073694
                     /locus_tag="CAGL0K10978g"
                     /db_xref="GeneID:2890081"
     mRNA            <1071625..>1073694
                     /locus_tag="CAGL0K10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448693.1"
                     /db_xref="GeneID:2890081"
     CDS             1071625..1073694
                     /locus_tag="CAGL0K10978g"
                     /note="highly similar to uniprot|P49367 Saccharomyces
                     cerevisiae YDR234w LYS4 homoaconitase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448693.1"
                     /db_xref="GeneID:2890081"
                     /db_xref="GOA:Q6FM51"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004418"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /translation="MVVLRRSFHVYTRLQRGQNLTEKIVQQYSVGLAPGKRVHSGDYV
                     SIKPAHVMSHDNSWPVALKFMNLGARTVKDPRQIVNTLDHDIQNKSDKNLTKYRNIES
                     FAKKHGIDFYPAGRGIGHQIMVEEGYAFPLNLTVASDSHSNTYGGMGALGTPVVRTDA
                     AAIWATGQTWWQIPPVAQVEFKGKLHESVSGKDIIVALCGVFNKDQVLNHAIEFTGDA
                     IKHLPVDFRLTIANMTTEWGALSGLFPVDDTLINWYKNRLNIVGPNHPRINETTIKNL
                     EDKAKVFKADSDAVYAKKLVIDLSTLTHYVSGPNSVKVSNTVQDLARDNIKINKAYLV
                     SCTNARLSDLESAAKVVCPTGDLSKVNKVADGVEFYFAAASSEIEKEAAEKGIWQALL
                     AAGCKPLPSGCGPCIGLGAGLLEPGEVGISATNRNFKGRMGSKDALAYLASPAVVAAS
                     AVLGRIGSPAEVWGIEDVKSSGLLAEELACNTETSTATPVSEGSAAKVEMLEGFPEEI
                     VGELVLCDADNVNTDGIYPGKYTYQDDVSRETMAQVCMENYDGEFGSKANAGDILVSG
                     FNFGTGSSREQAATSLLAKGINLVVAGSFSNTFSRNSINNALLTLEIPTLVEKLRSKF
                     ENAPKELTRRTGWFLKWDVPNAKVYVTEGSPDGQVLLEQKVGELGKNLQEIIIKGGLE
                     GWVKSQL"
     gene            <1074261..>1075895
                     /locus_tag="CAGL0K11000g"
                     /db_xref="GeneID:2890082"
     mRNA            <1074261..>1075895
                     /locus_tag="CAGL0K11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448694.1"
                     /db_xref="GeneID:2890082"
     CDS             1074261..1075895
                     /locus_tag="CAGL0K11000g"
                     /inference="similar to AA sequence:UniProtKB:Q03776"
                     /note="similar to uniprot|Q03776 Saccharomyces cerevisiae
                     YDR235w PRP42 U1 snRNP associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448694.1"
                     /db_xref="GeneID:2890082"
                     /db_xref="UniProtKB/TrEMBL:Q6FM50"
                     /translation="MQGYEKLVNSHEFAQLTTELAQYPKKLISWEKLLVLINTHIGNV
                     NKAIDAKLYKLLKTTYTDMLYYFPLLENYYIDYALLEYKLGHFKSVHTIFKEALAVHN
                     NRSLLLWKNYLQICNKIVIDQRQLLKKYSEAEDYIGVHYLSGEFWEMYLEVLKERCNV
                     KIRYYSTLRKVLEIPLHSFSKFYAIWLKHIDDDITDLSKLKLFVSEIDIREKLLVDIN
                     YKGRRGPYIQKAKEQLKKYTQDLYTIVQYQVIERYSLFESKLTVQYYTSCDELVSADQ
                     QNIWDKYLDYVINLNIAPLTQTTFQRALVCLAHYDFIWIKYAQYFLKVEEDLYSAKNV
                     LLKSLQYALRKGRIIELLTVVLVKTNELYFLDKLFKVWEDSLPEGCEDIEDFQSFWNY
                     IEFQVYLHRNKNQSRYEDSNSNAFLSDDILSKIMHRLEYQEKRQGHGIILSYLVDLQT
                     KSNTQLIEDKVFKEIIRKDLTFLIGGGLFWYLYSKLIFFDSERSYLERRGYIIERVWS
                     QIPKQYYERVSTKLLEFCETYLPEDVDIVYDMRKEQ"
     gene            complement(<1076095..>1076850)
                     /locus_tag="CAGL0K11022g"
                     /db_xref="GeneID:2890083"
     mRNA            complement(<1076095..>1076850)
                     /locus_tag="CAGL0K11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448695.1"
                     /db_xref="GeneID:2890083"
     CDS             complement(1076095..1076850)
                     /locus_tag="CAGL0K11022g"
                     /inference="similar to AA sequence:UniProtKB:Q03778"
                     /note="similar to uniprot|Q03778 Saccharomyces cerevisiae
                     YDR236c FMN1 Riboflavin kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448695.1"
                     /db_xref="GeneID:2890083"
                     /db_xref="GOA:Q6FM49"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="InterPro:IPR023465"
                     /db_xref="InterPro:IPR023468"
                     /translation="MNPIALVVVAVSFWCQYWLEKSSMVAHLLRHEGLSTLINSGKSA
                     ESESIAGWNRSARYIDLAMTVRDVDVPIPEQPGAPYPIVTKCCDIVCGFGRGSSELGI
                     PTANVPVDQLPEVVNKLELGVYFGYAKVTPVAHDLEQVEREDGRVVSYNYGSHLEEDN
                     GDLEVLPVVLSVGKNPFYHNDFKTVEIHILHDFKSTFYGAKIKFNILGYVRPELDYTS
                     KEALIEDIKTDIEISKQVLDTEPYRAHMAELLK"
     gene            <1077233..>1078084
                     /locus_tag="CAGL0K11044g"
                     /db_xref="GeneID:2890084"
     mRNA            <1077233..>1078084
                     /locus_tag="CAGL0K11044g"
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /transcript_id="XM_448696.1"
                     /db_xref="GeneID:2890084"
     CDS             1077233..1078084
                     /locus_tag="CAGL0K11044g"
                     /note="highly similar to uniprot|P36519 Saccharomyces
                     cerevisiae YDR237w MRPL7"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /protein_id="XP_448696.1"
                     /db_xref="GeneID:2890084"
                     /db_xref="GOA:Q6FM48"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:Q6FM48"
                     /translation="MLGRRAFSSTSGAGKAACSLVKPVHHLVRIDKNKLSPRFPDLKY
                     EKTDVRSPGYRPQEVCGDRVRDFYHSTLQQDMLLINYRHGQEVERGLKKREWDGSSPY
                     HLNRPLKKPQGSMAQLPDIKPVKWHNVPWLENVTINCFVKEAKENELMAVSAALQLQQ
                     ITGAKPKPIYSKTDVPTWKLRKGHQMGAKVVLTGYEMSQFLSTLTEIVLPRIREYKGV
                     KPNGDRFGGISFGMTSSDVRFFPEIDANQDLWPKTFGMHVNINTTAQNTAQAVTLLSG
                     LQFPFQK"
     gene            <1078317..>1078889
                     /locus_tag="CAGL0K11066g"
                     /db_xref="GeneID:2890085"
     mRNA            <1078317..>1078889
                     /locus_tag="CAGL0K11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448697.1"
                     /db_xref="GeneID:2890085"
     CDS             1078317..1078889
                     /locus_tag="CAGL0K11066g"
                     /note="weakly similar to uniprot|P40892 Saccharomyces
                     cerevisiae YJL218w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448697.1"
                     /db_xref="GeneID:2890085"
                     /db_xref="GOA:Q6FM47"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="UniProtKB/TrEMBL:Q6FM47"
                     /translation="MNTQDFINQLNTGEPVFAGTETYKFMHGVSQDALKITMEMNNKY
                     HTPEELLELFSQLIGKQVDPTFCLFPPFYTDCGKNITVGKRVFINSGCRFQDQGGVTI
                     GDDCLIGHNAVLATLNHGMSPADRKNLYPAPIRIGNNVWLGANVTVLPGVTIGDNAVV
                     AAGAVVTKDVPENMIVAGVPAKILKSIHDN"
     gene            complement(<1079157..>1082075)
                     /locus_tag="CAGL0K11088g"
                     /db_xref="GeneID:2890086"
     mRNA            complement(<1079157..>1082075)
                     /locus_tag="CAGL0K11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448698.1"
                     /db_xref="GeneID:2890086"
     CDS             complement(1079157..1082075)
                     /locus_tag="CAGL0K11088g"
                     /note="highly similar to uniprot|P41810 Saccharomyces
                     cerevisiae YDR238c SEC26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448698.1"
                     /db_xref="GeneID:2890086"
                     /db_xref="GOA:Q6FM46"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011710"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016460"
                     /db_xref="InterPro:IPR029446"
                     /translation="MTAEIDPPAYTLVFNPATNSTPNTVAEFQKALEKGSDETKIEAM
                     KEILVTMLEGNPLPEMLMHIIRFVMPSKNKKLKKLLYFYWEIVPKLDQDGKLRHEMIL
                     VCNAIQHDLQHPNEFIRGNTLRFLTKLREPELLEQMVPSTLACLEYRHAYVRKYAILA
                     VLSIYKVSEHLLPDAKEIINTFLLAETDPICKRNAFLGLSELDRDNALQYLQDNIDDI
                     ESLDPLLQAAFVQFIRKDAIQTPALKSQYCDLLLELLASATADEVVFETALALTILSG
                     NQTVLIKAVSKMIDLAVKVSDNNVKIIVLDRIQDINERNPGCLEELTLDILRVLNAED
                     IDVRSKALTIAMDLVTSRNIEDVVQLLKKELQTTVINNEKEKSSDYRSLLIKTIRGIA
                     VRFEEIAANIVSLLLDFITDLNSVAANGVIAFVKDVVELYPQLRSNILENLIAKLESV
                     NSAKAYRGALWILGEYSTTESEIQDSWKHIRQSIGEIPILQTELKNQRKSQDEDDEAT
                     EESATKQAGPVILPDGTYATENAFGSSNNDNKKKLVENENRPPLRRFVLGGDFYTASI
                     LASTIVKLVLRFEKVSERAAVLNALKAEGLLMLVSIIRVGESSIVEKNIDEDSQERIT
                     TAIAILMDESNPDESSAERELLNIAFLDATKASFKGQFVAQKKTKLFKSSPVRKHKEA
                     IDQSVSFRLLQENDNTAVSGDAIDEDLQLAIRGDAARDTSSIAISKLKKIVPLTGFSD
                     PVYAEACITTNQFDVVLDVLLVNQTKETLKNFHVQFATLGDLKIVENPPATNVVPHGF
                     HRVSVTVKVSSADTGVIFGNIIYDGGHGQDARYVILNDVHVDLMDYIKPAKTDDESFR
                     TMWNAFEWENKISVKSKLPSLHAYLDELIKGTNMGVLTPVESLGEKDCRFLCCNLYAR
                     SSFGEDALANLCIELDPNTEQVVGYVRIRSKGQGLALSLGDRVALIAKQNNKVIVGHV
                     "
     gene            complement(<1082567..>1084981)
                     /locus_tag="CAGL0K11110g"
                     /db_xref="GeneID:2890087"
     mRNA            complement(<1082567..>1084981)
                     /locus_tag="CAGL0K11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448699.1"
                     /db_xref="GeneID:2890087"
     CDS             complement(1082567..1084981)
                     /locus_tag="CAGL0K11110g"
                     /inference="similar to AA sequence:UniProtKB:Q03780"
                     /note="similar to uniprot|Q03780 Saccharomyces cerevisiae
                     YDR239c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448699.1"
                     /db_xref="GeneID:2890087"
                     /db_xref="GOA:Q6FM45"
                     /db_xref="UniProtKB/TrEMBL:Q6FM45"
                     /translation="MFGGGAGKLKRKSFFLFGDSKSSNSDGKKGNESPVHVGTPSSTF
                     KVKGKESSSAPSNRKEKTLNKSASVPNAKGTDGETARVKQVNKPIKAVSNPLGKEPLW
                     NSNPFLNDDNLNIGSGRRPENIRLSSTDSARRLRENNPFRLEEDPNAISNELIDVKMP
                     SKARFSRPPPPPVNEDELANAKRISSIPVPSDMVQANHETEDLRDLSQKMNEVQINTN
                     ITGHKRQKSEAEKLVDDIDSYMNNQSLSPESIDEKALSPSQDILPPILGIDSERIDTN
                     SILDSLYSNVPPLTVEPNTEKDDDMRSEEEKSYSNFSFVPDVEDDDSKSGLESLESDR
                     HEGSPVMLQDDVSNEDILRVVNADSSYHSSSSSSSISSSSSVAGLNCSYSSVAEVNNE
                     VKSFESSHYNSETLIQQQTTASNEARTLRVVNEDRPSFYLQATNTNDDDTTTVSSASF
                     GPLKPLQNNYSEIDSKDVTPNIFSNMSTIPNADTSTSTETSSANMSTPKAYKSTTSTP
                     LGTISAASESFTTPTNLHNEKEAQVDTESGISARSSMDKNSGISNNIISPRSENTFRL
                     VSSYLEEIRLKYNPTSNFLEPPPNLPISIKQKNNLIQPKNIRVKLRTNAKQIGIKHGR
                     VKQKLLTLETANENTTDTKRSSSSFPNTPTGSVIDHTKEFRNLLHKNTDKDVDQSSET
                     GSEDYLDEIPGDEAYDSDDAMAPLREKKSRTATTDNTVTRSNTVVSYYTRKKNKLGTG
                     YNEEEASEHALPSKLSMLDYANAETKAKRGRSESRASQLSAKTERDFMFRGPLHIANP
                     SDSESD"
     gene            complement(<1085316..>1086749)
                     /locus_tag="CAGL0K11132g"
                     /db_xref="GeneID:2890088"
     mRNA            complement(<1085316..>1086749)
                     /locus_tag="CAGL0K11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448700.1"
                     /db_xref="GeneID:2890088"
     CDS             complement(1085316..1086749)
                     /locus_tag="CAGL0K11132g"
                     /inference="similar to AA sequence:UniProtKB:Q03782"
                     /note="similar to uniprot|Q03782 Saccharomyces cerevisiae
                     YDR240c SNU56 U1 snRNA protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448700.1"
                     /db_xref="GeneID:2890088"
                     /db_xref="UniProtKB/TrEMBL:Q6FM44"
                     /translation="MMRKRARNGYDGDRENRSALNKKAKRHPALTQDSYDLWKNLDRI
                     RKLHKNSDKVLKRSVVLIPLSCETNNTIVQCIQHLLRYVDQERLHFKTVSGQLYTHVV
                     ILRNFSVLDFCLVVPVLLSAVKRLNSKTSDYFKFDSHIFCNGTFFVPDNTVISIDRTT
                     LQLKETALRLIPGFKELNCTPTESNNIQDMINTLANFISKVKFGKNKDDIYATFKREL
                     ALFSKRTRFGLGEVSMLEKGMLIDSQAVIDKNLPLVQNTKAKLQTYVQTLLDENEDKI
                     TTEVQTTAAKSSDAISSTNGNNNVASKPIQSRFQNNQSHNVPSSRYSHQATSTAIRKP
                     YTAKEASPLPTQSRASPGRPRFMTIEEIRGRCIATVRASIDSVKKISAYQIVKVYVKF
                     PKKDSDTLFSNLDELRNKSNCNIVVLHYNNEHESKQWLDGLDLTRYIRGQDEPNASTV
                     RILSIGGVAEYIVTALEGILALLQEQT"
     gene            1087132..1087219
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0K11154r"
                     /db_xref="GeneID:2890089"
     tRNA            join(1087132..1087171,1087183..1087219)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0K11154r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2890089"
     gene            complement(<1087381..>1089129)
                     /locus_tag="CAGL0K11198g"
                     /db_xref="GeneID:2890090"
     mRNA            complement(<1087381..>1089129)
                     /locus_tag="CAGL0K11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448701.1"
                     /db_xref="GeneID:2890090"
     CDS             complement(1087381..1089129)
                     /locus_tag="CAGL0K11198g"
                     /inference="similar to AA sequence:UniProtKB:P23394"
                     /note="similar to uniprot|P23394 Saccharomyces cerevisiae
                     YDR243c PRP28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448701.1"
                     /db_xref="GeneID:2890090"
                     /db_xref="GOA:Q6FM43"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLVLRKFRWRKWTAETLESTKMTRPIDVHQLLKSRSAGPKYMSV
                     EERERVVIEHSNDEVDLGVEYAKKRNVDEVAEDSARESKKKSKRLDFDWDPADNTLEG
                     YQPIVNPVILERIRQQEDQGDDLEAQYLGKSWREKLLVEMDERDWRIMREEFNITSKG
                     KGAVKHPLRNWSETNVIPTDLVRALTEGMGFDEPTAIQRITIPNAISSNKSVPRDILG
                     IASTGSGKTLAFSIPILARLDALPARPVNLKTLDGPLALVLVPTRELAQQISQEINRL
                     LSAWENKKNLNAVSIVGGHSMSDISHTLRNGCDILIATPGRLLDVLDNHLVVLNKIQS
                     LVLDEADRMIDLGFEDQMKSILSHLMADELAARQTMLFTATLSSSVESIAKGYLKNPL
                     HVSVGSRWDSDKPLITQVVRHTGDDDKKLSFLKDDLIKNGLPAIIFINYKETADWLTL
                     RLSDRFNIVTLHGSKSQSQRESAIQKLKSGTANVLIATNVAARGLDIPDVALVVNFQM
                     SKKFDDYIHRIGRTGRAGKTGIAVTYLTGEEDPQLIKQLAKYVKDVDPNKENDFPEEC
                     AKHFGIVSETRNRIIY"
     gene            <1089300..>1091072
                     /locus_tag="CAGL0K11209g"
                     /db_xref="GeneID:2890061"
     mRNA            <1089300..>1091072
                     /locus_tag="CAGL0K11209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448702.1"
                     /db_xref="GeneID:2890061"
     CDS             1089300..1091072
                     /locus_tag="CAGL0K11209g"
                     /inference="similar to AA sequence:UniProtKB:P35056"
                     /note="similar to uniprot|P35056 Saccharomyces cerevisiae
                     YDR244w PAS10 peroxisomal targeting signal receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448702.1"
                     /db_xref="GeneID:2890061"
                     /db_xref="GOA:Q6FM42"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR024111"
                     /translation="MNMTDCSVGSNPLAQLNKHAQGQGSSLSNTHVRHSGGVSGSNVF
                     RSGQNVVSEDGRQQLNSFMSQPMRLGEDKMHPATPMGSSMGNAIGGSMMQVDDSSMRS
                     AGDSQWTREFRQNTAGKTNMAQEMGSSGAAMANSNAWKFRYSPMTNVNNTAPLRPFNN
                     IIRQKERANGLETGDIAWNDKFDELEKEVSDKLNFKDGETVEKMDTGAEMQQDNLETG
                     DSTDYQKEFQEVWDSIQQDTEEMLSYKDDYEDMLNDTDFERSFLGKRAVESLEYKFEN
                     PSENQYMNNPNAYQIGCILMENGAKLSEAALAFEAAIKQDPKHVDAWLKLGIVQIQNE
                     KELNGMSALETCLKLDPNNLEAMKNLAISYINEGYDMSAYNMLNRWADTKYPGFYNSA
                     ELEGKRDEHENIHSKMTRRFLSLVNRINSVDPDIQLCLGLLFYANDEFDRTIDCFQAA
                     LKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGCY
                     KEAAEHLLTALSMHDVEGEFEVQSTRSNSISSADKYSFSGFKPTDNLLETLKRVFISM
                     GRDDLLDRVRPGMDLSQFRNEFTF"
     gene            <1091358..>1092509
                     /locus_tag="CAGL0K11231g"
                     /db_xref="GeneID:2890062"
     mRNA            <1091358..>1092509
                     /locus_tag="CAGL0K11231g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448703.1"
                     /db_xref="GeneID:2890062"
     CDS             1091358..1092509
                     /locus_tag="CAGL0K11231g"
                     /inference="similar to AA sequence:UniProtKB:P50108"
                     /note="similar to uniprot|P50108 Saccharomyces cerevisiae
                     YDR245w MNN10 subunit of mannosyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448703.1"
                     /db_xref="GeneID:2890062"
                     /db_xref="GOA:Q6FM41"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:Q6FM41"
                     /translation="MSRRASPVPLDEKLGYDETDDEVYDKRWKNVRVQQHRLMDLFSQ
                     FKNYLLLIGIVLFLWNWVDNSAGGETVRSIRSNTQLYPADYVNNEYGMGDIATTTGIR
                     SWWRGKPKVVIVLAANEGGGVLKWKNEQEWAIEKVSIANKLEYARRHGYGLILKDMTT
                     AKRYSHEYREGWQKADILMEVMDEFPEAEWYWWLDLDTLIMEPSKSLEDHIFKRINSY
                     TYRKLDVFNPLQMQDDIPYVDYSQQMDLLVTQDCGGFNLGSFLLRNSEWSKALLDLWW
                     DPICYEQKHMIWEHREQDALETLYANQPWIRSKVGFLPLRAINAFPPGACSEYSDDPQ
                     YFYEPNARDFVVNMAGCQFGRDCWGEMKYYHNLKQKLNRSWLRKLFFFI"
     gene            <1093092..>1093994
                     /locus_tag="CAGL0K11253g"
                     /db_xref="GeneID:2890063"
     mRNA            <1093092..>1093994
                     /locus_tag="CAGL0K11253g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448704.1"
                     /db_xref="GeneID:2890063"
     CDS             1093092..1093994
                     /locus_tag="CAGL0K11253g"
                     /note="some similarities with uniprot|Q03784 Saccharomyces
                     cerevisiae YDR246w TRS23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448704.1"
                     /db_xref="GeneID:2890063"
                     /db_xref="GOA:Q6FM40"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q6FM40"
                     /translation="MALDSILIINKSGGLIYHRNFEDPRQPAKESDISKMNSNDYLIL
                     ASTLHGVFAIATQLTPTAVQLKANSSASGSDASAREMDSVKSEEYSTVSSISNSSIAS
                     ATGGAGGVSNTAKVPGPGAPGPNKAAANILNQGHRHLGSVSSGKKDGNNGRAQISNLT
                     PYIPYVGMPHNNIASGGNSSANSPMDMGSFKGDDFFKEPFVSWNTSGIRHMSTDQFTM
                     FIYQTMTGLKFVAIKNNQVVGSPSSNTTDIVGGIHLADNLLRKVYCLYSDYVMKDPFY
                     SLEMPIKSTTFDEKLQQMIQNMNW"
     gene            <1094626..>1096203
                     /locus_tag="CAGL0K11275g"
                     /db_xref="GeneID:2890064"
     mRNA            <1094626..>1096203
                     /locus_tag="CAGL0K11275g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448705.1"
                     /db_xref="GeneID:2890064"
     CDS             1094626..1096203
                     /locus_tag="CAGL0K11275g"
                     /inference="similar to AA sequence:UniProtKB:Q03785"
                     /note="similar to uniprot|Q03785 Saccharomyces cerevisiae
                     YDR247w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448705.1"
                     /db_xref="GeneID:2890064"
                     /db_xref="GOA:Q6FM39"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FM39"
                     /translation="MITKCKINDYHITEEIGSGAYGLVYKAVHYRGDIVDLDEHSNLK
                     EYAIKATMKKLSKAERIRLGLSNVSQNFQAVILDCFRRNHYVLSLPEVDLESIKSLSE
                     EELSKIPQYKEIALHLKVHDHKNIVTIYKVLESPVATFIVMDYYKIDLFTSIVDMRHF
                     QANGRLIKKVFLQICSAIEYCHKNGIFHCDIKPENMLLDSDDNVHLCDFGLATTAPYL
                     TPNVCIGSSYYMAPERISYSDDTEAFEESEYEQDNEDSKSFHIDYENGNTNKNHNEKT
                     IISTAYNNRHSKRYLSFSTASADVWSLGIILINLSCVRNPWLKAHQTDDNTFYYYVRD
                     PKVLLKILPISQEFFRLLKRILKVDPSRRISIQNLMLSVKSIKSFTEAGPLSTVEELS
                     NEDYDYYTNYFDSVGANTKSQLKPLLHNRASSSYLDSGDHMPSKRMDVEHSPNNIHPS
                     KNTIVIPESPKLNEIADNENENDDMRREGSPIEHKNFKHSEIINQASRPKTDENPLPE
                     FQERLKYLKMDLSSINR"
     gene            complement(<1096742..>1097293)
                     /locus_tag="CAGL0K11297g"
                     /db_xref="GeneID:2890065"
     mRNA            complement(<1096742..>1097293)
                     /locus_tag="CAGL0K11297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448706.1"
                     /db_xref="GeneID:2890065"
     CDS             complement(1096742..1097293)
                     /locus_tag="CAGL0K11297g"
                     /inference="similar to AA sequence:UniProtKB:Q03786"
                     /note="similar to uniprot|Q03786 Saccharomyces cerevisiae
                     YDR248c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448706.1"
                     /db_xref="GeneID:2890065"
                     /db_xref="GOA:Q6FM38"
                     /db_xref="InterPro:IPR006001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FM38"
                     /translation="MTNHKLKVIVLAGTAGTGKSTVAARLLKEYSTKYPGIKFVEGDE
                     LHPKANIDKMASGNPLNDDDRWGWLKEVALKSAQSAEEGGCGVSVVACSSLKKSYRDL
                     IRSTRPDVEYHFVFLYGSKVEILNRLNSRKGHFMKSNMMESQFKDLQLPEESEANCVV
                     VLLDHKGFDEIEDDVLKYTNTVL"
     gene            complement(<1097846..>1098955)
                     /locus_tag="CAGL0K11319g"
                     /db_xref="GeneID:2890066"
     mRNA            complement(<1097846..>1098955)
                     /locus_tag="CAGL0K11319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448707.1"
                     /db_xref="GeneID:2890066"
     CDS             complement(1097846..1098955)
                     /locus_tag="CAGL0K11319g"
                     /inference="similar to AA sequence:UniProtKB:Q03787"
                     /note="similar to uniprot|Q03787 Saccharomyces cerevisiae
                     YDR249c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448707.1"
                     /db_xref="GeneID:2890066"
                     /db_xref="GOA:Q6FM37"
                     /db_xref="UniProtKB/TrEMBL:Q6FM37"
                     /translation="MGYIMAGLPSRVGHLSHLKRQYKLRQPFYVEKKARKRAAHTKHH
                     RRHRRKMTLEDLPVEVIRRIFVHTCGEPAMTMVNKHFHRSLETSNILLEKVFWERYTW
                     EDERHILVTEQSDGNHELWRTQQFLVNRSLFKNMIMVNYMLHNYESLERKIAYFVDDH
                     MMEYLQENELLDVKEIRDMHMRFSHREKFLANDIDTIDEPYATETKQQIGYRTDFPPI
                     FYSQYKLYFEKHAIYSMKKMRKHFYIKRPYDLITSIIPWFFQIDDYHSNWKSLMKAVR
                     TIMCLSNNDITLKDEIAMNSPLPLVYLITEITHASELEKRDLKRIKQFITKFYKDQEM
                     LSNPELWSHIRDTANKDLTALIISMGGQPDLTFFT"
     gene            <1099215..>1099772
                     /locus_tag="CAGL0K11341g"
                     /db_xref="GeneID:2890067"
     mRNA            <1099215..>1099772
                     /locus_tag="CAGL0K11341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448708.1"
                     /db_xref="GeneID:2890067"
     CDS             1099215..1099772
                     /locus_tag="CAGL0K11341g"
                     /inference="similar to AA sequence:UniProtKB:Q04935"
                     /note="similar to uniprot|Q04935 Saccharomyces cerevisiae
                     YDR231c COX20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448708.1"
                     /db_xref="GeneID:2890067"
                     /db_xref="GOA:Q6FM36"
                     /db_xref="InterPro:IPR016529"
                     /db_xref="InterPro:IPR022533"
                     /db_xref="UniProtKB/TrEMBL:Q6FM36"
                     /translation="MWNPFKKSEEKPQVAEDLPTNYTPGQKILLEDTRPKFQSDISKG
                     DVAASKEQASLRAAWESISWNDFTLEKLTSIPCFRDAGMVGFSSMFVTGSVILLYHKN
                     INKAMNWAVGGLMLGSIVGWEQCRMKRKRSFQVAQMAMETVAKKEKPMKHKVEHDPKL
                     LDQWEGRSGLKPNGPSDSKPWYKFW"
     gene            complement(<1100013..>1101257)
                     /locus_tag="CAGL0K11363g"
                     /db_xref="GeneID:2890068"
     mRNA            complement(<1100013..>1101257)
                     /locus_tag="CAGL0K11363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448709.2"
                     /db_xref="GeneID:2890068"
     CDS             complement(1100013..1101257)
                     /locus_tag="CAGL0K11363g"
                     /inference="similar to AA sequence:UniProtKB:Q04934"
                     /note="similar to uniprot|Q04934 Saccharomyces cerevisiae
                     YDR229w IVY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448709.2"
                     /db_xref="GeneID:2890068"
                     /db_xref="UniProtKB/TrEMBL:Q6FM35"
                     /translation="MNGKEENFKSPARYAAHLSEFYPLVNGESHGQMSNKEDMHTPDR
                     RSYLEEPITPRSQMHTRRTSSVASGVSSISDIQSFVTKRDVKLTSDALKELHETSYRF
                     SKALNSVATEANAMAKSLESIARLKGCGDDIAQNLLSAGGLFYLVGNHDLIMANYLDE
                     YLGENLLKDIDEFKVDSKTLENSFKAKSKSETVKLRLQEKHNRQLGKRKIRNLLAYRE
                     SLLSLQNTLDDLETLKHNYYVDSYELVESTCSKVLGKVASLSRAQLEISENIARKGWA
                     GGGLDNLLQVSDDQYNKDTMETEEEQDNPTAAQPTLTKTQSDNGGRASLSPSQTGLRS
                     PIKAIQEGSIKTNDQSSLLRGDESQDQEAQNSIDRESENNYDVTENSFSLPPTRKDDL
                     EDAGSSENILSGLDKLKIDEED"
     gene            <1101728..>1103587
                     /locus_tag="CAGL0K11374g"
                     /db_xref="GeneID:2890069"
     mRNA            <1101728..>1103587
                     /locus_tag="CAGL0K11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448710.1"
                     /db_xref="GeneID:2890069"
     CDS             1101728..1103587
                     /locus_tag="CAGL0K11374g"
                     /inference="similar to AA sequence:UniProtKB:P39081"
                     /note="similar to uniprot|P39081 Saccharomyces cerevisiae
                     YDR228c PCF11 component of pre-mRNA 3 -end processing
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448710.1"
                     /db_xref="GeneID:2890069"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR021605"
                     /db_xref="UniProtKB/TrEMBL:Q6FM34"
                     /translation="MDKETEATVKEFEGVLDELTFNSRPIITTLTRMAEENISCAQYF
                     VDAVEARIEKWKPSQKLFAFYVMDSICKNAGSPYTIYFSRNLPNLYRKAYLLVDNQVR
                     TKLIRMFKTWVEPNQSTGGSTFLFEKTALDKIEQFLIKASALHQKNLESQLPKPTVPL
                     LLKEIDKLAYITNERLKDQPNDDKLQKKIMVLQQLKKELQRERMASSALKQVQMQLRN
                     IFAQDYQKLQDKLRYQQQQQQQQQQQEQFLEQQPTKTGDAQSSRSTPDMLSGSAIPLF
                     GDQNGSTLFGESTPMFSTPDFVEIDNNKNHQLNKLKSLFNELDSVGLLYKPKNESIVT
                     LYNKLNGITGDNEVDLKLKEYNQLKQVPTVSVLQGIINDCKAYFATANIDILNSPNLQ
                     LNQGNLLNHNSTVDVRLVNLLYRSKPNKCLTCGKRFGNSMEDKKAEADHLDWHFRINK
                     RIKGSRLVNNPFTSSNVSSTQKNIQSRTWFLNDSDWVKFNDDEIVSTTRDIDQRHNKE
                     KNKSSEDAYSKIASESLAKSESTDFIDVNDLRKKYVVVPESSDDMSFQCPICKETVSS
                     VFDEDSGEWIWRNTISVDSKFFHATCYFEAAQSRDSLAGVTADLQKLKQLLKN"
     gene            complement(<1103764..>1108107)
                     /locus_tag="CAGL0K11396g"
                     /db_xref="GeneID:2890070"
     mRNA            complement(<1103764..>1108107)
                     /locus_tag="CAGL0K11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448711.1"
                     /db_xref="GeneID:2890070"
     CDS             complement(1103764..1108107)
                     /locus_tag="CAGL0K11396g"
                     /note="weakly similar to uniprot|P11978 Saccharomyces
                     cerevisiae YDR227w SIR4 silencing regulatory and
                     DNA-repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448711.1"
                     /db_xref="GeneID:2890070"
                     /db_xref="GOA:Q6FM33"
                     /db_xref="UniProtKB/TrEMBL:Q6FM33"
                     /translation="MAQELPQDQISQPAPNYSSTIESSHVTTNRTYEGQQYVVNSMNG
                     PTNSELVSPMNKTINLANQNLENGRTENIVYHNYPDTNGDPRVQKSVYPSNRIYVNNN
                     GRYIPAGEVYYGTDRSFPSYSHPRNRKPPLIPLVRYTKSACNTPKRQLEQDTTIVTNG
                     YVSPFESRLAYQKNGDSNFQNQLAAVPVREQNYGSNIQTYRDAHFRKQGNTRLLSLLR
                     SKVSSNSNYMNNSDQIPVQYQQTNQRINGVPSYGAYNIVNSYGHVMSAPQRQRRSDST
                     PQLLPITHPRHNEEIMPIHTRNSIPNTINDAHHLNSETNSHNVQILGYVAGNEIVPQL
                     TSNTSSPILEHPEDISRSNTISISSYPRQDAIYHEQGNTRTGGSFLTDVKQLLVQRSQ
                     SSSKSGSPRSPNHKTPSTTTSHPVRDTKSELNDRLITINNTTQDRADYEKLNKDSGIF
                     IAKTPQTNQSDDESRLSGTNNEIEKVSLGSAQVKRVASSHYKRSLSADGCMEGPHALR
                     DGIILSGSRQAPKISDDTGVKTKQTEKYNVIKQSTPRYPASTLDDKTKEIENKSNVPE
                     TKDLKSITSSDNSDTEYPIAHNKSKEISSQSITKDPEGLLDQQSLHEDYGEENPLPKI
                     TEPSRPVNDSSTVDKRVENKNENATQEDKTVVDNLIFKKQSHIQANDADNMKDKEVGY
                     QDIDHRSHLAATEDKSKSTDESSFKHSKRPLPESVVDDYLDHDDSSQPLHKKSKDAGY
                     GTEKEFQNEPHTAKDVEQISMSPKTKEVPEINSNSNNYTDSSSNETKNLTTPITTIDS
                     KPPEKNPEGTNVMGDDDLATKILNGFNQKALLDSSDERSKSNSSGVEHNEVPIALIRE
                     ENIPFSTNVATHKKNRLRKNSLSKSSDDPIVPDIGREANRRSVSRLLKPLSGVLIEDN
                     HYSTKNDNDQSDDNYGKMQMIYLSDEDSDIELSSDNNSVDSDRIPSYLRNYIGSSSTE
                     VTTSSLSESAQAFNFESEKRRIDRFLNIEVNEYLGTRNAYSRSSILEIIKKAVPQYLP
                     LEAGVDVSVTNDICSVDNYLSSSAHLYQQLHKRDKMVTDRSDYSFLKNTHFSESPAYY
                     AEVDNQEEGNDITSSKKGSNSDGVRTSKHKWRSQWLNHLRSAYVYFFADPESLLFDPE
                     ITTIIHVFVNEFKVNVAKVFSNDVDIIIKIEGNNSNNQLWKNLERKLVNIPKNIRVWD
                     VPKALNFIKNMDIQADEWPLISSVMIDDKSTEDVSSSNAYRKNSGNSLNSDHIRDNRQ
                     PVSRSDMSKSSDFRGQSPPRITHIESELDSPRYDIKIATNPIELESIPNIPLLVTKEI
                     MTTNDTHMSNVGTKSSQSPSALTSNEETSSASKTENPDKHEIIDSKTSPESADNDYKM
                     PHTAGYANSDSVYRIIIKELTDNLIQNETKSISLKTRLRSKEEELSNLAKKYRELEAK
                     YLKLQKESNED"
     gene            complement(<1110482..>1111150)
                     /locus_tag="CAGL0K11418g"
                     /db_xref="GeneID:2890071"
     mRNA            complement(<1110482..>1111150)
                     /locus_tag="CAGL0K11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448712.1"
                     /db_xref="GeneID:2890071"
     CDS             complement(1110482..1111150)
                     /locus_tag="CAGL0K11418g"
                     /note="highly similar to uniprot|P07170 Saccharomyces
                     cerevisiae YDR226w ADK1 adenylate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448712.1"
                     /db_xref="GeneID:2890071"
                     /db_xref="GOA:Q6FM32"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028587"
                     /translation="MSSSDSIRMVLIGPPGAGKGTQAPNLVERFHAAHLATGDMLRSQ
                     ISKGTELGLQAKKIMDQGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEK
                     LDNMLKERGTPLEKAVELKIDDELLVARITGRLIHPASGRSYHKLFNPPKEDMKDDVT
                     GEPLVQRSDDNEDALKKRLGAYHDQTEPIVDFYKKTGIWADVDASQPPETVWSAILKA
                     LGKN"
     gene            complement(<1112191..>1112586)
                     /locus_tag="CAGL0K11440g"
                     /db_xref="GeneID:2890072"
     mRNA            complement(<1112191..>1112586)
                     /locus_tag="CAGL0K11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448713.1"
                     /db_xref="GeneID:2890072"
     CDS             complement(1112191..1112586)
                     /locus_tag="CAGL0K11440g"
                     /note="highly similar to uniprot|P04911 Saccharomyces
                     cerevisiae YDR225w HTA1 or uniprot|P04912 Saccharomyces
                     cerevisiae YBL003c HTA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448713.1"
                     /db_xref="GeneID:2890072"
                     /db_xref="GOA:Q6FM31"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSGGKGGKVGSAAKASQTRSAKAGLTFPVGRVHRLLRRGNYAQR
                     IGSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPSASQEL"
     gene            <1114096..>1114491
                     /locus_tag="CAGL0K11462g"
                     /db_xref="GeneID:2890073"
     mRNA            <1114096..>1114491
                     /locus_tag="CAGL0K11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448714.1"
                     /db_xref="GeneID:2890073"
     CDS             1114096..1114491
                     /locus_tag="CAGL0K11462g"
                     /note="highly similar to uniprot|P02293 Saccharomyces
                     cerevisiae YDR224c HTB1 or uniprot|P02294 Saccharomyces
                     cerevisiae YBL002w HTB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448714.1"
                     /db_xref="GeneID:2890073"
                     /db_xref="GOA:Q6FM30"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTAPSSDGKKRTKARKETYSSY
                     IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIASEASKLAAYNKKSTISAREIQTAV
                     RLILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <1114883..>1115206
                     /locus_tag="CAGL0K11484g"
                     /db_xref="GeneID:2890518"
     mRNA            <1114883..>1115206
                     /locus_tag="CAGL0K11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448715.1"
                     /db_xref="GeneID:2890518"
     CDS             1114883..1115206
                     /locus_tag="CAGL0K11484g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448715.1"
                     /db_xref="GeneID:2890518"
                     /db_xref="GOA:Q6FM29"
                     /db_xref="UniProtKB/TrEMBL:Q6FM29"
                     /translation="MYFSFYFSLPLIRNVMCLLFKIQHLLIYQSCPNSRISYPKYKFI
                     VPNYKQSINSRFYLYKSNNLIITTVLHNKIHKRCNMMLKCRTFLSTLVNFFKAPTIDY
                     LPNSY"
     gene            <1115569..>1116714
                     /locus_tag="CAGL0K11506g"
                     /db_xref="GeneID:2890519"
     mRNA            <1115569..>1116714
                     /locus_tag="CAGL0K11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448716.1"
                     /db_xref="GeneID:2890519"
     CDS             1115569..1116714
                     /locus_tag="CAGL0K11506g"
                     /note="highly similar to uniprot|P26793 Saccharomyces
                     cerevisiae YKL113c RAD27 ssDNA endonuclease and 5 -3
                     exonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448716.1"
                     /db_xref="GeneID:2890519"
                     /db_xref="GOA:Q6FM28"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGIKGLNSIITEHVPSAIRKSDIKAFFGRKVAIDASMSLYQFLI
                     AVRQQDGGQLSTETGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPVLKSHELDKRT
                     SRREETEKKLAEATEEAEKMKHERRLVKVSKEHNDEAKKLLELMGIPYVNAPGEAEAQ
                     CAELAKKGKVYAAASEDMDTLCYRTPYLLRHLTFSEARKEPIHEINTEIVLQGLELTI
                     DQFIDLGIMLGCDYCDSIKGVGPVTALKLMKEHGSLEKIVEYIESGEANNKWKVPENW
                     PYKEARELFVKPDVIDANEIDLKWTPPKEDELIQYLCHEKKFSEERVRSGIKRLQKGL
                     KSGVQGRLDGFFKVVPKTKEQLEAAAAKAKLAKKNAKGAKGKVTKRR"
     gene            <1117256..>1118320
                     /locus_tag="CAGL0K11528g"
                     /db_xref="GeneID:2890520"
     mRNA            <1117256..>1118320
                     /locus_tag="CAGL0K11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448717.1"
                     /db_xref="GeneID:2890520"
     CDS             1117256..1118320
                     /locus_tag="CAGL0K11528g"
                     /note="highly similar to uniprot|P22936 Saccharomyces
                     cerevisiae YKL114c APN1 AP endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448717.1"
                     /db_xref="GeneID:2890520"
                     /db_xref="GOA:Q6FM27"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="InterPro:IPR018246"
                     /db_xref="UniProtKB/TrEMBL:Q6FM27"
                     /translation="MSTFARSTVSKYKFGAHMSGAGGISNSVTNAFNAGCNSFAMFLK
                     SPRKWVSPAFTQEEIAKFKENCEKYGYNPLTDILPHGQYFINLANPDPEKAEKSYESF
                     IDDLTRCEQLGVGLYNFHPGSTLKGDHDEQLKQLASYINKALGETKFVKIVLENMAGT
                     GNLVGSDLTDLRKVIDMVTDKSRIGVCIDTCHTFAAGYDIQSKDAFDKFWKDFDDIIG
                     YKYLASVHLNDSKAPLGANRDLHEKLGEGYLGLDFFRNLAHYDHLKGIPIVLETPQPD
                     DAGYAKEVKLLEWLETIEDGDTDKLKEMEAKNEELQKLGEKSRKEQMSKFEKKKTTTT
                     KKRKATGAADITAQLKKAKK"
     gene            <1118971..>1120587
                     /locus_tag="CAGL0K11550g"
                     /db_xref="GeneID:2890521"
     mRNA            <1118971..>1120587
                     /locus_tag="CAGL0K11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448718.1"
                     /db_xref="GeneID:2890521"
     CDS             1118971..1120587
                     /locus_tag="CAGL0K11550g"
                     /inference="similar to AA sequence:UniProtKB:P28708"
                     /note="similar to uniprot|P28708 Saccharomyces cerevisiae
                     YKL116c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448718.1"
                     /db_xref="GeneID:2890521"
                     /db_xref="GOA:Q6FM26"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016240"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:Q6FM26"
                     /translation="MSEQYLHNDPKTPRIPQTGFDIPEGTMTGFNGTSEGNTSVAGSI
                     DELTSRDTNVSEFGASVPDITMNTEVGADETEDVKVVTPLSVSIPTFENVATLPTPMV
                     YSPMSPAVLNKSPQAIKSTEMKINIPKRRAQYKPNLDGLIGSKPIRIISEVVPTPDTA
                     QQRVISLPTVSEETTTENDKFPIHHDGTALADDSNSQEDDIVLMGYRIGEYTKALQWR
                     KVKTIGVGNFSDVLLYESIDQNDPELLQVAVKRIRYPQELKDIRNRSANFDELLGRLD
                     NSLTREISVLNSLNHPCIVKLFGVNDPLFIESCRPLYDMLKLRQKLVPCNLIMSYCVG
                     GDLLAAMSQCSGNLDRWLIQRLFTEILLGVKYLHEHNIIHRDLKLENILLKVPLGNIR
                     SLKDKDIYYEHSFVEIADFGLCKKIEPDELCTARCGSEDYVSPEILMGVPYDGHLSDT
                     WAMGVILYSLLEDRLPFDPLPGASIRQKNRPTAHRIARFEWKWHKMIEDDSSAKEIVN
                     NTLTRKNQRWNCNDIFNSAFIQEIVGSLQF"
     gene            complement(<1120965..>1121621)
                     /locus_tag="CAGL0K11572g"
                     /db_xref="GeneID:2890522"
     mRNA            complement(<1120965..>1121621)
                     /locus_tag="CAGL0K11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448719.1"
                     /db_xref="GeneID:2890522"
     CDS             complement(1120965..1121621)
                     /locus_tag="CAGL0K11572g"
                     /inference="similar to AA sequence:UniProtKB:P28707"
                     /note="similar to uniprot|P28707 Saccharomyces cerevisiae
                     YKL117w SBA1 Hsp90 Associated Co-chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448719.1"
                     /db_xref="GeneID:2890522"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:Q6FM25"
                     /translation="MSKVLTPEVAWAQRSSESDAEKNYLLITVSIPDCESPEVKIEAG
                     SLDLEAQSRGHVGDEHKHTYKLHIDFYKDIVPEKSLHKIANGQHYFLKLFKKDLELEY
                     WPRLTKEKIKYSNIKTDFDKWVDEDEQETAADTGMPGDMDFSQLMGGMGGAGMGGMGD
                     MGGMPGMGGMGGPGGPSMEQLQSMLSQQGGLGGLGGEDLGDFGGEDEDEEEIEEIKKD
                     "
     gene            <1121873..>1122502
                     /locus_tag="CAGL0K11594g"
                     /db_xref="GeneID:2890523"
     mRNA            <1121873..>1122502
                     /locus_tag="CAGL0K11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448720.1"
                     /db_xref="GeneID:2890523"
     CDS             1121873..1122502
                     /locus_tag="CAGL0K11594g"
                     /inference="similar to AA sequence:UniProtKB:P32341"
                     /note="similar to uniprot|P32341 Saccharomyces cerevisiae
                     YKL119c VPH2 H+-ATPase assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448720.1"
                     /db_xref="GeneID:2890523"
                     /db_xref="GOA:Q6FM24"
                     /db_xref="InterPro:IPR021013"
                     /db_xref="UniProtKB/TrEMBL:Q6FM24"
                     /translation="MFEVAVGSALRRALESAVEAAVAAGDGDAKVRLLELIERGSVPC
                     GELAELCRAWGSEVSVSEALSGLEFKFKDRETRKPSPEFQAQLARLRALQQEQEYQQI
                     VKNRDLAITTESEATPAQINREIKEQVTTVFNIIISVISVVVAIWYWSRTSAGLAIHH
                     RIFLCMFFGILVLVAEVVVYSSYLSKIEEAKASEKSKKEHKKLVQKYVF"
     gene            complement(<1122663..>1123625)
                     /locus_tag="CAGL0K11616g"
                     /db_xref="GeneID:2890524"
     mRNA            complement(<1122663..>1123625)
                     /locus_tag="CAGL0K11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448721.1"
                     /db_xref="GeneID:2890524"
     CDS             complement(1122663..1123625)
                     /locus_tag="CAGL0K11616g"
                     /note="highly similar to uniprot|P32332 Saccharomyces
                     cerevisiae YKL120w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448721.1"
                     /db_xref="GeneID:2890524"
                     /db_xref="GOA:Q6FM23"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FM23"
                     /translation="MAKGEDKIQKSAAQKVSKFGSFTAGGLAACIAVTVTNPIEVVKI
                     RMQLQGELMAANQRIYTNPFQAMGVVFRNEGIRGLQKGLVAAYIYQIALNGSRLGFYE
                     PIRAVMNKTFYPDQESHKVQSVGINVFAGAASGIIGAVMGSPLFLVKTRLQSYSNAIK
                     IGEQTHYTGVWNGLKTIYMTEGVKGLFRGIDAAILRTGAGSSVQLPIYNTAKNFLLRN
                     DIMEDGPSLHLTASTISGLGVAVVMNPWDVILTRIYNQKGDLYKGPIDCLVKTVKIEG
                     ITALYKGFEAQVFRIGPHTILCLTFLEQTMKLVHAFESKVLGHN"
     gene            complement(<1124172..>1125950)
                     /locus_tag="CAGL0K11638g"
                     /db_xref="GeneID:2890525"
     mRNA            complement(<1124172..>1125950)
                     /locus_tag="CAGL0K11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448722.1"
                     /db_xref="GeneID:2890525"
     CDS             complement(1124172..1125950)
                     /locus_tag="CAGL0K11638g"
                     /note="weakly similar to uniprot|Q03177 Saccharomyces
                     cerevisiae YMR102c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448722.1"
                     /db_xref="GeneID:2890525"
                     /db_xref="GOA:Q6FM22"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FM22"
                     /translation="MIEEDTESVRSGTYSADLQPLDFDARSRVQINDVTNFDHDQFEK
                     YLVRPDYVKLLKKQADCDILPFKRLFLAQELQLGGSSVTVSRFSKDGTLFCVGCKDGS
                     LMVLKVLQTKSEKLGISDAECEETGKRKIQYAPIFNELDIVSLNSDEKVHREVLDLSW
                     SVNHFLLVSSVDSYVTLWTPFDGNRPIMRFDHPDLVTSAKFIEADDRFFISGCLDHCV
                     RFWSVTDNRVEYSFNCEEPINVVTVSPGMSHFTVVGTFGGYIYVFSTMGLKLIDKFHI
                     INGRSIDGNLRNGADKIKITGIEWIVTDNRLDEIQEDNEYSTARIVVTSGDERIRVFK
                     LTEGGYHNLELKGFHCEQFRHRAQLCIWDDKPFIYCSSEDQWFYVWRLNYQDLMLTRA
                     TNEILYASTTHRRRRTERILGHTKEVTSSVLDMFFSTYAAADVEMGSNDKGMRHGQQQ
                     SMTFSHESTVTQTMPIGQPTGSTTKSTIEEQREENYILRHSHTFSFHAHDHPITTVNI
                     APIGTIAAVTQSNDFIYEFTCRCYSNNVELRDVEMDSCDIIGPIVVTTDSVGKLRVFR
                     TDLSDIARETLINVLHSAMETKQSTF"
     gene            <1126526..>1127089
                     /locus_tag="CAGL0K11660g"
                     /db_xref="GeneID:2890526"
     mRNA            <1126526..>1127089
                     /locus_tag="CAGL0K11660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448723.1"
                     /db_xref="GeneID:2890526"
     CDS             1126526..1127089
                     /locus_tag="CAGL0K11660g"
                     /inference="similar to AA sequence:UniProtKB:P32342"
                     /note="similar to uniprot|P32342 Saccharomyces cerevisiae
                     YKL122c SRP21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448723.1"
                     /db_xref="GeneID:2890526"
                     /db_xref="UniProtKB/TrEMBL:Q6FM21"
                     /translation="MSVKPIDTFIENSVKLFEANPSGSSITISYHGGAKADPVVFRTH
                     NPHLSTTYKYQTKMNKEVSRVLNALGPRGVSMNPISKIAKRRNYLDVVKKAKQMNNSK
                     ISKKQAKLIRKAQTNPIVNTIGIGKLIANEDIKEVKTESTSGGAGNKKTKQKKNKNNK
                     DSTPVVNTSANAQSKGKNKKNKNKKKR"
     gene            complement(<1127317..>1127865)
                     /locus_tag="CAGL0K11682g"
                     /db_xref="GeneID:2890527"
     mRNA            complement(<1127317..>1127865)
                     /locus_tag="CAGL0K11682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448724.1"
                     /db_xref="GeneID:2890527"
     CDS             complement(1127317..1127865)
                     /locus_tag="CAGL0K11682g"
                     /inference="similar to AA sequence:UniProtKB:Q12421"
                     /note="similar to uniprot|Q12421 Saccharomyces cerevisiae
                     YDR022c CIS1 involved in suppression of CIK1 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448724.1"
                     /db_xref="GeneID:2890527"
                     /db_xref="GOA:Q6FM20"
                     /db_xref="InterPro:IPR018621"
                     /translation="MEPLSLTVYDRNIWHLFKKEEGAPQAMFPTNIKYIFEDDDDVAD
                     VDDLVFQQQQPDSELENVIIVEIDGAGQLENVELISDQYEMLSYRRERPVSLASQRSL
                     SWLTSGNDTGGDAGKKSGDISDPAAGPDVPREAPLSIELELVSEFKDYRNLNLEDLKL
                     DELTRIFCIQNKQLQMISDALN"
     gene            complement(1128047..1128120)
                     /gene="tRNA-Val (TAC)"
                     /locus_tag="CAGL0K11704r"
                     /db_xref="GeneID:2890528"
     tRNA            complement(1128047..1128120)
                     /gene="tRNA-Val (TAC)"
                     /locus_tag="CAGL0K11704r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2890528"
     gene            <1128486..>1129862
                     /locus_tag="CAGL0K11726g"
                     /db_xref="GeneID:2890529"
     mRNA            <1128486..>1129862
                     /locus_tag="CAGL0K11726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448725.1"
                     /db_xref="GeneID:2890529"
     CDS             1128486..1129862
                     /locus_tag="CAGL0K11726g"
                     /note="highly similar to uniprot|P07284 Saccharomyces
                     cerevisiae YDR023w SES1 seryl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448725.1"
                     /db_xref="GeneID:2890529"
                     /db_xref="GOA:Q6FM19"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:Q6FM19"
                     /translation="MLDINQFIEEKGGNPELIRQSQKARYASVELVDEIIADYKDWVK
                     TRFELDELNKKLNKLQKDIGMKFKAKEDASELLAEKDKLSEEKKQLIEKEQKEDKDLR
                     QKVNQIGNIVHPSVVVSNDEENNELVRTWKPEGLADVGPVASVTGKPAALSHHEILLR
                     LDGYDPERGVKISGHRGYFFRNYGVFLNQALINYGLHFLASKGYIPLQAPVMMNKEVM
                     AKTAQLSQFDEELYKVIDGEDEKYLIATSEQPISAYHSGEWFEKPQEQLPIRYVGYSS
                     CFRREAGSHGKDAWGVFRVHAFEKIEQFCITEPEKSWEEFDRMIANSEEFYQSLKLPY
                     RVVGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRSGIKKMND
                     REKKYVHCLNSTLAATQRALCCVLENYQTEDGLIVPEVLRKYIPGEPEFLPFVKELPK
                     NSTSNKKK"
     gene            <1131241..>1132257
                     /locus_tag="CAGL0K11748g"
                     /db_xref="GeneID:2890530"
     mRNA            join(<1131241..1131285,1131832..>1132257)
                     /locus_tag="CAGL0K11748g"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_448726.1"
                     /db_xref="GeneID:2890530"
     CDS             join(1131241..1131285,1131832..1132257)
                     /locus_tag="CAGL0K11748g"
                     /note="highly similar to uniprot|P26781 Saccharomyces
                     cerevisiae YDR025w RPS18A or uniprot|P26781 Saccharomyces
                     cerevisiae YBR048w RPS18B"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_448726.1"
                     /db_xref="GeneID:2890530"
                     /db_xref="GOA:Q6FM18"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:Q6FM18"
                     /translation="MSTELTVQSERAFQKQPHIFSNPKFKTSKRTKRWYKNAGLGFKT
                     PKTAIEGSYIDKKCPFTGLVSIRGKILSGTVVSTKMHRTIIIRRDYLHYVPKYNRYEK
                     RHKNVPVHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVAAATGKANKQFHKF"
     gene            complement(<1132799..>1134454)
                     /locus_tag="CAGL0K11770g"
                     /db_xref="GeneID:2890531"
     mRNA            complement(<1132799..>1134454)
                     /locus_tag="CAGL0K11770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448727.1"
                     /db_xref="GeneID:2890531"
     CDS             complement(1132799..1134454)
                     /locus_tag="CAGL0K11770g"
                     /inference="similar to AA sequence:UniProtKB:Q12457"
                     /note="similar to uniprot|Q12457 Saccharomyces cerevisiae
                     YDR026c or uniprot|P21538 Saccharomyces cerevisiae YBR049c
                     REB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448727.1"
                     /db_xref="GeneID:2890531"
                     /db_xref="GOA:Q6FM17"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6FM17"
                     /translation="MDAPGEDRNSMKTAESNPEKEAISWLYLKNVEEGNQEGNEDKGE
                     DEIGSQIADDDTEVSIAALKAVGIIDKKRKREEREKKKSKKSNKKKRHSKKADDQDAH
                     SNVDPALSGLEMALDVTDNVTKNYNTFSGNEISDEISHQFSKSNGKVGISLSENGTNT
                     FSYADGINTTNNDQSIKDTEKNYNDISNKNKEKIANRSVPSTIKGAGELDDAFLEKGI
                     IDSKVLKPLTDKLDSSDGILSSSLQSAGRGFDAEEDAKLDAYINEYQKMNSFTREQLC
                     DRIWNNNGQRDDFWKTICKILPYRTRSSLYKHVRRRYHIFEQRGKWTREEDEILAKLC
                     LEKEGQWSVIGKEMGRMPEDVRDRWRNYIKCGEKRASQKWTAEEETKLKEVIGTMFKE
                     AAEYHQKRETEMDGIHDGIIDAEDKNNHLLTRGPKGRVLNDKPGFNEVINWTVVSERM
                     GGTRSRIQCRYKWNKMIKDEALSKVKNVTDEEGRWLLKTLQNHNYTHQSHIDWNSIAT
                     EQPESNKWSPLELRLCYEKLREPIDNIKNKTVTAICTELLSKE"
     gene            complement(<1135044..>1137698)
                     /locus_tag="CAGL0K11792g"
                     /db_xref="GeneID:2890532"
     mRNA            complement(<1135044..>1137698)
                     /locus_tag="CAGL0K11792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448728.1"
                     /db_xref="GeneID:2890532"
     CDS             complement(1135044..1137698)
                     /locus_tag="CAGL0K11792g"
                     /inference="similar to AA sequence:UniProtKB:Q12071"
                     /note="similar to uniprot|Q12071 Saccharomyces cerevisiae
                     YDR027c LUV1 interacts with the beta-tubulin binding
                     protein RBL2P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448728.1"
                     /db_xref="GeneID:2890532"
                     /db_xref="GOA:Q6FM16"
                     /db_xref="UniProtKB/TrEMBL:Q6FM16"
                     /translation="MSESSKRGDKEVPANIVVSNTSGKDSVIPSNTPSSSIADDDSSS
                     LNDDLRSVSVSNQVKSSSRISMDSMSVRRSFESTSQFGRPGHGRPFAFDNMRHSGSMD
                     YSPLGNNAIFEVVMNTRRKNWLSYPTVSDIPPITLTKNSLPTEWKEKLDVYRKLINSE
                     YSVFKATNNIKSANRMQQIRQLSDDKLDENDALEDDKEVTSWDTQLKNAGVPDFYMDD
                     NFKLDNPRVFHKVLEGVELQLENFSVSGAEDRVIGYGNLRRNLNDYLDVVENLLIKEI
                     SKSSHKFYRTLSEVDDLEVSIKKGLGLLDELSKSLVNVERNEIEVRLAKLKKIFRRRN
                     VEKLEQGLLQVRLIKEKIRECQEIYEKEELQKCLDLTSSINNLIHGDNSDKVVQAWTN
                     EWPFKLLNLKSVPALSECREFITNIAIEIGGKYSLMLCDILIKDIRDYCMKKEGSFTI
                     EYIRTTNKEKEQYNFSEDLRNSIVDYIRKLYSCEELTGAFELYQERTLAELKSILKGY
                     LPQESSKPKSDENIASTSTSAASGSRLAQLIREQTNDEFTNMLQRIFSHEILALRRLY
                     GHQKLLLDISLTEINSVPEPNENQHNMITQLDIRQGINEIIHVIQLRTGKIIAVRRDS
                     TSSIRFNYFLRFYDVCVTFIQECEALSGEFLTKYLSDVLAAQVKSYISQFFPRNSKKL
                     QSMIVNEKWTPAIVNPNIQKSVNDMLTSIDIDPLEWTKLPSLLVNDPNDGEQESGSEQ
                     PQQGHRKSVVVGDKTFVASEPLLSTLIYLNELMILSLNLPSIYLPSLERQAYDFLKFF
                     NQTSMNSVAPQGQAIGKTTKNLSIMGESFDCLSEFIDILQKFYQRLGHNFKDYNPYPD
                     TYYNDLRTRYRTASDRLYQAHAPPPPTA"
     gene            complement(<1138550..>1141576)
                     /locus_tag="CAGL0K11814g"
                     /db_xref="GeneID:2890533"
     mRNA            complement(<1138550..>1141576)
                     /locus_tag="CAGL0K11814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448729.1"
                     /db_xref="GeneID:2890533"
     CDS             complement(1138550..1141576)
                     /locus_tag="CAGL0K11814g"
                     /inference="similar to AA sequence:UniProtKB:Q00816"
                     /note="similar to uniprot|Q00816 Saccharomyces cerevisiae
                     YDR028c REG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448729.1"
                     /db_xref="GeneID:2890533"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:Q6FM15"
                     /translation="MSTNLADYFKNQNASSDKKEDSNKKQLPYNDYDDMGPSVSMAVE
                     AENEDDFKKSTFNLKRTRSMGLLDDFIDPTKKPSEKSSDDEADSKLVDDEPASHGTES
                     YYNEDISHYDHLHEQSASVSPPPADNDNYFIPQDDNDVVVEPERHVDYLSHQWKESEI
                     SNSWKYIILKKKKRDVDLVNAARLENASWRTWAKARNHLKTVSPEILNWSKDSDVTWL
                     YGPIVRDQHKNKKNKRKENGDIETDSEHEISIGYGSDDETSKRIPSKGKRSVTPKPIL
                     KKRSVTEIIEENAQWKLNEARKHINDMKHASVVMDPNGLKDVHDDYDALAARVNAQYY
                     TTPRSRPGSGAPSRENSESNLHNPPRSSSTTPNYAVADSKSFHSDTPINEQSSVKSGS
                     LVTPIQSPNVVASPAQDIVAPQAKQPLSSILSSKYSEKGTGQEQKKSAPSRHIHFNDR
                     VEQCMALRYPSSDSEVDSDYESNSNNLHQTSSVSPSSAPSNNNIRFVRKGEKGQRNQE
                     SKIPESPISDDSVSSPSDDNEDEEDYGGLFINARFSRRSDSTVHSPVTDNSSIGSSVT
                     SRTGVRPIIKLLPATTLNYGSDEESETSDIYNYGNAVSHNVNTSRGYDYIYDYNSVYT
                     GDTSSFLPLDHCDIVDVPEGIGLDTSITESDHTGYDINSPLDKRTNIMIPSPTDTPPF
                     LSKASKSPSSYNSSSDSGKSTPLRQNFLSNENHGYSSSDSEQQFIEDSQLNSSDEDED
                     SEDSDEDDESDDGLTLKRTVTLGKSGTSTSIKDLNMPNEHNADFIPPVKTRSFITGET
                     IDDATREKNNFISNSSSPGIPLKRNQSSKSFIFNSDSNDEDSSDNTSDSASFFGIETP
                     QPVNHQTNATAKSVSGHKNVIPPSNVGPISSIEVSKNFKIPSNTAPDVASSDVAIKGS
                     FSPRYNSVKSVINKEGILSDKSNSPSPQQSSTNIMSKNNFSHSGTGQSFSDNENPDTN
                     KDLSNESLQKMMQSAKNAASKYLNSWKRPENRREDK"
     gene            complement(<1143042..>1144610)
                     /locus_tag="CAGL0K11836g"
                     /db_xref="GeneID:2890534"
     mRNA            complement(<1143042..>1144610)
                     /locus_tag="CAGL0K11836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448730.1"
                     /db_xref="GeneID:2890534"
     CDS             complement(1143042..1144610)
                     /locus_tag="CAGL0K11836g"
                     /inference="similar to AA sequence:UniProtKB:Q12021"
                     /note="similar to uniprot|Q12021 Saccharomyces cerevisiae
                     YDR030c RAD28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448730.1"
                     /db_xref="GeneID:2890534"
                     /db_xref="GOA:Q6FM14"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FM14"
                     /translation="MNKLAFDRLFENHASSINDALHTGDSLKVYSHCPQRAHLSPGVS
                     TLATDSTSGNLLLSGSYDGSVSLWSLDGKVQDNSLVNKRLEYITRKAHDGTAQNTTHI
                     KSLRPSLHKRQKTQDPRAVRHAARHAGPRAASSPVHAFETRAYKYRMYRQSSSPQGNP
                     LGSTPGTARASPASHLQQAGEPPEEDPHRAHTYGITCLAWYGPDNGIFLTGSNDHAVK
                     LWDTASFEAVKCYNFDTRVNDLHSTSAAQSLIAVATDDYYPRVIDLRQSAADEAGAMQ
                     LGAKSLMRDPMLCARFHPTNGQLLATGDAGGNCKLWDLRMVGKPWGNMASMRPGNPGV
                     TVANSGLGSASNSKAHLRSCNALTWSPGGSELVTMGTDGRIYCWSPFQLNAESIVDVS
                     GTATADRQIGPIDLEYTGCRTIGGSTIDPSRNKEQHKYRTSQRLEWFDNYLLVNTDYA
                     EIQIYEIDTGKYLDKISYDYENDLQHTKSKLVKTIKRNKKLIGGMCLQKFIHNGVGLR
                     LYLGTNDGYVVEMS"
     gene            complement(<1144920..>1145516)
                     /locus_tag="CAGL0K11858g"
                     /db_xref="GeneID:2889958"
     mRNA            complement(<1144920..>1145516)
                     /locus_tag="CAGL0K11858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448731.1"
                     /db_xref="GeneID:2889958"
     CDS             complement(1144920..1145516)
                     /locus_tag="CAGL0K11858g"
                     /note="highly similar to uniprot|Q12335 Saccharomyces
                     cerevisiae YDR032c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448731.1"
                     /db_xref="GeneID:2889958"
                     /db_xref="GOA:Q6FM13"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:Q6FM13"
                     /translation="MPKVAIIIYTLYGHTATIAEAEKKGVEAAGGQADIFQVQETLSP
                     EVVKALGGAPKPDYPIATQDTLTEYDAFLFGIPTRFGNFPAQWKAFWDRTGGLWAKGA
                     LHGKVAGAFVSTGTGGGNEATIINSLSTLAHHGIIFVPLGYKNAFPELTNLEEVHGGS
                     PWGAGTIAGADGSRSPSALELKIHEIQGKTFFETVKKF"
     gene            <1146885..>1147835
                     /locus_tag="CAGL0K11880g"
                     /db_xref="GeneID:2889959"
     mRNA            <1146885..>1147835
                     /locus_tag="CAGL0K11880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448732.1"
                     /db_xref="GeneID:2889959"
     CDS             1146885..1147835
                     /locus_tag="CAGL0K11880g"
                     /inference="similar to AA sequence:UniProtKB:P38079"
                     /note="similar to uniprot|P38079 Saccharomyces cerevisiae
                     YBR054w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448732.1"
                     /db_xref="GeneID:2889959"
                     /db_xref="GOA:Q6FM12"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:Q6FM12"
                     /translation="MSYVDLYKRGGNEAVKINPPTGADFHITSRGSDWAWAVFCVMFF
                     CAIVMVLLMFRKTANDRLAYYTAIAPCVFMGIAYFTIASNLGWIPVRAKYNHVRTSTQ
                     QQHPGVRQIFYARYVGWFMALPWPVIQASLMGKTPIWQIAFNIAMTEVFTVCFLIAAC
                     VHSTYKWGYMTIGCGGAIVAMISVMTTTRHLVRAKKDGELWKGFNIYFGLVMFFWAIY
                     PICFGITDGGNVLQPDSALIFYGILDIILYAFLPCLWVPIASYIGISNMGYNFSDAEA
                     GMTTSNTMATVASPAMSPTPKTPKTPKTPATGKKAKKSMA"
     gene            complement(<1149210..>1151705)
                     /locus_tag="CAGL0K11902g"
                     /db_xref="GeneID:2889960"
     mRNA            complement(<1149210..>1151705)
                     /locus_tag="CAGL0K11902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448733.1"
                     /db_xref="GeneID:2889960"
     CDS             complement(1149210..1151705)
                     /locus_tag="CAGL0K11902g"
                     /inference="similar to AA sequence:UniProtKB:P40971"
                     /note="similar to uniprot|P40971 Saccharomyces cerevisiae
                     YDR034c LYS14 transcriptional activator of lysine pathway
                     genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448733.1"
                     /db_xref="GeneID:2889960"
                     /db_xref="GOA:Q6FM11"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6FM11"
                     /translation="MLSNIGDPGNTGEQRSARSSTDDQPPSDYYLSPVSIQGNTPQSR
                     QLHQSLSNITNQSNTELNNMPSSIDVKFALSYGRSMSNGSNNINGTRTSTPGSTGTAV
                     NSTLSNSVYNDRENFHSYSASSPAQHPNGNFQNDYRNLATDSMTTSNVSKSGTPLSRS
                     EYEKDEQNHSANGTPVIKPNINVISTIKDAEGNTVKRKYSRNGCAECKRRRMKCDESK
                     PKCWQCTRLNRDCVYILNPKNKKRKTSKGSDRVKEERCEEQKLVNGQLVTSNNEPPQA
                     TITPQLDIRHSPITPISSKSAETKNPEIPNVLPTSDLMDGFDTNLLMQNLNDMVNMKL
                     HDSFLINDNSQEFDLPDFDLPDLLSSTTSASSSVPISFLVNNIITFNSKLTSFRLGGI
                     HDKYLQVFYYDCLDSIAPFFQDQANPLRDIILSFARNETYLLSAILATGASIVHRKSN
                     DSQDERNYCAYLSRCLSLLNEQFQNEANVLNKIEPIILTVIMLAWDCIYTMDSQWRSH
                     LKGVTDLFKKITKGNSSKVLNVAKCWFKVMETFAGVSTVLGGSLTEEADIDAIFDPHD
                     YQYVDSLKFLNIMTPLNEFNLLRGHKEEFDLVIRDVIKSLSVIRNVEKKEFSNDDKNG
                     FSKRNLDYLLWSSRNTDLSTKDALSYFKTQKILVQIDKQLDYEFIDKSGIIPPTHQSH
                     PKNSGIHDNAIDLVTLRNGEEIAISWYDISHQTQVLSFLLIVLLKLLGIPKESLSIQD
                     VVKRIMSFFKFLDSDNPPKNLRTCYSNFAVLIAGMNAMDEETRDIVRSYYKLNGSFFR
                     RLTEHNLNRLERVWYGKESEANYELADQDVLTW"
     gene            1152762..1152845
                     /gene="tRNA-Leu (TAA)"
                     /locus_tag="CAGL0K11924r"
                     /db_xref="GeneID:2889961"
     tRNA            1152762..1152845
                     /gene="tRNA-Leu (TAA)"
                     /locus_tag="CAGL0K11924r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:2889961"
     gene            <1153568..>1153891
                     /locus_tag="CAGL0K11946g"
                     /db_xref="GeneID:2889962"
     mRNA            <1153568..>1153891
                     /locus_tag="CAGL0K11946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448734.1"
                     /db_xref="GeneID:2889962"
     CDS             1153568..1153891
                     /locus_tag="CAGL0K11946g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448734.1"
                     /db_xref="GeneID:2889962"
                     /db_xref="GOA:Q6FM10"
                     /db_xref="UniProtKB/TrEMBL:Q6FM10"
                     /translation="MGMGGMPNTGMNMMSQMQTGVQLGGTMPGTMQGRRRGGGSCNDC
                     ICCIELCGSCLTAWFAPSPMEVRQSATNNPIPNDRIAEANKPVPPPAYEPVLDNRTTV
                     NHTHS"
     gene            complement(<1154025..>1155512)
                     /locus_tag="CAGL0K11968g"
                     /db_xref="GeneID:2889963"
     mRNA            complement(<1154025..>1155512)
                     /locus_tag="CAGL0K11968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448735.1"
                     /db_xref="GeneID:2889963"
     CDS             complement(1154025..1155512)
                     /locus_tag="CAGL0K11968g"
                     /inference="similar to AA sequence:UniProtKB:P28817"
                     /note="similar to uniprot|P28817 Saccharomyces cerevisiae
                     YDR036c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448735.1"
                     /db_xref="GeneID:2889963"
                     /db_xref="GOA:Q6FM09"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6FM09"
                     /translation="MLRAPAAGFPRLIQKTSYRAFSSTLAKMSESETPVLFSVQETAR
                     IVTLNRPKKLNALNEEMCSSIFNTLTEYSKSDAANLILIKSNNSPRSLCAGGDVASVA
                     QSNLDKNFESSINCFKSEYSLNFQLATYQKPVVVFMDGITMGGGVGLSIHTPFRIATE
                     NTKWAMPETDIGFFPDVGTTFALPRLITLANKNAQMALYLCLTGDVISGEDAYLLGLA
                     SHYIPHSNLEKLQTRLGELRPALDIKFFSDEFFDSVNLAIEEFTTPLPTNHKFKFSKD
                     QLEVIEKCFDISSGESINAIFSKLEAFEGTPEMMQFARDTKKKLESKSMTSMQVGIRL
                     MQENSRDDIESALKRDLTTAVNMCVNDSGIAEFSAATKHKLLDKQKVPYPWKQRTELT
                     PQQVTSLIAPKPSLPVSLIRNNSNVTWSQYPHSLKYQLPRDYEIEQQVEKLIKRGPIK
                     KNDVVKYFTDFNPQTKAKLGVEQYCDLLFDWKLSFDHASGLRWKK"
     gene            complement(<1156224..>1159199)
                     /locus_tag="CAGL0K11990g"
                     /db_xref="GeneID:2889964"
     mRNA            complement(<1156224..>1159199)
                     /locus_tag="CAGL0K11990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448736.1"
                     /db_xref="GeneID:2889964"
     CDS             complement(1156224..1159199)
                     /locus_tag="CAGL0K11990g"
                     /note="some similarities with uniprot|P38080 Saccharomyces
                     cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448736.1"
                     /db_xref="GeneID:2889964"
                     /db_xref="GOA:Q6FM08"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FM08"
                     /translation="MSDLSKTPSLDVRGENSKESQELRGKSSANLNAPGTPVQTVVPS
                     VVPPVAQPVAQPVVAPSAMKDIKSQTPVQVPQTQVKPQSIPPVAQPQIEEKFPAGKVV
                     TVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLKPGSPACLKRVLV
                     QDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFEVLLLMELCPN
                     KSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIENVLVDANNN
                     FKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPINEKSDIW
                     ALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPNSYSSKLINLIIVMLAENPSLRPNI
                     YQVLYYLSEVTNREVPPTVLSDKYGQGPYNFEKYTRFQKESQQVQLQLSTLQAKINDP
                     NSTMQPADWELYDRMYMSAFTIVPQLPVSDRKIVAQNQFIQPGQQQQSQIPQISNRPI
                     QSNIPQIQQMPQLQVPPSQASNEFGTDDENFKTSRSKSNQLGYQKENNDPKSGAIPNF
                     DGDPFNSTLPRKDSNAEYRRSQLIVQGNIGPSRSMGSVSPVQSPVNYNQNHPNFQALN
                     LERGMEKPVNYHKGNPFEQDMPGNNGKFVQKGQPIQINQQPLYVGASSQMGQNMNKNQ
                     EKRSSDLEGKYNNTSSSNFDPSLLRENVPNKSSMSHLLDKNGNQVELPPRPKRSSMQS
                     QTMPSDNVPTNATSNHTRTRSVDAHKVSFEGSSDRGFSKGNTNNKVQDKSAQNILEEE
                     GFFENEYGNRDYRKEVFTGQALRTINSSPQSARSDNSSHPSNAEFAQLGKKTLQGNFE
                     KPNKKTLDIDYQEVDFSPALSDNTTRQGYFEGQSPGFSDQLSYDLNDALEFDRRGKDS
                     RHMTPGAFDTGGLQKLKSSSLNRSQGSISSGANEWPESSDRLHSARKSLDLDRARQLH
                     NYQSDKKKRSLFNMFKEKK"
     gene            <1159993..>1161768
                     /locus_tag="CAGL0K12012g"
                     /db_xref="GeneID:2889965"
     mRNA            <1159993..>1161768
                     /locus_tag="CAGL0K12012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448737.1"
                     /db_xref="GeneID:2889965"
     CDS             1159993..1161768
                     /locus_tag="CAGL0K12012g"
                     /note="highly similar to uniprot|P15180 Saccharomyces
                     cerevisiae YDR037w KRS1 lysyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448737.1"
                     /db_xref="GeneID:2889965"
                     /db_xref="GOA:Q6FM07"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FM07"
                     /translation="MSQEEATKAATEGVANLHLDEVTGEMVSKSELKKRMKARQVEAK
                     KAAKKASAQPKPEPKKKKNDLLADLDPSQYFEARSRQILELRKTHSPNPYPHKFQVSI
                     SNPEFLAKYAHLKRGETLPNEIVSIAGRIHAKRESGSKLKFYVLHGDGVEVQVMSQLQ
                     DYADAEAYENDHDLIKRGDIVGVEGYVGRTQPKKGGEGEISVFVKRIELLTPCLHMLP
                     ADHFGFKDQETRYRKRYLDLIMNKDSRKRFITRSKIIKYIRKFLDNRDFIEVETPMMN
                     VIAGGATAKPFVTHHNDLDMDMFMRIAPELFLKELVVGGMDRVYEIGRQFRNEGIDMT
                     HNPEFTTCEFYQAYADVYDLMDMTELLFSEMVKEINGSYVIKYHPDPNNPEKEMELNF
                     ARPWKRINMIEELEKRFNVTFPAGDQLHTKETGEFLQKVLKDNNLECPPPITNARMLD
                     KLVGELEDTCINPTFIFGHPQMMSPLAKYSRDQPGLCERFEVFVATKEICNAYTELND
                     PFDQRARFEEQARQKDQGDDEAQLIDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSN
                     TIREVLLFPTLKPDVLRDEVKKEEN"
     gene            complement(<1162128..>1165391)
                     /locus_tag="CAGL0K12034g"
                     /db_xref="GeneID:2889966"
     mRNA            complement(<1162128..>1165391)
                     /locus_tag="CAGL0K12034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448738.1"
                     /db_xref="GeneID:2889966"
     CDS             complement(1162128..1165391)
                     /locus_tag="CAGL0K12034g"
                     /note="highly similar to uniprot|P13587 Saccharomyces
                     cerevisiae YDR040c ENA1 or uniprot|Q01896 Saccharomyces
                     cerevisiae YDR039c ENA2 or uniprot|Q12691 Saccharomyces
                     cerevisiae YDR038c ENA5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448738.1"
                     /db_xref="GeneID: