GenomeNet

Database: RefSeq
Entry: NC_006035
LinkDB: NC_006035
Original site: NC_006035 
LOCUS       NC_006035            1455689 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome L complete sequence.
ACCESSION   NC_006035
VERSION     NC_006035.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1455689)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1455689)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr
            E-mail:david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380958.
            On Aug 5, 2010 this sequence version replaced NC_006035.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1455689
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="L"
     gene            complement(<736..>5931)
                     /locus_tag="CAGL0L00157g"
                     /db_xref="GeneID:9488036"
     mRNA            complement(<736..>5931)
                     /locus_tag="CAGL0L00157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999538.1"
                     /db_xref="GeneID:9488036"
     CDS             complement(736..5931)
                     /locus_tag="CAGL0L00157g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999584.1"
                     /db_xref="GeneID:9488036"
                     /db_xref="GOA:B4UN41"
                     /db_xref="UniProtKB/TrEMBL:B4UN41"
                     /translation="MRFRNILLLAASTVFYCTSVLAKTYENQEIVLDSATLGLTTYED
                     DELMVLKNAKVTLNDFTTIKLPEGISLTGNSVLKINAPSGDGTPYSIVINGKVSIDDE
                     SQFIFDGSSLSYNIVASDFDYSTFTFDINTGADGVFISKNSLMRIKLPKTTGTGIVAD
                     ITFNPSIHIGGTYKAPNNSPLAILGNLEVLRSDSKVDGYFDDKLWRVDLGPDHIDENG
                     VFTIQNDLSGNIHCQAFIGVYADIFKGTENVLIRSLGYQGYSVVSPITIDLGEGPVLG
                     PQIVLNYILLPEGQDGFKFLNFKYLDGKSALQQMGLMYFFDGNSKDVIATAENNVIEV
                     KNLTSQKSISVIGDHNYNISSMYIQGNPDARNGYFSFHKYENEVAILLQPISSENSDY
                     TTTIDKGNGDFETDLVSHITTKDTDGKPTTITTTIPLYGPAPPAVTKTVDLGNEVTEY
                     LVISYWTTTNEFGGLITTNSTATYSPPPVTVTATTASDYIESDWISFFITTDEKGDIV
                     TSSTLFNATRDYNLPEAPHTSFGPAPPAVTKTVDLGNEVTEYLVISYWTTTNEFGGLI
                     TTNSTATYSPPPVTVTATTASDYIESDWISFFITTDEKGDIVTSSTLFNATRDYNLPE
                     APHTSFGPAPPAVTKTVDLGNEVTEYLVISYWTTTNEFGGLITTNSTATYSPPPVTVT
                     ATTASDYIESDWISFFITTDEKGDIVTSSTLFNATRDYNLPEAPHTSFGPAPPAVTKT
                     VDLGNEVTEYLVISYWTTTNEFGGLITTNSTATYSPPPVTVTATTASDYIESDWISFF
                     ITTDEKGDIVTSSTLFNATRDYIDSQAPYTSSSRYSKSKIEESDYTTTIDKGNGDFET
                     DLVSHITTKDSDGKPTTITTTIPLKPSDAGEADYTTTIDKGNGDFETDLVSHITTKDS
                     DGKPTTITTTIPLKPSDAGEADYTTTIDKGNGDFDTDLVSHITTTDSDGKPTTITTTI
                     PLKPSDAGEADYTTTIDKGNGDFETDLVSHITTKDSDGKPTTITTTIPLKPSDAGEAD
                     YTTTIDKGNGDFETDLVSHITTKDSDGKPTTITTTIPLKPSDAGEADYTTTIDKGNGD
                     FETDLVSHITTKDSDGKPTTITTTIPLKPSDAGEADYTTTIDKGNGDFETDLVSHITT
                     KDSDGKPTTITTTIPLKPSDAGEADYTTTIDKGNGDFETDLVSHITTKDSDGKPTTIT
                     TTIPLKPSDAGEADYTTTIDKGNGDFETDLVSHITTKDSDGKPTTITTTIPLKPSDAG
                     EADYTTTIDKGNGDFETDLVSHITTKDSDGKPTTITTTIPLKPSDAGEADYTTTIDKG
                     NGDFDTDLVSHITTTDSDGKPTTIITTVTLTEEPDYTSVFVSDGHTITAVVSHVTTTN
                     DVGQTVTTTVTVMSYDQVGDGVYTSAPAYSQPPVTTTTVSADTTTATVVISYFPSVGD
                     DGVTRTGTTTISTVSVGGEADYTTTVDRGNGSTETDVISHITTTDSNGNPTTITTTIT
                     NAPAPSNSKANIGSDHTTTVVSNGHTFTGVVSHSTGTDEHGHTIVSTVTQTVGGQSHG
                     STVSSAKPVSTVSGAGSNAPGTAGVGGIVNSQKPQSGNVAGQGSGNEKPTQAAGTAGG
                     SGSGSGSGSVHQSAGNNVPSGSPSVQSAKGTASPVSGIHSSQTPHSVPSQAQTQGQAQ
                     AQSSRQQAATTVLLSSGSSVDNIGSGFSSTQTASVLQGKGASIRVASSSIVFSMIVVI
                     VFGMI"
     gene            complement(<17811..>27536)
                     /locus_tag="CAGL0L00227g"
                     /db_xref="GeneID:9488037"
     mRNA            complement(<17811..>27536)
                     /locus_tag="CAGL0L00227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999539.1"
                     /db_xref="GeneID:9488037"
     CDS             complement(17811..27536)
                     /locus_tag="CAGL0L00227g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999585.1"
                     /db_xref="GeneID:9488037"
                     /db_xref="GOA:B4UN42"
                     /db_xref="UniProtKB/TrEMBL:B4UN42"
                     /translation="MKTRSPLPPWITWLTGFFFLVTHAVSQAVVQRNTITTGNNPVGY
                     DKGYIVLDGAYLAFQDMNTVPLYQNIRVNKGGALYYINNNLEGFNINSAHAFFVDFVF
                     QNDGTVVVDDRKSASAGHFKIYDGSFTNTGSIMFASSQGDTFDISGTSVTNTGLIYSL
                     GTDSLKPQQLKIGNNVKTWYNTGTICLTNTSFDLVNPIQGVGCVSIGAHSLFNIHDIN
                     VQQQTVYLTERSSVLAVSNGQNMPIAGLGNGNGLLYPDYPIQSFSYNSITGILTFTIG
                     YVGLQSFTVVVGTGYNETLFEKVGETYIQGKRYRNNFIRYNGAPPQGPPSICQPCVEI
                     PLYTFKVPDAYETTNEYGFTQTISFYSTYDKSKVPIIGTTTIYTPPPLYTITRKDDTT
                     TETDIISRVVAVDVNGNPITYYSTIKYVAPEQPGEGGSGSGSEGGSGSNPGGSGSGGS
                     GSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGS
                     GSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGEGGSGGS
                     NPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGGSGSGS
                     EGGSGSNPGGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGG
                     SGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSEGGSGSNP
                     GGSGSGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGSE
                     GGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGEGGSGGSNPVDDGKDKTTVVTD
                     KDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGGSGSGSEGGSGSNPGGSGSEG
                     GSGSNPGGSGSGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSN
                     PGGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSNPGGSGSGGSG
                     SEGGSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSG
                     SGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSNPGGSGSGGSGSEGGS
                     GSNPGGSGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEG
                     GSGSNPGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDKDGKPTVIL
                     TQYQSPTPSPGGSGSGSEGGSGSNPGGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNP
                     GGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSEGGSG
                     SNPGGSGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGEGGSGGSNPVDDGKDK
                     TTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGGSGSGSEGGSGSNPG
                     GSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGSEG
                     GSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEG
                     GSGSNPGGSGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGS
                     GGSGSGSEGGSGSNPGGSGSGSEGGSGSNPGGSGSGGSGSEGGSGSNPGGSGSGGSGS
                     EGGSGSNPGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSE
                     GGSGSNPGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSG
                     GSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGSEG
                     GSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGG
                     SGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGSGGS
                     GSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSG
                     SEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGSGSEGGSGSN
                     PGGSGSGSGGSGSGGSGSGSEGGSGSNPGGSGSGSGGSGSGGSGSGSEGGSGSNPGGS
                     GSGGSGSGGSGSGSEGGSGSNPGGSGSGGSGSGGSGGSGSGSGSNPGSGSGSGSGSGS
                     GSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGS
                     GSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGS
                     NPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGFNPGSGSGSGS
                     GSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGS
                     GSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGSGSNPGSGSGSGSGSGS
                     GSNPGSGSGSGSGSGSGSGSGSGSNPGSGSGSGSGPGSGSNPGSGSGSGSGSGSGSNP
                     GSGSGSGSGSGSGSGSGSGSKPGSGSGSGSGSGSGSNPGSSSGSISGSSSNPGTGSNV
                     GGSNSAGSSGSSNSGAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSA
                     NNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGA
                     AGAVGSANNAQGAAGAAGSANNAQGAAGAVGSANNAQGAAGAVGSANNAQGAAGAAGS
                     ANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAVGSANNAQGAAGAAGSANNAQG
                     AAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAG
                     SANNAQGAAGTAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAVGSANNAQGAAGAA
                     GSANNAQGAAGAVGSANNAQGAAGAVGSANNAQGAAGAAGSANNAQGAAGAAGSANNA
                     QGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAVGSANNAQGAAGA
                     AGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANNAQGAAGAAGSANN
                     AQGAAGAAENGSGSSIYPSTASNGNSRGPTTIITPTASASQYHGAAAAIELNNWYYAL
                     PALLFLL"
     gene            <32461..>36618
                     /locus_tag="CAGL0L00297g"
                     /db_xref="GeneID:2890922"
     mRNA            <32461..>36618
                     /locus_tag="CAGL0L00297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448786.1"
                     /db_xref="GeneID:2890922"
     CDS             32461..36618
                     /locus_tag="CAGL0L00297g"
                     /inference="similar to AA sequence:UniProtKB:P23255"
                     /note="similar to uniprot|P23255 Saccharomyces cerevisiae
                     YCR042c TSM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448786.1"
                     /db_xref="GeneID:2890922"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV8"
                     /translation="MAYGVNSTQINLLSNFEETQYRPYKIAHQSVSLDVDIYNHCIKG
                     SATIILIPLIQHLEYVTFDSKGLEITDVTIESRRSANYIYDDQQRTQHEVYLNSFNDN
                     LLLKNNSVHQTEFYKERIGEFNFAPSEETRSQITIKIPSNIKITLQNTDLLSNYTPIT
                     PTIKGTPASQEAVYTPLTIKIDYNVDQPTSGLVFDTVSKTEPELWNVFTTNSELGCGG
                     SNWMPCIDTLDEKCTWEIEISIPKTVHDLIKESRLSERLARNKFGSDDTNTLLSKAAQ
                     EEYDVEENLANEESENDNQNPLSREIMVVCSEYSTVKQLLHPTDISKKIFSFQIFNPI
                     SAQFIGWSVGAFDTWQLPQLSKKLDYDEDLDEIRKITENSNSGEDNIGIQVFTLPQSD
                     VTETLIMNSCLILQRIMDFYSKEFGSFPFSSYSLLFLPCASQNTLDFAGFSIFNTRLL
                     YPPEIIDQMLPTTEKLAIALANQWSGVNITPATLNDFWCCKGIAGYMLLRVIKSIFGN
                     NMFHYKLKMNTTKIIEEDIGRPPLGNSFSQLSSRPISLRSSAFDFMELKSPMVLHILD
                     RRMTKTERSFGMSRVLPKIFLQAMSGDLPNNALTSSHFQHVCEKVNKSKLESFFQQWV
                     FGSGVPLFRVTQRYNKKRMVVEMGIRQYPNDTDEFNERDKSKMEDFFNKALNSLEAPN
                     VNKTSIFTGSITIRIHDSDGTPYEHLVEIKDIYTKVDIQYNTKHKKTRTRKNNEDEKT
                     NEIRYGTSGSDISFLGNILDSDTECQDWGIVHPSTAVANLSGDEIQRANESTIEWIRI
                     DSDFEWLSTFYLNQPDYMFATQLQRDSDIEAQLESVWYYGDNLRDNMASKIYASQLVR
                     TLMDDRYFYGIRIQAAKALSRYICKPTDKEHFLLTAFKKLYCHDNSNIPKSNNFSSFQ
                     DYFLQMSFPSLIAEIKDHYGDTPDYIGDFLLDILSYNDNSENSYYDTYYLCEIFEFTV
                     NCCNGGNRNHVTKLMEQIRRYEHLEYWSPSYNLALTSKLIEIKCRLHTKGILLFEPID
                     YEILTRLAGERWMGESLICYSNFGIAKDFHNKINPVRISTFGGDKVIHFREGTQDASL
                     AAMKSLLVCCSLKNQDILQLFAMFLAFEKDAYLKEGFVHSFIFAMNTCITTMKNQDII
                     DDFKEICESCCPEDNIEQLSDEEELSTMRVVDDFAEERTEKRKRAFKSGIYGVLPWFI
                     HQFESYLPLQEILWEVLHNPLITTYQRKVLFDIVNIMYTQEDEYKVTLSLPRAKKLTA
                     TTLEDHKVVIKRKGALRLHINTNAASYNKSSNAPTSNKIKLKTGSKPNISINTIKNSV
                     VASKPAKKAKKPTINRVGLLPIRFVKISGENVELSSVPFSKNIEFLKVNKRTFQLKIK
                     TKPKNQI"
     gene            complement(<36723..>37778)
                     /locus_tag="CAGL0L00319g"
                     /db_xref="GeneID:2890923"
     mRNA            complement(<36723..>37778)
                     /locus_tag="CAGL0L00319g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448787.1"
                     /db_xref="GeneID:2890923"
     CDS             complement(36723..37778)
                     /locus_tag="CAGL0L00319g"
                     /note="highly similar to uniprot|P08524 Saccharomyces
                     cerevisiae YJL167w ERG20 farnesyl-pyrophosphate
                     synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448787.1"
                     /db_xref="GeneID:2890923"
                     /db_xref="GOA:Q6FLV7"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV7"
                     /translation="MSKEASRQKFVDEFPSLVQELRVVLEGYGMPKEAIEWYESSLNY
                     NTPGGKLNRGLSVVDTYAILKGYESVDDMKDDEYKKVALLGWCIELLQAYFLVADDMM
                     DKSITRRGQPCWYRVKNVNEIAINDAFMLEAAIYVLLKKHFRNDSYYVDLLELFHDVT
                     FQTELGQLLDLITAPEDHVDLSKFSLSKHSFIVIFKTAYYSFYLPVALAMYAAGVNDS
                     KDLKQAQDVLIPLGEYFQIQDDYLDCFGTPEQIGKIGTDIQDNKCSWIINKALELANE
                     KQRKILDENYGRKDSKCEANCKAVFSELKIDIHYREYEEAVANELKDKISQVDESRGF
                     KKEVLTAFLNKVYKRSK"
     gene            complement(<38421..>39584)
                     /locus_tag="CAGL0L00341g"
                     /db_xref="GeneID:2891116"
     mRNA            complement(<38421..>39584)
                     /locus_tag="CAGL0L00341g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448788.1"
                     /db_xref="GeneID:2891116"
     CDS             complement(38421..39584)
                     /locus_tag="CAGL0L00341g"
                     /inference="similar to AA sequence:UniProtKB:P36049"
                     /note="similar to uniprot|P36049 Saccharomyces cerevisiae
                     YKL172w EBP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448788.1"
                     /db_xref="GeneID:2891116"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV6"
                     /translation="MAKGFKLKELLAHEKGKVNEKKTTQASQKRIEGKQPELKPESES
                     ESESDEEKNDNEEYVSQTLSKKEKRKLKKALKKSGDNESLITDDANADQQDVSKSRID
                     LDRLENSDSEEEDFAISKPDDASMDSENDEDKEDEEEDVPLSDVEFDSDADVVPHHKL
                     TINNTKALKHSLERIQLPWAKHSFEEHQSVTSETNTDEGMKDIYDDTERELAFYKQSL
                     DAVNIAKEKLKKLKVPFKRPLDYFAEMVKNDEHMDKIKHKLVQEASEKKAREDARKQR
                     QLKKFGKQVQVATLQKRQLEKRETLDRIKNLKKKRKHNEIGDMDFNVGIEEATESEDT
                     KRRKPNSKRQAKNSKYGQGGMKRFKRKNDAQSSADITGFSNRKKSRPGKSRRK"
     gene            complement(<40198..>40869)
                     /locus_tag="CAGL0L00363g"
                     /db_xref="GeneID:2891115"
     mRNA            complement(<40198..>40869)
                     /locus_tag="CAGL0L00363g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448789.1"
                     /db_xref="GeneID:2891115"
     CDS             complement(40198..40869)
                     /locus_tag="CAGL0L00363g"
                     /inference="similar to AA sequence:UniProtKB:P06838"
                     /note="similar to uniprot|P06838 Saccharomyces cerevisiae
                     YML095c RAD10 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448789.1"
                     /db_xref="GeneID:2891115"
                     /db_xref="GOA:Q6FLV5"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV5"
                     /translation="MNNTDSTSFQSILAGVERLRKQKEGAADKDRNNDLVTKDKDTNF
                     SERKQTAHVQDANKVPPRNKNVINAFNQQRYDDDSTKPEENGKKRPFITTQSGSTNVG
                     KTVLVSTTQKENPLLNHLKNTNWRYSKPQPGQKIYYDYKVKNRSILFLTLSYHKLYVD
                     YIERRMLPLKQNNDNILIFVVDDTNSEEILTTITKICLFNGFTLLLAFNFQQAAKYLE
                     GLNSF"
     gene            <41387..>42092
                     /locus_tag="CAGL0L00385g"
                     /db_xref="GeneID:2891114"
     mRNA            join(<41387..41405,41638..>42092)
                     /locus_tag="CAGL0L00385g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448790.1"
                     /db_xref="GeneID:2891114"
     CDS             join(41387..41405,41638..42092)
                     /locus_tag="CAGL0L00385g"
                     /inference="similar to AA sequence:UniProtKB:Q04493"
                     /note="similar to uniprot|Q04493 Saccharomyces cerevisiae
                     YML094w GIM5 Gim complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448790.1"
                     /db_xref="GeneID:2891114"
                     /db_xref="GOA:Q6FLV4"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV4"
                     /translation="MSSSQKIDLSTLSPEQLAVVKQQLDQEIQHFSQSLQALNMAKTK
                     FTECIEDVKQVSSISESKKQPILVPGSSSLYIPGEIVESKSFMVDIGTGYYVEKTDEE
                     AIAFYQKKIDKLNTESVQIQNIIKEKSQTSLLLENQIRQAAFTRHEQSKANETKA"
     gene            <42659..>46774
                     /locus_tag="CAGL0L00407g"
                     /db_xref="GeneID:2891112"
     mRNA            <42659..>46774
                     /locus_tag="CAGL0L00407g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448791.1"
                     /db_xref="GeneID:2891112"
     CDS             42659..46774
                     /locus_tag="CAGL0L00407g"
                     /inference="similar to AA sequence:UniProtKB:P35187"
                     /note="similar to uniprot|P35187 Saccharomyces cerevisiae
                     YMR190c SGS1 DNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448791.1"
                     /db_xref="GeneID:2891112"
                     /db_xref="GOA:Q6FLV3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR022758"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV3"
                     /translation="MVTKPSNNLRREHAWLKESNIFDNDNDILLSTLSKQFSNKKSTN
                     EYNKGSLILHNVGSIDRNETIEVLDDDDDDDIILTNISKPNELSKAQTATSSPKNNMN
                     PNAMNEIQRDVSTSSRVVSTYSGSNSYPFISKDISPKNVCNSSDNLQQSTLPVVYRDK
                     RSNKTIDGSIPVLKAQKELIEKLKDLNKTMTSKIDIMESTSLSEDYKRTQINTVINPK
                     IKSKQSEIEKMELKLETLSQEIKNISHILSDISNENVFKNIKSQKFDSQRASITANNS
                     LTDLQINEGFNNNITKNNRDFNPIPDNSVIRGQQVNMSSFQEESLYIDSYNEPNTQSR
                     APYTRQMRDRHQINYRIPEADEPFEYRVGKLQPTIASDDTTYDAENTDNPDEDGYLTT
                     QDGEKHSDVHQSDLDFIEDSPSEITHDTAYVETNNNETSSRIQIIMSSPNRLDEYGPS
                     VQSQIDLSGDSLDSNHNVGYKMEYIGESDFNINTGATNTKHTEVIENLSTDSDNWGEV
                     ENLTDYDAESFDEERENKTRVSDIEELDNELEIITERKIGNGDGFMLTSVKKEESAIV
                     SLSESHPTSLTDDELEEDISLLGVAENAESPPHTHITDVVSPNSWTKEVYKKLKTVFN
                     LTSFRSNQEEAINATLSGKDVFVLMPTGGGKSLCYQLPAIVKGGCTKGTTIVISPLIS
                     LMQDQVEHLQKLNVKARMLSSKGGIDEKNHTFNLFINGFLDLIYLSPEMISVSEKCKT
                     AIEKLYQNKQLARIVVDEAHCVSNWGHDFRPDYKQLSYFKVQYPDIPMMALTATASEQ
                     VQMDIVFNLKLKDNLFLRQSFNRTNLYYEVRKKTKNTIFEICDTIKQQFRNQTGIIYC
                     HSKNSCEQTAQQMQRNGIKCAYYHAGMEADERLQVQREWQNDNLQVICATVAFGMGID
                     KADVRFVFHFTVPRTLEGYYQETGRAGRDGNYSYCITYYSFRDVRTMQTMIQKDKNLD
                     GINKQKHLDKLQQVTAYCENDTDCRRKLVLSYFSEEFDPINCNKNCDNCRNSSSVTKE
                     ERDVTSTAISIVKLVQSIQNQKVTLIYCQNIFKGSRNSKIVQAGHDMLPQHGAGKNLT
                     KSEIERIFFHLITKRILQEYSKVNNAGFSSSYVKVGDGCRDLLNGKLQLKIQFSVSEG
                     NSRSSAGLPKSNSSNTNNYDRSLTKNITANNDSEQHLRNYAYSPSNSERMRAESSKHT
                     GSTQEVNDLKSAYDRLRNAAISWGSRMVPAVNKFMDDNVLRRLAAILPATEEEFIGIV
                     GNNSTDSKKYKYFKDIFIDLRKRRIERMCNLSSNFAFNEEGQSQIDTMEIQTTSRFFN
                     NTDENKNLVSLTPYEQSTQVSKGVNARTAGGKKYKRNFNYKRYRNYNKWKK"
     gene            complement(<46999..>50097)
                     /locus_tag="CAGL0L00429g"
                     /db_xref="GeneID:2891113"
     mRNA            complement(<46999..>50097)
                     /locus_tag="CAGL0L00429g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448792.1"
                     /db_xref="GeneID:2891113"
     CDS             complement(46999..50097)
                     /locus_tag="CAGL0L00429g"
                     /note="highly similar to uniprot|P49095 Saccharomyces
                     cerevisiae YMR189w GSD2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448792.1"
                     /db_xref="GeneID:2891113"
                     /db_xref="GOA:Q6FLV2"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV2"
                     /translation="MLKGTAIKRSWTGLRRLYATDVSSTKFKQIYHADPLDSKNDRLD
                     TFQRRHLGPNPKDVDEMLKTVNSNYNDLSDFVNDMVPSKILGMKDGLKFKSSPKGVFN
                     ETAMLNHLAQIAEKNNYKVKNYIGKGYYDTILPPVIQRNVLECPEWYTSYTPYQPEIS
                     QGRLESLLNFQTVVSDLTGLPVANSSLLDEGTAAGEAMLLSYHSLKSKKIKKSSPNQK
                     LNFIIDKNLHPQTKSVLKTRAKPFNIELLEIDFNELSNKEIEDKLSKELLDNSFGGLV
                     QYPDTNGNIPTTDKLNTISGLLHSSNCLFSVATDLLALTLLEPPSTFGADICLGSSQR
                     FGVPLAYGGPHAAFFSVTEKLNRKIPGRIVGVSKDRLGNTALRLALQTREQHIKRDKA
                     TSNICTAQALLANVSANYCVYHGPEGLKNIAKRVYGMTTVLANAISEHSEHKLLNNSW
                     FDTLTIELKEGTTADQFLELALSEFNTNVFAVNNRTVSISFDEKKTIDDLEDMIRLFC
                     NLKKNSSISSSIKDSGILPEFPKELQRKSQFLQNPVFNRYHTETAMLRYLHHLQSRDL
                     SLANSMIPLGSCTMKLNSTFEMMPITWPQFANIHPFQPVDQVQGYKELITAIEEDFSS
                     ITGFHSVSLQPNSGAQGEYTGLRVIRSYLEDIGEGHRNLCLIPISAHGTNPASAAMCG
                     LKVIPINCLQNGALDLADLKEKAEKYKDDIAAVMITYPSTYGLYEPDIKEAFDIVHSC
                     GGQVYLDGANMNAQVGLTSPGDLGADVCHLNLHKTFAIPHGGGGPAGAPICVKEHLAP
                     FLPRHDVTDMITEIGSNKSIDSVSSAPYGNALVLPISYAYVNMMGEEGLPFSTVIATL
                     NSNYMMARLKEHYKIMFVNGEDVKHCAHEFIIDLREFKAKGIEAIDVAKRLQDYGFHA
                     PTLAFPVPGTLMVEPTESENREELDRFVDSMISIRKEIDDYIAGKPEGMVIKNAPHPL
                     SDLISSTDWETRGYTREQAAFPLAFLKTSKFWPTVARVDDKFGDTHLICTCPSVEEMA
                     EE"
     gene            <52187..>52912
                     /locus_tag="CAGL0L00451g"
                     /db_xref="GeneID:2891111"
     mRNA            <52187..>52912
                     /locus_tag="CAGL0L00451g"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="XM_448793.1"
                     /db_xref="GeneID:2891111"
     CDS             52187..52912
                     /locus_tag="CAGL0L00451g"
                     /inference="similar to AA sequence:UniProtKB:Q03246"
                     /note="similar to uniprot|Q03246 Saccharomyces cerevisiae
                     YMR188c"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="XP_448793.1"
                     /db_xref="GeneID:2891111"
                     /db_xref="GOA:Q6FLV1"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV1"
                     /translation="MARQNFIGLVVSQGKMQKTVKVRVERKVFDKRINKELMKRKDFL
                     VHDEGEITREGDLVRIEATRPLSKWKSFAIAEIIRNKGQQFALFESQAKDDVLKEEMQ
                     KTKEFLERREARLGHTDSQLLKDVKFLQSYFGKVNSEGGNEAQANELKQELEKIKQRY
                     GVQEFTPNTVKQLIKLDIQGVEEDLIEQKSKIDAMQGKLNDLLQEPSKCIEYLKQRGV
                     ESPELLQKNIMKNLVRKHVLKEL"
     gene            <53395..>54774
                     /locus_tag="CAGL0L00473g"
                     /db_xref="GeneID:2891110"
     mRNA            <53395..>54774
                     /locus_tag="CAGL0L00473g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448794.1"
                     /db_xref="GeneID:2891110"
     CDS             53395..54774
                     /locus_tag="CAGL0L00473g"
                     /note="some similarities with uniprot|Q03236 Saccharomyces
                     cerevisiae YMR187c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448794.1"
                     /db_xref="GeneID:2891110"
                     /db_xref="GOA:Q6FLV0"
                     /db_xref="UniProtKB/TrEMBL:Q6FLV0"
                     /translation="MWLKQKWKGRQRVKLGLCWVCLEEEEIDDNWLIQNCDCNLQLHK
                     KCYLKWLYNRNFDLSQKVFRTLLQENIGETANRYQDVIDEEISKEVKRSFYCYFDGHR
                     DFHKPTSIPLLILTNPLLTKIFSPFMPAYYRSLSSHEDGSLIINYLNRLPPIKSGPCP
                     QCKMDPFVKNVEYKSKSWILDVIYKLRTNLRIISLLSFPVLSPFNICKWWLKLSLWQL
                     RCVFPETLLRKLLNISTTKALDVYLQSVPGIMSIPQRTSSVLSLFPIYIYEALNTDTN
                     PSIAFFAWPAMAYMNLSLYNFKQNDPLIVAMLSMKVFLIVYRKYLSEMLSGYYNRILN
                     EIYGSFYNSDEVIFEILDSNVSNENILIRDEIFEHCLRSVLTPFSANMVGRGLRYLYS
                     LVRKCTTVNYLANYSPAEIHGIANILGFGLSFVAQKAFHLYLTKLRIKEIKELQKASD
                     TYEIDQLDI"
     gene            complement(<55122..>57239)
                     /locus_tag="CAGL0L00495g"
                     /db_xref="GeneID:2891108"
     mRNA            complement(<55122..>57239)
                     /locus_tag="CAGL0L00495g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448795.1"
                     /db_xref="GeneID:2891108"
     CDS             complement(55122..57239)
                     /locus_tag="CAGL0L00495g"
                     /note="highly similar to uniprot|P15108 Saccharomyces
                     cerevisiae YMR186w HSC82 heat shock protein or
                     uniprot|P02829 Saccharomyces cerevisiae YPL240c HSP82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448795.1"
                     /db_xref="GeneID:2891108"
                     /db_xref="GOA:Q6FLU9"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU9"
                     /translation="MSETFEFQAEITQLMSLIINTVYSNKEIFLRELISNASDAIDKI
                     RYQALSDPKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTKA
                     FMEALSAGADVSMIGQFGVGFYSLFLVADRVQVISKNNDDEQYIWESNAGGSFTVTLD
                     TVNEKIGRGTILRLFMKEDQLEYLEEKRIKEVVKKHSEFVAYPIQLMVTKEVEKEVPV
                     TEEEKKDEEKKDEDDKKPKLEEVDEDEEKKDEKKTKTVKETVKELEELNKTKPLWTRN
                     PSEITQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFKAILFIPKRAPFDLFESKKKK
                     NNIKLYVRRVFITDEAEELIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNI
                     VKKLIESFNEIAEDSEQFDKFYSAFAKNIKLGIHEDTQNRAALAKLLRYNSTKSVDEL
                     TSLSDYVTRMPEHQKNIYFITGESLKAVQNSPFLDALKAKDFEVLFLVDPIDEYAFTQ
                     MKEFEGKQLVDITKDFELEETEEEKAEREKEIKEYEPLTKALKEVLGEQVEKVVVSHK
                     LVDSPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPKSPIIKELKKR
                     VDEGGAQDKTVKDLTNLLFETALLTSGFTLEEPSSFASRINRLISLGLNIDEDEEEQA
                     APEVKAEAEVEEVPADTEMEEVD"
     gene            complement(<58025..>61027)
                     /locus_tag="CAGL0L00517g"
                     /db_xref="GeneID:2891109"
     mRNA            complement(<58025..>61027)
                     /locus_tag="CAGL0L00517g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448796.1"
                     /db_xref="GeneID:2891109"
     CDS             complement(58025..61027)
                     /locus_tag="CAGL0L00517g"
                     /inference="similar to AA sequence:UniProtKB:Q12751"
                     /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
                     YMR185w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448796.1"
                     /db_xref="GeneID:2891109"
                     /db_xref="GOA:Q6FLU8"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019414"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU8"
                     /translation="MVQHNNTKQSIAALLDRGPDFTNDTPIDTFFSKLENNLIDKLRK
                     FDDEGESPQLFEYLGFGSQKLFVAYLIEQLQEIHNILQSNSKHIDVQKDVIPISLNDM
                     KYLDDLINLLIVHGIDAYLPSDCRIPLNEKLASKFSRNQIEKKFTISGVESIDDDELS
                     VIVNRVLEIMLKKYSIDGQKNYISIVLLNGVMYSNIFLAATYLIDMKNYTLECTVEDI
                     ENLQETYSLFELYNNYSQTIANHKLKSIFLVRLSTLTYRRENNGLITLVDFILGVREQ
                     EQIDIEKFSRLNQILLTRPKTIRNIDYLKNLFNQIYDCMSFINRPLLVSGINGVITEF
                     YFKNKRIVQDFLFQRVYNIFFNDSATEYTYKELNDCINVILSLSKNTSKELLMDFASR
                     NTISSEKTDISFFQYLWVYAVFLKSKGASKDIRIEESGKNEQLDIQEYCNVILSLMKT
                     FLLVFDSETTILNQICQNILNYEHEKWRFSIDIKSGLPLIEVKRNDLDKDLAYATSND
                     YKTEELTTLFKDMDKVCDLFIELLRIIDDPKQTRSVFLHVFKKWIEDTAVKSQKSQQL
                     SFLSETVNDATTSNLLALVNLKLSQHIIKEFRSEIISSVADILIVVAELFDILDDGDK
                     VTKIEGVISSVRDSDDEDSDDEEQPNGDQQHEKPDNIENELTNFSDNAIDIVIALLES
                     VIGDCSVETLHQFRPTIERLLNKLEAAFPNDYEDIKKQLREVLMYKGSNGAAQNSNKE
                     NDEERMTKAIASLADPLVPIRAHGLAELRNLVLQHTKVITIEKVVNIHLEFLSNEDPF
                     LYLNVIKGLTYLIEVDSSGKTLEQLFDKYQSRRTKLDLCLRLGEVFINYVQVRNELVT
                     EPQMSRLVDLCLEKIRVNSSTARAVDDRLRMSALSILGICIKSNVDAITDSRMRDIFD
                     CVFGVLQLETSEPKSILRRAAIHLVHDYLISKLGDSDQEMHVTLPEPYTVEKLTATLD
                     YLKLHDNDYLVHQQCSTIVEELSAFTQL"
     gene            complement(<61771..>62442)
                     /locus_tag="CAGL0L00539g"
                     /db_xref="GeneID:2891107"
     mRNA            complement(<61771..>62442)
                     /locus_tag="CAGL0L00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448797.1"
                     /db_xref="GeneID:2891107"
     CDS             complement(61771..62442)
                     /locus_tag="CAGL0L00539g"
                     /inference="similar to AA sequence:UniProtKB:Q03233"
                     /note="similar to uniprot|Q03233 Saccharomyces cerevisiae
                     YMR184w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448797.1"
                     /db_xref="GeneID:2891107"
                     /db_xref="GOA:Q6FLU7"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU7"
                     /translation="MTNTMPVRSYQNCSENDVVGYNDCPESLFVMPAVKAAKKTRPRR
                     IPVSVNTDTQSSKINEGVSSESASKDDDVLNLPKSRLAKASAVPPPPIGRRSTSSSVS
                     SLMCDSPTPLQSRSSSMSTLDNVSLLDENELMKKVANILNAESKLSNKEYEYYKGKID
                     SNLEESLKNDKVRIFLSRFFSELESSKNKEFAQKILLRGMTSDTTINSWCPAFHKIFD
                     NASCC"
     gene            <65336..>66130
                     /locus_tag="CAGL0L00561g"
                     /db_xref="GeneID:2891106"
     mRNA            <65336..>66130
                     /locus_tag="CAGL0L00561g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448798.1"
                     /db_xref="GeneID:2891106"
     CDS             65336..66130
                     /locus_tag="CAGL0L00561g"
                     /inference="similar to AA sequence:UniProtKB:P39926"
                     /note="similar to uniprot|P39926 Saccharomyces cerevisiae
                     YMR183c SSO2 syntaxin or uniprot|P32867 Saccharomyces
                     cerevisiae YPL232w SSO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448798.1"
                     /db_xref="GeneID:2891106"
                     /db_xref="GOA:Q6FLU6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU6"
                     /translation="MSQEYQAILSDVQNIQTQLRIYDQLLQNISNLHNVIYSQIDENS
                     EVNKGKLDNLAAEIAKLQQGVANKIKQLSTKIKFHDNEHYVHYSAIRDQFLSLIRKQR
                     LIEYNWKLSCRNEVKRQIDLMSLDLSDAQIDDYLADPENEIYQSIFKRYLLSNEDAKM
                     ALNEVEHRMKEIKNLEKRMNDLAILFKEMEELVVQQEEPIDKIDTNVEKVVVDLESGI
                     THTEQAIHIAEQKRKNKKLLISIIFYVCAILLLSIFVAVIVTVSLH"
     gene            <71544..>72710
                     /locus_tag="CAGL0L00583g"
                     /db_xref="GeneID:2891105"
     mRNA            <71544..>72710
                     /locus_tag="CAGL0L00583g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448799.1"
                     /db_xref="GeneID:2891105"
     CDS             71544..72710
                     /locus_tag="CAGL0L00583g"
                     /inference="similar to AA sequence:UniProtKB:Q12132"
                     /note="similar to uniprot|Q12132 Saccharomyces cerevisiae
                     YPL230w USV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448799.1"
                     /db_xref="GeneID:2891105"
                     /db_xref="GOA:Q6FLU5"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU5"
                     /translation="MAFTRAEHHARHIRKHTGEKPFQCDICMKFFSRIDNLKQHKDSV
                     HSANKAKGFNSVYYGQKKVKQNKKSESSSPDSIISKLGQYSSPDSDSSSKSQSFKNSN
                     SANSNNLDRKTQESRFEKSTRKSYASSIFSNSDNNDSYNTSFSTSSISQSSVVPRLSS
                     NNEGNIPNERNVSFKSVPQYQQSHPIFQLNVSNPPNQFAPLLHSQANSQQFPMQPLPT
                     HNQERRFNDNRGFAYFNNDNSKIAVFPHAFGYERTKTYPEPAISHNEILITPNFAQYG
                     QSFSNNTNNNTFRTTSPSSYRCPNPSSKKRQHSYEKLHELNNNYNHPRPNIRNDKNNL
                     DIKNKPDNNSTSFADRGPEIITTDQKTSASESRATDSSDDDASTSRLKLKYIIT"
     gene            <75253..>75780
                     /locus_tag="CAGL0L00605g"
                     /db_xref="GeneID:2890566"
     mRNA            <75253..>75780
                     /locus_tag="CAGL0L00605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448800.1"
                     /db_xref="GeneID:2890566"
     CDS             75253..75780
                     /locus_tag="CAGL0L00605g"
                     /note="highly similar to uniprot|P25296 Saccharomyces
                     cerevisiae YKL190w CNB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448800.1"
                     /db_xref="GeneID:2890566"
                     /db_xref="GOA:Q6FLU4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /translation="MGAAPSKIVETLLEDTNFDRDEIERLRKRFMKLDRDSSGSIDKN
                     EFMSIPGVSANPLAGRIMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLKFAFKIY
                     DIDKDGLISNGELFIVLKIMVGSNLDDKQLQQIVDRTIMENDLDGDGQLSFEEFKSAI
                     ETTEVAKSLTLQYSV"
     gene            <77798..>80341
                     /locus_tag="CAGL0L00627g"
                     /db_xref="GeneID:2890567"
     mRNA            <77798..>80341
                     /locus_tag="CAGL0L00627g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448801.1"
                     /db_xref="GeneID:2890567"
     CDS             77798..80341
                     /locus_tag="CAGL0L00627g"
                     /inference="similar to AA sequence:UniProtKB:Q08886"
                     /note="similar to uniprot|Q08886 Saccharomyces cerevisiae
                     YOR371c GPE1 or uniprot|P39717 Saccharomyces cerevisiae
                     YAL056w GPE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448801.1"
                     /db_xref="GeneID:2890567"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU3"
                     /translation="MNELSLSDENFSDFGSPVPPNIIHTDRNLMDEKLTANVSNYVDV
                     SDLKQFSNIPYLSNYNSILSLLLSNQKKSNFSKYNETLLKKYYLSRRNINYQTSIRND
                     NPIKSISNNSSVEHNINEEHSDDGSYIANSSDTGSDNNSKVQVPSLTHIDFDMNIILE
                     KLEKPLDEEKLSSLIQSKEVIDLHTAASYIKYCQKLFTVNVRKEDILKQHNLWVPSVH
                     DDFKKYLLSERRKENSFSYIQDRKSNPLFVDGESYMAGKYDIFSGSSLVPSLFSEYKP
                     PSFLYHTAVELAGKCYILGGLIPIYGYEEDAPDLSQFKVDGIKNIPPPLLSQIINNPS
                     MINNPHLYIYSLPSSRLIRPIISGQIPPPLIGMRGSKLTDRYLFFYGGFEIKTDSVCD
                     ENGVIYLKKRAFVNNMGYILDVVSFKFTKVEIIAPTISSAGYPELHPRFGHTQISVNM
                     NATVSNTPFSSNVSQTSLYTEPQLKLDSKDNEEKSDKKNNFGLHTIYIFGGYRQTGDD
                     RYEAIADMWKIEVTVVARGKGGFCKFGDAALAKSIKTIQNSENWPSGRAFCGYCVPNM
                     RLVYKQSFETYLLDRLDSEYMVDFESINVRNKSRPIFPNVATNMESDVINSRKPMDAS
                     NKVNTSGSGLFPPEQVPGGGLPGRGKPNRTIALPTNAGARTIVIHGGSAGTDIYSDMW
                     WFDLELEVWRKIDTYAKTENKMEGLVPLNLGIVGHSMNLIGHMLVCTGGMIESDVNKY
                     YKNIPYQFNLDRVPAGSTIFNTFDLNTQSLAVRSIKSRKTEDDNTAYLTMEDTPEAML
                     VVSVGGEAIEYDGNIILIGGVVIPRKNMDLLYLRGAMLECIMPSMSLLA"
     gene            complement(<80936..>83050)
                     /locus_tag="CAGL0L00649g"
                     /db_xref="GeneID:2891117"
     mRNA            complement(<80936..>83050)
                     /locus_tag="CAGL0L00649g"
                     /product="acetate--CoA ligase"
                     /transcript_id="XM_448802.1"
                     /db_xref="GeneID:2891117"
     CDS             complement(80936..83050)
                     /locus_tag="CAGL0L00649g"
                     /note="highly similar to uniprot|Q01574 Saccharomyces
                     cerevisiae YAL054c ACS1 acetyl-CoA synthetase"
                     /codon_start=1
                     /product="acetate--CoA ligase"
                     /protein_id="XP_448802.1"
                     /db_xref="GeneID:2891117"
                     /db_xref="GOA:Q6FLU2"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /translation="MSPSAIAEKKQVDNIQEIKDKNQEPAHHEYEHLTNVGVVKQKPI
                     DHRLKDNIKTHYSPHLDGLQEYKRQYQESIENPEKFFSEKARSFMNWFRDFDRVFVPD
                     VDNPTKPSFENNAWFLNGQLNTCYNCVDRHALKTPNKTAIIYEADEPGEGYSMSYKEL
                     LEKVCQVAQILKYSMNVKKGDTVAVYMPMIPEALITLLAISRIGAIHSVVFAGFSSNS
                     LRDRINDAGSRVVITADESNRGGKIIETKRIVDDALRETPQVEHVLVYRRTNNPQVNF
                     QAPRDLDWETERKKYKTYFPCEPVDSEHPLFLLYTSGSTGTPKGVQHSTAGYLLGALL
                     TMRYTFDVHQEDVFFTAGDIGWITGHTYCVYGPLLYGCTTLVFEGTPAYPNFSRYWEI
                     IDKHQVTQFYVAPTALRLLKRAGDSFIDGFSLKSLRCLGSVGEPIAAEVWEWYSDKIG
                     KNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASLPFFGIETVILDPTTGEEINDS
                     HAEGVLAIKRPWPSFARTIWKNHDRFLDTYLNPYKGYYFTGDGAARDKDGYIWILGRV
                     DDVVNVSGHRLSTAEIEAAIIEDRMVAECAVVGFNDDLTGQAVAAFVVLKDKSTWASA
                     SEEELQDIKKHLILTVRKDIGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGESDQ
                     LGDVSTLSNPGVVKHLIDSVKL"
     gene            <85126..>86757
                     /locus_tag="CAGL0L00671g"
                     /db_xref="GeneID:2890925"
     mRNA            <85126..>86757
                     /locus_tag="CAGL0L00671g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448803.1"
                     /db_xref="GeneID:2890925"
     CDS             85126..86757
                     /locus_tag="CAGL0L00671g"
                     /note="highly similar to uniprot|P17064 Saccharomyces
                     cerevisiae YER056c FCY2 purine-cytosine permease or
                     uniprot|P40039 Saccharomyces cerevisiae YER060w FCY21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448803.1"
                     /db_xref="GeneID:2890925"
                     /db_xref="GOA:Q6FLU1"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU1"
                     /translation="MELNYRNHDHSGSDGSHSNDYELNEVEKQPVEDVKTTNVNTNDF
                     EYDYGDDFTNSSEAATVEETKLKLGFISRLALKMNAETKGVEPVTDEEKTDDSVLNAA
                     SMWFSANLVLASYALGALGPIVFRLNFGTSVLTIVFFNMIGLVSVAFFSVFGAEFGLR
                     QMILSRFLVGNVTARVFAAINVVACVGWGVVNTVVAAQLLHIVNQGSHQLPLWGGCLV
                     IVGGTVMVTFFGYSIIHAYERWSWVPNFAVFLVIIARLHKSGQFSNGPWTSGATTAGG
                     VLSFGSAIYGFAAGWTTYAADYTVYMPRTMNKFKIFFFLCAGLAFPLLFTMILGAASA
                     MGAVNNPEWMALYDKDNMGGLTYAILVPNSLHGFGEFCCVLLAMSTIANNIPNMYTIA
                     LSVQALYEPFSRVPRVVWTLAGNAAVVGISIPASYYFEGFLENFMDSIGYYLAIYIAI
                     SLSEHFIYRRGFKGYNIEDWNNWDRLPIGIAGCSALFVGAFGVALGMSQTYWTGEISR
                     HIGKHGGDIGFELGMSWAFIVFNIVRPLEIKYFGR"
     gene            <87330..>88079
                     /locus_tag="CAGL0L00693g"
                     /db_xref="GeneID:2890926"
     mRNA            <87330..>88079
                     /locus_tag="CAGL0L00693g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448804.1"
                     /db_xref="GeneID:2890926"
     CDS             87330..88079
                     /locus_tag="CAGL0L00693g"
                     /inference="similar to AA sequence:UniProtKB:P40526"
                     /note="similar to uniprot|P40526 Saccharomyces cerevisiae
                     YIL049w DFG10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448804.1"
                     /db_xref="GeneID:2890926"
                     /db_xref="GOA:Q6FLU0"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:Q6FLU0"
                     /translation="MIDNSNILQLITICLRLSNIVGLMSLIIAKYYLPDFLRYGKTFT
                     FAKNGNENIWDKIKNFSVPKSYFAHFYILSSVLALVTLASYPTDILVWQLFLHSSRRL
                     YETLYISKYTEKSKMNWSHYAVGLWFYSQLNILVYLRVQRENTTARVLPILVMVLASW
                     DQYKNHVVLSKLKKYSLPRSRLFELVCCPHYLDEMIIYGSLVSYGHEFVWPLIWVIAS
                     LSISALESRKFYLSKFKDTEVPRYAAIPYIL"
     gene            <88807..>92241
                     /locus_tag="CAGL0L00715g"
                     /db_xref="GeneID:2890927"
     mRNA            <88807..>92241
                     /locus_tag="CAGL0L00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448805.1"
                     /db_xref="GeneID:2890927"
     CDS             88807..92241
                     /locus_tag="CAGL0L00715g"
                     /note="highly similar to uniprot|P40527 Saccharomyces
                     cerevisiae YIL048w NEO1 ATPase whose overproduction
                     confers neomycin resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448805.1"
                     /db_xref="GeneID:2890927"
                     /db_xref="GOA:Q6FLT9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT9"
                     /translation="MSASPHNLNSRNSVSLDSFENSFDEALDNIEINPVRGYHIDNSL
                     NNSNRITDFDIDENFEMRSVLEDEEHFDNDGHPLMRDRTRSNASTLNSRYNKYNNVSG
                     SRSVTGYTPSTIGVGLKKWFVNVKTAISSGWKDYSTSVALGDEHTEREVHPGTTQVYD
                     RHRFPSNEVSNAKYNAVTFLPTLLYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYVV
                     PLAFVLTVTMAKEASDDIQRRRRDRESNMELYEVLGRPRPVASKDLKVGDLIKISKGA
                     RVPADLILLQSSEPSGEAFIKTDQLDGETDWKLRIACTLTQNLNEDDLLEKITITASA
                     PEKSIHSFLGRVTYKDTNTSGLTIDNTLWANTVLASSGFCIGCVIYTGRDTRQAMNTT
                     SAKVKTGLLELEINDISKILCACVFILSILLVVFAGLHNDDWYVDIMRYLILFSTIIP
                     VSLRVNLDLAKSVYAHQIEHDKTIPETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQ
                     LKKVHLGNVSYTTETADIVSDYIQGMIESKNDSVTNLGPRSTTRKDAATHVIDLITTL
                     AICHNVTPTFEDDELTYQAASPDEIAIVKFTESVGLSLFKRDRHSMSLLHEHSGTILN
                     YDVLTMFPFNSDTKRMGIIVYDKQKDQYWFLQKGADTVMNRIVANNDWLEEETGNMAR
                     EGLRTLVIGRKKLTKKIYEQFKKEYEEVSASMYNREQEMANTISKYLEHDLELLGLTG
                     VEDKLQKDVKSSIELLRNAGIKIWMLTGDKVETARCVSISAKLISRGQYVHVVTKLSK
                     PEGAFNQLEYLKVNKNACLLIDGESLGMFLKYYRQEFFDVVVHLPTVIACRCTPQQKA
                     DVALIIRELTGKRVCCIGDGGNDVSMIQCADVGVGIVGKEGKQASLAADFSITQFCHL
                     TELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVFSVCSQFEPIALYQGWLMVGYAT
                     CYTMAPVFSLTLDHDIDESLTKMYPELYKDLTEGKSLSYKTFFVWVALSFYQGLVIQG
                     FSQTFTSLAEIDFTKMVAIGFTALIFNELIMVALEIYTWNKTMIITEIVTLAIYVFSV
                     PFLGEYFDLKYISTLKFITELILILVVSIFPVWLTKAIYRRLNLPSYAKVQEFSTV"
     gene            complement(<92346..>95081)
                     /locus_tag="CAGL0L00737g"
                     /db_xref="GeneID:2890928"
     mRNA            complement(<92346..>95081)
                     /locus_tag="CAGL0L00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448806.1"
                     /db_xref="GeneID:2890928"
     CDS             complement(92346..95081)
                     /locus_tag="CAGL0L00737g"
                     /inference="similar to AA sequence:UniProtKB:P40528"
                     /note="similar to uniprot|P40528 Saccharomyces cerevisiae
                     YIL047c SYG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448806.1"
                     /db_xref="GeneID:2890928"
                     /db_xref="GOA:Q6FLT8"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT8"
                     /translation="MKFADHLRESTISEWKGKYIDYKYGKKKLKKYKANTAKLNIPAV
                     GYVSGRGTPKKKYNDFQVECINDFIEDWLIPNQLYKCNEFYLWLLSQCQEKYLILSQQ
                     LDCYREHKKEFREISSRVTYQTSSTSVLQAYGSISNAPEEDIEEDPELSFKKHDNMFQ
                     MTLKHFLNEHDLMPSWPKMFIETIPEALKPKSINTKLKETFAYSNKLNLNLNLMRNKD
                     EHGNKILKNPHKELKHARALLSDALLEFYLFLQLVKSYRDVNVVGFRKIVKKFDKTCK
                     TQELAGFMRFVRANYTIFKHDAVSTEATIKASKAKTLTDDDIGEDSSTITDTNVSLTS
                     TTIDPLRAWEAKLTKWYTVDVVNSLSEKKRHLEKLKKVSIQYSLNEQMIHRNNRAILQ
                     MTVFGVFTGIAVTLIAYTLYLAFLSPLNTKRHKILFPIWGGWYMILLISLFFLIDCFI
                     WHRTGINYRFIMFGEVQAKSGTQFFNNDFATTGIPLRLYFLAFFIISCAIISALSFHF
                     DHLTPYGYIYFIVVGLLFITPYDLIPYWDKLVETRKFLVTTTIRLVLSGLYPVEFKDF
                     FLGDIICSLTYTLSDLAIFACYYAPKTRKDPLGMCGSSHSKAMGVLSCLPSFWRFMQC
                     VRRFFDSNDWFPHLPNAAKYLLGVAYNATLCAYRLSNHSPAKRNPFIIFATLNSISTS
                     IWDLVMDWSVLQSSIGNENLFLRKDLYLAGKRNWETGKYDWSRKAVYYIAMVLDVVIR
                     FQWIVYAVAPQTIQQSAVTSFALAVTEVCRRFIWVIFRVENEHVANVHLFRVTGEALL
                     PYPNQDVVDFSGKATTDLYDDQHFQQGRDSIESSRPSHLHDLDLSLSDINNKFEEPTA
                     TYHSIVRRRTAIFDNISRSIPWAHAKDFQRPLTQHNGESSKTYESDSESEGESIA"
     gene            <95845..>96765
                     /locus_tag="CAGL0L00759g"
                     /db_xref="GeneID:2890929"
     mRNA            <95845..>96765
                     /locus_tag="CAGL0L00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448807.1"
                     /db_xref="GeneID:2890929"
     CDS             95845..96765
                     /locus_tag="CAGL0L00759g"
                     /note="highly similar to uniprot|P00498 Saccharomyces
                     cerevisiae YER055c HIS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448807.1"
                     /db_xref="GeneID:2890929"
                     /db_xref="GOA:Q6FLT7"
                     /db_xref="InterPro:IPR001348"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /translation="MDFVNHLNDRLLFAVPKKGRLYEKTKQLLNGSDIKFNRSNRLDI
                     ALCTTLPIALIFLPAADIPTFVGEGKCDLGITGLDQVKESGIEEIDLLMDLGFGGCKL
                     QVQVPEKDRKYTDPKQLVGKTIVSSFVKLSRDYFQQLEEEVLGKPVDKLSTKIKYVGG
                     SVEASCALGVGDAIVDLVESGETMRAAGLIDIATVLETSAYLIQARRPQQDKSREELI
                     EVIKSRIQGVLTAQRYVCCSYNTPEGNLKELLKVTPGRRAPTISKLDDDGWVAVNSMI
                     ERKRKADIMDELKRKGASDIMVFEISNCRV"
     gene            <97503..>99524
                     /locus_tag="CAGL0L00781g"
                     /db_xref="GeneID:2890930"
     mRNA            <97503..>99524
                     /locus_tag="CAGL0L00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448808.1"
                     /db_xref="GeneID:2890930"
     CDS             97503..99524
                     /locus_tag="CAGL0L00781g"
                     /inference="similar to AA sequence:UniProtKB:P39014"
                     /note="similar to uniprot|P39014 Saccharomyces cerevisiae
                     YIL046w MET30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448808.1"
                     /db_xref="GeneID:2890930"
                     /db_xref="GOA:Q6FLT6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT6"
                     /translation="MEVRQVKHSRDDTEAEGAKRRKMPYDEQIQMLAEEEEEDTMKRD
                     MGDALATSTESQSGVSVLPRDNFQRYCYRHNPEIQTSNTHELCYKQDMQRIKMINNKI
                     SQLACPKEQADIHHIISKYTNSNDKVRKLILDGILTSSCFPQLSYIAQHINTMIKIDF
                     ISVLPQELSLKILGYLDCQSLCNASMVCKNWHLLADDDRVWYHMCEQHIDRKCPNCGW
                     GLPLLHMKRARVCYIKAKNPNTTVNDRKMIQDNDNRISPLTDRTQGNESPGATFSTNV
                     CTTASNNTVSGSKSSGQGQQENGRCRQKSWKMVYRERFKVESNWRKGLCTIQEFKGHM
                     DGVLTLQFNYRLLFTGSYDTTVAIWDLFTGKLIRRLTGHSDGVKTLYFDDQKLITGSL
                     DKTIRVWNYITGECISTYRGHTDSVMSVDSHKKIIVSGSADKTVKVWHVESRTCYTLK
                     GHTEWVNCVKLHPKSFSCYSCSDDTTIRMWDIRTNTCLRVFRGHVGQVQKVIPLTIID
                     AQNLVTHERKPGEEDDIASNGTGEDDPENGVNGQRELDKKMPYPTHLLSCALDNTIKL
                     WEVRSGRCIRTQFGHVEGVWDIAADNFRIISGSHDGSIKIWDLQSGKCMHTFHGRKLK
                     GSDVNTSSNPDHDERTKSAPVACVCIGDSECFSGDEFGCVKMYKFDSQD"
     gene            <100545..>103028
                     /locus_tag="CAGL0L00803g"
                     /db_xref="GeneID:2890931"
     mRNA            <100545..>103028
                     /locus_tag="CAGL0L00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448809.1"
                     /db_xref="GeneID:2890931"
     CDS             100545..103028
                     /locus_tag="CAGL0L00803g"
                     /note="some similarities with uniprot|P40036 Saccharomyces
                     cerevisiae YER054c GIP2 or uniprot|P40187 Saccharomyces
                     cerevisiae YIL045w PIG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448809.1"
                     /db_xref="GeneID:2890931"
                     /db_xref="GOA:Q6FLT5"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT5"
                     /translation="MYIDEEIDSVFVRRLDGDRSSEMKSRSTRRSLKKKKKSNGSTAK
                     STSSAHNDKPVKQSAVGQQPMAAKANMRSNGTAGKTVVAQDDSKMDAERIHQEATKRF
                     AVIESIRNDKALEAQTPFTKNFTIHEKLPDHKDNKDVKTTAGSGKSDLVVDTDDHIKT
                     AESMDIRLNNPLLKDSQNSVENGKAINVESKKNEEPMTILRKHNNQNITENKNDTVPK
                     QKDAMPNVKYSPKVNDTKIETENVLKKNHDTYTQLNSKVAISMENPVEKVPLSLDTYQ
                     SQPKIKAETTPDLITGERNIRRTSNVIGTGKGRINSLDFLHKPQRVTQMKSEDFISPE
                     ELKRNTDMNKQILMAKILPDDRINDKIDDITTPEEEITGLKHELGKMSIGNGSANSPA
                     INSIKAEEIIELAQDESISPTEHHYPILNRANQAQQDVCLPLHDSYDQSPVEDHMMPL
                     PPVYKKSGELVKSSLKRRSKSLPVTPNSNRRTQNSRGVRMNNPRDQLIRSKSVHFDQR
                     LPVKYFFKEESPSVVSIRDEEDDVLSFQHKPLVRSIDRNNGRKKRLDLNRRLEGGFMD
                     DDEDGYPYSYDYDEDDDETTRGGTDLDRYMDEYDYENGFSQGDSIFSRGLKSLMMNDR
                     GSGLKDNFKDPTPPVSQSSTSKKEEKMTTLVSKNFPTLGSKTSKSLKLNIFLNSTSDK
                     KVLLQEVSLNVQKRKSNYYNSNFGGPGIGFSTGRDEDDKLIITGTVLVKNIYFDKKVS
                     IRYTWDHWRSCNEVESMYVGSGNNYLPGSQMDIFRFMIDNTVLSNGQYVSNRSRELEF
                     CIQYTTRSNTAREEYWDNNNGKNYIVEIQ"
     gene            complement(<104706..>105503)
                     /locus_tag="CAGL0L00825g"
                     /db_xref="GeneID:2890932"
     mRNA            complement(<104706..>105503)
                     /locus_tag="CAGL0L00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448810.1"
                     /db_xref="GeneID:2890932"
     CDS             complement(104706..105503)
                     /locus_tag="CAGL0L00825g"
                     /inference="similar to AA sequence:UniProtKB:P40529"
                     /note="similar to uniprot|P40529 Saccharomyces cerevisiae
                     YIL044c AGE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448810.1"
                     /db_xref="GeneID:2890932"
                     /db_xref="GOA:Q6FLT4"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT4"
                     /translation="MTSVPVKKALTTLLRDPGNASCADCKSQSHPRWASWSLGVFICI
                     KCAGVHRSLGTHISKVKSVDLDTWKEEHLKELVQMRNNVNANRVYEAKLPDSSKFNGK
                     SLGNDINLLQEFIRQKYERKRWMDSSVDLSRDQPVVSQANSSSSSLVSTMSSSNESTN
                     NTVAVEEKLKPQSTHSSSLLNLQGRKEIVENKRPARPTQQDTPQRNDLKKSILSLYSS
                     ANASKSNNNSTMNVSSGMGMTTPFNTTPQNNSSLSIDDDELFKNVWS"
     gene            complement(<106031..>106888)
                     /locus_tag="CAGL0L00847g"
                     /db_xref="GeneID:2890933"
     mRNA            complement(<106031..>106888)
                     /locus_tag="CAGL0L00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448811.1"
                     /db_xref="GeneID:2890933"
     CDS             complement(106031..106888)
                     /locus_tag="CAGL0L00847g"
                     /inference="similar to AA sequence:UniProtKB:P38626"
                     /note="similar to uniprot|P38626 Saccharomyces cerevisiae
                     YIL043c CBR1 cytochrome-b5 reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448811.1"
                     /db_xref="GeneID:2890933"
                     /db_xref="GOA:Q6FLT3"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /translation="MDGIKILATFSVLVLFYKLFTYSKKGGVSQKEAVKALLKTEFRE
                     FELVEKEQLTHNTAKYKFKLADESHVLGLPIGQHITVKTIIGGKPVSRSYTPTSLDEE
                     CVGFFELLVKSYPEGNISKHIGDMKIGEKINISGPRGFYEYVPNVHKHLAMVAGGTGI
                     TPMFQIMKAIARDPSDKTRVTLLYGNVLEEDILLKQELDDLVKQRPDQFKITYLLDKP
                     ERDDWEGGVGYVTLDLMKESFPSAEEDVQLLVCGPPGMVSSVKRNAVALGFPRAKPVS
                     KMEDRVFVF"
     gene            complement(<107233..>108492)
                     /locus_tag="CAGL0L00869g"
                     /db_xref="GeneID:2890934"
     mRNA            complement(<107233..>108492)
                     /locus_tag="CAGL0L00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448812.1"
                     /db_xref="GeneID:2890934"
     CDS             complement(107233..108492)
                     /locus_tag="CAGL0L00869g"
                     /inference="similar to AA sequence:UniProtKB:P40530"
                     /note="similar to uniprot|P40530 Saccharomyces cerevisiae
                     YIL042c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448812.1"
                     /db_xref="GeneID:2890934"
                     /db_xref="GOA:Q6FLT2"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT2"
                     /translation="MFLRSALRLGGHRRVIGRQFHAASVLLKNSKYGSVANYQDRLKH
                     LEFDKHYKIRSNIELLIQEYASKPIPPLTYDYLTHYKPPLSANEEYMLTIKTINLLLS
                     YTCRRLNAIQKLPYVAAVNPSIEKSYSLYLKTLESLLSIEFPYALHDKDIIHGLLIEF
                     LDDHQDTVETLSRGLEEIMDFLEKDTIFKFLDEHLRDRIAMKILATNHLAVSNHNRDS
                     DPNMIGTIHKALPVADMVKKVSEFVSDLCFVKYDQLVAPVKIYGGHDVTFPCIPTILE
                     YVLTEILKNSYRAHIENTTSHNCLVEKPVEVQIVKDEKYDEELEIRIRDFGGGIPPNV
                     ESHIFEYSYTTVESDKKESGASAYVIPGEDINIVSGMGFGLPMCKAYIEMFDGKLDIQ
                     SLWGWGTDVYIKLKGPTKKMLEPKKDE"
     gene            <108801..>109826
                     /locus_tag="CAGL0L00891g"
                     /db_xref="GeneID:2890935"
     mRNA            <108801..>109826
                     /locus_tag="CAGL0L00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448813.1"
                     /db_xref="GeneID:2890935"
     CDS             108801..109826
                     /locus_tag="CAGL0L00891g"
                     /inference="similar to AA sequence:UniProtKB:P40531"
                     /note="similar to uniprot|P40531 Saccharomyces cerevisiae
                     YIL041w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448813.1"
                     /db_xref="GeneID:2890935"
                     /db_xref="GOA:Q6FLT1"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT1"
                     /translation="MSNFNSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQRMV
                     QEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNE
                     FSKNMAAKVQELSKATSATEAQNILVAPGPVKEPKTLNYAMSKVALNASEYLNHSFDD
                     PMDAKLSKVLLNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQ
                     SKRLQYDVARTNLQNAKPEKEAGLRVQMETLEDQFAQATEDATVVMQEVIASANFLPS
                     LKELATAQLEYYEQSAKLMKEFISSVDSSSSDAPASKTSKTSQTSTTTDAGISLEDDD
                     DEPLPPK"
     gene            complement(110216..110287)
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0L00913r"
                     /db_xref="GeneID:2890936"
     tRNA            complement(110216..110287)
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0L00913r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2890936"
     gene            <111552..>111995
                     /locus_tag="CAGL0L00935g"
                     /db_xref="GeneID:2890937"
     mRNA            <111552..>111995
                     /locus_tag="CAGL0L00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448814.1"
                     /db_xref="GeneID:2890937"
     CDS             111552..111995
                     /locus_tag="CAGL0L00935g"
                     /note="weakly similar to uniprot|P40532 Saccharomyces
                     cerevisiae YIL040w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448814.1"
                     /db_xref="GeneID:2890937"
                     /db_xref="GOA:Q6FLT0"
                     /db_xref="InterPro:IPR024316"
                     /db_xref="UniProtKB/TrEMBL:Q6FLT0"
                     /translation="MMDRTVTHPEENIQQLIVGLLSKVINFLQILIPVIVRFSKEYPT
                     AFIVISLIIGLYVVWRCIMSLYAMVRRLFYLSLVLLVVCAYMRGAELFFEHDVPLVAN
                     GIWDNRELIKSSVVSTCTYGYKILRQNSIILYYYLKNQLEEAIQK"
     gene            <112612..>113733
                     /locus_tag="CAGL0L00957g"
                     /db_xref="GeneID:2890938"
     mRNA            <112612..>113733
                     /locus_tag="CAGL0L00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448815.1"
                     /db_xref="GeneID:2890938"
     CDS             112612..113733
                     /locus_tag="CAGL0L00957g"
                     /inference="similar to AA sequence:UniProtKB:P39101"
                     /note="similar to uniprot|P39101 Saccharomyces cerevisiae
                     YER048c CAJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448815.1"
                     /db_xref="GeneID:2890938"
                     /db_xref="GOA:Q6FLS9"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS9"
                     /translation="MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNA
                     QAKFQAVGEAYQVLSDDELRKRYDQLGKESAVPQQGFVDPSEYFTAIFGGDGFKEWVG
                     EFSLFKELGEAAAEEAATGTTSAEAAAEANGSANGKSKLTKEQREKLAEMQKRRREDL
                     IKQVEELSNKLNAKLDSYVVAVKGNHLDEFQKKLTQEIEELKLESFGLELLHILAKVY
                     RNKANNYLLSKKTLGVSRFLTGFRDGAKDVKSTYSLIHTGYEAQKTMQGLSEVNPEEL
                     SPEERAKFEHMVAGKTLGVMWAMSKFELERKLREVCNRILNDRNGHDKTLKAKGLLFL
                     ADNFSRARRSPEEAEEARVFEELILGQQERQTKRRYRVQ"
     gene            <114185..>115612
                     /locus_tag="CAGL0L00979g"
                     /db_xref="GeneID:2890939"
     mRNA            <114185..>115612
                     /locus_tag="CAGL0L00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448816.1"
                     /db_xref="GeneID:2890939"
     CDS             114185..115612
                     /locus_tag="CAGL0L00979g"
                     /inference="similar to AA sequence:UniProtKB:P40533"
                     /note="similar to uniprot|P40533 Saccharomyces cerevisiae
                     YIL039w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448816.1"
                     /db_xref="GeneID:2890939"
                     /db_xref="GOA:Q6FLS8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS8"
                     /translation="MGLRGFIKLFAVFGTLLALFSNLFIYTYPSIHPGRCSWARTKND
                     KFVDVSLPKGLSTTNKVKITVQNYFNDLFGYTENTEDSAVEDIHFMAFGDPQIKGIFK
                     NTPYNTRLDIFGNDYYLGHIYSMMKKRLKPLHVAVLGDLFSSQWIGDSEFYNRTYRYM
                     DRIFQRDTTEIVNIKENHHDEEGQYKTDWKAWGDQFKEYYENNMTFPFGYSDVYSWNP
                     NQENFLFINISGNHDCGYSGDATYQHMSRYYDMFGKDNYWIEYDTNTDHPWRIVVLNS
                     LLLDGPPLQQEFVDATWEFLYQLFERRFEGNTILLSHVPFYKEEGLCVDGPEFRYYPE
                     VFEREPYKANLLRSQNHLSKETSEKVLNLVFDNDKPGIVLTGHDHEGCETIYNKFKNG
                     TWEATRKPVYEDTLAHIQEVTVRAMMGEFYGNTGLITGHFNKSLKTWEWKFSLCPFAI
                     QHVWWIAKVSALISGFLWSFIVLLN"
     gene            complement(<115884..>118295)
                     /locus_tag="CAGL0L01001g"
                     /db_xref="GeneID:2890940"
     mRNA            complement(<115884..>118295)
                     /locus_tag="CAGL0L01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448817.1"
                     /db_xref="GeneID:2890940"
     CDS             complement(115884..118295)
                     /locus_tag="CAGL0L01001g"
                     /inference="similar to AA sequence:UniProtKB:P06102"
                     /note="similar to uniprot|P06102 Saccharomyces cerevisiae
                     YIL038c NOT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448817.1"
                     /db_xref="GeneID:2890940"
                     /db_xref="GOA:Q6FLS7"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS7"
                     /translation="MAHRKLQQEIDRVFKKINEGLDIFDSYYERHESCTNNPSQKEKL
                     ESDLKREVKKLQRLREQIKSWQSSPEIKDKDSLLEYRRSVETAMEKYKAVEKASKEKA
                     YSNISLKKSDTLGPQEKEIKEVSDYLSQEIDELERQYEAAQIEIDRLIVLNKKKKTAS
                     AANDEKKDQLKALQLRYRWHQQQMELALRLLANEELDPQKVNAIKDDIRYFIESNREP
                     DFVEDETIYDTLDLTSNEAIAHEVAQYFAAQSSEDNLGGENNEPIDLDSIDTSKLSKK
                     ELRKLEREAKKAAKVAAKNAAIATANAPPTISIPAAKPQSADSSIISNSDDKNDDKSN
                     NKSESVSPIVSKIENSTANTTPRSPLVKKPTTSTPVSSRPTTTGFNTDTAEIKGSHTH
                     IQTQNGMTSSTILKPAVVPARPAGDLKWSVAASHGIEKERKINSPPSLVATMSSRSNS
                     ITQQTNEQTPTISKTQINTTGTTLAERLEKAHEQSVSAATQINSVSEQTKPAEPQNDN
                     AKGSMDNTSDENNNKEQEVNIDSPILEAPLFSDFSDSDYEEIESDSEEQLSLDESNTQ
                     NLKKEHLKSALSSDFEMLLLPSGIQEFIMGMDLTKNNITTTSEGKIRRSRDTCNIFRL
                     DNVPYGVNPPSPLDAFRSAQQWDTARHSLWSSLRNNEANFNEEILMSKFESLDMFTLF
                     YNYYFSVTPLEKQIASKVLKNREWRVANNEVMWFLRQGEPKLVNDQYEIGDYKIFKLD
                     DWTVIDKVNFKLDYGLLKDNQKQSNTDGRDTEQNSLTGDDDNALSHGQQLLQQLKRGK
                     DSISA"
     gene            complement(<119691..>119978)
                     /locus_tag="CAGL0L01023g"
                     /db_xref="GeneID:2890941"
     mRNA            complement(<119691..>119978)
                     /locus_tag="CAGL0L01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448818.1"
                     /db_xref="GeneID:2890941"
     CDS             complement(119691..119978)
                     /locus_tag="CAGL0L01023g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448818.1"
                     /db_xref="GeneID:2890941"
                     /db_xref="GOA:Q6FLS6"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS6"
                     /translation="MSTIEIKNNSGIKILQSQKKNCRISIIVTVIFILLDPMLLACLG
                     LYNLAMVKRRHRLLMLEISEVYELRNKCFMTQPIEPLYKRFNSENLHTSEI"
     gene            complement(<120109..>120342)
                     /locus_tag="CAGL0L01045g"
                     /db_xref="GeneID:2890909"
     mRNA            complement(<120109..>120342)
                     /locus_tag="CAGL0L01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448819.1"
                     /db_xref="GeneID:2890909"
     CDS             complement(120109..120342)
                     /locus_tag="CAGL0L01045g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448819.1"
                     /db_xref="GeneID:2890909"
                     /db_xref="GOA:Q6FLS5"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS5"
                     /translation="MAFMITDLGILIKKYTEIKNINSVFDKAVSLIHAMRREQLQPTN
                     RPLDTIARQCLLIGDIDKYNTRTDELQRNLNVS"
     gene            <122716..>123333
                     /locus_tag="CAGL0L01067g"
                     /db_xref="GeneID:2890910"
     mRNA            <122716..>123333
                     /locus_tag="CAGL0L01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448820.1"
                     /db_xref="GeneID:2890910"
     CDS             122716..123333
                     /locus_tag="CAGL0L01067g"
                     /inference="similar to AA sequence:UniProtKB:Q12515"
                     /note="similar to uniprot|Q12515 Saccharomyces cerevisiae
                     YDL173w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448820.1"
                     /db_xref="GeneID:2890910"
                     /db_xref="GOA:Q6FLS4"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS4"
                     /translation="MTEKYRISTGRGGAGNIHASDSRASPKLIKQGSQTPSILQPVYS
                     TGRGGAGNMRRNTDPKLTRRAQDVDSMSEDLIDIDELMDHEDYIEPVNPVGALQADDN
                     ETAVDTSIGGRKQSRSHTSRSRSRSRSKSRLSKTLSATKSNTKHKPQEKVIIGRGGAG
                     NIISPKSSNPKAKHMHSKNQNNKDKDKTKKKKGFLSSITSMFSST"
     gene            complement(<123897..>130355)
                     /locus_tag="CAGL0L01089g"
                     /db_xref="GeneID:2890911"
     mRNA            complement(<123897..>130355)
                     /locus_tag="CAGL0L01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448821.1"
                     /db_xref="GeneID:2890911"
     CDS             complement(123897..130355)
                     /locus_tag="CAGL0L01089g"
                     /note="highly similar to uniprot|Q12680 Saccharomyces
                     cerevisiae YDL171c GLT1 glutamate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448821.1"
                     /db_xref="GeneID:2890911"
                     /db_xref="GOA:Q6FLS3"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS3"
                     /translation="MLSSDPYDPMEDAYETSGNIPDYAHDELYHNSENKSWGQVVPGK
                     VGLYDPDYEHDACGVGFVANVNGLQSHKIVSDARSLLCNMTHRGAVSSDGNGDGAGIL
                     VGIPHGFIKREFKLDLGIEVPERGQYAVGNVFFKKDDSDDETLSEKSKAEIRVMQQKF
                     EDTARNFNLNVVGWRNVPHDSSILGDVALSREPVILQTLVVPLDSNELVEFNETVFKT
                     NLYLFRKFITKQFKPEDCFYVCSLSNSTIVYKGQLTPNQVYNYYHDLTNAHFESHMAL
                     VHSRFSTNTFPSWDRAQPLRWVAHNGEINTLRGNKNWMRSREGVMVSETFKDKLDSLY
                     PIIEEGGSDSAALDNVLELLTINGTLSLPEAIMMMVPEAYHSDMDSDLKAWYDWAACL
                     MEPWDGPALLTFTDGRYCGAILDRNGLRPCRYYVTSDDRVICASEVGVIPIDNSLVLQ
                     KGKLKPGDVFLVDTQQGQIVDTKKLKSDFSKREDFKSWLSKVIKLEDLLQKTENCEPE
                     DFVLNAPSLKVQSDPRLLAHGYTFEQFSMLLTPMALTGKEALGSMGNDAPLACLNQDP
                     VLLYEYFRQLFAQVTNPPIDPIREANVMSLDCYVGPQGNLLEMHPSQCERLLLKSPIL
                     KWNEFKAIQNIEKVNPSWSVANIDITFEKSEGIEGYINAVERITKDASIAIEEGKKIL
                     IISDRRMGEHRVALSSLLAVSSIHHHLIRNKQRTEVALILETGEAREIHHFCVLLGYG
                     CDGIFPYLAMETLIRMNREGLVRNVNNDDHDLTDQELVENYKHAIDSGILKVMSKMGI
                     STLASYKGAQIFEALGIDSSVIDLCFTGTSSRIKGVTFEYIAQDAFSFHEKGYPSRMT
                     ITRSVNLPETGEYHWRDGGYKHVNDPTAIAALQDSVRHKNDDAWSLYVKKEMEAIKDC
                     TLRGLLELDFENSTPIPIEQVEPWTEIARRFASGAMSYGSISMEAHSTLAIAMNRLGA
                     KSNCGEGGEDAERSLVHPNGDTMRSAIKQVASARFGVTSHYLSDADEIQIKIAQGAKP
                     GEGGELPAHKVSKSIAKTRHSTPNVGLISPPPHHDIYSIEDLKQLVYDLKCANPRAGV
                     SVKLVSEVGVGIVASGVAKAKADHILISGHDGGTGASRWTSIKYAGLPWELGLAETHQ
                     TLVLNDLRRNVVVQTDGQLRTGFDIAVAVLLGAESFTLATIPLIVMGCVMLRRCHTNT
                     CAVGIATQDPYLRSKFKGQPEHVINFFYYLIQDLRQIMARLGFRTIDEMVGHSEKLRR
                     RADANPKVINIDLTPILTPAHTIRPGVATRFTKKQDHKLHTRLDNKLIDEAEVTLDKG
                     LPVNIDANIVNTDRALGSTLSYRVSKRFGENGLPRDTIVANINGSAGQSFGAFLASGI
                     TFILDGDANDYVGKGLSGGIIVVRPPKNSKFKSDENVIVGNTCFYGATSGTAFIAGSA
                     GERFAVRNSGATIVVERVKGNNAFEYMTGGRALVLSQLESINAFSGATGGIAYCLTSD
                     YDAFLSKINKETIELEHLEDPVEIAYVKNLIQEHYNFTKSELASNILGNFNHYLKKFV
                     KVIPSDYKKVLLKEAEEKAKEKENATAEYLKKLGSPAEPGLDATNGEVAKMQAAKRQA
                     ISRAVISNKSTLHEPKVLDLEEAVPDAKQMEKNAEKVVKMNGFMKYNVRHEGHRDPAT
                     RTKDWKEFTKPVSKRDAKYQTARCMDCGTPFCQSDTGCPLSNIIPKFNELVFKNQWKL
                     ALDKLLETNNFPEFTGRVCPAPCEGACTLGIIEDPVGIKSIERIIIDNGFKEGWIIPT
                     PPSTRTGRRVAIIGSGPAGMACADMLNRAGHSVTVFERADRCGGLLMYGIPNMKLDKS
                     IVQRRLDLLSAEGIEFVTNTEIGKDITVDELKSNYDSVVYAIGSTIPRDLPIKGRELK
                     NIDYAMNLLTENTKALLSNDLETIRKQIEGKRVLVIGGGDTGNDCLGTSVRHGAKSVV
                     NFELLPQPPNERAKDNPWPQWPRIMRVDYGHAEVKEHYGRDPREYCILSKEFIGDEEG
                     NVTGIKTARVEWKKSQSGVWQMVEVPNSEELYEADIVLLSMGFVGPELLNNDTNIKKT
                     RRGTIETLSHSSYNIDGGKMFAAGDCRRGQSLIVWAIQEGRKCAAAVDEFLMGDTYLP
                     GSGGIVKRDYRLLEELAATV"
     gene            <133129..>134274
                     /locus_tag="CAGL0L01111g"
                     /db_xref="GeneID:2890912"
     mRNA            <133129..>134274
                     /locus_tag="CAGL0L01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448822.1"
                     /db_xref="GeneID:2890912"
     CDS             133129..134274
                     /locus_tag="CAGL0L01111g"
                     /note="highly similar to uniprot|P32771 Saccharomyces
                     cerevisiae YDL168w SFA1 long-chain alcohol dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448822.1"
                     /db_xref="GeneID:2890912"
                     /db_xref="GOA:Q6FLS2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR014183"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS2"
                     /translation="MTEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTA
                     VCHTDAYTLSGADPEGLFPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCK
                     FCLSGKTNLCGAVRATQGKGVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVV
                     AIDQTAPLESVCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGA
                     SRIIAIDTNDQKKDFCTQFGATDFINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGN
                     VNVMRSALEACHKGWGQSVIIGVAAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMA
                     GLIEQYKKGELKVDEFITHRRSFNEINEAFDDLHNGLCLRTVLSFSK"
     gene            complement(134535..134605)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L01133r"
                     /db_xref="GeneID:2890913"
     tRNA            complement(134535..134605)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L01133r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2890913"
     gene            complement(<135948..>136394)
                     /locus_tag="CAGL0L01155g"
                     /db_xref="GeneID:2890914"
     mRNA            complement(<135948..>136394)
                     /locus_tag="CAGL0L01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448823.1"
                     /db_xref="GeneID:2890914"
     CDS             complement(135948..136394)
                     /locus_tag="CAGL0L01155g"
                     /inference="similar to AA sequence:UniProtKB:P32613"
                     /note="similar to uniprot|P32613 Saccharomyces cerevisiae
                     YEL048c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448823.1"
                     /db_xref="GeneID:2890914"
                     /db_xref="GOA:Q6FLS1"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS1"
                     /translation="MTPKVEPCFISIISETNSPIITYCPPRYRTEMEHILKSNVLANI
                     SLDYFESNLYKWKQTSDGDVTIKNLFQIEEVSVFGMLVLSTNLKIVLGFPVDNSFDDI
                     EIKRIFDGIRKVYTRVKCNPFITVNIENQEEEVSRLLEEKLNEIFT"
     gene            complement(<136726..>138123)
                     /locus_tag="CAGL0L01177g"
                     /db_xref="GeneID:2890915"
     mRNA            complement(<136726..>138123)
                     /locus_tag="CAGL0L01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448824.1"
                     /db_xref="GeneID:2890915"
     CDS             complement(136726..138123)
                     /locus_tag="CAGL0L01177g"
                     /note="highly similar to uniprot|P32614 Saccharomyces
                     cerevisiae YEL047c FRDS1 soluble fumarate reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448824.1"
                     /db_xref="GeneID:2890915"
                     /db_xref="GOA:Q6FLS0"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:Q6FLS0"
                     /translation="MATVIVGTGLAGLTCANQLLELGKSPVILLDKTGTIGGNSTKAS
                     SGINGAHTRTQEAQNIQDNPELFYQDTVKSSKGRGVTDLMDKLANDSHLAIQWLQEEF
                     GLSLDLLAQLGGHSVARTHRSSGKLPPGFEIVSTLSKRLKEIAEKEPEKCKIILNANV
                     VDVNINNEKAITGVIYKDGEGKEIQLDANNVVFCSGGFGFSKDMLKKYAPETVDLPTT
                     NGPQTTGDGQRILEKIGADMIDMDQIQVHPTGFIDPEDPSAGSKFLAAEALRGLGGIL
                     LNPSTGKRFVNELSTRDAVTNAIQTHCPKEKNTALLVMGEGIYEKCKVNLDFYMFKKL
                     VNKITIAELVKKYEVPVDAKEVASEINSYNVSSSDSFGRTLVIQNFGENVTQDTTVFV
                     GEVTPVVHFTMGGAKINTSSEVVGKDGQVVANGLYAAGEVSGGVHGANRLGGSSLLEC
                     VVFGRTAAKTIASKN"
     gene            <138701..>139099
                     /locus_tag="CAGL0L01199g"
                     /db_xref="GeneID:2890916"
     mRNA            <138701..>139099
                     /locus_tag="CAGL0L01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448825.1"
                     /db_xref="GeneID:2890916"
     CDS             138701..139099
                     /locus_tag="CAGL0L01199g"
                     /inference="similar to AA sequence:UniProtKB:P32617"
                     /note="similar to uniprot|P32617 Saccharomyces cerevisiae
                     YEL044w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448825.1"
                     /db_xref="GeneID:2890916"
                     /db_xref="GOA:Q6FLR9"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR9"
                     /translation="MEVDRIEVLKEVFAQNVQAASLGFKRQHQKRVGKGRHKSCKQLL
                     SDEQKRINNECLNNGKVPKVTYFNVEAPPSLKPAKKYCDITGLKANYRSPTNNIRYHN
                     AEIYQLVVKPMAAGVDQEYLKLRGANFVLK"
     gene            <139739..>142723
                     /locus_tag="CAGL0L01221g"
                     /db_xref="GeneID:2890917"
     mRNA            <139739..>142723
                     /locus_tag="CAGL0L01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448826.1"
                     /db_xref="GeneID:2890917"
     CDS             139739..142723
                     /locus_tag="CAGL0L01221g"
                     /inference="similar to AA sequence:UniProtKB:P32618"
                     /note="similar to uniprot|P32618 Saccharomyces cerevisiae
                     YEL043w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448826.1"
                     /db_xref="GeneID:2890917"
                     /db_xref="GOA:Q6FLR8"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR8"
                     /translation="MFHLFVAFLAFSWLLYRLVRFITIPVSSIVVTLGVKTPPTTKVS
                     IDKITSDSITIHWENEPLNQDSKEVNTDSGNGYTNEYSICHYILYLNNKQIAVFHNSP
                     NALYTCCAITGLEHGMEYQLDFVSVNKLGYVNKLPSIYCKTDAITGNGIDKTDIIHNN
                     EFNDQMDNSQKTTRWRRNTLVKKLTSTFSGDSSQSKISTDNYGLSVNGFNAGSNLQSY
                     TSLTTLKDLENYTIDDLKKILVCSQEDLHDVLAQEKSISEDFQESQVQLQMELDNLKT
                     SWSHEMNLRKSLKSSIKSLENSKLLTDTKSEKVKKKINELRFKISRMEKDMKEWEKEN
                     SLYHTADLGGKYDTMIKEIGDTEMQLLQQVQNLQSEIQIGEANYKDIVSRKPILTKVK
                     SKVGKETINSLSSDKQENALPIIRDLEFLLTDTSKLYQHNSKLASLSNDSKIMKFIKT
                     QKSMDQKKDSKWKAKFEKIQTTIKELEGKLTEMESQKQGNNLNDEGNVYKISSSDNIQ
                     NYQNILAQNYQNISMNQNDTPQLLPNSKLSDGLEQVNSNGLSNDSPVLSNDIDMANQT
                     PLILHHPASYNGLNPPINFQVMSPPNQVAYMNQETRQFSSGSNAVGSVMSAGAQSNHT
                     NNSVWNNSYPYENADNNLEYENTNHLLTGLEDMIHDEADYPESISNYSNVFTVDQLDN
                     YWNKKRSIPLKSNAAHSTNTGVSNIHAAAEMLSPQASALSQSSQVDNKLGTSYSQDRI
                     PLSSSPLGPYTHAHSSSLGVPQSHTQHLLSSSLNNSVLGKYQDQFGFQQGSNYYGNSR
                     PLASNINGLSNGLPSPHQNENETGPVSFNFLPNYAHNDDILVNQVHLNNSFGVNDIGQ
                     HNINEEAFQNSRMVDNASNIWNTIQLDNDDPKSVSNMESKESSSTIHEPTTPKAHKRN
                     QSNSSIASWTRLSWKSLTTSNPTSPQRGSIHEPALEEEDQRPNSQGHANGQERPTNGR
                     KMSRLLSRSTMNNLFKKSTHDS"
     gene            <143206..>144831
                     /locus_tag="CAGL0L01243g"
                     /db_xref="GeneID:2890918"
     mRNA            <143206..>144831
                     /locus_tag="CAGL0L01243g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448827.1"
                     /db_xref="GeneID:2890918"
     CDS             143206..144831
                     /locus_tag="CAGL0L01243g"
                     /inference="similar to AA sequence:UniProtKB:P32621"
                     /note="similar to uniprot|P32621 Saccharomyces cerevisiae
                     YEL042w GDA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448827.1"
                     /db_xref="GeneID:2890918"
                     /db_xref="GOA:Q6FLR7"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR7"
                     /translation="MNGLFRNYRFLMGAFALIMLILLIRSSNSIPNGSGISRPVTPNT
                     NKPDSPQDFKTLPIDEPGYTDDKKTENNNPEVADAVKDAIKSSVSGDSAKTGKKPSGE
                     VIGTGKTCTQEHQYVIMIDAGSTGSRVHVYEFDICSKPPILINETFEMLKPGLSSFDT
                     DSIGAAKSLDPLLNIAMNVIPKHQRPCSPVAVKATAGLRMLGETKSQKILDAVKRHLE
                     VDYPFPVVGGDGISIMSGELEGVYAWVTTNYLLGNIGASDRRPTSAIFDLGGGSTQIV
                     FEPTFPPTEEMVEGEHKYVLDYGSEKYTLYQYSHLGYGLMQGRNKINSLLVSNAIKEG
                     TIKQGDSQTEYVLSSPCLPPKVTAPVEKVKVGDSETYKVKFVGPKVAAGAQCRFLTDS
                     ILNKESSCKVPPCSFNGVHQPSLVRTFHESNDLYIFSYFYDRTRPLGMPLSFTLQELM
                     ELTRNVCNGEEVWDDVFANLGDSLNSLKKDPHFCQDLSFLGSLLHTGYDIPLQRELKT
                     AQKLAGNEIGWCLGASLPLINSKDWKCRLDQKA"
     gene            <145708..>147288
                     /locus_tag="CAGL0L01265g"
                     /db_xref="GeneID:2890919"
     mRNA            <145708..>147288
                     /locus_tag="CAGL0L01265g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448828.1"
                     /db_xref="GeneID:2890919"
     CDS             145708..147288
                     /locus_tag="CAGL0L01265g"
                     /inference="similar to AA sequence:UniProtKB:P21373"
                     /note="similar to uniprot|P21373 Saccharomyces cerevisiae
                     YJR049c UTR1 or uniprot|P32622 Saccharomyces cerevisiae
                     YEL041w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448828.1"
                     /db_xref="GeneID:2890919"
                     /db_xref="GOA:Q6FLR6"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR6"
                     /translation="METSRRDSNEETKRTIMESDSRSTSVQSSSSSGGSMTPYSHSPR
                     NSVPPITVSEEDMGPMNDRFKFSDIRSVENMVRRLSTDSLPRSRASKTHFQYATTAYD
                     VRMLSKDIVNKKVELDVETVMIICKVDDQSVILLMRELVEWILVRYPMITVYVEEIFK
                     TSKLFDADDLFKDVKCRNSRLKYWTPKFINENDVFFDLVITMGGDGTVLFASHLFQKH
                     VPPILSFSLGSLGFLTNFSFEHFKEELPLILNSKIKTNLRMRLECKIYRRQKVTMDNS
                     TGRKVCYMKLESTRHVLNELTIDRGPSPFISMLELYSDNDLMTVAQADGLIVATPTGS
                     TAYSLSAGGSLINPGVNAIAVTPICPHTLSFRPIILPDSIELKIQVSLKSRGTAWIAF
                     DGRPKIELNRGDYVTVSASPFSFPTVEAKPSDFVDSISRTLGWNVREKQKSFSHVLSL
                     KNQEKYENESYRNKRELENEEAEEEILLDESGEITARNLIKVPADIDSASKRHHKSPL
                     GKTIPTKSRRMSAGFTLE"
     gene            <147817..>148572
                     /locus_tag="CAGL0L01287g"
                     /db_xref="GeneID:2890920"
     mRNA            <147817..>148572
                     /locus_tag="CAGL0L01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448829.1"
                     /db_xref="GeneID:2890920"
     CDS             147817..148572
                     /locus_tag="CAGL0L01287g"
                     /inference="similar to AA sequence:UniProtKB:P32626"
                     /note="similar to uniprot|P32626 Saccharomyces cerevisiae
                     YEL038w UTR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448829.1"
                     /db_xref="GeneID:2890920"
                     /db_xref="GOA:Q6FLR5"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /translation="MSPDPKYSAYLLDIEGTLCPLSFVKDTLYPFFVLHVQRIVYENF
                     NEEHPKDEFIAEQLAKYDIKEEGQAGKNKLVEHLLDLVANDTKDSTLKALQGHVWEVG
                     YNSGELEVPLYPDVIDFLVRNDGRGDDKVPVYIYSSGSIHAQKLLFGHVKNSGNSHAK
                     IAGNWDLNRFIDGYFDINTAGKKTESNSYKKILDEIKMTDKPHDVLFLSDNAKELDAA
                     KECGISVGLAMRAGNVTVPNAIDYKQYFQFTKL"
     gene            complement(<148931..>150109)
                     /locus_tag="CAGL0L01309g"
                     /db_xref="GeneID:2890921"
     mRNA            complement(<148931..>150109)
                     /locus_tag="CAGL0L01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448830.1"
                     /db_xref="GeneID:2890921"
     CDS             complement(148931..150109)
                     /locus_tag="CAGL0L01309g"
                     /inference="similar to AA sequence:UniProtKB:P32628"
                     /note="similar to uniprot|P32628 Saccharomyces cerevisiae
                     YEL037c RAD23 nucleotide excision repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448830.1"
                     /db_xref="GeneID:2890921"
                     /db_xref="GOA:Q6FLR4"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR4"
                     /translation="MVSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKL
                     IFSGKVLKDGDSVESCNFKDGNEVIFMVSAKKATATKVTESSAPKAQSEETPSESTPA
                     TSTQPETNQNETTEPATNSSSENTEAPNAGTDDGFVVGSERNATIERIMEMGYERAEV
                     ERALRAAFNNPDRAVEYLLMGIPETLRPQEGQTSQEHEADVDMNEEESTEGNAEPPAE
                     DDLFAQAARDSATPSAAQTAGGTTSESAGSATGGPPGSIGLTMEDLLALRQVVSGNPE
                     ALAPLLENLSNRYPQLREQIMANPEVFVSMLLEAVGDNLQGAMDFEAIAEGEGDTVEG
                     ADGFAEENAPITLSPEDEQAISRLCELGFERTLVIQVYFACDKNEEIAANMLFSDYAD
                     "
     gene            complement(<151156..>152499)
                     /locus_tag="CAGL0L01331g"
                     /db_xref="GeneID:2890872"
     mRNA            complement(<151156..>152499)
                     /locus_tag="CAGL0L01331g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448831.1"
                     /db_xref="GeneID:2890872"
     CDS             complement(151156..152499)
                     /locus_tag="CAGL0L01331g"
                     /note="highly similar to uniprot|P32629 Saccharomyces
                     cerevisiae YEL036c ANP1 required for protein glycosylation
                     in the golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448831.1"
                     /db_xref="GeneID:2890872"
                     /db_xref="GOA:Q6FLR3"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR3"
                     /translation="MFKYNRPFLVSCVGSLFALYLVLKFVNNVFDLAGVLAVWFSANY
                     IPDFRSVPGVEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPH
                     HLIDLSFLVSDSSDNTMGVLMHHLQQAQKDKNKRFGNIEIFEKDFGQIIGQSFSDRHG
                     FAAQGPRRKLMARARNWLGSVAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVP
                     NVWRPLPDWLGNIQPYDLNSWVESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMR
                     DPNGNPEDEMMLDGIGGVSILSKARVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDV
                     VGLPHYVIWHIYEPSTDDLKYMAWMAEEEKRKLEEIQLREFYDRIWEIGYEDVRDDWA
                     HEKDIIFKNMETQKDIVVDWSDDADVSSNGDQSLNNANANNAAQQDKPLDFDPNK"
     gene            <153155..>153628
                     /locus_tag="CAGL0L01353g"
                     /db_xref="GeneID:2890873"
     mRNA            <153155..>153628
                     /locus_tag="CAGL0L01353g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448832.1"
                     /db_xref="GeneID:2890873"
     CDS             153155..153628
                     /locus_tag="CAGL0L01353g"
                     /note="highly similar to uniprot|P23301 Saccharomyces
                     cerevisiae YEL034w HYP2 translation initiation factor
                     eIF5A.1 or uniprot|P19211 Saccharomyces cerevisiae YJR047c
                     ANB1 translation initiation factor eIF5A.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448832.1"
                     /db_xref="GeneID:2890873"
                     /db_xref="GOA:Q6FLR2"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR2"
                     /translation="MAEEEHTFETADAGSSTTYPMQCSALRKNGFVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRTEFQLLDIDDGFLSL
                     MNMDGDTKDDVRHPEGELGDQMQAAFDEGKDLMVTIIAAMGEEAAISFKEAPRSD"
     gene            154269..154350
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0L01375r"
                     /db_xref="GeneID:2890871"
     tRNA            154269..154350
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0L01375r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2890871"
     gene            <154715..>157552
                     /locus_tag="CAGL0L01397g"
                     /db_xref="GeneID:2890875"
     mRNA            <154715..>157552
                     /locus_tag="CAGL0L01397g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448833.1"
                     /db_xref="GeneID:2890875"
     CDS             154715..157552
                     /locus_tag="CAGL0L01397g"
                     /note="highly similar to uniprot|P24279 Saccharomyces
                     cerevisiae YEL032w MCM3 replication initiation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448833.1"
                     /db_xref="GeneID:2890875"
                     /db_xref="GOA:Q6FLR1"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR1"
                     /translation="MDGGIEDSGAFFAPDAVFGDRVRRFQEFLEVFEQYKDDVKAILA
                     KNSASLASELGNIDEDAEEDVDLMDDIDKSKKNVSDGPNAVPHRITISLDDLRDFDRK
                     FWRGVLNEPAYYIPPAERALSEIATALDDSPRNTVDAVSAKRPWRLSFKGSFGSHTLS
                     PGTLNAMYLNKLVSIEGIVTKTSLVRPKLMRSVHYAEKTGRFHYRDYTDSTTSLTTRV
                     PTPAIYPTEDPDGNKLTTEYGFSTYIDHQRITVQEMPEMAQVGPVPRSVDIILDDDLV
                     DKTKPGDRINVVGVFKSVGAGGLNQGESNTLNGFRTLIIGNSVYPLHARSTGVSAKET
                     LNDLDIRNINKLSKRGDIFEILAQSLAPSIYGHENIKRAVLLMLFGGVEKNLENGSHL
                     RGDINILMVGDPSTAKSQMLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRL
                     EAGAMVLADRGIVCIDEFDKMTDVDRVAIHEVMEQQTVTIAKAGIHTTLNSRCSVIAA
                     ANPVFGQYDVNRDPHQNIALPDSLLSRFDLLFVVTDDINEARDRSISEHVLRTHRYLS
                     PGMVEGEPVRDRLNLSLAVGTDEDDENANDNTNQDEEDQVFEKFNPLLQAGAMLAKNR
                     GNYNGTEIPKLVKISFLRKYVQYAKERVVPQLTTEAVDVIVKNYTDLRNDENTKKSPI
                     TARTLETLIRLATAHAKVRLSRTVDKVDATVAANLLRFSLLGEDVGEITDADLQMDFE
                     YPSNRNSPKKSPKKKQRLGPRGYGLSPSKSNRGSPVKRLDFGDSQAEERLDASQIEEE
                     DVLEPGMEELHISDDANLHRRLERELRGSPLRSTQQGPLTEVTTPRMPNISTAGQEED
                     NGNQDISVDTVDQSNISTARLSLLSGLVARLMQTDLFEEESYPVDALFDVINGELAEE
                     EKFTKTEYLAGLKVMAQRNNLMIAEEKVWRV"
     gene            <158120..>161764
                     /locus_tag="CAGL0L01419g"
                     /db_xref="GeneID:2890876"
     mRNA            <158120..>161764
                     /locus_tag="CAGL0L01419g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448834.1"
                     /db_xref="GeneID:2890876"
     CDS             158120..161764
                     /locus_tag="CAGL0L01419g"
                     /note="highly similar to uniprot|P39986 Saccharomyces
                     cerevisiae YEL031w SPF1 P-type ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448834.1"
                     /db_xref="GeneID:2890876"
                     /db_xref="GOA:Q6FLR0"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FLR0"
                     /translation="MADKVNSPIVKDSQLLIPKSLTARPYTLPFFPLYATFAQIYFQQ
                     YDTYIKGPEWTFVYLGTIVSLNILVLLLPEWNIQLAAKFKYNKVDNINEATHILINTT
                     PNNGSSDIVKIERANEMGELQTFFQFQKKRFLWHEDEQQFSSPKFLIDGTPKISEFQN
                     FKGHKGDLTHLRRLYGNNEFDIPIPTFLELFKEHAVAPLFVFQVFCVALWLLDEYWYL
                     SLFNLFMILSMEAASVFQRLTALKEFRTMGVKPYAINVLRDGKWVEMQTNELLPMDVV
                     SVVRTAEDSALPCDLILVDGTCIVNEAMLSGESTPLLKESIRLRPGNEELQIEGTDKI
                     SVLHGGTKVLQVTTPEKTGKVPSPPDGGAIAIVTKTGFETSQGSLVRVMIYSSERVGV
                     DNKEALYFILFLLIFAVVASWYVWVEGTKMGRVQSKLILDCILIITSVVPPELPMELT
                     MAVNSSLSALSKFYVYCTEPFRIPFAGRIDVCCFDKTGTLTGEDLVFEGLAGLSSDPK
                     DIRHLYSATDCPNSTSLVVGAAHALVRLEDGEIVGDPMEKATLKALKWTVEKGDKVFN
                     EKNGQVTILRRFQFSSALKRSSSVATHDGKLYSAVKGAPETIRERLFTIPANYDEIYK
                     SFTRSGSRVLALASKKLEKMSQSQIEDADREHFERDLEFNGFLIFHCPLKHDAIETIQ
                     MLNESAHRCVMITGDNPLTAVHVAKEVGIVKGETLIVDMVDNGNDDKLVFRNVEETLS
                     FEFVVSKDSFEKYGIFDKYDLAVTGHALEALKGHHQLQDLIRHAWIYARVSPAQKEFI
                     LNNLKDMGYQTLMCGDGTNDVGALKQAHVGVALLNGTEEGLKKVAEQRRLDSMKEIYD
                     KQTAFLARWGKPPAPVPENIAHLYPPGPSNPHYLTALEKKGTVITPEIRKMVTEANNK
                     PVEIAAPSTEKPAANDLASMILSGASESQEDGETPTLKLGDASCAAPFTSKLANVSAV
                     TNIIRQGRCALVNTIQMYKILALNCLISAYSLSIIYMAGVKFGDGQATTSGLLLSVCF
                     LSISRGKPLQKLSKARPQAGIFNVYIMGSILSQFVVHIGTLIYLTNEIYRLEPREPQV
                     DLEKEFAPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRSNKGMYYGLLGVTGLAL
                     ASATEFIPELNEAMKFVPMEDDFKMKLTITLFVDFFGCWGAEHFFKFFFMDDTPADIT
                     EEKVRIQEKN"
     gene            complement(<161992..>163809)
                     /locus_tag="CAGL0L01441g"
                     /db_xref="GeneID:2890874"
     mRNA            complement(<161992..>163809)
                     /locus_tag="CAGL0L01441g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448835.1"
                     /db_xref="GeneID:2890874"
     CDS             complement(161992..163809)
                     /locus_tag="CAGL0L01441g"
                     /inference="similar to AA sequence:UniProtKB:P39682"
                     /note="similar to uniprot|P39682 Saccharomyces cerevisiae
                     YML046w PRP39 pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448835.1"
                     /db_xref="GeneID:2890874"
                     /db_xref="GOA:Q6FLQ9"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ9"
                     /translation="MSTNAVLGFDGSFLRDNPILVQTYNNLDWESQESIINLIGVVEK
                     IVVKYNDPNENIKANICKIFELILDTYPYLGLVWKKYTAVKYQLYGLEDSIKVLETAV
                     KAFPDSVELWCDYLSVLEANKTGSVDERRSKYQTAKDNIGYNFLSHQFWDKYIQFETT
                     QEDWEAVMSIYHELLKIPLHQYAKYFKAYMAFNSSEGSKKLTKEDITKELQKTQTLVN
                     SIWRFESQIKHAFFSVNGVSQVEAKNWKQYLSYIKEQDIDIKIIETTYRRCLIPCAKE
                     EFFWLAYISWQMNQKYPSTRVLSSFQKAIRLLPSSATEIRNLNLSYMSERYRDSPDIF
                     YESYCDTLESLIKDYPSDHSLIWKLLNMIKRHNYGNKWGDDSKEILQKQNLYAKFLET
                     KLSAYLQNSYRKTDTLTRILNDGNVSVLIVALIKLTWLVLKNKIQTRKYFTQYARLPL
                     VKNSSQFWVLLYQFEKSEKNFIKLNALIKTLSYNNTLPLTIKNDIFEDYRHFYMLNCE
                     IDDNRNLTVFDDPLLLSILGINEPRVGTKGAQSVSQRDNGHPGIATNNPIHKNSLILN
                     NSSKLSQFGQPLPKTISVDKLFSAPKYMDYYTSDFLNKR"
     gene            <164254..>165225
                     /locus_tag="CAGL0L01463g"
                     /db_xref="GeneID:2890879"
     mRNA            <164254..>165225
                     /locus_tag="CAGL0L01463g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448836.1"
                     /db_xref="GeneID:2890879"
     CDS             164254..165225
                     /locus_tag="CAGL0L01463g"
                     /inference="similar to AA sequence:UniProtKB:P47114"
                     /note="similar to uniprot|P47114 Saccharomyces cerevisiae
                     YJR054w or uniprot|Q04705 Saccharomyces cerevisiae YML047c
                     PRM6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448836.1"
                     /db_xref="GeneID:2890879"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ8"
                     /translation="MDGVTTYESYHELCFSDIDVQLFYKRDYYTIVKYICLLYGQSVL
                     KFMVLISDMYSCVKLLAFNTWSNNIIQPCIPFKITKWLFSACILLSIVFISIEIVLGM
                     RILMNTRRRDVISQMYLNNFSRITTSLVAYKKFCIYDHIEPSNMWEKLGVWAYFELKG
                     APKLIAADSSRQLINGLTLWSILISKSGKIKNDSLNLGGIFHRIKLIAVQNHEEAVFL
                     SFMTFSFIVWSLFIFKFCMLMVAAIVITHKLGNTSFTESKQTLRRYAHFAIRRNINDM
                     IIKKLENSLSDCESEWSDGTFLISERNEAQSKLLSSIYTPCEAYMPR"
     gene            complement(<165596..>166747)
                     /locus_tag="CAGL0L01485g"
                     /db_xref="GeneID:2890877"
     mRNA            complement(<165596..>166747)
                     /locus_tag="CAGL0L01485g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448837.1"
                     /db_xref="GeneID:2890877"
     CDS             complement(165596..166747)
                     /locus_tag="CAGL0L01485g"
                     /inference="similar to AA sequence:UniProtKB:Q04697"
                     /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
                     YML048w EFF2 involved in glucose repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448837.1"
                     /db_xref="GeneID:2890877"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ7"
                     /translation="MEVYVRLNDDCEHDYAFQVDKEDTIKTRVEKIFTSNLNEIMVLR
                     PTIFHEKKPYAFKKSVHPGFLTEGGCLLFDYDAADQKYVKDLDYDKPLFEQLWPGQLI
                     VPQWRYSKKYVTIFALLMAGWLYTDLPDVISPTPGICLTNQLSRMLLPFVRRMELYEL
                     AAKLEAEIQVNFSSVDAQWLFFVLHILKIILIITFFYSGMANPISFNPYRLWNLRNEL
                     DVHNPKFKNMLKSIGWIGARRATFDAYQGNYYNHMLEKYGGQVRAYRAGVIKRIASPG
                     VQLHDGEGFQTPLKERFTGSTFKEMKENERFVLSEEYFVELENNLKENLDKCNGDIGK
                     MNMEIRRFRRFGIYEPNEKLLELVTIRRARADKEKAEAEAAEAEKKKEK"
     gene            <167209..>171099
                     /locus_tag="CAGL0L01507g"
                     /db_xref="GeneID:2890878"
     mRNA            <167209..>171099
                     /locus_tag="CAGL0L01507g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448838.1"
                     /db_xref="GeneID:2890878"
     CDS             167209..171099
                     /locus_tag="CAGL0L01507g"
                     /inference="similar to AA sequence:UniProtKB:Q04693"
                     /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
                     YML049c RSE1 involved in RNA splicing and ER to Golgi
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448838.1"
                     /db_xref="GeneID:2890878"
                     /db_xref="GOA:Q6FLQ6"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR017986"
                     /translation="MELYHLTLQRQSNYVHSVKGSFLGRDSNELVVATQTHIELYDFA
                     GKVRRKVGNDIVLFTSLLALDTIWDEDGLAHLVMLGQNGNLVVAKFALSGDRLQLDSE
                     FLYRFDNSVEKTWLPKVVANKSSILVTWGLTQKIVVPVSWSQEPRFRSPIFFSNAEHS
                     VVLELCSLTSFEDHYVSLELDTRLKVYKLNFLFFDRNLQSLLLTNSYNLKSNEVDDRP
                     NFITDIPDLAVYGVSTAINKSTSKKNPFVLIGFNKHILIKDMMGIYSLKCEFPADIME
                     SLPMDKKLLIVASDLQILKNNVGFLLLLQTNTGHLFKVIIFPNEEDRNRPIAKLGYFD
                     KVKHISNSSKLHIFNNGSMYINSQFNYDHVYLNFESIGDNDENYDKIDNENENISVIS
                     KHTNINPIALNLCLMENMPLTFMHFQGGNRTTDSEKVNIIRNAIPLKEYVSSPLPQGV
                     SNIFTIKTQYQSYHSFIFLTMINFTTVILKIADDSIEQYIPASDTFKLKDDMTIHVAT
                     MGDNSIIQVCKDEFRQILLDSKDEENFKMNLKWYPPAGVSILSAVSNFSQLILALSNN
                     EIVYLQLENNTLIEYKNRPELPDVITSLALLNDNTKKSEILAVGTSDNMVNVLSLEIV
                     DEAISFETVVFQALDAIPSSLLILNQGHKLVNLHIGVEDGSYLVNRLDLRNMSINNIL
                     RKQLGTRSIKALNHIGVDLRNDTLQYDDDESGNSKENTLKNRGEKTSVVVIHGNRTWA
                     NYSSHSNMYIRPLYLKDSRRLITTKEFSSASIDSGGSCCSLSASGSLLIGGFDFLPWV
                     GNWFSKDAVAIQLSDDSSTAVSGGDSTDGSDDDEDYDEEKLEEFDIHCRKFLNFNDQG
                     KSTVLVFENTIDDKAESTLCIINKKDISPMTISDDGKSVFRKSLPFKTRDVALSKLGT
                     KKWYLFVLSTSSTIFTYGIKTSTDGTVDLKMELIHETHFDNEVFCIKVFRDMLIVPQY
                     NRLLFCEVGKTKLLNKMIGPAVDYVEKITVLDCWADDRIAIGDFRNSVSLLQFSSSHE
                     VNVIANDICTRDVTAIKFLDRSTIIGGDKFGSVWVLRLSIQDEKILQSCDNNKVELQQ
                     HLLREKGTLREKAPNILNTYFKLDLVNQFFINDIVTGFSVEEITQASDRPIIFYYGIQ
                     GTIGCLLPLLVKSEISKLRSIEQMMKSADETWFLKNELLNEKIGIELEDKENHEYDLA
                     VHSVIDHEVGRTAGNWASSSGFIEGKFTTLDCDHTAYRSYYAPVKNVIDGDICETYLN
                     LTDDLKAYLTKHASPDNDLTTIVQTLMKVRNNFI"
     gene            complement(<171217..>172158)
                     /locus_tag="CAGL0L01529g"
                     /db_xref="GeneID:2890881"
     mRNA            complement(<171217..>172158)
                     /locus_tag="CAGL0L01529g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448839.1"
                     /db_xref="GeneID:2890881"
     CDS             complement(171217..172158)
                     /locus_tag="CAGL0L01529g"
                     /inference="similar to AA sequence:UniProtKB:Q04689"
                     /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
                     YML050w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448839.1"
                     /db_xref="GeneID:2890881"
                     /db_xref="GOA:Q6FLQ5"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /translation="MVIGNRVLLPLTKRYYNARYRKVLHPELREEIIAHNCYCEEVNS
                     KLHFDDEKIDPGISLKTAVPSYDKHVMLISDINRGMAKKPGVWKNIWESRIENNTTHP
                     YDIISKLNFGPGVLFNAISITSSLESFAPTSLEFYDFLVMPDMRYYRVKKPDIEKFSQ
                     YINSGHAVAPKLSFSDYLSGKAAATTVSNNNQITLSLDDSIYYRELKNDAWLFVCGHE
                     KRDMRCGIMGPEILHSVNTANSKPLVNNTGIISHIGGHKFAGNILIYKPIENQNGRKK
                     VDSLWFGKVTPFNVSEIVQSVNEGVIIENNFRGGLSL"
     gene            complement(<172658..>173590)
                     /locus_tag="CAGL0L01551g"
                     /db_xref="GeneID:2890880"
     mRNA            complement(<172658..>173590)
                     /locus_tag="CAGL0L01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448840.1"
                     /db_xref="GeneID:2890880"
     CDS             complement(172658..173590)
                     /locus_tag="CAGL0L01551g"
                     /inference="similar to AA sequence:UniProtKB:P54003"
                     /note="similar to uniprot|P54003 Saccharomyces cerevisiae
                     YML052w SUR7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448840.1"
                     /db_xref="GeneID:2890880"
                     /db_xref="GOA:Q6FLQ4"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ4"
                     /translation="MKLPSLFHISLKLLILLFLAGNTLLLILIIISGSTNDYPINRFY
                     WVEGDTTGIPNAPSLTRWTFWGACSYDNNKIDCGEYLKPAAPISPVDNFHTKENVPHS
                     FISKRDAFYYLSRFAFCFFWIALAFVGISFILFILSWCSKAVTQVIFILITFGCVFNI
                     TAVVLIQAAAAMAKKAFSDADRHGKVGPSLFGIAWASVVLVLFEFVTIFYWFIKSKKE
                     GKSIFKESTFGFPSAKTQNLFSYRNTSQEVPAPVDGTETYANEQFQTPPVVTQQAQQM
                     SAAQPVATEANHHGINFFKIKRTEKISSGDEESV"
     gene            <176421..>176894
                     /locus_tag="CAGL0L01573g"
                     /db_xref="GeneID:2890884"
     mRNA            <176421..>176894
                     /locus_tag="CAGL0L01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448841.1"
                     /db_xref="GeneID:2890884"
     CDS             176421..176894
                     /locus_tag="CAGL0L01573g"
                     /note="weakly similar to uniprot|Q04978 Saccharomyces
                     cerevisiae YML053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448841.1"
                     /db_xref="GeneID:2890884"
                     /db_xref="GOA:Q6FLQ3"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ3"
                     /translation="MQMYAPSSPVVANADVRLMMLLQQEQLKMQKRRMKRSHEMFEDN
                     NYKRVKYGFHNSETRNTYPSIVPAIGTMNSTTNNNGNNINNISHDRMNLHNTVQTHGL
                     RPEMSGLHNPDSDSEPYAEIEEYMVKGYCLDETVAGTQNITINEPSIMTDMMDMD"
     gene            complement(177331..177418)
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0L01595r"
                     /db_xref="GeneID:2890882"
     tRNA            complement(join(177331..177367,177379..177418))
                     /gene="tRNA-Tyr (GTA)"
                     /locus_tag="CAGL0L01595r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2890882"
     gene            <178104..>181547
                     /locus_tag="CAGL0L01639g"
                     /db_xref="GeneID:2890883"
     mRNA            <178104..>181547
                     /locus_tag="CAGL0L01639g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448842.1"
                     /db_xref="GeneID:2890883"
     CDS             178104..181547
                     /locus_tag="CAGL0L01639g"
                     /inference="similar to AA sequence:UniProtKB:P39538"
                     /note="similar to uniprot|P39538 Saccharomyces cerevisiae
                     YJL197w UBP12 ubiquitin C-terminal hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448842.1"
                     /db_xref="GeneID:2890883"
                     /db_xref="GOA:Q6FLQ2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR006615"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ2"
                     /translation="MENITSNEGIPDLNEELNTIQIESTSSNDGHEELLRKRGIITKL
                     MKNCELSAKEGDKVYIIPKDWFDKFFSEELKSENDLGPIDVASIIKDYEHFVLEDYNS
                     VPYTSVPEPLFLQFQEWYGITDLSQPVVTYLIENENGELVTEYNKRIFRLHHLTIGES
                     SRNNYTLNQSYIVLSSLNLYSDLKVKAIQQFAKNQNYLNMENHEFRVWVVEDNETNSA
                     NTALSSYEITPLQFLSLSSKELIAEDMFHKLLKSTSSQPCDIIIETRNLNDGKWPSYF
                     FMYNNPMTMTGIVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPLGY
                     NGTVATAFGNLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFAGYMQQDSQEFLAF
                     LLDSLHEDLNRIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARNDSVINDLF
                     VGMYKSTLKCPTCKNISITFDPYNDLTLPLPISTVWNKKVKIFPQKSPPCILEVELPK
                     SATYNDLKDYVATYSNIDSSSLFGCEIFNHQFYRNFESPISDSNYLPVQELISETDDI
                     IFYEIIINPGDIILPVINTRIEEGFNSPSLFGVPFFVTVSDEERRNPFLIYQKLEKLY
                     TNLSGGYIQLRETLNNENQLNAIFPNLVAKYGKEDMEPINDIIDTLYDPNDSTDGIFT
                     LKTISESRDEIEIESPSKTQPWIPESNINYKLADDIFNFSSVILRDIYYYNKMENQTS
                     DAENASSTDNSNSEDNMEISTDSPVVDGSDLGNSESNHKPEKYQSELDKLCIESSSIL
                     VCEWTQKSIDEVFTDDKPIDWEHPALLENKELLLAQKQRNSASPNIITLDSCLKLFSK
                     PEVLGINDSWYCPKCKEHRQATKQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFP
                     IEGLDMTPYVVDSVVEDGCIYDLFAVDNHYGGLGGGHYTSYVKNNIDNRWYYFDDSRV
                     SSTDPKKSVAGSAYLLFYCKREQNPNGIGNSKLQDIIINSRTKYEERWQEILNSQTQL
                     YESTKDIVSQETSLNIGYTPDSKNKSYEIEPNNSPSLTNSHSDTTESETFELKQDKNG
                     SESSEDDILSRKSTGYSTESLEVGNLDINEADENGGRRKLRLLKKVYGSDTNPEDEDE
                     C"
     gene            181974..182046
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0L01661r"
                     /db_xref="GeneID:2890886"
     tRNA            181974..182046
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0L01661r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2890886"
     gene            complement(<182135..>182446)
                     /locus_tag="CAGL0L01683g"
                     /db_xref="GeneID:2890887"
     mRNA            complement(<182135..>182446)
                     /locus_tag="CAGL0L01683g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448843.1"
                     /db_xref="GeneID:2890887"
     CDS             complement(182135..182446)
                     /locus_tag="CAGL0L01683g"
                     /inference="similar to AA sequence:UniProtKB:P35727"
                     /note="similar to uniprot|P35727 Saccharomyces cerevisiae
                     YKL061w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448843.1"
                     /db_xref="GeneID:2890887"
                     /db_xref="GOA:Q6FLQ1"
                     /db_xref="InterPro:IPR020491"
                     /translation="MIKQDVQKCVDALQDFVDKEIGESVNLFSCKSRANNELLLNIDE
                     KFQLKDKDELHQLGEQKIENQNKLQEIRNKVEYYEKLLTELEEAQKELEVRYKLVSKS
                     K"
     gene            <182580..>183944
                     /locus_tag="CAGL0L01705g"
                     /db_xref="GeneID:2890885"
     mRNA            <182580..>183944
                     /locus_tag="CAGL0L01705g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448844.1"
                     /db_xref="GeneID:2890885"
     CDS             182580..183944
                     /locus_tag="CAGL0L01705g"
                     /inference="similar to AA sequence:UniProtKB:P36090"
                     /note="similar to uniprot|P36090 Saccharomyces cerevisiae
                     YKL047w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448844.1"
                     /db_xref="GeneID:2890885"
                     /db_xref="GOA:Q6FLQ0"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="UniProtKB/TrEMBL:Q6FLQ0"
                     /translation="MASHMLTNVFLCQFDMSRGNTLVWSARDNDPLLKGIEFKALPSG
                     IHEVSDDVIRFCIEYEQTQYYGICCYLQNAFEVLDNEGQVDRSKVKMYSLGVIVDPSQ
                     ISDDLRGFNYEVTNQYIPELQSLLKDWSTNQGSNSNSYEQLSTYYHKKISGSLNYEVD
                     YQTSMLNHLPYWLNKLGPLIFPLFKSCLLRERILVISAPGNSFEYTNSLLYCLATISR
                     NSKLNMGNTGSKGSYIPTLFTVGTYDIEDLEKHGQEGFLAVTSDEILLYKEELFDKAL
                     ILPSDSLIHEGLELQDNKGHPVKATIHESRIFNKLLETYCDQDITKRDLERFSRNTET
                     MSWLQYILDSMLFLATAGHITARYNETREIIQKSLSREEGEPDEHYDARGIVQFFNSR
                     SDELLDYIQRTIEDSNNILPATITIDLDMDYFSKQDYEFLRMFAKKWLDKDIMFKTNI
                     LGIY"
     gene            complement(<184249..>185589)
                     /locus_tag="CAGL0L01727g"
                     /db_xref="GeneID:2890890"
     mRNA            complement(<184249..>185589)
                     /locus_tag="CAGL0L01727g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448845.1"
                     /db_xref="GeneID:2890890"
     CDS             complement(184249..185589)
                     /locus_tag="CAGL0L01727g"
                     /note="highly similar to uniprot|P36091 Saccharomyces
                     cerevisiae YKL046c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448845.1"
                     /db_xref="GeneID:2890890"
                     /db_xref="GOA:Q6FLP9"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /translation="MRLVTLLSGLVSLVSVFGLELDLDDYASLQNATALVAYGLMDYY
                     TGDQYGKTVGMFSDPYYWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDY
                     VPLNQSTTEGNDDQAFWGIAVMQAAERKFPNPPDDKPQWLYLTQAVFNTMALRWDSET
                     CGGGLRWQIFVWNSGYDYKNTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVH
                     LIDNGTYRYVYDGVSINDNCTTVTKYQWTYNQGLMLSGSAYLFNMTGSDLWHERTHAF
                     LNASRVFFNNSILYEAACQGPNTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLN
                     TSALAAAKSCSGGTDGHTCGLNWFRDDWDGMYGLGEQMAALEVMVNTQALKRAPPYNA
                     TNGGNSTGDGAAGTKPHPTNLAPLHITGGSRAGAGIITAIIGISIIACALWLVY"
     gene            <186348..>187856
                     /locus_tag="CAGL0L01749g"
                     /db_xref="GeneID:2890888"
     mRNA            <186348..>187856
                     /locus_tag="CAGL0L01749g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448846.1"
                     /db_xref="GeneID:2890888"
     CDS             186348..187856
                     /locus_tag="CAGL0L01749g"
                     /note="highly similar to uniprot|P20457 Saccharomyces
                     cerevisiae YKL045w PRI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448846.1"
                     /db_xref="GeneID:2890888"
                     /db_xref="GOA:Q6FLP8"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP8"
                     /translation="MFRQSKKRVSMRRNFAEDRGDASAIIIGATTTEEEKKLYQRIYE
                     NKLSFYDIPPQGEITLEEFEIWAIDRLKLLLEIESCLARNKTLKEIEGIIKPLFKKYN
                     IFNNMDTFEDRKKEYYSHFILRLCFCKSKELRDKFVRIETMLLRLRFNMLSSTDQAKF
                     VKSLNLPSLQFIDEEEKAELSTQLYQTISRDLQFTLNLADEQQRQLYFKNEKFIKLPF
                     ESVIELVGNRQVFLKNGYAYLPQFQQLNLIANEFSTKLQEELIKTYQYLPRLNEDDRL
                     IPILNHLSSGYTIADSGSFDSQFGNNEDNEINAKSVWSEEISKHYPLSVKNLFYGLKE
                     NNHLRYHGRQQLTLFLKGIGLSVDEALKFWHDAFTKNNKMTTEKFNKEYRYNIRHSYG
                     LEGNRINYKPWDCRTILSKPRPNRGEYHGCPFRDWNHDRLTSELSKMGLTTQQITDVL
                     DSCDKHEYTIACTKVFEMTHNVPEGESMHISHPNLYFERSRQLEKKAKGEKI"
     gene            <198971..>200278
                     /locus_tag="CAGL0L01771g"
                     /db_xref="GeneID:2890889"
     mRNA            <198971..>200278
                     /locus_tag="CAGL0L01771g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448847.1"
                     /db_xref="GeneID:2890889"
     CDS             198971..200278
                     /locus_tag="CAGL0L01771g"
                     /note="some similarities with uniprot|P36093 Saccharomyces
                     cerevisiae YKL043w PHD1 or uniprot|P53438 Saccharomyces
                     cerevisiae YMR016c SOK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448847.1"
                     /db_xref="GeneID:2890889"
                     /db_xref="GOA:Q6FLP7"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP7"
                     /translation="MTSSAQYINTATANTYYQMSYPPNAQQHVVYRYNPYQQPQPQHI
                     QHVQTSIPQHQPIYYSTSGSGYVSAVYQQGSSTPVTASRMSQSSASGNAAVGNGSTVI
                     TQGSGLVSTTPQYTTSTSINALNQAHHVYPYRSSPTYPTIIPAGQIGSGSRHNSASEI
                     RSSIVGHQQPTHLTIAAIPDSQQHHSLRVLSSAVAGDGKGPRIITTIWEDENTLCYQV
                     EANGVSVVRRADNDMINGTKLLNVTKMTRGKRDGILRSEKYRKVVKIGSMHLKGVWIP
                     FERALFIAKREKIVDLLYPLFVRDITSVLKTSLKPSSLVIPMQDNTTVTSKIYQLPAS
                     NHVISNATQSSSVHDGYHSPTSHVRMIPKIEEQQHSPTSTSHQYVRLPTIIKREDEER
                     PILKSSSSTPPLIKSEDNDSSWDSRRASKSDVTKISSLINSST"
     gene            <208720..>209799
                     /locus_tag="CAGL0L01793g"
                     /db_xref="GeneID:2890669"
     mRNA            <208720..>209799
                     /locus_tag="CAGL0L01793g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448848.1"
                     /db_xref="GeneID:2890669"
     CDS             208720..209799
                     /locus_tag="CAGL0L01793g"
                     /note="weakly similar to uniprot|P36094 Saccharomyces
                     cerevisiae YKL042w SPC42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448848.1"
                     /db_xref="GeneID:2890669"
                     /db_xref="GOA:Q6FLP6"
                     /db_xref="InterPro:IPR021611"
                     /translation="MNISPTPKRYNSRGDRYYASQARGKVPEFEPYRKSGLNFNDGYS
                     GINPPVYKNGLHSNLDDDKLVPEEIKLQRTVINDLISQNKELQTTVHTQREEIERLNI
                     IIGQFRAKLTKYSVMNRKLEDELRGSERSSNALNKDRNDDRNDSILENSFENAEDYIQ
                     IPKLRYNSKGKQDKSPQTNDLNDRLSQLVQLLEKSQQNNSTKINSNSNDMSPPVCSSA
                     TPPERNNKPIMSSPKIRDPSEEDILCQESAELKSLENQIELVKKKLLIKRENELRKLS
                     LENELIELMDQLSTDASPYRYGKSKGNFISTSKHEKHDENLSDIYGDYTGKNSLRKHN
                     IKPFNPIKMDNILETPTPPNRRNSE"
     gene            complement(210024..210095)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L01815r"
                     /db_xref="GeneID:2890670"
     tRNA            complement(210024..210095)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L01815r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2890670"
     gene            <212208..>212366
                     /locus_tag="CAGL0L01831g"
                     /db_xref="GeneID:9488054"
     mRNA            <212208..>212366
                     /locus_tag="CAGL0L01831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999540.1"
                     /db_xref="GeneID:9488054"
     CDS             212208..212366
                     /locus_tag="CAGL0L01831g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999586.1"
                     /db_xref="GeneID:9488054"
                     /db_xref="GOA:B4UN43"
                     /db_xref="UniProtKB/TrEMBL:B4UN43"
                     /translation="MPEQVNCQYDCHCSNCACENTCNCCAKPACACTNSASNECSCQT
                     CKCQTCKC"
     gene            <213115..>213789
                     /locus_tag="CAGL0L01837g"
                     /db_xref="GeneID:2890671"
     mRNA            <213115..>213789
                     /locus_tag="CAGL0L01837g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448849.1"
                     /db_xref="GeneID:2890671"
     CDS             213115..213789
                     /locus_tag="CAGL0L01837g"
                     /note="highly similar to uniprot|P36095 Saccharomyces
                     cerevisiae YKL041w VPS24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448849.1"
                     /db_xref="GeneID:2890671"
                     /db_xref="GOA:Q6FLP5"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP5"
                     /translation="MDYVKTAIWGPDVKEQQRNIKSLLRKNSRQIDKSLRELSALQNK
                     TQSLIKKSAKKNDVRNVRLYAKELYHINKQYSRMYTSKAQLESVSMKIDEAFRMRTLS
                     NQMASSTGLMMEVNSLVRLPQLQGTMIELEKELMKSGIISEMIDETMESIGDTDELND
                     EVDEEVNKIVEQYTSEKLAKVENVPTTELPKSEQEEQEVPEEEIEDEADKMLNDMRDR
                     LRALQN"
     gene            complement(<214016..>214807)
                     /locus_tag="CAGL0L01859g"
                     /db_xref="GeneID:2890672"
     mRNA            complement(<214016..>214807)
                     /locus_tag="CAGL0L01859g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448850.1"
                     /db_xref="GeneID:2890672"
     CDS             complement(214016..214807)
                     /locus_tag="CAGL0L01859g"
                     /note="highly similar to uniprot|P32860 Saccharomyces
                     cerevisiae YKL040c NFU1 iron homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448850.1"
                     /db_xref="GeneID:2890672"
                     /db_xref="GOA:Q6FLP4"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP4"
                     /translation="MITNRLMNKCVSSPLRSVTWRRLITIQTLTTPNENALKFLNKDN
                     ELLQTRGSKSIVIKNTDQNLISHSDLASKIFAQCPGVESLMIGDDFLTVNKDSQVPWA
                     QIQSDVIDLLTQQLASGKNVISDEFHAIKEDNEAGYQINEMKFDLTEEDEEIKELIEE
                     LIETRIRPAILEDGGDIDFRGWDPESGTVYLKLQGACTSCSSSEVTLKYGIESMLKHY
                     VDEVKEVIQMMDPEQEIALKEFDKLEKKLQSKDENDGTTAPASAS"
     gene            <216150..>217706
                     /locus_tag="CAGL0L01881g"
                     /db_xref="GeneID:2890673"
     mRNA            <216150..>217706
                     /locus_tag="CAGL0L01881g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448851.1"
                     /db_xref="GeneID:2890673"
     CDS             216150..217706
                     /locus_tag="CAGL0L01881g"
                     /inference="similar to AA sequence:UniProtKB:P32857"
                     /note="similar to uniprot|P32857 Saccharomyces cerevisiae
                     YKL039w PTM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448851.1"
                     /db_xref="GeneID:2890673"
                     /db_xref="GOA:Q6FLP3"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP3"
                     /translation="MFAHKFLLVFLVQLLSAVLANKETIGHKYEQVCSGMYSKQDFHG
                     KVDPFISFDLKKFSSNFDDDTIVVVIYDFQDYQHIGVYEGDSPYKTYICDDAAVERGV
                     CEEEHLNEFIIKDTIYDPETGENQSMKNSVMTFSQSTTGLHDTKYSVVKTGFYCVMAR
                     PLYYDSENYKSSKYAAEVNFRNSYGQLAGAEINKLPMYGLLAIAYGVAMALYSFAFWK
                     HKHELLPLQKYLLAFFVFLTTENIFVWAYYDIVNQKGITAGTTVYMVFLSIMSAGKAT
                     FSFFLLLIVALGYGIVYPKLNKSLMRKCQFYTIFSFALCVAFLIHSYTVDIEDPTPFI
                     MITFIPFLLSMVVFYFLIIRAMSKTTQYLKEQRQVVKLKMYRNLLLVIWCSFIILSAG
                     IVVSSVFYLGMNTIEMIERDWRTRFFFTDFWPSLVYFVVFCAIAFMWRPTDTSYMLAA
                     SQQLPTDPENVADFDLGDLQSFEDDNEDLDNNLVDDISIITEEEVPSNFRDANNTNNT
                     NDDSDSTNKP"
     gene            <220700..>224563
                     /locus_tag="CAGL0L01903g"
                     /db_xref="GeneID:2890674"
     mRNA            <220700..>224563
                     /locus_tag="CAGL0L01903g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448852.1"
                     /db_xref="GeneID:2890674"
     CDS             220700..224563
                     /locus_tag="CAGL0L01903g"
                     /inference="similar to AA sequence:UniProtKB:P32862"
                     /note="similar to uniprot|P32862 Saccharomyces cerevisiae
                     YKL038w RGT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448852.1"
                     /db_xref="GeneID:2890674"
                     /db_xref="GOA:Q6FLP2"
                     /db_xref="InterPro:IPR001138"
                     /translation="MPHNNDKKRTNVSRACDQCRRKKIKCDRNQERNICTSCQRNGER
                     CKFERVPLKRGPSKGAHKASDPELKLSSNKPSKSSLFEDSNSIIRPKSVGEDSNMDPL
                     SRHGSNTPILDNNSNSGINDRNMGGIDDRLGGSTDPGTPSRSGSILLPPLGQYPQQQN
                     YTNNSTSASNNMLNSTSLNSTILQQQQPFWKVPYHEFQNQRRGSIESLQSDLSVRTFN
                     PQDQLVYNTFQQSPIAMKHSSDPTNSIPPNTKSQHLTTTSNIGSVVGANDLLSGNPNY
                     WGSVRAGSFIPNGDENDDQIPQNLQRRSSSIPSILRNTSTSILLSQPQLPHPTNGAGS
                     TSNNFNNTNDNSNLINNKGTGSTAGLGNNIDNAVGSASPQAQRQSQQLYSYSQFLNQS
                     KPYNNQNFSSFGQFSTNGFQSRHGSITSEAMSPSTALGYNQNNSNNLPGANNPNISDI
                     SLLPNKESDPRVNDSQKVVKTEVSNDIFQFGEQNLANTIESNADKSEDKVKSGGKKGG
                     KVPRKRKTKQVKESNKKLKVNKKSNFDSDSINSPKVPTPVQQIKTGFQYGQILDVELI
                     DLYYEFIHVGFPVIPLNKQTLTNDILLVNTHPYSNIHEVNSYVILWFRNSLELLVRVA
                     LKRKNDSPFFDSHNTPGPLRSASGDENMAFNDTPKKKDITSSHADSISSGDDNGMAEV
                     QSAFISALNECFQRVVDIHPKVRENKDRISPKIKIIYLTTFILLNYILALVGYDNSFV
                     LGMSVTIFNEFKLYKLLVLPYKAICQDSEFSFNAKQSISLDDDFIENKNIGNGNGNRT
                     NGSTPGEPNNDEGENALTNFNPSKEQQNSQKGGSGEGNENQGNQIRSKIGKAVNIEEE
                     TETNENYTIMFKRLYILLTMFDSLQSCLFGGPKLLNVCITNTTEKFFSGTTNSKWNIE
                     DSLVREKGALISLKLGETLSEIASNRIIMNHFDIITLTNNNQANATDIVFNLKKLSNN
                     RDYDNFLQENKGLELFDQQPLCISQLFHKMLIMKSSFTYQLLSLMDANNGNFVNMDLK
                     RLEQIVESLCSLISVILQLLTLIMRLNPTNSIDLNYRPVTPTQRMEDMLSNKNTDSTD
                     SISNSNKTNSGNDFYRRLLGLEHSNDIVYSDISRGVISPFAMAILHESHNIHELIKMT
                     PTILIRVVMTLNVQDDTGNSVNNNATPGDHEEDMKLKRANTSQDLVYKLSNSMNDVVQ
                     IASLLSMIKPLKLFDHGFKTFESEDVLQGNDEDAKKRQRPVLKRLFYDTTNVPKPEAV
                     DPLVVSLVNTGWNLLDDMELGFLPQ"
     gene            <225386..>226894
                     /locus_tag="CAGL0L01925g"
                     /db_xref="GeneID:2890675"
     mRNA            <225386..>226894
                     /locus_tag="CAGL0L01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448853.1"
                     /db_xref="GeneID:2890675"
     CDS             225386..226894
                     /locus_tag="CAGL0L01925g"
                     /note="highly similar to uniprot|P32861 Saccharomyces
                     cerevisiae YKL035w UGP1 UTP--glucose-1-phosphate
                     uridylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448853.1"
                     /db_xref="GeneID:2890675"
                     /db_xref="GOA:Q6FLP1"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP1"
                     /translation="MSTAKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSIGSEHG
                     DDARTRFENELDSFFTLFRRYLVEKSSSNTLEWDKIKSPNPEEVVRYDTINSQAENVS
                     SLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGNSFLDLSVRQIEHLNRQYDSDVPLLL
                     MNSFNTDKDTEHLIKKYSANRIRIRSFNQSRFPRVYKDSMLPVPETYNDPKDAWYPPG
                     HGDLFESLHASGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTD
                     KTRADVKGGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRL
                     VESSALEMEIIPNQKTITRGGQEINVLQLETACGAAIRHFSGAHGVVVPRSRFLPVKT
                     CSDLLLVKSDLFYLQHGALKLDPSRFGPNPLIKLGSHFKKVSDFSARIPHIPKLVELD
                     HLTITGNVFLGKGVTLRGTVIIVCSDGQKIDIPNGSVLENVVITGNLQILEH"
     gene            <227996..>230269
                     /locus_tag="CAGL0L01947g"
                     /db_xref="GeneID:2890676"
     mRNA            <227996..>230269
                     /locus_tag="CAGL0L01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448854.1"
                     /db_xref="GeneID:2890676"
     CDS             227996..230269
                     /locus_tag="CAGL0L01947g"
                     /inference="similar to AA sequence:UniProtKB:P36096"
                     /note="similar to uniprot|P36096 Saccharomyces cerevisiae
                     YKL034w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448854.1"
                     /db_xref="GeneID:2890676"
                     /db_xref="GOA:Q6FLP0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FLP0"
                     /translation="MEVNFNTLVITIIIFFILFSSPGGDGISSQYEFNQLQLCKEQYK
                     NEYESFKNTTITSNFRNITGLKLSYEDSLNDPDLNATYPIEGKDYDNWLHNQNYMLLP
                     NEVISNIKHNIWNDSTYKEKDILFPKNITSLLKGETLVIGNEYTPIKMPIPLFYRSAI
                     DFVDNKPPDGEMYFKNPSAITNMTYDSGKMSISVSHLDLVSDTINGPDNRLFNSNPNW
                     KMLAANIEFHDYDEHEKVSFSSLGLYHVETGRVLFMSSSAKFHPLFAFPHYMEYMEDN
                     LDKNSEIFSDVKNLISEYWETKKVVDTLTMHSLNTFYENSMNRCEYMIFLQLEPWEGY
                     TEDQLQMIEDELTWPMGRPANLSSMPPISIKSGQVYSPDCGYTFSLEKVHGIRYELLV
                     KTIRSHVIFGTFLFICQVFLLIRQMQHTNTPSVINKLSYTSFFMINLMDGSLAMVYFA
                     TANSYPELYLPLVSSAFVSYILSTIFEMRYIISIFASQVNEVGISIMTLLRGSHQSDE
                     EQQNTRNVVIPDEAAIANEHYGKFFTAMLILLFLIILSTSWPRPLRLISEYIAIFVFN
                     SYWVPQIVRNCIKGLPSRKERRRSITLMNRRMHKWPLLWQFILGTTTIRCIPIIYIFS
                     YPSNVFRHHKDSKVVILLILWLLFQISVLYSQDILGSRWFLPKHSIPEEYSYHRVVSL
                     QHLMEHGGSENHTVDCAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESW
                     MSYKLQCPVCRSPLPPL"
     gene            <230757..>231470
                     /locus_tag="CAGL0L01969g"
                     /db_xref="GeneID:2890677"
     mRNA            <230757..>231470
                     /locus_tag="CAGL0L01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448855.1"
                     /db_xref="GeneID:2890677"
     CDS             230757..231470
                     /locus_tag="CAGL0L01969g"
                     /inference="similar to AA sequence:UniProtKB:Q86ZR7"
                     /note="similar to uniprot|Q86ZR7 Saccharomyces cerevisiae
                     YKL033wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448855.1"
                     /db_xref="GeneID:2890677"
                     /db_xref="GOA:Q6FLN9"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN9"
                     /translation="MLDLFERVKACLFDMDGLLINTEDIYTLTLNRILKEYGLGPLTW
                     DVKIQLQGLPGPEAGKKIIETYKLPLTPKELETKNIEIQNDYWPTAAFLPGALELLKY
                     LKSKNIPIALCTSSNKIKFKGKTSHLGEGFNLFDAIVTGDDERIPSGRGKPFPDVWQV
                     GLKSLNDKFNTSISPSECLVFEDGIIGVQSGRAFGAHVIWVPHQESLPFIDNAADVLQ
                     GQGEQLNTLEELELSKYGL"
     gene            <231837..>234998
                     /locus_tag="CAGL0L01991g"
                     /db_xref="GeneID:2890678"
     mRNA            <231837..>234998
                     /locus_tag="CAGL0L01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448856.1"
                     /db_xref="GeneID:2890678"
     CDS             231837..234998
                     /locus_tag="CAGL0L01991g"
                     /inference="similar to AA sequence:UniProtKB:P36097"
                     /note="similar to uniprot|P36097 Saccharomyces cerevisiae
                     YKL033w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448856.1"
                     /db_xref="GeneID:2890678"
                     /db_xref="GOA:Q6FLN8"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016441"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN8"
                     /translation="MDRGQTVFKKLREPCVLVSRVAFLPRESFDPNSPLLIDSLKELS
                     ICLSEINDADDLPSNLGDYVYLPISHLLKQDSLGDVAIEYVFKITRMILKLFWHKSGS
                     LDKETCKKLFMITNFLINNDPSSKEYLKKSSPYKLEGIKLLQELLRSLQKQEYHSSFF
                     VEKPEMLSIMTHMVSICLEMLKSEPFVIDLQLQCIETLRTLYVEILPHGETLSYILPG
                     NISALVAVLGKPGLLSNSAVIIGCLKLYSQLLIIIYNDKDLGVKENSANNGRIINTIL
                     EQELKETPLDPFSLKLPILGTNLNTKRVHRDTSWLKGTSSQIRLSLESFLTKLCRRND
                     SRINHELSKLCGGLLANCKSSLCTSVPLLVRTLIYLNSNPQNILKSCINEVRNIFSEE
                     VENLNSQLKESTEGTLSQLFFLVKLLEGDSELLPGITKCLVSLKTHVMKEIDIYDAST
                     KKIQTIDQKSEVIMMDKWELDTAETGLLTNVIGTEEKTVASFLGALAHELPAQSKEHV
                     IEGLLNEMDFTSLSDKITSMWISSNLLNGKLSISGSNGVAMDSLTGTGLNSYASYPTV
                     AYQLLECAKQCYEGLEMEMEGQNGTISQEILVCTILRSITTVVETIGKDFQDEVIDYI
                     YIIIENLASSSMLIREFSKRSAIVLAKILYHNSISDMITQNTDYIIDAVSIKLASGMT
                     QRVSVVLMVICKLAGYEAIRSFKDVIETLFKMLDFYHGYSDLCIQFFKVFEIIVMEMQ
                     KTYLTADKNWDKIEDKASNKSTFKPWGIANVEQICKMLENEIIIDIEDGTIDINEDDA
                     LSEINNFKDYVNRKMELENSDSDDDDDDDDIENYEDEGSHNELEEMKKKKKTSEEWVS
                     PIPVESYRVLLQIISYGDRLLTHPSKELKILILNIFSQIWPMLATQYSSLLPQVAQAW
                     PLISTLTFDSDYSIVEAACVCLRIMIECSGDFVSKRFVDLWKEVKARSILLKEIKYSQ
                     IENGQETTSVVVLNRIRFPPITMKALAALNYMLLEGIIIAELFLSDLDIRDMLHCCVQ
                     SIPKDEIESKSLHLGDVLFDMTI"
     gene            complement(<235616..>237127)
                     /locus_tag="CAGL0L02013g"
                     /db_xref="GeneID:2890679"
     mRNA            complement(<235616..>237127)
                     /locus_tag="CAGL0L02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448857.1"
                     /db_xref="GeneID:2890679"
     CDS             complement(235616..237127)
                     /locus_tag="CAGL0L02013g"
                     /note="some similarities with uniprot|P33417 Saccharomyces
                     cerevisiae YKL032c IXR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448857.1"
                     /db_xref="GeneID:2890679"
                     /db_xref="GOA:Q6FLN7"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN7"
                     /translation="MNHIPQSGNASGGTGTGNSNSNNNSSLNQQQFQEMMYNSFLNHL
                     NQNKPASGSSGSGSNNAASGNSNTSSGNNATAAALAQQQKYLSSQPQRYYSNPSANMM
                     NDPLAQQSFLQQQQQQMLQQHQLHQMQGGQSSTTASTGNNHTTTNSANYSPQYMHDQL
                     QYHPSGNGSLQYNSNGQPYQYHPQNVSYQQNQQKSSVAQYNQVNQDQSFPYQQQYNQQ
                     NMPNNINMQQAQLKAQQRTLQLNQDGTPKVTKKGKGRKPKKQDGAAPTKAPKEPAASQ
                     QQGNNANHPKKLSSTQSRIEKRKQLKKQGPKRPSSAYFLFSMSIRNELLQQFPDAKVP
                     ELSKLASARWRELSDDEKKPYYDEFRTNWEKYRVLRDEYEKTLPPKRPSGPFIQFTQE
                     IRPIVVKENPDKNLIEITKIIGSKWRDLDPAKKNEYTEMYKKRLKEWEECYPEEAAAH
                     EQSTQTKKGRKKKQDPHAQDNTAITDPSLLNAGNISVGVADLSSMVPKMDSMQ"
     gene            complement(<240413..>242389)
                     /locus_tag="CAGL0L02035g"
                     /db_xref="GeneID:2890680"
     mRNA            complement(<240413..>242389)
                     /locus_tag="CAGL0L02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448858.1"
                     /db_xref="GeneID:2890680"
     CDS             complement(240413..242389)
                     /locus_tag="CAGL0L02035g"
                     /note="highly similar to uniprot|P36013 Saccharomyces
                     cerevisiae YKL029c MAE1 malic enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448858.1"
                     /db_xref="GeneID:2890680"
                     /db_xref="GOA:Q6FLN6"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR015884"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN6"
                     /translation="MFLFRKPSIRSCQRINSLCSLLELQRGYATTTRENTLYPPHADT
                     SSPHKTPVGEAAKEYLKQKKRKLQEKGTPKSTRLTVEGVIECPLESFQLLNSPLFNKG
                     SAFTQEEREAFNLEALLPPQVNTLDEQLERAYKQLCYLKTPLAKNDFMTSLRVQNKVL
                     YFALVRKHIRELVPIIYTPTEGDAIASYSHRFRKPEGVFLDITEPNSVEKRLAVYGEA
                     KDVDYIVVSDSEGILGIGDQGVGGVRIAISKLALMTLCGGIHPGRVLPVCLDVGTNNK
                     KLARDELYMGNKFSRIRGKQYDDFIDSFIQAVKKLYPSAVLHFEDFGVKNARRILDKY
                     RYDLPCFNDDIQGTGAVVTASLLAALKHTDRELKDTKVLVFGAGSAGLGIADQITNHM
                     VTHGLTPEEARSNIYLMDRRGLILESMEENSTVAQHRYAKPDEDWDDIDTTKLFNVVS
                     KMKPTCLVGCSTQAGAFTKEIVQEMYKYNPRPIIFPLSNPTRLHEAVPSDLMEWTNND
                     ALVATGSPFAPVNGYRISENNNCFSFPGIGLGAVLSRATAITDTMISAAVDQLAALSP
                     LKPGDSRPGLLPPLEDITNTSAKLATAVILQSLKEGTARIEDEEVPGSPGEKVTVPRD
                     FDQCLEWVKSQMWEPVYRPMVKVNYDPEVHTNQM"
     gene            <243489..>244889
                     /locus_tag="CAGL0L02057g"
                     /db_xref="GeneID:2890681"
     mRNA            <243489..>244889
                     /locus_tag="CAGL0L02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448859.1"
                     /db_xref="GeneID:2890681"
     CDS             243489..244889
                     /locus_tag="CAGL0L02057g"
                     /note="highly similar to uniprot|P36100 Saccharomyces
                     cerevisiae YKL028w TFA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448859.1"
                     /db_xref="GeneID:2890681"
                     /db_xref="GOA:Q6FLN5"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN5"
                     /translation="MDVPIDEIVKNLLKFVVRGFYGGSYVLVLDAIIYHSVLVEEDLK
                     QLLSINKTELGPLIARLRSDRLVSTHKQREYPPNSKSVERCYYYIKYPHAVDSIKWKV
                     HQLVQRMKEDLDKNSEPNGYMCPICLTKYTQLEAIQLLNYERTEFLCSLCDEPLIEDD
                     SGKKNKEKQDKLNRLMDQIQPIIDYLKKIDDSRIEENTFELALARLIPPQNQLNAAYT
                     FNPKKGSTMFKPGETTLDANSIMGNSLGNDSSRRAGANSQATLHVNITTANDEIVQRQ
                     LQERQAEEKRKQNAVPEWHQQSTIGKTALGRLDSDEEFDPQTTQQALQSTMGGGSDVV
                     DEESTYGYNNNLTANQREEKENERTLNEYYAALARKQAKAKKEEEEEEEEEMEDVNDD
                     NVDGNDDDEDGFEDVVTGNNGTTQNQSEDSEDNEDIAAFEDEFEDVMDESDEKKISNG
                     EDKNKDDDMDIEFEDV"
     gene            <245464..>246357
                     /locus_tag="CAGL0L02079g"
                     /db_xref="GeneID:2890682"
     mRNA            <245464..>246357
                     /locus_tag="CAGL0L02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448860.1"
                     /db_xref="GeneID:2890682"
     CDS             245464..246357
                     /locus_tag="CAGL0L02079g"
                     /note="highly similar to uniprot|P38152 Saccharomyces
                     cerevisiae YBR291c CTP1 citrate transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448860.1"
                     /db_xref="GeneID:2890682"
                     /db_xref="GOA:Q6FLN4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN4"
                     /translation="MSKDSKKVDPTKSFVAGALAGAVEASITYPFEFAKTRLQLIDKS
                     SKASRNPLVLIYNTAKTQGVGAIYVGCPAFIVGNTAKAATRFLGYDTIRNLLKDKKTG
                     ELSGPRGVLAGLGAGLLESVVAVTPFEAIKTVLIDDKQSVRPKYQNNGRSMARNYISL
                     VKDEGFRGLYGGVLPVSMRQAANQAVRLGCYNKIKVLVQDYTGAPKDKPLTSGLTFIV
                     GAFSGVVTVYATMPIDTVKTRMQSLTASKYSSTLNCFTTIYKEEGLKTFWKGATPRLG
                     RLILSGGIVFTIYENVLLYLS"
     gene            complement(<246556..>247494)
                     /locus_tag="CAGL0L02101g"
                     /db_xref="GeneID:2890891"
     mRNA            complement(<246556..>247494)
                     /locus_tag="CAGL0L02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448861.1"
                     /db_xref="GeneID:2890891"
     CDS             complement(246556..247494)
                     /locus_tag="CAGL0L02101g"
                     /inference="similar to AA sequence:UniProtKB:P38356"
                     /note="similar to uniprot|P38356 Saccharomyces cerevisiae
                     YBR290w BSD2 metal homeostasis protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448861.1"
                     /db_xref="GeneID:2890891"
                     /db_xref="GOA:Q6FLN3"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN3"
                     /translation="MSEEDRHNNTTVPQIEITSDTPESNTHRVEIEMANNTNGEETQG
                     TTNNEEEDPGVSSSDRLLPTDFGRAARHIDNIGRHFNILDRFFKRRNNANGSNSRGVG
                     FDGVFSNLSAKPDRDGANEHTQQDNPPTYDEAAADMSPSYYGMDLSSTDMYYDEICIE
                     GLPVGNIANLFWNIIVSTSFQFVGFLVTYLLHTSHAAKQGSRFGLGLTFIGYAYSMRP
                     RNVDVKVGKDKTADRIKIENPNDYNDLQIPEDGTEMDNFESSLSHGLEEKKQSWSFIT
                     IFAALLGIFIAIKSIYDYVKVKKMERKYLSQEEQQV"
     gene            complement(<248319..>251411)
                     /locus_tag="CAGL0L02123g"
                     /db_xref="GeneID:2890892"
     mRNA            complement(<248319..>251411)
                     /locus_tag="CAGL0L02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448862.1"
                     /db_xref="GeneID:2890892"
     CDS             complement(248319..251411)
                     /locus_tag="CAGL0L02123g"
                     /inference="similar to AA sequence:UniProtKB:P18480"
                     /note="similar to uniprot|P18480 Saccharomyces cerevisiae
                     YBR289w SNF5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448862.1"
                     /db_xref="GeneID:2890892"
                     /db_xref="GOA:Q6FLN2"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN2"
                     /translation="MNNDPNNGTQTSNTGKPNKKPNPQSASIMQTIFRNIGTPSFKLS
                     QIPQQYLQNLTPQQLQMIQNRHQQLLYARMQQQQAQNSQASTPQEQVSAANKISTQRK
                     PASNAPSPAVQEIQQNHAFQQSNSTPTAFHNSPPNSSTGSVNPNTGGVPPTLPPQIAQ
                     LPLASQQQVLQTLKQQAIAKNNPAVVAAITAAEQHVKNLLEQQDQQNTGSKSQTKMTA
                     NKQGSRVVNQKMTTAANYVPESPGITNQIPPMALPQNIPPPQIDMRKYELPSFQTINY
                     DPPETKLPNPSYWSSRNPTTDILLYEQITQRDKANVSAQHREVNGYDPFSIYGFSNKE
                     YVSKLWHTLKYYQDLKTTRMKSITNTSQNIPTASIWGNGYSGYGNGITNTTTKVVPFH
                     PIAGRNFYSPDKIKLYKQAMSEDAENLVPVRLEFDLERDKFFLRDTLLWNRNESVVDI
                     NEFVEDMVADYQFDTSIKRHAIDMISQSIKEQVQEYQPNPFIEEHLSRIGGDDMRITI
                     KLDIVVGQTQLIDQFEWDLSNPDNSPEEFAECMCRELELPGEFVSAIAHSIREQVHMY
                     HKSLIMLGYGFDGGIVEDDDIRSRILPVVTVDDVYRPPADCKVFTPNILQISPAELER
                     LDKDKDRDTRRKRRQGRFSRRGNTNIGGMSMSSTNANASAANNSSVGGEATLPDIADI
                     PRTFRTPIPSTILPGGVDLGPSVFSYNLETSVEYQSRGPPPEPVMPPCYVVDHIPGKS
                     MLVSIKLPQKTAAPLAVEQHGQHFGGDSTNTDVPIKKEDDNISAEAAPSMQNISNPSQ
                     TIQAASEVPEDKREQDIDAITPIVESQTEEKKEEPETATENSEKIEDKETMDKVVEAE
                     SGEKQVVSEQELNSHIDEKLDGEKPPVDSTDIKKVGESEQVNGTPPLEVNTTQKEAKS
                     PSDEVPQSIESGMKSPEEENKEGSSNDNRLESENINTSNENDNADTEVAGKDNEETEV
                     AGKDNKETEVAGKDNEETEATRMGSEESGNQYDDNQTHNETTEKPDTDNTDGQEKTQL
                     "
     gene            <252110..>253741
                     /locus_tag="CAGL0L02145g"
                     /db_xref="GeneID:2890893"
     mRNA            <252110..>253741
                     /locus_tag="CAGL0L02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448863.1"
                     /db_xref="GeneID:2890893"
     CDS             252110..253741
                     /locus_tag="CAGL0L02145g"
                     /inference="similar to AA sequence:UniProtKB:P38153"
                     /note="similar to uniprot|P38153 Saccharomyces cerevisiae
                     YBR288c APM3 AP-3 complex subunit mu3 subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448863.1"
                     /db_xref="GeneID:2890893"
                     /db_xref="GOA:Q6FLN1"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN1"
                     /translation="MVYQAVYITDAENKLVFQHLLNAKAPEFSKMWVKLSAMHPQLVA
                     PRNYQDNIYTIERDSGGGSVSSTSEEVIGSYGTDNTIYKYKSQLAGSALTYWCLHSND
                     SNVYYMEPLFAMQVFETRLHEYFDKEELTITKITNNADRVSIICNYILNGGYYNVAGM
                     YDSRIKEIVPERSDLSKLISSTAHTIQSAVNKQRNTPGFGNGMGQSMGSKVSHIGSTL
                     KGDDSVAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLE
                     YVRGNISGSVDMRCFLTGNPLVEIALKQGGLDIGIPGFHDCVDKTSLLKQEKISKLSF
                     IPPDGRFTLMQYNINLDQGKRHSVGLVHADIEDHLGTLGDEFEVTLNISSSTSVKHIE
                     DMEVMLYFGLSHGNRKKDTHLSSDEEEFSVEQFRIKPLQITHGRLENMSSGVHKRSKW
                     VFDKEVSTGTMPVLRGCVERQRSDEDVKDSKGSDSTAQRMLVLQSINISYKHTGSSNG
                     LQIESINVDTSADLQRNLFKGVKYHTIAKDYQVRV"
     gene            <255052..>257757
                     /locus_tag="CAGL0L02167g"
                     /db_xref="GeneID:2890894"
     mRNA            <255052..>257757
                     /locus_tag="CAGL0L02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448864.1"
                     /db_xref="GeneID:2890894"
     CDS             255052..257757
                     /locus_tag="CAGL0L02167g"
                     /note="highly similar to uniprot|Q02207 Saccharomyces
                     cerevisiae YKR009c FOX2 hydratase-dehydrogenase-epimerase
                     peroxisomal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448864.1"
                     /db_xref="GeneID:2890894"
                     /db_xref="GOA:Q6FLN0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FLN0"
                     /translation="MGKDLSFNGRVVVITGAGGGLGKVYALEYAKRGAKVVVNDLGGT
                     LGGSGHDSKAADVVVDEIVKSGGTAVANYDSVNDNGEQIVETAIKAFGRIDILINNAG
                     ILRDVSFAKMTEKEFSAVLDVHLTGAYRLTKAAWPYMRQQKFGRIINTASPAGLFGNF
                     GQANYSAAKLGLVGFAETLAKEGYKYNINVNSIAPLARSRMTENVLPPHILKQLGPEK
                     IAPLVLFLTHESTKVTNSIFELAAGFYGQIRWERSAGQIFNPNPETYTPEAILNKWTD
                     ITDFKDKPFNKVQHPIMLSDYNDLITKAKKLPENNDQGSIKITSLKDKVVIITGAGGG
                     LGKSHALWFAKYGARVVVNDIKDPNTVVNEINSKYGEGRAIPDTHNVVTEANQVIETA
                     MKAYGRVDVLVNNAGILRDRSFLKMTDQEWFAVVQVHLYSTFLLSKAVWPIFLKQKGG
                     HIINTTSTSGIYGNFGQANYAAAKAAILGFSRTIAVEGAKRGIRVNIIAPHAETAMTK
                     TIFSEKELANHFDASQVSPLVVLLASDELQRTNKKGVNGQLFEVGGGWVGQTRWQRAA
                     GYVCLEDNVTPEALKENWKQVVNFSGHTTNPASTEQSSMGILQAVQKAQAAAATAKDV
                     FEYNHKDVILYNIGLGATSKELKYTYENDSNFQVLPTFAVMPVFNSPPLAMDTLVDNF
                     NYAMLLHGEQYFKIGQNPIPVKGALKTEVKPLQVIDKGGKAAVIVAGYKSVDAKTNKL
                     VSYNESTFFVRGAHVPPNKKKYNEPRAPFAVQSFQAPTDRAPDYEVEVQTHKDQAAIY
                     RLSGDFNPLHIDPALAKQVGFPSPIIHGLCTLGVSSKAVLEKFGPYEELKVRFTNAVF
                     PGDTLKVRAWKQPNNVVIFQTVDLNTKKIVLDNAAVKLVGPVAKL"
     gene            complement(<258070..>259740)
                     /locus_tag="CAGL0L02189g"
                     /db_xref="GeneID:2890895"
     mRNA            complement(<258070..>259740)
                     /locus_tag="CAGL0L02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448865.1"
                     /db_xref="GeneID:2890895"
     CDS             complement(258070..259740)
                     /locus_tag="CAGL0L02189g"
                     /inference="similar to AA sequence:UniProtKB:Q02206"
                     /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
                     YKR008w RSC4 member of RSC complex which remodels the
                     structure of chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448865.1"
                     /db_xref="GeneID:2890895"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM9"
                     /translation="MVFKKRKIEEEEEHETDTKYTPGKHPRTQASLPRVDYESPLDPE
                     NELFVEEWNIPKINNYISYMLDTLIETHKNLVKDFIKLPSRKFHPQYYYKIEKPISIN
                     EIKSRDYETNDGNLAFLLDVELIAKNCVSYNEEDTLIVKNSEQVVNLIEAEVLKTKNM
                     NRNYLLNDSLKKRATKYLDLLLDCTDKDIEEAFNRPTKGVDSKMKICGPFREMVNKDD
                     LPEYYEIIQNPISLDVIATNITIGKYKQLYDFITDVQLVFLNARVYNDVNTLIYQDAT
                     RILHYFNYLINNKLFAELQDATERGELNLELDPVGYEHMINEPSSNTNSLNLLDNDDM
                     GETDNLEGLGNGYNRSIMSEDFLLGPMNDRNESNNNEDEEDDAEAKVPKYNIIKSLQK
                     DVISNQYTMAKKPFEIIKQIEIFSTLRSFKQAVDPLPGSKPSTNPDWFQYIFKGNQMS
                     QNENMYSLSLQPIHTQVTIAADTTKSGIKISLVLNRMLVKSRKMIINERNLMHLQSEV
                     KPDLSGLVGEREEFDIRLSEGLNMLELRCIDTAQSQEEVVKLWINIFA"
     gene            complement(<260207..>260695)
                     /locus_tag="CAGL0L02211g"
                     /db_xref="GeneID:2890896"
     mRNA            complement(<260207..>260695)
                     /locus_tag="CAGL0L02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448866.1"
                     /db_xref="GeneID:2890896"
     CDS             complement(260207..260695)
                     /locus_tag="CAGL0L02211g"
                     /inference="similar to AA sequence:UniProtKB:Q02205"
                     /note="similar to uniprot|Q02205 Saccharomyces cerevisiae
                     YKR007w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448866.1"
                     /db_xref="GeneID:2890896"
                     /db_xref="GOA:Q6FLM8"
                     /db_xref="InterPro:IPR028209"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM8"
                     /translation="MGILLSCCKEREPEEEPLIASNQRGYGGEGAGNFEEYSDLQRLK
                     REEENKLMAREQQLRDIVSDTNDKLIDISMISNSGIVTHGRDVSTANNDTSEGNISEQ
                     EAQRSSQIDAKSTAAVYTPLDANSASRYTVTQLRSAHSVLFDQLQSELEVRPTGDLVV
                     NL"
     gene            <260991..>261722
                     /locus_tag="CAGL0L02233g"
                     /db_xref="GeneID:2890897"
     mRNA            <260991..>261722
                     /locus_tag="CAGL0L02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448867.1"
                     /db_xref="GeneID:2890897"
     CDS             260991..261722
                     /locus_tag="CAGL0L02233g"
                     /inference="similar to AA sequence:UniProtKB:Q02204"
                     /note="similar to uniprot|Q02204 Saccharomyces cerevisiae
                     YKR006c MRPL13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448867.1"
                     /db_xref="GeneID:2890897"
                     /db_xref="GOA:Q6FLM7"
                     /db_xref="InterPro:IPR018305"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM7"
                     /translation="MIRSGYSAVAGRRFLHTTKVNQDFFSWFAKKKQETKVKAKPVQE
                     VMEAVEQGKVDSLEETTSAKVKLELIPDNFIGITKLELKKQREKELFETIEINKWLSD
                     DKVKSLESLNRIIAEASKNAGIDSAEGAFTDIQSRFAFAKSLQIKTGYIIPDYELTIL
                     KSPSDIQRYFIDNIFSGKLARYKSSEPDAIHLTQDTYSAPNVRVVDNSVPVRERKQKL
                     KTLLKTVRDLEEEQTRRVLEEARNS"
     gene            <262270..>263174
                     /locus_tag="CAGL0L02255g"
                     /db_xref="GeneID:2890898"
     mRNA            join(<262270..262272,262320..>263174)
                     /locus_tag="CAGL0L02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448868.2"
                     /db_xref="GeneID:2890898"
     CDS             join(262270..262272,262320..263174)
                     /locus_tag="CAGL0L02255g"
                     /inference="similar to AA sequence:UniProtKB:Q02202"
                     /note="similar to uniprot|Q02202 Saccharomyces cerevisiae
                     YKR004c ECM9 involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448868.2"
                     /db_xref="GeneID:2890898"
                     /db_xref="GOA:Q6FLM6"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM6"
                     /translation="MAISQYIVNNDTYLATVGLLLTTPENKTIINLHYKCLLELCADD
                     TKALQREVVYLQRLLSCTNNRINKSSSLWLLYKKLYIQFNKTITFNVNTTLIKSAENH
                     FSNYYAWNFARWYYINTTIEERSSLLTRTRYFCNTHFKDSAAWSAFMFMLLPIDDSHE
                     KFLAENCLTDSLDHKSQPLEQEFVEKEVRSVINRIDILQCPEWSPFALVLAATKHMRG
                     CPLHDIFVKWKQEINQYEAQNDTIKFFHRQPMFDKNDTNILSRQLFMHIAYKKTLLDK
                     LLMFNEVVI"
     gene            complement(<263346..>265055)
                     /locus_tag="CAGL0L02277g"
                     /db_xref="GeneID:2890899"
     mRNA            complement(<263346..>265055)
                     /locus_tag="CAGL0L02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448869.1"
                     /db_xref="GeneID:2890899"
     CDS             complement(263346..265055)
                     /locus_tag="CAGL0L02277g"
                     /note="highly similar to uniprot|P29468 Saccharomyces
                     cerevisiae YKR002w PAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448869.1"
                     /db_xref="GeneID:2890899"
                     /db_xref="GOA:Q6FLM5"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM5"
                     /translation="MNYQKVYGITGPVSIAGPTAAENKLNDELIQELKKENSFESEQE
                     TANRVKVLKTLQELTEKFVYEVSKKKNMSDGMARDAGGKIFTYGSYRLGVHGPGSDID
                     TLVVVPKHVTREDFFTVFDALLREREELDEIAPVPDAFVPIIKLKFSGISIDLICAKL
                     DIAQVKPSLTLDDKALLRNLDEKDLRALNGTRVTDEILELVPKPSVFRIALRAIKIWA
                     QRRAIYANVFGFPGGVAWAMLVARICQLYPNACSAVILNRFFKILSEWKWPQPVILKP
                     IEDGPLQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITESTKAVILKELNRGIQV
                     TNDIFAYKKTWADLFTKHDFFFQYKYYLTITAATRGDDEEHLKWSGLVESKLRLLTLK
                     LETIPGIKLAHPFFKPFEAAYCYTDDQDAKTILNNHGSHITEKALEKFTKVTDENKDD
                     EDVKSKKKVHITTMYVGLGVSVENKKEKIDMHIPCGEFFNLCRNFHESYQNPEVYSLV
                     IRYLKSYELPDDVFGEDEQRPTKKLSKKRKEAKYDEEAAKRSKAETISKSAVSEATTV
                     SSA"
     gene            <266032..>268134
                     /locus_tag="CAGL0L02299g"
                     /db_xref="GeneID:2890900"
     mRNA            <266032..>268134
                     /locus_tag="CAGL0L02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448870.1"
                     /db_xref="GeneID:2890900"
     CDS             266032..268134
                     /locus_tag="CAGL0L02299g"
                     /note="highly similar to uniprot|P21576 Saccharomyces
                     cerevisiae YKR001c VPS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448870.1"
                     /db_xref="GeneID:2890900"
                     /db_xref="GOA:Q6FLM4"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM4"
                     /translation="MDEHLIATINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLINRRSKKSDKEVQKASDQLLDLNMDDHSKKE
                     DPAGKKGQSEDNAEEWGEFLHLPDKKFYNFDEIRNEIVRETDKLTGTNLGISPIPINL
                     RIYSPHVLTLTLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNAIILSVNAANTD
                     LANSDGLKLAREVDPEGTRTIGVLTKVDLMDKGTDVIDILAGRVIPLRYGYIPVINRG
                     QKDIEHKKTIRAALQDEKKFFEEHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDI
                     KNKIESTLKKYVNELESLGPETMDSASSIVLSMITDFSNEYTGILDGEAKELTSQELS
                     GGARISFVFHEIFKNGVDSLDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQ
                     QIRRFEEPSLRLVTLVFDELVRMLKQIISQPKYARYPALREAISTQFIDYLKEAIVPT
                     NEFVQDIIKSEQTYINTAHPDLLKGSQAMSMVEEKLHPRPTAVDPKTGKPLPNQPPAK
                     PMPAVEEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQMTERETMETEVIKLLINSY
                     FNIVKRTIADLVPKALMLKLIVKSKNDMQKVLLQKLYGNQDIDELTKENDITIQRRKE
                     CQRMIEILKNASQIVTSV"
     gene            <268778..>269401
                     /locus_tag="CAGL0L02321g"
                     /db_xref="GeneID:2890901"
     mRNA            <268778..>269401
                     /locus_tag="CAGL0L02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448871.1"
                     /db_xref="GeneID:2890901"
     CDS             268778..269401
                     /locus_tag="CAGL0L02321g"
                     /note="highly similar to uniprot|Q02196 Saccharomyces
                     cerevisiae YKL001c MET14 ATP adenosine-5 -phosphosulfate 3
                     -phosphotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448871.1"
                     /db_xref="GeneID:2890901"
                     /db_xref="GOA:Q6FLM3"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM3"
                     /translation="MTVTKATNITWHANLSYDERKALRKQDGCTVWLTGLSASGKSTI
                     ACALEQLLLQKGLSAYRLDGDNIRFGLNKDLGFSEADRNENIRRISEVSKLFADSCTI
                     SITSFISPYRTDRDKARELHKEAGLRFIEVFVDVPLEVAEQRDPKGLYKKARQGIIKD
                     FTGISAPYEEPASPELHLRTNEKSIEECAAIIYDYLTKEKVIPDNTI"
     gene            <270033..>270770
                     /locus_tag="CAGL0L02343g"
                     /db_xref="GeneID:2890902"
     mRNA            <270033..>270770
                     /locus_tag="CAGL0L02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448872.1"
                     /db_xref="GeneID:2890902"
     CDS             270033..270770
                     /locus_tag="CAGL0L02343g"
                     /inference="similar to AA sequence:UniProtKB:P40006"
                     /note="similar to uniprot|P40006 Saccharomyces cerevisiae
                     YEL001c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448872.1"
                     /db_xref="GeneID:2890902"
                     /db_xref="GOA:Q6FLM2"
                     /translation="MKFLHIGLMTLMAGVSNVLAQEEANAEDVMVNIEGQDMTMEEAE
                     AYMAAKEKMGGAQQQREMINLQVNYDLLEEPFADLQDFIVFEVGETATLNYTIHNLDQ
                     EETYSIVGVSGAVLSEVDQRNVANLTETNITEIVLAPNATGTLRHKIDMNLTEGRYYI
                     LPLLHVKDKNEVKRVMSNTFKLDLINQSISIFDPSFLSIIAVLIALVGGTVYLYSNVV
                     APPKKIKKKEAIPAKIDESWLPDVHKK"
     gene            <271597..>272883
                     /locus_tag="CAGL0L02365g"
                     /db_xref="GeneID:2890903"
     mRNA            <271597..>272883
                     /locus_tag="CAGL0L02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448873.1"
                     /db_xref="GeneID:2890903"
     CDS             271597..272883
                     /locus_tag="CAGL0L02365g"
                     /inference="similar to AA sequence:UniProtKB:P33767"
                     /note="similar to uniprot|P33767 Saccharomyces cerevisiae
                     YEL002c WBP1 oligosaccharyl transferase beta subunit
                     precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448873.1"
                     /db_xref="GeneID:2890903"
                     /db_xref="GOA:Q6FLM1"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM1"
                     /translation="MKLLFINLFLALLSTLARAASINGGRTLVVYDQRQNDIENYSDY
                     LDSLKGHQLTVDVIEISDKSVNVELFDAGEKKYDHLIVFPATTKSLNKRLSMNHLLNF
                     YENGGNIMTLYSPKSATEAIRLFWAQLGVHLPAKGYTTVDNFQDESQALRLPLVSVNK
                     EVYQSTSAEEVIFGESTTALLEGNELVIPVIPAGRKSYVINAKDDIWSTGPQGFSVVG
                     HQNYKNARSLWIGSSDAFLNENFDTNAKFLNEITRWVFGEKAVIKTSKVSHSHVNGLT
                     YDEKPYKVTDEIVYEISFSEWNGEKWVPFEREDIQFELRQVDPYYRITMEPINRTNDS
                     IIYTTGVFKLPDRHGMFTFLTDYKRPGLSFVHESDVRAIRHLANDEYPRSWTISNSWV
                     YLSAIYGTMLVWIAFVVLFVVSSKKDTTVSVEKKTE"
     gene            complement(<273166..>273501)
                     /locus_tag="CAGL0L02387g"
                     /db_xref="GeneID:2890904"
     mRNA            complement(<273166..>273501)
                     /locus_tag="CAGL0L02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448874.1"
                     /db_xref="GeneID:2890904"
     CDS             complement(273166..273501)
                     /locus_tag="CAGL0L02387g"
                     /inference="similar to AA sequence:UniProtKB:P40005"
                     /note="similar to uniprot|P40005 Saccharomyces cerevisiae
                     YEL003w GIM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448874.1"
                     /db_xref="GeneID:2890904"
                     /db_xref="GOA:Q6FLM0"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:Q6FLM0"
                     /translation="MDQKTNAFQIKYNDYKQTLETLQAKIIELGHDKDEHDVVLSTLK
                     NTDENRKCYRMINSALVETDVKTTIPILSTKRANLEEAIEKMKAELIKTAEEFEKWKK
                     DNKIQVVKQ"
     gene            <273966..>274838
                     /locus_tag="CAGL0L02409g"
                     /db_xref="GeneID:2890905"
     mRNA            <273966..>274838
                     /locus_tag="CAGL0L02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448875.1"
                     /db_xref="GeneID:2890905"
     CDS             273966..274838
                     /locus_tag="CAGL0L02409g"
                     /note="some similarities with uniprot|P40003 Saccharomyces
                     cerevisiae YEL005c VAB2 VAC8P binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448875.1"
                     /db_xref="GeneID:2890905"
                     /db_xref="GOA:Q6FLL9"
                     /translation="MDNKPLITVAEASEYKELLALEKLPQSSQLSYKAIFKSVSSEWE
                     QVKTDITHVNENILKDINEEIEQTDQIEKKLKSSFKSINQHYHKLLKHRRNRQNDEGT
                     SDLFLKYKNDVNELASNIETIENGLDMVIQNMISFDSTSSLDGDSLFNSSIITKRHYP
                     LLYDLIHKNYNKGQNSDKTSKDNSKITTDVTLPASDEDNSPDIEEQQSKLSSLSFSIE
                     KAQNPIPVDKAKNTDNSSRSIINSNVKIKNPTLILPMIKQRAQPSVALDAKPVIARDS
                     YKADTKSIIAPEIT"
     gene            complement(<274928..>276934)
                     /locus_tag="CAGL0L02431g"
                     /db_xref="GeneID:2890906"
     mRNA            complement(<274928..>276934)
                     /locus_tag="CAGL0L02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448876.1"
                     /db_xref="GeneID:2890906"
     CDS             complement(274928..276934)
                     /locus_tag="CAGL0L02431g"
                     /inference="similar to AA sequence:UniProtKB:P40557"
                     /note="similar to uniprot|P40557 Saccharomyces cerevisiae
                     YIL005w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448876.1"
                     /db_xref="GeneID:2890906"
                     /db_xref="GOA:Q6FLL8"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL8"
                     /translation="MQNIFFQLFIILFTIVRVYSEEIYPDPLSSNDFYSLIKDGNLHL
                     IEFYSPYCSYCNHLAPTWKKTWEKAQEINLLANYNVTLDRVNCIENGDLCYDEKIDYF
                     PSFRLYGPSGFIKYYPEDDKKTVNEFLKFVKQASKDKTNFQEKGQKDKSLALTELAFN
                     ELLNDPNLNHPYLISFWPTKQLISTDDDIDFENCYECLPFQRSWNLLSNTLDEKNIKT
                     AHVNCESAVNLCKAMGYKDLTEIKNHRGDRMAKVALLVPGRPHSKNKVIRYNEEYFTD
                     YLKVKDFAIRGVENAKVPDFNSNYISNYPVIDVTSYFEPESTDLESFVIYVNDRLDES
                     DDQLLDSLIEVVSNAERTTLYKANVEDFYAAMGPELENFYGKYYNDKEYTFKDLIQLK
                     LSTNLPAIYYIQKGQIKTSIFPVKKSLSNDKFTKGVQKWLNLFNIPLLTDITSWKFSK
                     LMNYDKSNHRFILTELVDTSLIGVDKEIDSKLQKYHELQNIYEIEVDNWYLRQNSLPE
                     GQEQRKIAIGKLRDKRKAGLITTFLDISEAKSFATRNGLVSSSRQYEIGDVIIIDRAS
                     GYVYNSYNDGESISVTNTNKILHALLSAQFSIPADTKFAGRLLGSPFPGPLKFMDTIH
                     QYGVFGYITILVLIALLWNLKRILKLTKRPASVSNGIQKDGKYY"
     gene            complement(<278611..>280524)
                     /locus_tag="CAGL0L02453g"
                     /db_xref="GeneID:2890907"
     mRNA            complement(<278611..>280524)
                     /locus_tag="CAGL0L02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448877.1"
                     /db_xref="GeneID:2890907"
     CDS             complement(278611..280524)
                     /locus_tag="CAGL0L02453g"
                     /note="some similarities with uniprot|P40002 Saccharomyces
                     cerevisiae YEL007w TOS9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448877.1"
                     /db_xref="GeneID:2890907"
                     /db_xref="GOA:Q6FLL7"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL7"
                     /translation="MDISPTFKGYIEDESDVLLILQATLDGKLQQIPRRPYEIERPYL
                     IVSGNIFVFVEEISGIKRWTDGISWSPSRITGKFLVYRELDKSGAQHHTQDFDINSPA
                     SMKYTGLIKKTISVKLRRAPFHLLENFHIVSYYTLSDVQEKKILSPKHIPIFNEVTPS
                     GELIKAMENTTLGNVKTSSSGGHSSHKHSPLDSHEKQTSIAYGNYNAPVSTNSLSMGN
                     PVPNNSSHYFYSANGLQAYGSNGTAYQGQPYVHLSNNNSTNCNNSNEMHSSLNSHNSA
                     GVTNSGLSSGQKIPGFPGGGSYYYTYSSSSGKPQDMSSSTSPRPLLVKGSTSMSNNNT
                     GYVDHIQQSGGPASLNANTSLGNATPSSGSVAASIPPLNTPYYYSSTATPNNMSNPHF
                     SVVQQGTPYHAIEGNTSMSSFQGQKATNSTVPYLSSANGNPIYQQVSRNYSGADTSMS
                     PLNHTSFQGYQSQVGINSSAALMNGNLSGNHLNKQGSSVTHQNLSEQHAPQNQQLIGS
                     FSSQGLPHSQNSYAPQYYSGLQQAYNSNLEKGISKIASTPSLPQVQQNTGSTVSNLVG
                     NSAPTPNILPYVSSGPTHSSSMIVPSTAATTPSTLTSVKGPSSLQVNNFSHATIDRGY
                     QYHQGQVPNENRS"
     gene            complement(<291813..>292745)
                     /locus_tag="CAGL0L02475g"
                     /db_xref="GeneID:2890908"
     mRNA            complement(<291813..>292745)
                     /locus_tag="CAGL0L02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448878.1"
                     /db_xref="GeneID:2890908"
     CDS             complement(291813..292745)
                     /locus_tag="CAGL0L02475g"
                     /inference="similar to AA sequence:UniProtKB:P03069"
                     /note="similar to uniprot|P03069 Saccharomyces cerevisiae
                     YEL009c GCN4 transcriptional activator of amino acid
                     biosynthetic genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448878.1"
                     /db_xref="GeneID:2890908"
                     /db_xref="GOA:Q6FLL6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL6"
                     /translation="MKMYVAQSNENVTKAGVPEFTNDKKVVVGELVFGKFNQDQQAIL
                     RDDSNAANNNYGDTLMDPTNAIPTDFFGSTIDQHFTNDNNDIDAAVVDAFFSSSTDST
                     PMFDYDDNQLAGNTVSGSSDNPENWTSLFDDDVEIKVEDVFGADAAGASITQFEQQKP
                     EPVIAIKQEENSMGHNLIIPKTSFLPTPVIEDGKLDSSIKKANRVTKKSTVGSPVSPC
                     LSSVKKDEKVDHLGVVVYNRKKRSQALTPVIPESDDPASLKRAKNTEAARRSRARKLQ
                     RMNQLETKVEELLKKNNELENEVRRLRGLLGESA"
     gene            <295794..>296879
                     /locus_tag="CAGL0L02497g"
                     /db_xref="GeneID:2890854"
     mRNA            <295794..>296879
                     /locus_tag="CAGL0L02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448879.1"
                     /db_xref="GeneID:2890854"
     CDS             295794..296879
                     /locus_tag="CAGL0L02497g"
                     /note="highly similar to uniprot|P14540 Saccharomyces
                     cerevisiae YKL060c FBA1 fructose-bisphosphate aldolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448879.1"
                     /db_xref="GeneID:2890854"
                     /db_xref="GOA:Q6FLL5"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL5"
                     /translation="MGVQEVLKRKTGVIVGDDVRALFDYAKEHKFAIPAINVTSSSTV
                     VAALEAARDAKSPIILQTSNGGAAYFAGKGVSNDGQNASIRGSIAAAHYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWYDGMLEADEAYFKEHGEPLFSSHMLDLSEETDDENIATCVK
                     YFKRMAAMNQWLEMEIGITGGEEDGVNNEHVDKESLYTKPETVFAVHEALAPISPNFS
                     IAAAFGNVHGVYQAGNVVLSPEILADHQKYAAEKTGAPAGSKPLYLVFHGGSGSTQEE
                     FNTGINNGVVKVNLDTDCQYAYLTGIRDYVLNKKDYIMSMVGNPEGADKPNKKFFDPR
                     VWVREGEKTMSKRISEALDVFHTKNTL"
     gene            complement(<297555..>299144)
                     /locus_tag="CAGL0L02519g"
                     /db_xref="GeneID:2890855"
     mRNA            complement(<297555..>299144)
                     /locus_tag="CAGL0L02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448880.1"
                     /db_xref="GeneID:2890855"
     CDS             complement(297555..299144)
                     /locus_tag="CAGL0L02519g"
                     /inference="similar to AA sequence:UniProtKB:Q08902"
                     /note="similar to uniprot|Q08902 Saccharomyces cerevisiae
                     YOR378w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448880.1"
                     /db_xref="GeneID:2890855"
                     /db_xref="GOA:Q6FLL4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL4"
                     /translation="MSKSNLSSTSTSSDTEYSAEKLTEVDTSIRLPKTWIREIFLVII
                     LISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSAVMVLIAGKLG
                     DLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFIVPNSLAIM
                     GRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTKWAWNYWALACVCVLYTV
                     GAILFIPPDNIVHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALGWSPPHTYI
                     TLIIGVILILIAMFVDWRVDDPLVPLQHLRADVVVILICVYFGFLSFVIWANWFWQFY
                     ELVHNDSPLRIAAKLVPLAIGSIPAAIFTVTCLQLNIKAPTMMVISMVCFLVPNILMA
                     TVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIITVISYAI
                     SIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGLIDYKI
                     TRTHCGDIPPPLSKIGRKSKK"
     gene            <300308..>300988
                     /locus_tag="CAGL0L02541g"
                     /db_xref="GeneID:2890853"
     mRNA            <300308..>300988
                     /locus_tag="CAGL0L02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448881.1"
                     /db_xref="GeneID:2890853"
     CDS             300308..300988
                     /locus_tag="CAGL0L02541g"
                     /note="weakly similar to uniprot|P40449 Saccharomyces
                     cerevisiae YIL161w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448881.1"
                     /db_xref="GeneID:2890853"
                     /db_xref="GOA:Q6FLL3"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL3"
                     /translation="MEQQPVAKQIKKNNGPRRRPKKSGEAKKANRNDQSDSGKKKPGV
                     KDNNRRSRNKKNDKGKDFKVIQDDTTKQNNKVRDEQVSECEHLLNKSHGFKLFRKGDF
                     INTYSFTFHDPSRTRSKDSNIRVRVQVPHDYPRNGLTLNIESKSRDTEVLQTICKNFK
                     ISSRNLTRQAVPIVSQLNMLVNSFDEYTVSNYAAFEDMKSQWFKSFEQRDQLEVVPAL
                     PKADVSVA"
     gene            <302012..>303094
                     /locus_tag="CAGL0L02563g"
                     /db_xref="GeneID:2890857"
     mRNA            <302012..>303094
                     /locus_tag="CAGL0L02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448882.1"
                     /db_xref="GeneID:2890857"
     CDS             302012..303094
                     /locus_tag="CAGL0L02563g"
                     /inference="similar to AA sequence:UniProtKB:P36169"
                     /note="similar to uniprot|P36169 Saccharomyces cerevisiae
                     YKR100c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448882.1"
                     /db_xref="GeneID:2890857"
                     /db_xref="GOA:Q6FLL2"
                     /translation="MTGTVSTAVGCAVGIPVGVGVIVACLFWIRMQRRLKEEDIIDQE
                     LNRAVYDESGFVSFNNIDTLKAEPNGHPSSEDTNEVMHSSDIDDNGDDDDEDHNARRN
                     NTYAAQDKNNGKYVPAYRRQINKHNSILQQQRKSRNLVNTMGHSIESLSMDDHSQANG
                     KSRQVSVYDQMVPVLDDANRDSSSPFPTNDKDTSDKKSNLFQSHDVSANTSTSFFETR
                     SNDNLIKNLNSHDFGSYYPRRPSTSNLNHSQGSLHTRNSSMLSLGKIENAENVFATPK
                     SENILKHPHPLEHESSSISNETNNVTDNTIDGESASKSSKTYQLKNNYDIQNTSEIAE
                     EDQYENEFTNYSENKRAYIDGLRPKM"
     gene            complement(<303525..>305846)
                     /locus_tag="CAGL0L02585g"
                     /db_xref="GeneID:2890856"
     mRNA            complement(<303525..>305846)
                     /locus_tag="CAGL0L02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448883.1"
                     /db_xref="GeneID:2890856"
     CDS             complement(303525..305846)
                     /locus_tag="CAGL0L02585g"
                     /inference="similar to AA sequence:UniProtKB:P22035"
                     /note="similar to uniprot|P22035 Saccharomyces cerevisiae
                     YKR099w BAS1 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448883.1"
                     /db_xref="GeneID:2890856"
                     /db_xref="GOA:Q6FLL1"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL1"
                     /translation="MAASVKGNKESVKKNENFDLLSITESLGYKTNRKASKNYWSKEE
                     DQKLADLVNDELLGMGLVNGIKDLKTIHDSMNYSRQIKWEKLIHAFKDKDRTPKLLRK
                     RWISALDPNIKRGKWTPEEDQKLISAYEKHGPKWLDISSEILGRTEDQCSKRYVEVLG
                     PSSKERLREWTLDEELSLISKVKKYGTKWRTISSEMESRPSLTCRNRWRRIITMVVRG
                     LAPEEIMKAVKEDKNIDFGIGQFKKYKRRSKLKENGNSSNSTSQISLLTETTSDTMSY
                     ASLTSPSQDFSSSNAKDIGIEVATEMKNEDNKFNQKQRSNTNSISSQDNVREGLETRA
                     LSLFEMKQSKRPYKSASPVQVASHLKTSNVMKTAMKSPSSLTSPGSVLADSRCDTPSL
                     EQQFAETTIDDQSKPKITTHQWKFTLKDSQDYSISNGSISNSQLVKELVEQAKKHNLK
                     ISIHQHIHNHYGSPAAKQSSQVNLNDSISRSQSVKPVADALAQHLEVSNDLSVFETPN
                     DYGHVFNVSDNAFMATSPNYNPFGLDADTPVSNDYYSKPSNEANMSPDQRGSQISNEH
                     GHTGTSSSAGSFSTPGSELPEGGPNRMTHFTYLPSTMKPQLESSGSTRSTNLQYLLGE
                     NGHKHKKRKRRTSRQHEVDSERALDEENKRIKLEYEKTSDDSKQTTVNGQSNYNNFYS
                     LEEDEEDFWESLRSLADNPASPGKQDMSQSYVSAGKDNTLNAVSQTGHHLHGRGLAEI
                     NTLDSFLGNEDDEGISMGGSEDGEAFFLPLNPS"
     gene            complement(<306589..>308346)
                     /locus_tag="CAGL0L02607g"
                     /db_xref="GeneID:2890859"
     mRNA            complement(<306589..>308346)
                     /locus_tag="CAGL0L02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448884.1"
                     /db_xref="GeneID:2890859"
     CDS             complement(306589..308346)
                     /locus_tag="CAGL0L02607g"
                     /inference="similar to AA sequence:UniProtKB:P38887"
                     /note="similar to uniprot|P38887 Saccharomyces cerevisiae
                     YHR202w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448884.1"
                     /db_xref="GeneID:2890859"
                     /db_xref="GOA:Q6FLL0"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FLL0"
                     /translation="MLWLVFLLFVKVIGAFPTEQFFSTSEYAASLELRPIKLGKINFL
                     HTTDTHGWLGSHLLQRDFNADWGDFISFVELFRKNRINSKNQDLIVLDTGDKRDGNGL
                     SDATSLVGMNSSVIFNEMDFDLLTLGNHELYTEEASILEYYGTALSGKFKDKYVSSNV
                     EFIDDKGSKHAFGNKYLCFKTTNTKTKILALSFIFDFKRYNRKTIVTPAIQEIKKPWF
                     SDMVKSYTEDDIDMVLVFGHIPARGEADDELLSIHKELRKYYPNIVIQYFGGHTHIRD
                     FKIMDDKSTCLQSGKFSETVGFLSIDNLDSQNVTFSRRYLDFSKRSFKFHAGVKSLTT
                     TLGDSVSKAISKLRTHLGLNEIIGYVPHTFYMSARPLNSSENIYNLLSTKVLPLLETP
                     KGLFSHSRIIMINSGSVRYDLYKGPFTKDTEYIVMPFPNFWKYIRLPLKVAIQIEPAL
                     NNGPVIAHLVPPEGRVGSKLVASSQKCPFVTNPKLSEGFTTVDDAGCDGDDTPHRSQY
                     YHDIPNVVQCIQVHDEEPDTIVDFIYYSFMEDSVITAINFILGQLEGEDHKNVTRGDT
                     LHYGGRATKELLKAYIKSI"
     gene            complement(<309320..>311707)
                     /locus_tag="CAGL0L02629g"
                     /db_xref="GeneID:2890860"
     mRNA            complement(<309320..>311707)
                     /locus_tag="CAGL0L02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448885.1"
                     /db_xref="GeneID:2890860"
     CDS             complement(309320..311707)
                     /locus_tag="CAGL0L02629g"
                     /inference="similar to AA sequence:UniProtKB:P07834"
                     /note="similar to uniprot|P07834 Saccharomyces cerevisiae
                     YFL009w CDC4 cell division control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448885.1"
                     /db_xref="GeneID:2890860"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK9"
                     /translation="MKALEFPLAEIPIPFKYQLAAKRNRPLGNSKRRHDVDGGADRKR
                     MKICLDDMQDGVGRTPSSLEVLVRATNTPNETDINDKSLCSTEDGTCDNISMLSAPPT
                     AVVSNTSSNPAVSTIPPTSVDTTGANANVAVSTPSTVSNPKVTTGLVTSGSANESNVN
                     NSMAVDTAAESGIMLDDGALPLSPIASTPGSASPILKSMDLIEEYKDKERAETERLLA
                     TIKASLGAVNMNHLIYSLLSGMHRSELSDISTLLRDNLKRDFVTSLPLEITLKILNKL
                     PFESISNCLQVSKSWNRLINGTPALWKHLLLSESFVSKDSFDKKYPVENNKLDPPFDN
                     DSRYRQDFLMNCSILQNWYNPDFIPQRTTLKGHMTSVVTCLQFEDNYVITGADDKMIR
                     IYDSITKKFLIELSGHDGGVWALKYAGNGILVSGSTDRSVRIWNIHLGKCTHVFKGHT
                     STVRCLDIVEHEGVKYIVTGSRDNTLHIWKLPQMSDSNIDEGMPNVYSNNGPLFFHSP
                     EENPYFVGVLRGHIASVRTVSGHGRIVISGSYDNNLIVWDIIQMKCLYILMGHTDRIY
                     STIYDYKRNRCISASMDSTIKIWDLQNIWNNGECVNVTNATVPCTKITGPMMTLQGHT
                     ALVGLLKLSDKFLVSAAADGSLRGWDSSDYSRKFAYHHNNLSAITTFYMTDNILVSGS
                     EGQFNIYNLRTGKLIHSNILNDADQIWSVNFKGNILVAAVEKDGQSFVEILDFSKKQV
                     TFSSALHNENQVECVTDSSSSSLPSADLSTSLPDRPYSSGSTYSYSSNAIVSSSE"
     gene            <312371..>315100
                     /locus_tag="CAGL0L02651g"
                     /db_xref="GeneID:2890858"
     mRNA            <312371..>315100
                     /locus_tag="CAGL0L02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448886.1"
                     /db_xref="GeneID:2890858"
     CDS             312371..315100
                     /locus_tag="CAGL0L02651g"
                     /inference="similar to AA sequence:UniProtKB:P33894"
                     /note="similar to uniprot|P33894 Saccharomyces cerevisiae
                     YOR219c STE13 type IV dipeptidyl aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448886.1"
                     /db_xref="GeneID:2890858"
                     /db_xref="GOA:Q6FLK8"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK8"
                     /translation="MSKSHRRKNSQLFLQNKNSSNSVLPQQPASNQSSDEVVRSGSVQ
                     PFFDLEREVDLFGFEDVSASELNHPIRNNGSNRLSEDFEPLSQWSNWYLNGKYNYKRR
                     PYFLLVIGVIMLLTMGTLLSYIYWHGPTATERQDPSDFIPDLDDPGSRRNIFTIEEIL
                     HGEFSIKEETFHFIDPPEWLKSHDQDPGLYFTVEQKTGQMEFIARQLFDRTFEQKIGK
                     VTFEFEGKRYTTSSIQINYPLTKAIIATNMEKQYRHSSKAYYWLLDIHSGKYTPIRPK
                     EIKDRLVYLNYAHFSPHYNYIDFNYNNDLYFFGVESPSTVYRITNDGSNIILNGITDW
                     VYEEEVLSTDRSVWWAPDDSRFIFTKLNDVNVSTYEIDKYALKKENKDKNYVEYPVPG
                     SPNPTIELYQFDISAGVLYTVTTDLELDQPILYYAKFVSPTQFLYKVTDRTSRYLKVK
                     VYELDQNKVHLLNAMDTAAFNGWVEKSKNVFSIPPNKVSKDFGFLDIHPDRNGFNHIF
                     YYPSMKSSDVKAIQLTFGEWEVSELVGFEYESLKVFFAGNREHPMSQHLYAIDLSKEN
                     KHESLELLQDPNKKLDYYSFEISKSGRFAKARYLGPKPLKVKAGSLLEVLDVDSAENN
                     NNNVLSLSDDSNFNESLRTYDLPKTSYSSILLNDGTEINIVEIKPSYIDPERKYPILV
                     SVYGGPGSKTYTTKSSVFFEQAVAQGLDTIVLQIEPRGTGGKGWEFKSWARKNIGHWE
                     PKDIIETTKKYIELNSPHIDTDKVAIWGWSYGGYTTLKTIEQDSADTFKYGIAVAPVT
                     DWLSYDSIYTERYMGLPDLNEEGYENAKIKNISAFEKLTRLFVIHGTADDNVHIENTF
                     SFVDKLNEHSLSNYDMHIFPGSDHSISHHNGSRVLFRKLYNWIKLAFHPRAFQ"
     gene            complement(<315159..>317723)
                     /locus_tag="CAGL0L02673g"
                     /db_xref="GeneID:2890863"
     mRNA            complement(<315159..>317723)
                     /locus_tag="CAGL0L02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448887.1"
                     /db_xref="GeneID:2890863"
     CDS             complement(315159..317723)
                     /locus_tag="CAGL0L02673g"
                     /inference="similar to AA sequence:UniProtKB:P38630"
                     /note="similar to uniprot|P38630 Saccharomyces cerevisiae
                     YOR217w RFC1 DNA replication factor C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448887.1"
                     /db_xref="GeneID:2890863"
                     /db_xref="GOA:Q6FLK7"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK7"
                     /translation="MVNITDFFGKQKGATPKRKVVKKPEVIDLDDDDDDILGAIVDEP
                     EEQETKPAETKKEIPVIEKKQLPTSPPVVEKKAIVAKEEAKPIAKPATPKSNKPVTAQ
                     DVLDSIPSLDLNTVHVKENATFDFRQSKQQSNDSGMAMDVDIPEGQDNCLLGLTIVFT
                     GTLPSIERGAAENLAKRYGARVTKSISKKTSVVVLGDEAGPKKLEKIKDLGIKAIDEE
                     GFKQLIAGMPADGGSGDAAEKAKQKLEEQEREAIRQAEEMDREEKQKKMAREREMAKL
                     KKQNPNSITTTREPVREQDKLWTVKYAPTSLQQVCGNKTSVNKLKTWLSNWEANKSNG
                     FKTPGRDGTGIYRAAMLYGPPGIGKTTAAHLVAKELGYDVLEQNASDVRSKSLLNGGV
                     KNALDNFSIVGLLQNDKTANSNGTKFVIVMDEVDGMSGGDRGGVGQLAQFCRKTSTPL
                     ILICNERTLPKMRPFDRVCLDIQFRRPDANSIKARLMTIAVREKFKLDPNVIDKLVQA
                     TRGDIRQIINLLSTVSKTSKTINHENISEISAAWEKNIALKPFDIAHRLLDGSIYTEL
                     GSQRFSLNDKIMLYFDDFDFAPLMIQENYIHTRPSVLKPGQSHLQAVADAAESISQGD
                     LVERKIRSSEQLWGLLPLHAVLSSVRPASKVAGQMAGRINFTTWLGQNSKMGKYYRLL
                     QELQYHTRLSTSANKFGFRMEYMPLLKKRLLNPLVKRGSDAISDVIQLLDDYYLTKED
                     WDIIMEFMVGPDNTDAIIKKIPTAVKSAFTRKYNGMTHPVAIYRTGSSVPVSGGSRET
                     PDFEDVVDADDAVPAAEEDTQDDNDLKKDKLIKQKARPKKRAAPAKGAAKKKKQKV"
     gene            <317998..>319377
                     /locus_tag="CAGL0L02695g"
                     /db_xref="GeneID:2890861"
     mRNA            <317998..>319377
                     /locus_tag="CAGL0L02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448888.1"
                     /db_xref="GeneID:2890861"
     CDS             317998..319377
                     /locus_tag="CAGL0L02695g"
                     /inference="similar to AA sequence:UniProtKB:Q12234"
                     /note="similar to uniprot|Q12234 Saccharomyces cerevisiae
                     YOR216c RUD3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448888.1"
                     /db_xref="GeneID:2890861"
                     /db_xref="GOA:Q6FLK6"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK6"
                     /translation="MAKKKNNKKKAAPAAAPVAEQPAEVSEKEVEVEVPLERLDGAQD
                     SEDDSRLEADKHEQNSEEVGSDKVDNEVEETRNDGAENSNTGNTDENIREELERVKTE
                     RDQVESQYQTLLSRLSSMKTIFSKMKESEAELEVVKEQLQEYENQNLNLKNKVSLLTK
                     EKKELEETATTLNKELESLESEQESNDDKLKESQTRIKELEHQLEAKSEISKSESGRL
                     KKENEQLNSQVQELLVVIDNNKQDLSASKEEIEDLKQNVENLENEKVKLQNAFNDMEL
                     QLDAVEKANKEQLDEKNLEINALRTQLDQAIEAKNAEISKMEELEKKLAAMKQDVTLK
                     EKFEKESKEHASQIAKLRHETIVLNEHLTKALAMLKQSSDSESVDKELISNLLISFVS
                     IPRADPRKFEVLELLSNFLNWDDDQKRQAGLIFTPGQDNNNGSKIPSRTESFVAMWTD
                     FLERESEKK"
     gene            <319856..>320404
                     /locus_tag="CAGL0L02717g"
                     /db_xref="GeneID:2890862"
     mRNA            <319856..>320404
                     /locus_tag="CAGL0L02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448889.1"
                     /db_xref="GeneID:2890862"
     CDS             319856..320404
                     /locus_tag="CAGL0L02717g"
                     /inference="similar to AA sequence:UniProtKB:Q12032"
                     /note="similar to uniprot|Q12032 Saccharomyces cerevisiae
                     YOR215c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448889.1"
                     /db_xref="GeneID:2890862"
                     /db_xref="GOA:Q6FLK5"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /translation="MLRYSYTIAPRLRLVRYNSTIYNNVIGTLKKDLKEAMSTKDALK
                     KTAIKSILSTIKNNEIDAKDKSLLDEYSLHDAFTKMVAQRNDSIKEFIANKRDDLAEK
                     DKQEIEVINKYLKELPVSSAEDLKTKATEYLKQLQESEPNLQLKQLFGKVDWDALTKD
                     WKASQKSIRTTIVSEFKNIFKS"
     gene            <321922..>322611
                     /locus_tag="CAGL0L02739g"
                     /db_xref="GeneID:2890865"
     mRNA            <321922..>322611
                     /locus_tag="CAGL0L02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448890.1"
                     /db_xref="GeneID:2890865"
     CDS             321922..322611
                     /locus_tag="CAGL0L02739g"
                     /inference="similar to AA sequence:UniProtKB:Q99314"
                     /note="similar to uniprot|Q99314 Saccharomyces cerevisiae
                     YOR213c SAS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448890.1"
                     /db_xref="GeneID:2890865"
                     /db_xref="GOA:Q6FLK4"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK4"
                     /translation="MAFCTKSMGDNTIAITLRVKTQQSVLLDQQLEEGELPLRQWRVE
                     VSMLDRNKDEVKADILSSVTYHLHPTFVKPRRKMKTPPFSLEEIGWGEFSMTLMCKFR
                     HNGGVVKIQHELEFSEDAYIIDYSVNVPYLSEGPFYSLLARHFNVIPQNSVPVDNNIK
                     QLPKWVKTLQLQDEDTINELLQRILSNAAVKNFVNKIPRHEEVVFCLGELPDELMNSL
                     TEYMESTGDIK"
     gene            complement(<322823..>324082)
                     /locus_tag="CAGL0L02761g"
                     /db_xref="GeneID:2890864"
     mRNA            complement(<322823..>324082)
                     /locus_tag="CAGL0L02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448891.1"
                     /db_xref="GeneID:2890864"
     CDS             complement(322823..324082)
                     /locus_tag="CAGL0L02761g"
                     /inference="similar to AA sequence:UniProtKB:P18851"
                     /note="similar to uniprot|P18851 Saccharomyces cerevisiae
                     YOR212w STE4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448891.1"
                     /db_xref="GeneID:2890864"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016346"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK3"
                     /translation="MNTIGTGNIISQYLNTSNNSSDELKVVVQEQIEKARNETKDLQN
                     QIEKVKARKQDTNLLEMTASVPAITPGAINLKPVGILKGHTNKIADFRWSRDSKLILS
                     ASQDGFMIVWDSLTGLKRSAIPLDSQWVLTCALSPSGALAASAGLNNNCTIYRMPRGS
                     AVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDIPKAKRVREYSDHLGDV
                     LAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIGSCDSNCLKFFPDGNSV
                     AVGNDDGTISLFDLRADCTIALYSINDRGSPLQKENVFLNSNEYQSSSSSPKSPISLA
                     TNYFEDRGVISLDFSGSGRLMYSCYINLGCQVWDVLKGEVVYSLEGHGNRLAGVKCSP
                     DGMAICTGSWDQTLKLWTPQYEKTKTH"
     gene            <324952..>327627
                     /locus_tag="CAGL0L02783g"
                     /db_xref="GeneID:2890867"
     mRNA            <324952..>327627
                     /locus_tag="CAGL0L02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448892.1"
                     /db_xref="GeneID:2890867"
     CDS             324952..327627
                     /locus_tag="CAGL0L02783g"
                     /note="highly similar to uniprot|P32266 Saccharomyces
                     cerevisiae YOR211c MGM1 dynamin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448892.1"
                     /db_xref="GeneID:2890867"
                     /db_xref="GOA:Q6FLK2"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK2"
                     /translation="MLVRSLGSQVVRRQMGFSVLGGRPVQQLLLRRLFADAQTIGRFG
                     PIQRMVFESIRFHHPKFTPFLIWNSKRNISIIPKIVGKVVRIPVYVGGGMAAAGSYIA
                     YKLEEANTYTKDKLDRLKDFSDAVKDKLGGIWGQEGDGNSGNNNSDGTLPTATLIASL
                     VDEDEEMNKKNRDEQEDDDDDDDEFDEVDNTQDEMLNLTKQMIEIRSILNKVDSASAN
                     LTLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIELTLVNTPNVQETTADF
                     PSLRVYNMKDFREVKRMLTELNLAVPASEAVSEEPIQLTIKSAHVPDLSLVDLPGYIQ
                     VEAADQPMELKSKIRMLCDKYLAEPNIILAISAADVDLANSSALRASKVADPQGLRTI
                     GVITKLDLVSAEEARKILTNRKYPLTMGYVGVITKSPTGSQFPGLFHDNANQGIGGMF
                     GKKKANDDNNINKTEHGIGINQNLSRQFEKSYFKENKRVFTDCQVSTKRLREKLIKIL
                     EISMSNALEPTSTLIQQELDDTSYLFKVEFNDRQLTPKSYLLNNIDVLKLAIKEFQEN
                     FHRNELKSILKASLDQKILDFLASRYWKDDNLVELSNTNDKTNENEMMYWHKKLELAS
                     SGLTKIGIGRMSTMLVTNSILKELDNILQSTQLKNHELIKELVTNTAITVLNSKYYST
                     ADQVENCIKPFKYEIDLDERDWSLAKKHSTQLIKEELRQCTERFEAIKNIVGSKKLQH
                     VMSHLQQDPTKQETLGMSKLLLERGSEALFLDKRAQILNFRLKMLKNKCRSTSDKDKC
                     PEVFLSAVSDKLASTAVLFLNVELLSDFFYNFPIELDKRLNQLGEEQIEMFAKEDPKI
                     SRHIELQKRKELLELALEKIDSILVFKKSYKAKRT"
     gene            complement(<328041..>328253)
                     /locus_tag="CAGL0L02799g"
                     /db_xref="GeneID:9488038"
     mRNA            complement(<328041..>328253)
                     /locus_tag="CAGL0L02799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999541.1"
                     /db_xref="GeneID:9488038"
     CDS             complement(328041..328253)
                     /locus_tag="CAGL0L02799g"
                     /note="highly similar to uniprot|P22139 Saccharomyces
                     cerevisiae YOR210w RPB10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999587.1"
                     /db_xref="GeneID:9488038"
                     /db_xref="GOA:B4UN44"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:B4UN44"
                     /translation="MIVPVRCFSCGKVVGDKWESYLNMLQEDELDEGTALSRLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLEKRD"
     gene            <329039..>330334
                     /locus_tag="CAGL0L02805g"
                     /db_xref="GeneID:2890868"
     mRNA            <329039..>330334
                     /locus_tag="CAGL0L02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448893.1"
                     /db_xref="GeneID:2890868"
     CDS             329039..330334
                     /locus_tag="CAGL0L02805g"
                     /note="highly similar to uniprot|P39683 Saccharomyces
                     cerevisiae YOR209c NPT1 nicotinate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448893.1"
                     /db_xref="GeneID:2890868"
                     /db_xref="GOA:Q6FLK1"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK1"
                     /translation="MSSMTPAITSLLDTDMYKITMHAAVFTNFPDARVVYKFTNRTAQ
                     FHFNKRAVDWIKEQFRLLGDLTFTHDDVEYLAREIPFLPAKYLHYIENGFTLKPDEQI
                     ELDCQEIKGKEDQYDLHILVKGLWIDTILYEIPILALLSEAYFKFVDTDWDYENQLSN
                     AKEKALRLFENNLSFSEFGTRRRRSFKTQDLVMEGIMQAVKENPEKYRPLLLGTSNIL
                     FAKKYGVKPIGTVAHEWIMGIASITGDYPETNRIAMDYWIKTFGKEHAGLALTDTFGT
                     DDFLKSFKPPYSDYYIGVRQDSGDPIKYTEKIAHHFHDVLKLPKFSKFICYSDSLNID
                     KAIEYGKVAEAHGIKSTFGIGTNFTNDFHKKSDPSVKSAPLNIVIKLLEVNGNHSIKI
                     SDNAGKNMGDPDTVKKVKEQLGYVERQWAGGNEAHRSAA"
     gene            complement(<330885..>332939)
                     /locus_tag="CAGL0L02827g"
                     /db_xref="GeneID:2890866"
     mRNA            complement(<330885..>332939)
                     /locus_tag="CAGL0L02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448894.1"
                     /db_xref="GeneID:2890866"
     CDS             complement(330885..332939)
                     /locus_tag="CAGL0L02827g"
                     /inference="similar to AA sequence:UniProtKB:P29461"
                     /note="similar to uniprot|P29461 Saccharomyces cerevisiae
                     YOR208w PTP2 protein-tyrosine-phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448894.1"
                     /db_xref="GeneID:2890866"
                     /db_xref="GOA:Q6FLK0"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FLK0"
                     /translation="MACAVGATVDLSGKPMNTLKYVDGIFSAVSSDPVLVIDLASHSQ
                     SFLMQNKDKSVMKVNLKLPTTLLKRPVYGFAKLIDITLDDERKALLLDLIRHTKTVVF
                     FDNVSSFHRCLMTTYYFIEKFISYVDNSLGTEMVYVLSPSDEVNSIKFSPVETTSKKR
                     RLNLKLEIPKKDVFVSSFKKNSDTTLYTPNSLKTYFQFRIPEMASKECLPQWLKFYSD
                     AKNKDTVLTKIYDNFKLLEVLETKRLERCLNYNNNSSTSLDSDNSQRAGSSKIYSLSH
                     LQKQYKHSKRKKQAKDLKITIPTDVNSSKSTLHSCTSTSSFDTDSDILDTPANNYEIS
                     KGIQSLHRNRYSNILPYEHTRVKLEPSPVSTSPMEFSLSPKRMDQEGADQQLITNYNP
                     YFESEVPICPTIPGSSKYNNKQFNDYFNASYLNLPQINPDFHYIATQAPLPSTVDDFW
                     KVVMTSKVKIIISLNSDDELNMKKWDIYWNSQTCHKYIINITDIIDNVCGLDGCVLRV
                     FNIKKNNDKETKQWTVYQIQYKGWLDSCGVGMKQILTLHKIKAMLSIDPIRLVDELRK
                     GTYDDSHYFEFVSIVDEEIMEKLKCTPVLVHCSAGCGRTGVFITLDFLLNILCERTNK
                     SNKIDVWNASQDLIFIIVNELRRQRVSMVQNLTQYITCYQALLEFFSYRDQKLKSCLH
                     CN"
     gene            <334192..>337593
                     /locus_tag="CAGL0L02849g"
                     /db_xref="GeneID:2890870"
     mRNA            <334192..>337593
                     /locus_tag="CAGL0L02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448895.1"
                     /db_xref="GeneID:2890870"
     CDS             334192..337593
                     /locus_tag="CAGL0L02849g"
                     /note="highly similar to uniprot|P22276 Saccharomyces
                     cerevisiae YOR207c RPC128 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448895.1"
                     /db_xref="GeneID:2890870"
                     /db_xref="GOA:Q6FLJ9"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:Q6FLJ9"
                     /translation="MLHSKDEAFEDLLKPVYKGKKLTDEVNTADDKWNLLPAFLKVKG
                     LVKQHLDSFNYFVDVDLKKIIKANQLILSDVDPEFYLKYVDIRVGQRSGSPHKDQLVP
                     PHECRLRDMTYSAPIYVDIEYTRGRNIIMHKNVEIGRMPIMLRSNKCILHGADEKMMA
                     RLSECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKDIVQASVTSSTHERKSK
                     TYVVTKNGKIYLKHNSIAEEVPIVIVLKAAGIISDLEIMQLVCGNDSSYQDIFSVNLE
                     EAAKLNICTQQQALEYIGAKVKTMRRQKLTILQEGIEAIATTIIAHLTVEALDFREKA
                     LYIATMTRRVVMAMHNPKMVDDRDYVGNKRLELAGQLISLLFEDLFKKFNNDFKLSID
                     KVLKKPNRAMEYDALLSINVHSNNITSGLNRAISTGNWSLKRFKMERAGVTHVLSRLS
                     YISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLVKNLALMTHI
                     TTDDEEEPIRKLCYVLGVEPISLLDSASLHLNYGVYLNGTLIGTTKFPSNFVSRFRFL
                     RRTGKVSEFISIYTNDHHNAVHIATDGGRICRPLIIVKDGKSMVEAEHLKRLLSGELV
                     FDDFLKLGLVEYLDVNEENDSYIALYEKDITHDITHLEIEPFTVLGAVAGLIPYPHHN
                     QSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIELIDYDKLPAG
                     QNATVAVMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTTVLKKYPNHTKDALCGMR
                     VDENGEAIWQHESLGPDGLGEVGLKIRSGQIYINKSVPVQSSDAMAVNQAQYRETPVI
                     YRAPELSIIDQVMMSTSDNDQDLIKVLLRQNRRPELGDKFSSRHGQKGVCGIIVQQED
                     MPFNDQGICPDIIMNPHGFPSRMTVGKMIELISGKAGVLNGSLEYGTCFGGSKLEDMS
                     KILVDQGFNYSGKDMLYSGITGECLQAYIFFGPIYYQKLKHMVLDKMHARARGPRAVL
                     TRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMISSDAFEVDVCSNCGLMGYS
                     GWCSTCKSAEHIIKMTIPYAAKLLFQELLAMNIAPRLRLEDIFQE"
     gene            complement(<337796..>339934)
                     /locus_tag="CAGL0L02871g"
                     /db_xref="GeneID:2890869"
     mRNA            complement(<337796..>339934)
                     /locus_tag="CAGL0L02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448896.1"
                     /db_xref="GeneID:2890869"
     CDS             complement(337796..339934)
                     /locus_tag="CAGL0L02871g"
                     /note="highly similar to uniprot|P39744 Saccharomyces
                     cerevisiae YOR206w RAD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448896.1"
                     /db_xref="GeneID:2890869"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FLJ8"
                     /translation="MGKVSKATKKFQSKHLKDALEQRKKNKIEKKRREGRRGNKTEEE
                     KKAKALTKEEQKMKKSSKDEVFRDMPVDEFFEKGIELPKENKKLKKKQAESKGDSSDE
                     SSSDEEGDINMDELSKNDPEFFKYLEENDKDLLDFAGSNPLDGVDDNEEEEDDNEEQQ
                     IDSDSDIEGKEEERKANQIELTHKLVKQWKTQLRESPSLKLIRNVVSAFKMAINLNRD
                     EDTEEYKYAVTDEKAFQELMFIALKDLPAAVQKLVPYKETKGTRTLPSNKTVTKLSSI
                     IKSHAAALLTFIADITNTESAALALHSVNSLMPYFISYRRILKELIKNIVEVWSTTKD
                     VETQIATFAFLHSASKEFKKAILELVLKTTYSTFIKSCRRTNIRTMPLINFQKNSAAE
                     LFGIDEVVSYQVGFEYIRQLAIHLRNTINSTTKKTSKGNPAEAYKIVYNWQFCHSLDF
                     WSRVLSFSCNPEKEGNHESPLRQLIYPLVQVTLGAARLIPTPQFFPLRFYLIRSMIRM
                     SQNTAVFIPIYPLLSEILSSTAFTRNPKKSQNLVAFDFDHNIKCTAAYLGTRTYQEGL
                     CEQFIDLVGEYLVLYSKSVAFPELATPVVISLRRYAKTSKNIKFNKQLLNIVEKLNQN
                     IRLIEDKRSKIDFGPNNKTEVARFLNELPWEKTPLGAYVVVQREVREEKNKLLRESLE
                     ESEDDKSDDDENVIEKNLDDEDSEDEEMSE"
     gene            <340320..>341900
                     /locus_tag="CAGL0L02893g"
                     /db_xref="GeneID:2890836"
     mRNA            <340320..>341900
                     /locus_tag="CAGL0L02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448897.1"
                     /db_xref="GeneID:2890836"
     CDS             340320..341900
                     /locus_tag="CAGL0L02893g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448897.1"
                     /db_xref="GeneID:2890836"
                     /db_xref="GOA:Q8TFK7"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MRFRRYFSSTFKRLIDCNSCGVKLQNKQPGALGYYTKKDDNLVK
                     KITLEDVKYLIFGQDIQRIKEMTVDTENYDIKLEKPLICKRCSEALHNNKYNATEFKD
                     IPFEEVEKQIPLHSNVVHTAPILEFPFHINSQLLKNRTFNTTMVFTKADRVFKNKKQV
                     QKQIPIFLDAFFETYLNSKATRNIVTSTLNRWNLDTLFSFLHGTNYFVGEPNSGKSTL
                     INALLRRLFGVKIRGNDVKNFELDKQAEEELAVSKKFFLEKQLAGVSHIPNLTRTLQA
                     YKIKQKIIYDLPGYSNYNSYRIDEFIDPKWLQRFRKTSIFSEKRVKKKRYDSIVGNEN
                     GKCLTLGGIFYLVPPPTTINQIVCYIPGELRQFHNTDRGIEVLGKSGSKEHPLNKYCG
                     IKPGIGKEKYIRHIIPPFQGPIEVVLKDIGYFSLTPTGKYEYKGLYELWVLDGIDVCI
                     RKPLERVAEDSYDKSQEGKYYIKEPVVSHTYVVAHNDPNPLQTVKESYEKVKERTDEI
                     LNKYNLEKFGNNMWHFKW"
     gene            complement(<342831..>344684)
                     /locus_tag="CAGL0L02915g"
                     /db_xref="GeneID:2890837"
     mRNA            complement(<342831..>344684)
                     /locus_tag="CAGL0L02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448898.1"
                     /db_xref="GeneID:2890837"
     CDS             complement(342831..344684)
                     /locus_tag="CAGL0L02915g"
                     /note="highly similar to uniprot|P06634 Saccharomyces
                     cerevisiae YOR204w DED1 ATP-dependent RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448898.1"
                     /db_xref="GeneID:2890837"
                     /db_xref="GOA:Q8TFK8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTELAEQVSMPEGQQRRGGYVPPHIRNGGGRRGDSAPRGGFNNG
                     GGRGGFFRNNGDRGGFGFGGRGGGFGGNRGGFGGNRGGFGGGMRGRWVDGKHVPGQRN
                     ERIELELFGAPEDPSFQSSGINFDNYDDIPVEASGEDVPEAITEFTSPPLDSLLLENI
                     KLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSESFLTGPAEKAAN
                     DGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGAPIGNQMREMD
                     HGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPP
                     TGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVENRDKNSA
                     LLDLLAASNDNLTLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRS
                     GRANILVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVATAFFNR
                     DNNNIVKGLYEILEEANQEIPPFLEDCLREVSFSRSGSNRSTRGNRSSNTRDYRKHGG
                     NGSFGQNSRNSSWGSARGGGFGGSTGGWGNDRAGGSAGGWGASNTKTSSWW"
     gene            complement(<345165..>345797)
                     /locus_tag="CAGL0L02937g"
                     /db_xref="GeneID:2890838"
     mRNA            complement(<345165..>345797)
                     /locus_tag="CAGL0L02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448899.1"
                     /db_xref="GeneID:2890838"
     CDS             complement(345165..345797)
                     /locus_tag="CAGL0L02937g"
                     /note="highly similar to uniprot|P06633 Saccharomyces
                     cerevisiae YOR202w HIS3 imidazoleglycerol-phosphate
                     dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448899.1"
                     /db_xref="GeneID:2890838"
                     /db_xref="GOA:Q12578"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /translation="MAFVKRVTQETNIQLALDLDGGSVSVRESILGKEYASGDGQTIH
                     VHTGVGFLDHMLTALAKHGGWSLILECIGDLHIDDHHTVEDCGIALGQAFKEALGSVR
                     GIKRFGHGFAPLDEALSRAVVDFSNRPFAVVELGLKRERIGQLSTEMIPHFLESFATE
                     ARITMHVDCLRGTNDHHRSESAFKALAIAIREARTPTGRDDVPSTKGVLA"
     gene            <346700..>348784
                     /locus_tag="CAGL0L02959g"
                     /db_xref="GeneID:2890839"
     mRNA            <346700..>348784
                     /locus_tag="CAGL0L02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448900.1"
                     /db_xref="GeneID:2890839"
     CDS             346700..348784
                     /locus_tag="CAGL0L02959g"
                     /note="some similarities with uniprot|P47029 Saccharomyces
                     cerevisiae YJL084c or uniprot|P36117 Saccharomyces
                     cerevisiae YKR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448900.1"
                     /db_xref="GeneID:2890839"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:F2Z6E9"
                     /translation="MGVAACTKGDEAGATAPLSPRDKRFDVIDKKANPVIKTNNIRAY
                     VRFVENNVFLQGFKNGQDQLNQKPPVLLRGCLILEVLRPCKLSRIMLTFQGDLELRWP
                     PDMKQNIDAYHEKKSLMTHHWVYFDGENSNNTPVENNEKDDILGRSGAAIYRAPDDTA
                     SSKESGDSIDPELTDSQGPFVFQKGEYVYTFEHPIPHFYPETMHMPHASVKYYMQLRV
                     EKIVGHVIKTKKIMIGSRFINLYRIPPSDQVELGEPIVVDKVWNDKLKYNLIIPRKEL
                     VLNAFLPIHFEFLPLDKLIIHRIRIYLSETITYTATDKSITRIDSEKNYLLSELNGPV
                     QEGTGSSGKKPGVKNLGNLLEDPNTGDITNKAFQFNIFVPSSFTSPKADSTSLKQVLH
                     PDTTFEPIVCKHWLKVALRITVGPKHYEVVIDSPIHVLNPYCAHANTLLPKYDDLVSS
                     SLPVDMTNGSDSHDSNIFYPKEIIHSPILGSETDDVTSNNENKEKRKKVFNSPTLKSN
                     IYRPEFIKTEMTSPQALPMLSLEPDLGSKPPKYSVSNEDMPAYPPSYEQAQVPRVSVG
                     EIPHLNLDDESINNSISSREEDITSNTFQPSIQFRVPDEESNCFLNGRLSRRASMPNS
                     YNQKDAHYLFRRRKLSFDHVTEHSRPRNMEEILAAHAEDASDYEEALESPKVLPTDSS
                     VDIASLLKDQHK"
     gene            complement(<348799..>349506)
                     /locus_tag="CAGL0L02981g"
                     /db_xref="GeneID:2890840"
     mRNA            complement(<348799..>349506)
                     /locus_tag="CAGL0L02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448901.1"
                     /db_xref="GeneID:2890840"
     CDS             complement(348799..349506)
                     /locus_tag="CAGL0L02981g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448901.1"
                     /db_xref="GeneID:2890840"
                     /db_xref="GOA:Q6FLJ3"
                     /db_xref="UniProtKB/TrEMBL:Q6FLJ3"
                     /translation="MSVFKKRKRLGGTNTKQATPELNINVGYEDEDIESNELQPLRVN
                     RLEFRDNDFTDSNDNKSNSDSEYDNLIENMKLANSNYNKDSGTKIKAITDDNDDDDSN
                     AVEDITIDDINMPVTEVDSTNLEDTRLALTDKEKRVEELTRKNEIESGLARLDNRITD
                     WEKKILSQNIGIQDQADIEMPELTISDLDDPIGEHISALSRSQKFLTLQLERLNNERN
                     NLENDINMLIKSISTQQ"
     gene            <349871..>350788
                     /locus_tag="CAGL0L03003g"
                     /db_xref="GeneID:2890841"
     mRNA            <349871..>350788
                     /locus_tag="CAGL0L03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448902.1"
                     /db_xref="GeneID:2890841"
     CDS             349871..350788
                     /locus_tag="CAGL0L03003g"
                     /note="highly similar to uniprot|P14741 Saccharomyces
                     cerevisiae YKR026c GCN3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448902.1"
                     /db_xref="GeneID:2890841"
                     /db_xref="GOA:F2Z6A2"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:F2Z6A2"
                     /translation="MPDFSITDAYLKFLEEDPEMTMPIGAIEALVQLLKVKNPETAAE
                     MINRIKCAAEELIQSIPNSISLRAGCDIFMRFVLRNLHLYGDWESCKQHLIENGQLFV
                     SRAKMSRDKIAEIGVDFISDDDIILVHGFSRAVMSLLTHAANNFIRFRCVVTESRPTE
                     QGRQLYNLLVEKGISVTLVPDSAVGTVIHKVDKVFVGAEGVAESGGIINIVGTYSVGV
                     LAQNARKPFYVVTESHKFVRMFPLSSDDLPLDGEYLDFSPRNSENEDALRGPLIDYTG
                     HEYITALITDLGVLTPSAVSEELIKMWYD"
     gene            complement(<350948..>351673)
                     /locus_tag="CAGL0L03025g"
                     /db_xref="GeneID:2890842"
     mRNA            complement(<350948..>351673)
                     /locus_tag="CAGL0L03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448903.1"
                     /db_xref="GeneID:2890842"
     CDS             complement(350948..351673)
                     /locus_tag="CAGL0L03025g"
                     /inference="similar to AA sequence:UniProtKB:P36121"
                     /note="similar to uniprot|P36121 Saccharomyces cerevisiae
                     YKR025w RPC37 Pol III transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448903.1"
                     /db_xref="GeneID:2890842"
                     /db_xref="GOA:F2Z5X1"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:F2Z5X1"
                     /translation="MSKESLFVDEDMDVDVDMSETSDAEDDPVVKEIPLNLLSKELDL
                     HLLQYVNKPRLLGRKPVEHPFVLASRYKKKSALWELDIPLDEQAFFNKNKTENEWEAA
                     NLQTLRGVGVPNEGQYAAICVDGELYLSKISDVAQMRPTFKYLDSIAQKKKQEENKNN
                     MTAASQRSQVVTMSVKSVSDQSQNRLTGSLLAHKIADEDDYEEYEWTIDQFEQFKNAV
                     IEESQKNILEPQQSTESYISSLV"
     gene            <352032..>354179
                     /locus_tag="CAGL0L03047g"
                     /db_xref="GeneID:2890843"
     mRNA            <352032..>354179
                     /locus_tag="CAGL0L03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448904.1"
                     /db_xref="GeneID:2890843"
     CDS             352032..354179
                     /locus_tag="CAGL0L03047g"
                     /inference="similar to AA sequence:UniProtKB:P36120"
                     /note="similar to uniprot|P36120 Saccharomyces cerevisiae
                     YKR024c DBP7 RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448904.1"
                     /db_xref="GeneID:2890843"
                     /db_xref="GOA:Q8TFL3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSDDESMVLNFSTDTAGIQRADKVTGGRWKDRRKLQQRLGGREP
                     VKRRAEGGDKERGDKRAKVDTGNAQEKKNIPKPVSKADVNINSQIVSSLFTSNRAKQT
                     SENKNKHNSDDKVVPSNAPLTDDSFEGLGVGSLVVSHLENKMRIQKSTSIQKVVIPQI
                     LQNADKTDFFIHAQTGSGKTLAYLLPIFSAILGMGDHIDRKSGCFALIIAPTRELASQ
                     IYHVTTMLANCCHYLVPCLLIGGERKKSEKARLRKGCNFIIGTPGRILDHFQNTKVIK
                     EQMQSSLRYVVLDEGDKLMELGFEETINQIMEIVNSMDVITRKYPKLPNRIVHLLCSA
                     TKNNEVAKLSKRSLDNYKVISIGGKKDTMMDNTSVPDQLLQKVVIAPPKLRLITLAGV
                     LDGIQKKPLDAGSVAKRTIVFLSCADSVDYHFEVFSGNDGLYKNLVGDSVRVLSKGNK
                     ILPSIKDEELPGIICYKLHGSLSQQMRTMTLKHFATDSEQTKGKHLILFCTDVASRGL
                     DLPDVSTVIEFDPPFAVEDHLHRIGRTARAGRSGEALLFLLPGEEEGYLDYIQKYHPK
                     GWDLLDAEKDVLIKAFNDIDVARNDKEIKSTGKTFEWDTNATTWHLNVERRILENEQF
                     KEQATKGYISHVRAYATHISAEKQYFNLKGVHLGHLAKSFGLRDRPKAMGMNSSKDAN
                     GNERSKPKKENAKNKMFRMARMAAKQSADEFNY"
     gene            complement(<354287..>355885)
                     /locus_tag="CAGL0L03069g"
                     /db_xref="GeneID:2890844"
     mRNA            complement(<354287..>355885)
                     /locus_tag="CAGL0L03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448905.1"
                     /db_xref="GeneID:2890844"
     CDS             complement(354287..355885)
                     /locus_tag="CAGL0L03069g"
                     /inference="similar to AA sequence:UniProtKB:P36119"
                     /note="similar to uniprot|P36119 Saccharomyces cerevisiae
                     YKR023w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448905.1"
                     /db_xref="GeneID:2890844"
                     /db_xref="GOA:Q6FLI9"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI9"
                     /translation="MTQQKAIDYAIATIPDILPLEADEIRTLCDQIIKSCNGSPEQIA
                     EGFMGILGQEELVFDFVIRFNELYNEEVSVRKETPSNPNEPSNEATPVRIKTSESKAL
                     ESNIKKSQEIKPTKPATVKSKPIESGSLVSSKLDQVVSKPEKQLNTTQKKNRKVQSLQ
                     EIDEIVKILEVERENKNSDDYACNCQARRHPLFELVPNCLSCGKIICIKEGLHLNNCS
                     FCGEELIPINERLEIMDYLNKEKDEIINRKIVEAPVSRKKKPENSYKISTGMGKNMFE
                     EHDKLMNFIEKQQEREKKRREVLNSNEAENDTPTHATNRDDVDEELQAAQDRLQKLLH
                     YQDTSAERTKIIDNASDFSMSNETSIWGSAKERALLLKKQQRNMKKWEQLEKERNGKR
                     DKYVVSMNINSDGKVTMSEVLKSDQTINAHSDDDLDEISDDEDREDLLNIKQLKSDIN
                     KEKSLNEEAAYNSEWDFEKDQKKFTVPVYYRSENSKNETQADTKLMQDEANNDNQVSN
                     NWKNRVQFEQTEAGSLEQNILAII"
     gene            complement(<356238..>358586)
                     /locus_tag="CAGL0L03091g"
                     /db_xref="GeneID:2890845"
     mRNA            complement(<356238..>358586)
                     /locus_tag="CAGL0L03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448906.1"
                     /db_xref="GeneID:2890845"
     CDS             complement(356238..358586)
                     /locus_tag="CAGL0L03091g"
                     /inference="similar to AA sequence:UniProtKB:P36124"
                     /note="similar to uniprot|P36124 Saccharomyces cerevisiae
                     YKR029c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448906.1"
                     /db_xref="GeneID:2890845"
                     /db_xref="GOA:Q6FLI8"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI8"
                     /translation="MSSNSLLDDASTLLMFSKGKNEKDGTGASDKHREDVLRSPKNLE
                     AANAAAAALAAAATIPLPLKRTRTNSHDGSTSRRSSESDKEVSGEVKKPKLEQGPASE
                     SLEKPVEQPEGTTKRKPDQWPVSESYIVDIDAGIITCVCDFDDDDGFTIQCDHCNRWQ
                     HASCFGIDNIENAPDDFLCDKCDPREIDVEAANIRQKQQRGLLEKKKESAKPSNRRDS
                     GKKRNSASQETFDELESTTSREDSKSNDINKDKKRRNDSKQETVTGGKSETAIEPAPY
                     VPPNDVQFKKEFLLTPKDAYSATYVHSDENEYKDKYVKLFIDKHCDDDWVIQYNKKTL
                     KTVPIEVKSYSESSYARTFPAHTKLGVFTKEYCNNGDLIEEFTGQVDFLKTYLDDTKN
                     HYRIWGTAKNRVIFHPHWPLYIDARSKGNLTRFLRRGCKPNVELVTVCLPSAGEEKDI
                     KFILRATRDIDEGEELLIDWKWDLRHPIRNFISGATTLDSMNDTDKYSIIHSVETIMS
                     ACDCGCGTNSKECYLLKVKRYSQGLYKSVKSKIKMNNRYKLNQILNQYQGKKRRQMPI
                     TTRLIDDAIRQKYKAPLILDSYHEEKKLQQLLKSNSGSKSVISPEKAALIQKSIATIN
                     QSINSVVSLKPYKYNLVKGQIDVATTKMPSPLAQSHGPSDFIKNTSAEEAIVLITKIT
                     DYDESKVNNITDLPIPVQIPIAKVEKATEMVTDPHNKPVLHENKSNSTTTSEVSLDAR
                     ESDNAPKEIKHDYSTTESSTVANSSNLKKKLSFADYRKKLQK"
     gene            <360022..>360777
                     /locus_tag="CAGL0L03113g"
                     /db_xref="GeneID:2890846"
     mRNA            <360022..>360777
                     /locus_tag="CAGL0L03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448907.1"
                     /db_xref="GeneID:2890846"
     CDS             360022..360777
                     /locus_tag="CAGL0L03113g"
                     /inference="similar to AA sequence:UniProtKB:P36125"
                     /note="similar to uniprot|P36125 Saccharomyces cerevisiae
                     YKR030w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448907.1"
                     /db_xref="GeneID:2890846"
                     /db_xref="GOA:Q6FLI7"
                     /db_xref="InterPro:IPR007881"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI7"
                     /translation="MSVLPTSNAGHKDGLGERAYKLNIHDRTLPPVLGSLFKAPGNLD
                     FETAMWEMVNLILKPRKTFRAIYYQRQTKNQWARDDPSFFILEILLISISSVFWSLFY
                     YNHSLWKCLQSIFNLIFVHFFLFGFATATFFWITLNQPRFKFKSASSSNIEWAYCFDV
                     HCNAFLVILVALYYLRFLLLPLKFLGVLVPNTLFCASTIHYFILTFYGYSQLPFLKNI
                     SFILFPTIVLCILFVVGLFGVDIAALFGFGSYT"
     gene            complement(<361122..>365954)
                     /locus_tag="CAGL0L03135g"
                     /db_xref="GeneID:2890847"
     mRNA            complement(<361122..>365954)
                     /locus_tag="CAGL0L03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448908.1"
                     /db_xref="GeneID:2890847"
     CDS             complement(361122..365954)
                     /locus_tag="CAGL0L03135g"
                     /inference="similar to AA sequence:UniProtKB:P36126"
                     /note="similar to uniprot|P36126 Saccharomyces cerevisiae
                     YKR031c SPO14 phospholipase D"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448908.1"
                     /db_xref="GeneID:2890847"
                     /db_xref="GOA:Q6FLI6"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR015679"
                     /db_xref="InterPro:IPR016555"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI6"
                     /translation="MQEVVPGVIDRRHTDMGVMHTPAGPGTRTGEDGLYDVRSVGSSV
                     VSDPEARAKNLAFQGIPNSIKRMHQGRDVTPASMDHSEPAHQHGHRPTPMAGFDTDKT
                     GASRDRQFNGWRQEFNSTFKRISVISKLKVRSFNGFRTPPAFSRRQSAVQQGNNDDAD
                     DESNKITQSLASDLLDSLLAGCPAALFASSQFLRDEHGKRRASLLLAMLNVRVLPVND
                     SSINAFKNGMTTSTMASLSSSSNSSFAENFYEKNDLTVFKIELEYGVGENRLKWTIYK
                     SYKELLQLHHKLKLLAFQQNTINKIYIDQNRYHKFRIPNFPHLKYNEKNQIKHDIKHS
                     YKHGKKRELADRDLSLSPASSLFDDNRSILDSLRSSMSFDVNKVKMKHLKELMEEGDD
                     ESQEHHKRIERYLYLLNIALCLRPQSNRLFQFYECSPIGNLLGYENGYAGKQGFLVIR
                     STAKSQGWRVSHFNPHDFKEMIERHTAKWFLVRHSYITYVSDLGSTTPLDVFLVDSKF
                     KLMIAGNKNNIIDDVEDEIKYRPGSRKEKRTLKDDISSKLMLITLENSERKLKMICKS
                     ESGFKQWVHSISHMAKSTVWSQPHRFDSFAPVRKNAYCKFLIDGRDYFWALSDALRMA
                     EDVIYIHDWWLSPELYLRRPIKGNQEYRIDRLLKERAEYGVKIFIVVYRNVGTTVGTD
                     SSWTKHSMLNLHPNIHLIRSPNQWLQNTYFWAHHEKFVVIDNAVAFMGGIDLCFGRYD
                     TPEHVLRDDDPELINQIFPGKDYSNARVRDFYDLEKPFENMYDRKDVPRMPWHDVHML
                     TCGEPARDLARHFVQRWNYLLREKRPSRATPLLTPAGDFSKGELEGLPLFQYLKDRST
                     CEVQVLRSAGSWSLGLKQTEHSIQNAYLKLIETSEHFIYIENQFFITSSSWDGVVIEN
                     KIGDAIVDRIIRANTEGKPWKAMIVIPLMPGFDSPIDEPEASSLRLIMQCQYQSISRG
                     QTSIFSRLRKLNIEPFDYIQFFSLRKWSTNGENDKLVTEQLYVHAKLLITDDRNVIIG
                     SANINERSQLGSRDSEVAMVVRDTDLVKTKMNDKEYYAGRFAWELRQRLMREHLGCDV
                     DLVEIVERKFNRLEHLAQKNFDTLHTLNEGKKYKRSEKLSSAMIELAYREIFEADCSP
                     LWFDKYKTSEEKIVTNYGLMSQINEEEDAAFDSELYQSFEFSDIGKESLGLNSATTKF
                     SKLNKYHSFNHRAGEDNKGIRDRKAISTDPRIVNNSEHKADVEGYGADKWRTKDFIDH
                     KLSVTEQLHEWSKRAIETKIIDNKKKVKRMQQLPDRQTVEIYLSDPKIDCASKFDMLK
                     RIYYLQHVSYKESKSEKERENFIKKNSRPSSKDSKATNNSTSFEDEELDDESLDILLY
                     QILPDFGNSEKCESFKNVLDYKFIDPYSFEDPLSSQFYDELWLAVALRNTLLFRLVFH
                     CQPDNAVQTWRDYKEFAKLYIDFDNKQGKYVSDQAGLEGAEEEMVDREETIPPELALQ
                     RTMSVTVKKGEKLGDIDFPESINDLAENAEEKFGRKLMEKQTLNSKGNRMTLKMKMYA
                     SSVNGSNQRIFDKVTARRILERIRGHLVLFPTEWLCREVESKNWFYHADRLPPIDIYD
                     "
     gene            <367003..>367563
                     /locus_tag="CAGL0L03157g"
                     /db_xref="GeneID:2890848"
     mRNA            <367003..>367563
                     /locus_tag="CAGL0L03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448909.1"
                     /db_xref="GeneID:2890848"
     CDS             367003..367563
                     /locus_tag="CAGL0L03157g"
                     /note="some similarities with uniprot|P42944 Saccharomyces
                     cerevisiae YJL110c GZF3 transcriptional repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448909.1"
                     /db_xref="GeneID:2890848"
                     /db_xref="GOA:Q6FLI5"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI5"
                     /translation="MIISDKLEDTDTEVSCRSTPTPIPQCKNCLTSHTPLWRRDKDGS
                     MLCNACGLFQKMHGRARPISLKTDQIRHRNRKKKAISVMKIRPEPLLPHGQLISLSSD
                     INCSTTTTIPVSDIPWISKGAPIRNPSPRQRPHHNNLQDEEFVIKLKTRVNELESITR
                     LYKNHITRLEQRCQILESKLYELVYH"
     gene            <368034..>368645
                     /locus_tag="CAGL0L03179g"
                     /db_xref="GeneID:2890849"
     mRNA            <368034..>368645
                     /locus_tag="CAGL0L03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448910.1"
                     /db_xref="GeneID:2890849"
     CDS             368034..368645
                     /locus_tag="CAGL0L03179g"
                     /note="highly similar to uniprot|P69771 Saccharomyces
                     cerevisiae YKR035wa DID2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448910.1"
                     /db_xref="GeneID:2890849"
                     /db_xref="GOA:Q6FLI4"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI4"
                     /translation="MSRNPAAGLENTLFQLKFTSKQLQKQAAKASKEEKQETNKLKKA
                     LNENEEIARIYASNAIRKKNERLQLLKLASRVDSVASRVQTAVTMRQVSSSMAQVCKG
                     MDKALQNMNLQQITMIMEKFEQQFEDLDTSVNVYEDMGVASDAVLVDNDKVDELMGKV
                     ADENGMELKQSARLENIPDIKQKETVDDEKEDKLAERLRALRG"
     gene            complement(<368792..>370531)
                     /locus_tag="CAGL0L03201g"
                     /db_xref="GeneID:2890850"
     mRNA            complement(<368792..>370531)
                     /locus_tag="CAGL0L03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448911.1"
                     /db_xref="GeneID:2890850"
     CDS             complement(368792..370531)
                     /locus_tag="CAGL0L03201g"
                     /note="some similarities with uniprot|P47025 Saccharomyces
                     cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
                     cerevisiae YKR036c CAF4 CCR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448911.1"
                     /db_xref="GeneID:2890850"
                     /db_xref="GOA:Q6FLI3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MVNIVEKQNRLSLISLSLVSIRYKSWDFLYRILHGSIFDYIIGP
                     RKELLLYFKCVYDSTFFNGKNYFSNLFTDTATSFRLLTFLNEHDLKSIPPLPLDKCQG
                     LDSYSTLYDGYIVQSSHESQGLYDGSGKDGNDYTMKMQIMKNVLEMQINEMDDEIKRI
                     KLRRNVVAKKLDVIISRIVDHKENKSKTDGSTEDEVHIGNTSSVLKQTNHEHTIITSE
                     NNTDDKVSLLTLEPDNAQIGNKLQRYFEAMKLKKKSSGFDIEDFENIIGTKGQLGKTL
                     KCHDDYINSLAINAQLGVLSSTANLDNEIKLWDISTTQCLGVLSGHRATVNTTRFIDD
                     TRLLASAGKDASVKVWDVDNIVDKDGNANDNLCLATFDGHKDSVTALATTGNAIVSGS
                     NDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCIDNALVT
                     GTKDGIVYLWDLRIGRVVGSLEGHRGPITSLKYMGSELITGSMDKSTRIWDLRMGSVA
                     ELLSFEKEVVSVEESQTQLINALEGEPVKIYDRGERQYNSLPDSFNTTTLVVYESLLA
                     LGNDHGDITWWSL"
     gene            complement(<370778..>371701)
                     /locus_tag="CAGL0L03223g"
                     /db_xref="GeneID:2890851"
     mRNA            complement(<370778..>371701)
                     /locus_tag="CAGL0L03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448912.1"
                     /db_xref="GeneID:2890851"
     CDS             complement(370778..371701)
                     /locus_tag="CAGL0L03223g"
                     /inference="similar to AA sequence:UniProtKB:P36131"
                     /note="similar to uniprot|P36131 Saccharomyces cerevisiae
                     YKR037c SPC34 spindle pole body protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448912.1"
                     /db_xref="GeneID:2890851"
                     /db_xref="GOA:Q6FLI2"
                     /db_xref="InterPro:IPR013966"
                     /translation="MGESMNSCLEEINGCLDSITSLYFKPPGIFHNAMIRISKDGKET
                     HTLNDKIKNLIKGCDPKEETTLFQLDPVTKSLRRKDGRQALFDYLDKRDLNMKRNRRL
                     GHKDEKPVIHVPNEFYIREHDEELLRDSQRTKRFKAAGHGNDIDSNNTNNTTTALITE
                     LFNDDVGLMATMRKKFKENDEIKNLLMALQKGSVILDEKEGISTNNRRRTLFVEDFST
                     ESILKLLDAVLEMFPTEEYKKAAEQYHDVFQELNEESEKLLAEIQLQKDEIEGRLKIE
                     SSKDSTTGVQKLIEKERQKIAELESQLRISN"
     gene            complement(<371999..>373120)
                     /locus_tag="CAGL0L03245g"
                     /db_xref="GeneID:2890852"
     mRNA            complement(<371999..>373120)
                     /locus_tag="CAGL0L03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448913.1"
                     /db_xref="GeneID:2890852"
     CDS             complement(371999..373120)
                     /locus_tag="CAGL0L03245g"
                     /note="highly similar to uniprot|P36132 Saccharomyces
                     cerevisiae YKR038c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448913.1"
                     /db_xref="GeneID:2890852"
                     /db_xref="GOA:Q6FLI1"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /translation="MVDLNGISPKNKGYYVALGLEGSANKLGVGVIKQFVDGSPTEIV
                     SNIRDTYITPPGEGFLPRDTARHHKNWCVRLVKRALAEAGVTPGQLDAICFTKGPGMG
                     APLHSVVIVARTVSLLWDVPLVPVNHCIGHIEMGREITGAQNPVVLYVSGGNTQVIAY
                     SNQKYRIFGETLDIAIGNCLDRFARTLKIPNDPSPGYNIEQMALKCKNKERLVELPYT
                     VKGMDLSLSGILAYIDSLAKDLFRKNYSNKLLFDKKTHEQLVTVEDLCYALQETLFSM
                     LVEITERAMAHVNSAHVLIVGGVGCNLRLQEMMEQMCMDRANGHVYATDERFCIDNGV
                     MIAQAGLLQYRMGDYVKDFKETVVTQKFRTDEVLVSWRD"
     gene            <374784..>376577
                     /locus_tag="CAGL0L03267g"
                     /db_xref="GeneID:2890725"
     mRNA            <374784..>376577
                     /locus_tag="CAGL0L03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448914.1"
                     /db_xref="GeneID:2890725"
     CDS             374784..376577
                     /locus_tag="CAGL0L03267g"
                     /note="highly similar to uniprot|P19145 Saccharomyces
                     cerevisiae YKR039w GAP1 general amino acid permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448914.1"
                     /db_xref="GeneID:2890725"
                     /db_xref="GOA:Q6FLI0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FLI0"
                     /translation="MSSLEKTDLPKNELQIDSEFLREEPLEISNFEESSSSQGPQPSG
                     SRWRKFKDSFKPLDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTG
                     LFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGELSVVFPISGGFTTYATRFIDE
                     SFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRDGFVALFWVVIVIINLFGV
                     KGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGAR
                     FQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVG
                     LLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGC
                     SRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLAL
                     SGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQ
                     FYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRRE
                     MDLDVLRQEIAEEKQMMSTRPWWYRWYSFWC"
     gene            <378830..>379930
                     /locus_tag="CAGL0L03289g"
                     /db_xref="GeneID:2890726"
     mRNA            <378830..>379930
                     /locus_tag="CAGL0L03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448915.1"
                     /db_xref="GeneID:2890726"
     CDS             378830..379930
                     /locus_tag="CAGL0L03289g"
                     /inference="similar to AA sequence:UniProtKB:P46955"
                     /note="similar to uniprot|P46955 Saccharomyces cerevisiae
                     YJL116c NCA3 or uniprot|P36135 Saccharomyces cerevisiae
                     YKR042w UTH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448915.1"
                     /db_xref="GeneID:2890726"
                     /db_xref="GOA:Q6FLH9"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH9"
                     /translation="MKFVSAILMASAVLAAPAVQHQDKHAHEKRDLVVVTEYVDQDGN
                     IFTPTEVVNDAPAATPTPAPAAAPSSAAPAAPAASPAKDTTTLAPSSSKQQASQPTTG
                     SSFTGGAFQDGTIPCSQFPSGNGVVALDWLNMGGWASIMDLNGNTASSCQEGFYCSYA
                     CESGMSKTQWPSNQPADGRSVGGLYCKGGFLYRANTNANTLCEQDAGTAFAENQVGQS
                     IAICRTDYPGSENMVIPTVVGAGSTQPISVVKEDSYYQWKGMKTSAQFYVNNAGVSVE
                     NGCIWGNEGSGVGNWAPVVLGAGETNGITYLSIIPNPNNRTPPNFNVKIVATDGSSVN
                     GACKYENGVYSGSGSDGCTVSVTSGSAKFVFY"
     gene            complement(<380669..>381508)
                     /locus_tag="CAGL0L03311g"
                     /db_xref="GeneID:2890727"
     mRNA            complement(<380669..>381508)
                     /locus_tag="CAGL0L03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448916.1"
                     /db_xref="GeneID:2890727"
     CDS             complement(380669..381508)
                     /locus_tag="CAGL0L03311g"
                     /note="highly similar to uniprot|P36136 Saccharomyces
                     cerevisiae YKR043c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448916.1"
                     /db_xref="GeneID:2890727"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH8"
                     /translation="MGHSPTPRCIIVRHGQTEWSKSGQYTGLTDLPLTDYGVGQMLRT
                     GESIFSNNRFINPDHITYIFTSPRTRAKQTIELVLKPLSEEQRSKIKVIVDNDLREWE
                     YGDYEGLLTKEIVELRKSRGLDKARPWNIWRDGCENGETTEEVGLRLSRVIARIQNLH
                     KKHQEQGIPSDIMVFAHGHALRYFAAIWLRLGEEKECITAFSKQKVKSYEEDESVVPY
                     VEITKFRHLVDNPFFLLDAGGIGVLSYAHHSIDEPALDLAGAFISPPEEESQHAPVPN
                     KNY"
     gene            <381919..>383271
                     /locus_tag="CAGL0L03333g"
                     /db_xref="GeneID:2890728"
     mRNA            <381919..>383271
                     /locus_tag="CAGL0L03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448917.1"
                     /db_xref="GeneID:2890728"
     CDS             381919..383271
                     /locus_tag="CAGL0L03333g"
                     /inference="similar to AA sequence:UniProtKB:P36137"
                     /note="similar to uniprot|P36137 Saccharomyces cerevisiae
                     YKR044w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448917.1"
                     /db_xref="GeneID:2890728"
                     /db_xref="GOA:Q6FLH7"
                     /db_xref="InterPro:IPR001220"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH7"
                     /translation="MIAGGKSNVLVVVLICVLFGTFQLLMGTGELHSGGMGSVVRPEP
                     ENHRSNDRVRVKKVFNPDASLSVPFLDKINKYWHIGGTAEVRNMKSIMLTSAGQSGKH
                     GVVLSNGIGDNTITDFEIVVDFRIYGREQRQSSHIGDGMAIVITPENGFLVRDLVSSF
                     SRKQYEINSGGVHAKNVDLMGLPNNLPGLALVFDTYKNNYRTDVEIPYLDLILNTDPQ
                     KDMYSVNTDNLESTSKKLTPKHIKLHPSTIKGDITKLRIIYSETIGFLKVDIQYQKEG
                     DYWIELYQSNEKIYLPKNKSSGQRFIGISALTGDATENVEILGVSTNEYHWNSNEREI
                     QDSTTNDNLPRSYEYAQALKNYLLNEFGHRIALEKDDYTRWKMKMAQPNYENDLNDRV
                     ENQHVNNNKHQSKSSSRYIILLLFLVLIYISSVYIRVTKKHLRRLKRRRATSQTLLPT
                     "
     gene            complement(<383517..>384464)
                     /locus_tag="CAGL0L03355g"
                     /db_xref="GeneID:2890729"
     mRNA            complement(<383517..>384464)
                     /locus_tag="CAGL0L03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448918.1"
                     /db_xref="GeneID:2890729"
     CDS             complement(383517..384464)
                     /locus_tag="CAGL0L03355g"
                     /note="some similarities with uniprot|P36138 Saccharomyces
                     cerevisiae YKR045c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448918.1"
                     /db_xref="GeneID:2890729"
                     /db_xref="GOA:Q6FLH6"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH6"
                     /translation="MSHRNQSIGGNDHSFQGKTRKISGWVKRIIQPGRESNPVANNTT
                     LQLPVTNHRSNSNPNTNTNQQSQHMLKGDKHIGIDLTKSEKRLKERQRKVYDPTDEYN
                     ASLYQKNASFHRSAKKSSSKSRIVRSRADSAPESLPASRSLSNYLMPLSPSLSCDSDR
                     VTISSSLMPLFANDSDSDNDSTCRSPRPRSKYSLLSKEQHAESIVSDHEMDLSSMAPL
                     VSVCSSSVKSSTFSDIHSIQSTRPTVFSSRTQETNSSTMAIPPASILDRARQSTLTMN
                     TGVNTVSTVASGNTRPPQRLLARRDSGHTLNSILTIKSN"
     gene            complement(<384929..>388558)
                     /locus_tag="CAGL0L03377g"
                     /db_xref="GeneID:2890730"
     mRNA            complement(<384929..>388558)
                     /locus_tag="CAGL0L03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448919.1"
                     /db_xref="GeneID:2890730"
     CDS             complement(384929..388558)
                     /locus_tag="CAGL0L03377g"
                     /note="some similarities with uniprot|P46954 Saccharomyces
                     cerevisiae YJL089w SIP4 interacts with SNF1 protein
                     kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448919.1"
                     /db_xref="GeneID:2890730"
                     /db_xref="GOA:Q6FLH5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH5"
                     /translation="MESKRKYGKPQPPGELVLTRTKKRHSQACDRCRSKKIKCDGLQP
                     CSNCAKIGYNCVTSDKLSRRGLPKGYTDLLECEVVKLQKIVNEIAGYETLDRNEFKSI
                     LKTNDYLDKVKHLLAEESDGDGDGDGDGDGNGKVENYGDGSQREFGELAVLEDHSTKE
                     NSFSMGKNSNEGSTSPQGHNNDSSSAGTELTQGRDEIGQLAFINDTFYYYKNFFYITP
                     TQDTFSNNLSNNYLGHGTWHLLNGNIHPTGKDTKKKQDNNKLIDTSFIHDSTWLREFQ
                     IDTMVEILQLNSQYLLPQFLLVKYKYNMNQIKELLVLAIEQFFKSQSSLIPLLYPQAI
                     WKEKLTQQVILSISNLSTGYTNTLSTNPMASPVLEKKIGLVDNNPIILLTLIYIIQTN
                     WSCIDDYKLYQLSKLIFSTSPKNLTTFQSLLVATFYFMGSCDMKQNWYQEVMHEKTTE
                     EKRKGKSANSNKKNLKLSSNLWATELLHLSYTFALDMGLFINYTNLIPLCFDNRLLPT
                     KQRGNQTATSQLFDIADIEDYTDKIVVAFWCFQFLDSWWSLMQGLPKSNFLMNEFHPK
                     DVKSLKKPELKVFSLILEFVLAFDGCNLLHTLSNGGRLKLAETTGAFRNILDKWKLYH
                     SIKDHEELHESQLMQADHYSNLDIFLTKSDIVEIQLTLYYLILALFSDTRMITRKESD
                     QFEYAQTFTSDIASDNKKDFNFIESYPTEEISYEILSLYFLLLLNKDIIEQPQQFNVL
                     HILPCDSLDLIKLCLNNLHQWSVSPQHPNETSEQSNWKFNKYKTLLSQWCQLWYIDES
                     QDSLLKKILVSFKIKLQKPGDFNDSNFSLQKIKYFTEVVNFNAITRTNLVRSNSNANM
                     DQFNLFENINTDSRLMSPLLNSSIRLPLLQESKSFSNVNTQGVGEDLGLAINATDLNS
                     SNFLNLGFQNPMGSINLQRNKNQAAEEQDDTDDGYAEDDDDDDEEGNNAPLEFKTRRR
                     PSLFQQKHNQPPVFNKYRQEIDKTKQVSFANGNPSSTFKSVPAGNKRKIDHIILDENS
                     LEKNTKRQNRINETDRKATFPDSNNTQKPLISPSRLLTDGYDKSGNSSQTVLPPISYY
                     SNPQGMEPNEPKTYLNQITDMVRSSNNDLSMVPSQSNSTVLTRINSNSNTSSKKLLET
                     PRTFLNMFLLNTTPQGNDKPLSVDDRLSKPNSDINLLEQSKKLASTSSLTSTFIEAGA
                     SPDKL"
     gene            <388777..>389391
                     /locus_tag="CAGL0L03388g"
                     /db_xref="GeneID:2890731"
     mRNA            <388777..>389391
                     /locus_tag="CAGL0L03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448920.1"
                     /db_xref="GeneID:2890731"
     CDS             388777..389391
                     /locus_tag="CAGL0L03388g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448920.1"
                     /db_xref="GeneID:2890731"
                     /db_xref="GOA:Q6FLH4"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH4"
                     /translation="MYGVFSVRVRGTNSNTLNMSTSRNPQDYRNTGRLRNTCRSSPLL
                     LEKSDISVTCPVYLFLLMLSTPPVRNWRRCPPLRAGSHVPLLGFRDVSPRAPGRMETV
                     CYETVIFPVWAASFVSGREPPTHNPQAIENETGIMAHPPSTPCYSRVMTCVVHCIRWY
                     HMLYMCSFHMFHHMTSRLHVPHRVLSFGVFHSIVNILHHDYAPS"
     gene            <389484..>391679
                     /locus_tag="CAGL0L03410g"
                     /db_xref="GeneID:2890732"
     mRNA            <389484..>391679
                     /locus_tag="CAGL0L03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448921.1"
                     /db_xref="GeneID:2890732"
     CDS             389484..391679
                     /locus_tag="CAGL0L03410g"
                     /inference="similar to AA sequence:UniProtKB:P47027"
                     /note="similar to uniprot|P47027 Saccharomyces cerevisiae
                     YJL090c DPB11 involved in DNA replication and S-phase
                     checkpoint"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448921.1"
                     /db_xref="GeneID:2890732"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH3"
                     /translation="MRPFARITFCCTGLDEQLFKSISKKVLKLGGLLSYDLTSQVNVL
                     IVGDLHRRTDKYEFAVRNRPDIVFLDCNAILELYHLWLAGEDVAHSNDSGMAHVDQSV
                     RMLDILAKRYTLGPLTDYVIFIGRIRNDTLTNVPQLEEFCSAMNCCKCISKHFMSDSK
                     RKFAGKQVVFITDEPNGVRVDAARKENIPVIHYKWILDCYKRNATLQYDPYYLLEFAM
                     HIEDIKEIGRDSCDCWDDLDDPAQNRLVYEDEEDRMTQRKSISKRLKPHGDKLWQKVM
                     SSKDSKDQEISSINENEPNSAPLHNLEADISQSDVKDGGIFHGLAFIINDAFKIDHRK
                     ILEKVITQHGGNITYDIQDEGAYRYLELVPSHIPIEDIIINKNIGIDSTVTEFFIERC
                     LHYKKQLLPIDSWSSPYLYSTKFKILASNRSNKEFVISITGFSGVELLHLVKMLKALG
                     NFGIKYSEYLDKKTDLLLVNLAVLTSITKDHSLWNNQYHDLFLQNSESITQINQIFRN
                     SLKRKIQFIKEEHCIPMATPAFIIDIFRKAKDLYYNPTTIDHTIHLNNIQWLVLSRKG
                     KKTEFEFKVVRSSIPIDQRKALVDKSVLSSVEQAEKSSDINQRLLKRSASELLQKFKE
                     KPELSPSKSDFTHKRVRLNVIPPEIEQRKSSLGDKIPNLKKVDIQPVIRTTSWGSILA
                     EGHDMQRKELTELPSDDMNRNNNRNPIDQTQVTYGSVSATSSTNTTSHK"
     gene            <392060..>393520
                     /locus_tag="CAGL0L03432g"
                     /db_xref="GeneID:2890733"
     mRNA            <392060..>393520
                     /locus_tag="CAGL0L03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448922.1"
                     /db_xref="GeneID:2890733"
     CDS             392060..393520
                     /locus_tag="CAGL0L03432g"
                     /inference="similar to AA sequence:UniProtKB:P47026"
                     /note="similar to uniprot|P47026 Saccharomyces cerevisiae
                     YJL091c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448922.1"
                     /db_xref="GeneID:2890733"
                     /db_xref="GOA:Q6FLH2"
                     /db_xref="InterPro:IPR009447"
                     /translation="MSSLKERKEAFVSGLEGGSILEINVVTSIALTSYLCANLISYND
                     TQNIPLGIDFVLNWVAMLLSFTLYSQDIYLLTTLCLIPSIGWFLLNYKRNLKQSKNTV
                     KHTTKEAVQKFELTKKPFLTAYRSGMLILTCLAILAVDFQIFPRRFAKVETWGTSLMD
                     LGVGSFVFSNGIVSSRGLFREKMKDKKDKASSIKKIFAATRSGTTLLILGLSRLFFVK
                     NLEYQEHVTEYGVHWNFFITLSLLPPVLVLIDPITSYIPQCILAMLFSTVYQLFLIKD
                     DSLLTYLVLSDRNTFINANREGLISFVGYCSIFLWGQTIGFFILGNKKTTNNLYKCSV
                     TVSRDKKNRTLWDRLTTVGPSLGLLIWFIITYALSEGLYLIHPQTVSRRFANMPYVLW
                     VVCYNTAFLLCYSLVDKLFGNSSNFYRISTLLEAMNCNGLAMFLISNVSTGLVNMCIP
                     TIDQNDKVSIVILLIYAAFLAMVSFSLYKHKIFIKL"
     gene            complement(<393600..>396866)
                     /locus_tag="CAGL0L03454g"
                     /db_xref="GeneID:2890734"
     mRNA            complement(<393600..>396866)
                     /locus_tag="CAGL0L03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448923.1"
                     /db_xref="GeneID:2890734"
     CDS             complement(393600..396866)
                     /locus_tag="CAGL0L03454g"
                     /inference="similar to AA sequence:UniProtKB:P12954"
                     /note="similar to uniprot|P12954 Saccharomyces cerevisiae
                     YJL092w HPR5 ATP-dependent DNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448923.1"
                     /db_xref="GeneID:2890734"
                     /db_xref="GOA:Q6FLH1"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH1"
                     /translation="MNDSLDRDYKSHRVRDILGGLNQQQRAAVTFDPTKALQVIAGPG
                     TGKTKVLTSRVAYLILHYRIDPRDIIVTTFTNKAAKEMKDRLAVLLENTEFRSSDIMI
                     GTFHSICLKILARFGSRVGLQEGWRIVDEKEIEVIMTKMIENMPDQIRDYAHSTTRKV
                     NLCLPKRDSKSDSKNKSSGPNDSPDWDVHQKLIKKHISRLKSSAILPQEYKDDSAHDS
                     ALSHFYELYQDELFKLNALDFDDLLMFTFRLLTAERCLPFVQHVFVDEFQDTNSIQID
                     LMFLLARGNHHISRGITVVGDPDQSIYAFRYALAHNFQEMSNKCPLECSRVILVENYR
                     SSQKILDTSETLIKQQQKGREQRLPLKAQFTSHILPVYMNFPAYFLEAPSIAREILYL
                     KSLPNLFSYDSFAILVRKRRQIRMIEKSLIEYRIPYQILRGRAFWELKEIMAMLNIFR
                     IMVSENDEEAIISSLSYPSRGFGDTSAERLREIFAKYTDKTKLEILNLIAIGRVYVDI
                     PKSARGVVSGLCKLVEECNKENGQELSVRLVKVFDLIYEKSGLKHEFLFKDGKKKGEI
                     DIDGDPNLENPRHKNIQLLRSYFVDTEENQDDSMINQENTALSSINTTKSHGISLADY
                     ILQFLNSLSLFAGEKTVATTDDGNKGTLGTVTVCTIHGSKGLEWPVVFIPGCEDNNIP
                     AIFSDDKDNTSDNEEEGDGDNKEELTNKKSQNNNVEESIDEERRMFFVAQTRAKYLLY
                     LSSVTDMDAAVPRVPSRFLTQELLKTTAPFQKALVDFSGLKKLYNLVGVQFPTNTKNF
                     SLSQLIKDYKAYIDARREKFYWGGNIFRLGMNLDLAKNVHDMTSLRNEFTTASEHLKA
                     TGEWDKHVNKMVNNDAKKKTKTDIMSKMKQIKKADDISSNSLDAETVQNTAIDHSLSL
                     NSNIRTERGYGKTTSNNHHVKVEEQDSRNSGVTSIHDNAARVIPSNQTTCLKRSREVV
                     RKRLIKSEPIDIVSKESKYTEVIKLEDNDYKGDEVTNKTASELLHNPSELKIDNRPII
                     ASAKILADAARKSSKLPVKQEGIGVKKEMPILQDDIFSQLNRAKKKAKLNDSDIIVID
                     "
     gene            <397339..>399729
                     /locus_tag="CAGL0L03476g"
                     /db_xref="GeneID:2890735"
     mRNA            <397339..>399729
                     /locus_tag="CAGL0L03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448924.1"
                     /db_xref="GeneID:2890735"
     CDS             397339..399729
                     /locus_tag="CAGL0L03476g"
                     /inference="similar to AA sequence:UniProtKB:P40310"
                     /note="similar to uniprot|P40310 Saccharomyces cerevisiae
                     YJL093c TOK1 outward-rectifier potassium channel"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448924.1"
                     /db_xref="GeneID:2890735"
                     /db_xref="GOA:Q6FLH0"
                     /db_xref="InterPro:IPR003280"
                     /db_xref="InterPro:IPR013099"
                     /db_xref="UniProtKB/TrEMBL:Q6FLH0"
                     /translation="MARHGIEREDSVTSELARLERIFSHHRINHDTVLKDALQFSNER
                     VTIINANPASKEFGFWFIVSCYFPVITACLGPVANTISIACAVDKWRVNYFYVEGGGD
                     KVFTHIDDPRGVFAVNIISLVIGCCSNAVLFLHFARKLSYLKSQIINIVGWTLAGGML
                     MIDVIVLSTHNIDETYQEKTIGFWYAAITSGLYLCCTLTLSIHFVGHKLQKYPAQFNL
                     LPNERSIMVFTVILSIWLIWGAGMFSRLLHISYGNALYFCTVSLLTIGLGDILPKSTA
                     AKCMALVFSMTGVLILGIIVFMTRSILQTSAGPIFFFHRVEHRRVKAWEKLTRGDCTL
                     TDKECFELMMSIRRTSKMKGHIYSLMITIIIFILFWILGATVFYFAEGWTYFNAVYFC
                     FLCLLTIGYGDYAPETGAGRAFFVLWSIGAVPLMGAILSTAGDLLYASSESLDVKLGK
                     WLKNSVKTVLIGPNLTKKQSYTSSSPLEEQAEVNEFNFGNDDGIGIIDSTFNNDEDSQ
                     STVSDNIGDPINIRMASSNNNNNVDGLHTLAAAISRSSSYRRKGASSGSNRRRNNSIK
                     DEVEKCNREDEVFEGTDLFGDIRTEREKITRLNQLVKVLKRLHEMSLNDKDKKLNYND
                     WSKIHHLALKNLNNDGIDPNPTYWLSEYSPLKFPLNQPHYAFMKIMGLMDRTLRNLAI
                     DESMRGQSHFREDAANFMINPFNRLPVITHSEEQTLSSSPFSHTSSAASLTSSFDSSN
                     NSVAFSQDDAHAFTSLENSESLHNSENSSELQHEASTTSDSNTNTFDKGSRSTEHD"
     gene            <400390..>403020
                     /locus_tag="CAGL0L03498g"
                     /db_xref="GeneID:2890736"
     mRNA            <400390..>403020
                     /locus_tag="CAGL0L03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448925.1"
                     /db_xref="GeneID:2890736"
     CDS             400390..403020
                     /locus_tag="CAGL0L03498g"
                     /inference="similar to AA sequence:UniProtKB:P40309"
                     /note="similar to uniprot|P40309 Saccharomyces cerevisiae
                     YJL094c KHA1 K+/H+ exchanger"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448925.1"
                     /db_xref="GeneID:2890736"
                     /db_xref="GOA:Q6FLG9"
                     /db_xref="InterPro:IPR004771"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG9"
                     /translation="MAEIGGVLSGVNPFHYNPGSPITLFLFQVCLILATCNLVHIPFS
                     KLRQPKVISEVTAGVILGPTVFGQIPNYTETVFPQSSIPGLNLTANLGIILFMFFLGL
                     EVDIAFIRKHLKSAISIGLVTLAVPFGCGCLIAIPLYSNYANKDPNARHIKFTVFMVF
                     IAVSMAVTAFPVLSRILNELRLIKERPGIIVLGAGIINDILGWILLALSVILSSAESS
                     PVNTVYILLITLGWFLIYFYPLKYIVRWALIKTHELDRSKPSPIATMCILFIMFISAY
                     FTDIIGVHAIFGAFIAGLIVPRENHYVVKLTERMEDIPNIVLIPIYFAVAGLNVDLTL
                     LNKGKDWGYVFLSIAVAIASKVVSGTAMAKLHGLYWRESMAIGVLMSCKGIVEIVVLT
                     VGLNAGIISHKIFGMFILMALVSTFVTTPLTQLVYPNSYREQLKKEQPSDNESTVLIQ
                     KDDSTDCDYQNKMNWHELKQYSIPRVINVINTPEIISSSLEFLNFFLFKGNVDKQPRS
                     SNKDLLISRVSTGSTIKSSSKLKKLTHSLKRMNEESNEKMATIGEYPTGFSNMSTLRA
                     IHLRLLTERTTDLLQSSSLYNDDPLFTANSDYILNIFEIFSNLSKVPFTSEVIFSTMR
                     EKGVNATRLQMMPNELVLFPLKGASYEHKGSPGLSDEKYSSFDHFLSHIIGLNELPSI
                     FFQTLASDLKTNFAMLISNTCGRLSIERFKKKHFILLLPNPNMTHSDFLGLYILLKLC
                     YNDSLSHENNIFSIYYNNMNTRFEEEFQNLIADQYWFDDVNLKISSITASIKTEGDYR
                     TKPFVESVLEKGLSSEELEDLEESTFIIAENKFDRNEPFENDVKSTIYDAANKRFNVL
                     IVHYFNRVNFPHKSSFISTE"
     gene            complement(<403100..>407443)
                     /locus_tag="CAGL0L03520g"
                     /db_xref="GeneID:2890737"
     mRNA            complement(<403100..>407443)
                     /locus_tag="CAGL0L03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448926.1"
                     /db_xref="GeneID:2890737"
     CDS             complement(403100..407443)
                     /locus_tag="CAGL0L03520g"
                     /inference="similar to AA sequence:UniProtKB:Q01389"
                     /note="similar to uniprot|Q01389 Saccharomyces cerevisiae
                     YJL095w BCK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448926.1"
                     /db_xref="GeneID:2890737"
                     /db_xref="GOA:Q6FLG8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG8"
                     /translation="MTFLKKIAGSNGHSKSGSVSSIRYSANSQASPSASVSSSRSFKT
                     HVRNSSNSTDYSGSTYVFGTGNTASSGSNHGTPTSSKTFSKMGSSYNRRSIDSPRSTS
                     NRNSEYTLDNSSLNSHPQANKGGDNVSRPTSLEKNADTDSSTYSRKSSGSTSSLSFDN
                     LILSWDPTNPDEWTLSRVIAWFKFHDFPDSWIAVFKRHQLCGQRFLRLLAYDNFAIYE
                     KHLPISKNASFDKFQALLKDTMKKNVSSSHSRQRSGNSVAAMHIEPNKGVNLRHKSSR
                     SQDDIVGSRSASESGINNEQLNLGKPPEKGVVKSHKKTKSTGSLYRRSFISLMGSSSH
                     SSAENTQMEKNNPNIKIHIPSRPQSVVESEPSTAKTLSPLSPPYSALFNKLDQKNRSD
                     PTLFEISDEKYSRLKNDDYNDDIAAQSSSTNFNGKQQHSSSATYSKSKKNEKGGFNVR
                     NSAVMPEDKSTFWEKLKRKSQTISPSTQNHTQLNSANLSKNRVSLQQIQGGFDMTDQV
                     KPDNIVTPKIHQAHKSSSIDTKSQNFENVFDKFLLDKKYYPAKIKSSTNEEDFVLITK
                     DNVSFIPLLISELPNECSKLKEYFMRKLRIVSGECSVHMTDFGCDIGASLNDTLLDTI
                     RNSLFMNTSRKLFIRDTGTHKYSPGKPIINSSQREMLRKKESIKSINSSILASNDEIS
                     TITSSSDIASFDDRSSAPGRQYPQTPSYFYDASNVNDDVNYWNFKENQSSLVPGKVPD
                     VKPEAQFTLKIPDKIKHKGLEDDLQRNSFHVLRKDEGKEIDFNNRRRSPYTNPELAPK
                     REAPKAPITGSPMRLQKSRSLSKSVSIVTNNDRSRRDELSPSRKSYKNSETNSPSSEK
                     IVSSYTPGSSHVLVPQPYKGVGDISRKGKLEDDHMFSMTEVLRSRVNRSTSSVSNNSV
                     IYSTSPILKRGSSKRIVSSASAADVFEENTINFNDVPELSDSDEDSASSEDIIWGSET
                     KISETEVVPENNNFNKTDSEDDDKIYSMNNKLTPVRKMTLRPTAEIVYQNLERFFPRA
                     HLDKPVVEELHNSKSPVSKTSDKARINSILEQHSNISEKGVKSQNNDNVIKEKKSNTS
                     LPRRTRTIRAIAHEAGEARRNSMKVKRSNTKMWGTKIVEITDKNTIEINKSKNARGEY
                     KEFAWMKGEMIGKGSFGAVYLSLNITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSE
                     VATLKDLDHLNIVQYLGSEIRGNIYSLFLEYVAGGSVGSLIRLYGRFDEKLIRHLNTQ
                     VLSGLKYLHSKGILHRDMKADNLLLDEDGICKISDFGISKKSKNIYSNSDMTMRGTVF
                     WMAPEMVDTKQGYSAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIP
                     DDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVDPAFNFSRTRLYEFIKTN
                     DKLNSSVLRNT"
     gene            complement(<407836..>408303)
                     /locus_tag="CAGL0L03542g"
                     /db_xref="GeneID:2890738"
     mRNA            complement(<407836..>408303)
                     /locus_tag="CAGL0L03542g"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="XM_448927.1"
                     /db_xref="GeneID:2890738"
     CDS             complement(407836..408303)
                     /locus_tag="CAGL0L03542g"
                     /inference="similar to AA sequence:UniProtKB:P40858"
                     /note="similar to uniprot|P40858 Saccharomyces cerevisiae
                     YJL096w MRPL49"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="XP_448927.1"
                     /db_xref="GeneID:2890738"
                     /db_xref="GOA:Q6FLG7"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG7"
                     /translation="MFKFLTRSCGLLTVGKSSIQSVSKSLTRLNSTVSEKYKDLAPLK
                     LSNELYAIFKIHERPYLVTKGDKVILPFKLKEANVGDILNLTDVTTIGSRNYKLVDNP
                     IDKSIYSLKAVVLEKTKRAYQVREVTKRRNRRVRHAVNKADQTVIRISELKVN"
     gene            complement(<408701..>409351)
                     /locus_tag="CAGL0L03564g"
                     /db_xref="GeneID:2890739"
     mRNA            complement(<408701..>409351)
                     /locus_tag="CAGL0L03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448928.1"
                     /db_xref="GeneID:2890739"
     CDS             complement(408701..409351)
                     /locus_tag="CAGL0L03564g"
                     /inference="similar to AA sequence:UniProtKB:P40857"
                     /note="similar to uniprot|P40857 Saccharomyces cerevisiae
                     YJL097w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448928.1"
                     /db_xref="GeneID:2890739"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG6"
                     /translation="MSKDRRPVFSYLPLYNLASAIGWGYILYLVLLQYPKLGQPRFYQ
                     DTKDIVTYIQCGAIIEILNSLFGIVRSPLLTTAAQVLSRLVVVLGIFQYLPEARNAHG
                     IVYITLLLSWSITEIIRYMFYFFTLIGSRGAPTFLVYLRYNLFLVLYPTGVASELLII
                     YSALPVAEAKYSLLWKRFLIGVMLTYLPGLPMLFLHMLAQRRKIMKQLANKTQKQA"
     gene            complement(<410092..>413463)
                     /locus_tag="CAGL0L03586g"
                     /db_xref="GeneID:2890740"
     mRNA            complement(<410092..>413463)
                     /locus_tag="CAGL0L03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448929.1"
                     /db_xref="GeneID:2890740"
     CDS             complement(410092..413463)
                     /locus_tag="CAGL0L03586g"
                     /inference="similar to AA sequence:UniProtKB:P40856"
                     /note="similar to uniprot|P40856 Saccharomyces cerevisiae
                     YJL098w SAP185 or uniprot|P36123 Saccharomyces cerevisiae
                     YKR028w SAP190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448929.1"
                     /db_xref="GeneID:2890740"
                     /db_xref="GOA:Q6FLG5"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG5"
                     /translation="MSGSFWKFGTDYSSESSLSRLLNKAFIKIEEDEKETDAYKGGAL
                     SLNKDLEKGNDEKESNTATNAETEDEPQDSSSKLEDSEESIEDDEEEGESLPTTEEEY
                     KYYRPNMDVLDALLDDDELYTELMCSNFKLLVFLKYPEVLSKLIDYVKCNSLIEGLTL
                     EELEERSNKDAQTSVEEEHYSAQVDREKRSTTPDIILTEADDITKQTNEVAKESESEK
                     GEDSDSNSSSDADDVSVTVRQDYEEQDELRRARMAAEVLSADVWPISSAIIQNEDLLE
                     KLWSIMQYPAPLPIEISTYFMKINERLLDMDLNGILAFILNHPNLLDIFLTHIDNPPL
                     MDFLLKVISTDKADTPTGIIKILKEQGMIPKLLDFLSPEYDKSTQSAAGDFIKALVTI
                     SGNCNNEIASSIGPNEMIRELVSPPMVEKLISIMLKAGSSLSNGVGIVIELIRKNNSD
                     YDFVQLAYTTIKTHPPNDRDPIYLGYLLKAFAAHMAEFTQMLTSIELPPLQTPQGEIE
                     PLGFERFKICELIAELLHCSNMTLLNDPNGESIVKERDEERERILKLENQKLNDESDN
                     EIEDNNIPTTDLKSDTSQEDEKIANEMNDLQLDSEGNADDTDGSEQAKSDTVRDEFES
                     KETNEEEYLENISDDSETEHKLRENPTVGDQLKIALEDTRVIEVILEMFFHYVWNNFL
                     HNVVFDIIQQIFNGPLMTGYNRFLLIDLLKNIHMTDLIIKGNEQSGVYEEKHVLRLGY
                     MGHLTLMAEEIVKFEAYLDEMKITFTTDTIPTCLSEAKWKYYAETELADLREKYNTIL
                     GDVGDEVDELEDEDDDDEQASSVTGFNQGAERDEDDADYVEEDDEAYENQMNMYDSLS
                     STHQMDEYDDEDDELYAEYNDIDNPRYYEYIDGDGKKTRLELNPADLHDGDVKTKDSA
                     LNNNEDENNVTNKFSAYMSDQLRKDFYDSEADEPSRKSHKPDTQQFDDNEGTSWESDS
                     NAFILKNFSKTSQLASPEIENKNIFQHQFDLDNVSQIEQHDVEEDDDDYVDPNDDGQS
                     YSKPNNPLYSDKQNGGYFSNSSRSRSSDEDENELSDDSEAELEGSPYEDQADETDFNT
                     YTLCRSTSKDNLSWDENEQDRLMGMVSYNRDFKDS"
     gene            complement(<414375..>416843)
                     /locus_tag="CAGL0L03608g"
                     /db_xref="GeneID:2890741"
     mRNA            complement(<414375..>416843)
                     /locus_tag="CAGL0L03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448930.1"
                     /db_xref="GeneID:2890741"
     CDS             complement(414375..416843)
                     /locus_tag="CAGL0L03608g"
                     /note="some similarities with uniprot|P40955 Saccharomyces
                     cerevisiae YJL099w CHS6 or uniprot|P36122 Saccharomyces
                     cerevisiae YKR027w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448930.1"
                     /db_xref="GeneID:2890741"
                     /db_xref="GOA:Q6FLG4"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG4"
                     /translation="MLWGKEKQDHKVYLSPNRNATGARSIEDLDREGNRNSNLTLPNL
                     ELELELQPVGSHSHRSRSRSNSRSNLGAKASKSHGKGSTSSLPDIQPGVREFPRIVER
                     RFGESLGIRTQLLKRLSRGGKLGLGPPDLIHITSYDKYHKDIETGQYFYISGVDVSNE
                     SMPIAMLKLLKSGSSEQVISTYCSCNIFSHIDIRIRYESDTAYQINAVDITNGTSLVQ
                     LSEALWEEAFVSACVRSIISNIESARKLPGLVEYPLLGLTQGSNSDDIMKCKRILELL
                     CRYLPRFLECGWDSTRSVEPTIVSNYLTQSILEFLSIASPLLIEYTIGILKELMEVDN
                     KNSILYEVVLATVLHQSDEMDHDLVLILHKTIDKLNKMLSDNTEHDFDNLFLVNCLSE
                     LLIIQTQYLIYRAEDLKLAEKVITHSTELTVDSFKSWYWLAKTYIYLGQYDKALLAIN
                     SMHPLHSLDPVREALYSDPYMLNYYQKPLDGFKILPGKVNKGLEPCELTSIELNNLNS
                     KWKYQDEFQKFIFGRISMPYSPSEKGFIREIWEDAAYKIGPIFGTQVANLINFVSPQE
                     VEMVADYQLLSRNTINKQNNWFMAQVLDLLIEIITYLGWNGLMETRSKVFVMQQEYLG
                     TISPDSSGNENSQSTIIPLQFRKKRLCERWLDQLFLDIYEDLKITRAAMNNKDVKYSG
                     LEWELLGLTMLRTWQWSDAIACLRTSLVARFDIISATKILELYFDEDKIQRIHSIDMK
                     NDILPYDVAVDLIVKKISYEFRFYNEFQLYNVKILFKLAERYGLDLIRAQVVGLPYIN
                     RSILAVMDKMFNWIEKMTTDSPPA"
     gene            <417681..>419717
                     /locus_tag="CAGL0L03630g"
                     /db_xref="GeneID:2890742"
     mRNA            <417681..>419717
                     /locus_tag="CAGL0L03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448931.1"
                     /db_xref="GeneID:2890742"
     CDS             417681..419717
                     /locus_tag="CAGL0L03630g"
                     /note="highly similar to uniprot|P32477 Saccharomyces
                     cerevisiae YJL101c GSH1 glutamate--cysteine ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448931.1"
                     /db_xref="GeneID:2890742"
                     /db_xref="GOA:Q6FLG3"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG3"
                     /translation="MGLLSLGTPLPWEESRNYSEHIRNEGVEQLLYVFKSAGGRDGDP
                     LLWGDEVEYMMVELEAGKQVATLDVVHDRILDELNERDLELCNVNDVKFHPEYGRFML
                     EATPKSAYPGYVAEYVEYNMQQRRLVAEYKLAQYAEEEHLKGKRLVPLTLTVFPRMGC
                     PDFLNIPNAWDHKNTASRSLFLPDEVINRHARFPNLTSSIRTRRGEKVCINIPILKDR
                     NTPELDDSIKPRDWFVPEDKESRLASKPGHIYLDAMGFGMGCSCLQMTYQAPNIEKAR
                     FLYDTLVNFAPVFLAVSAATPGFKGWVADQDVRWNVISGAVDDRTPQERSVPPLLPEY
                     NIDGFGGILKENRKKVQQIPKSRYSVVDLYLGGNENKSFNRRYNDTDVPVNEKVLKRL
                     LENEKYPLDYDLAKHFAHLYIRDPISTFEELLDQDNSTSTNHFENIQSTNWQTLRFKP
                     PTQEATPDNHNVPGWRVEFRPLDIQLLDFENAAFSNMMYMIVDFVLQNTDKINPYVPM
                     SQVWENMIRAHHRDAAIKEKFYWRTTFDSKEKLQFGDESEELSLDEIFHNKNNGIFPV
                     FINTILKQRNFIQKEWQEMKDQPQNRRLYYYFKIISDRASGRLPTAAKFLKNFILTHP
                     DYRHDSKISQQINYDLIEMCDRITHLDDSRGELSAFVGEEIAKFLLNNKLSTGN"
     gene            complement(<419874..>422297)
                     /locus_tag="CAGL0L03652g"
                     /db_xref="GeneID:2890538"
     mRNA            complement(<419874..>422297)
                     /locus_tag="CAGL0L03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448932.1"
                     /db_xref="GeneID:2890538"
     CDS             complement(419874..422297)
                     /locus_tag="CAGL0L03652g"
                     /inference="similar to AA sequence:UniProtKB:P39677"
                     /note="similar to uniprot|P39677 Saccharomyces cerevisiae
                     YJL102w MEF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448932.1"
                     /db_xref="GeneID:2890538"
                     /db_xref="GOA:Q6FLG2"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLRFVCGRFQSGIRRYATTIDRFRNIGIIAHIDAGKTTTTERML
                     YCAGKIKRIGDVDSGDTVTDFLPQERDRGITIQSAAISFQWHDSSRDNSPRVINLIDT
                     PGHADFIFEVIRSLKVLDGAVLILDGVAGVEAQTEKLWRYSRNIPKICFVNKMDRVGA
                     GFSKTLKELTYKTDRRCVVVNFPYFEQTNQSEDPVFCGVIDVINMKLLKWDTKANSPD
                     AVTVVDLLELNDSDNAKVEAIKSRESMVEILGELDDVFVQEFFDGPSEGNSLKVSAQV
                     LNKSIRKLTIANELTPVLAGASFKNVGIQPLLDGIIQYLPSPLEARLPEVNPKDIPVV
                     HDPKVGALINKQNNLCVALAFKVTHDQIRGLMVFVRIYSGVLNSGNTVMNTTTGEKFR
                     IGKLVIMQADQAQEVKSLSPGQIGVLTGATITNKVATGDTIISHSIKKDGIRSFGEKE
                     SQLKVNAIQIPPPVFSVIVEPKSLGNKKLIEDALKEITMEDPSLHVIIDEETGQTVLN
                     GMGQLHLEIAKFRLVNEMKVPVDFGKIAVSYKETLELPTEVVTFKDERGFHFSLSVES
                     FEKDTINIEERSGASCFSVDNDENYLIIEGFQDRLQKSNWAYQIPIRNFVTTILSSAM
                     ASLQSAGKVGHLPLYSCAVRLKKDWDFPLDLQSPAELLSITRSLITEALQTVDVSNYT
                     LLEPVMDAHISVPQNDIGTVMQDLCSARTATISSLDDENVSSSDKLMELESQSKHLYY
                     PTDSTLGTAKIQDDKLKTIHAICPLKEMVTYSSKLRSLTKGRGELHMDYKGMSKVSQE
                     RIPDILQEL"
     gene            <422571..>424460
                     /locus_tag="CAGL0L03674g"
                     /db_xref="GeneID:2890536"
     mRNA            <422571..>424460
                     /locus_tag="CAGL0L03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448933.1"
                     /db_xref="GeneID:2890536"
     CDS             422571..424460
                     /locus_tag="CAGL0L03674g"
                     /note="some similarities with uniprot|P42950 Saccharomyces
                     cerevisiae YJL103c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448933.1"
                     /db_xref="GeneID:2890536"
                     /db_xref="GOA:Q6FLG1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /translation="MVKACEFCHEKHLHCDPGRPCINCVKRNRGQLCRDKERKKSKKS
                     GVEKSVGGSDAQSSGSSQSNNTAEVNVSADYTAGTMFNNMGFDPLQQSNYGFDTMTRQ
                     NNNNDNTLLNSSNNNAIDMGNRWSSQPDVVDNMVSPNITDGSNTVEFDSAWANNEYMK
                     LDELTKNGPPMMFSSYPNSVTENLDQDNAVEDLPISVLPGSKTKNGTAENLSQFLNIG
                     RPLHKTQSRPYISLDMMTAGMKDDILPPETYNTTSLGDNYLSPINSVGSSTNQLNDYQ
                     DSIPHQKTMTSPVLPTQSPSSAFNPAKLPTQVSISAISPDDNNEDDQKSSSGIPSKSD
                     KEKNNKTKKAKEKIFKTSPNDILISKKNPKGHKSTKRKNEKADISPYKFRQLVKVPED
                     LYEKQYLIKPHNYRHTYKKLLEQLEKIFLSDNSPKRRGQLQSIVKCILEDYVPTFIAL
                     TSNMIESDLYLQELTLQRTLLELESMAKLVNCSPICIWRRSGEISYVSDEFLQLTGFK
                     RKEILASRRFIFEFLDPTSIVNYFTNFHEYLAFGSKNQMTSNISLIKQGLLVNGAVVR
                     KSNPIVSSSPMCGTNTDGIFDECHLLLSNGYYLKCATCWTVKRDSFNIPLLIMGQFLP
                     VFEGQ"
     gene            <426695..>428518
                     /locus_tag="CAGL0L03696g"
                     /db_xref="GeneID:2890537"
     mRNA            <426695..>428518
                     /locus_tag="CAGL0L03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448934.1"
                     /db_xref="GeneID:2890537"
     CDS             426695..428518
                     /locus_tag="CAGL0L03696g"
                     /inference="similar to AA sequence:UniProtKB:Q99252"
                     /note="similar to uniprot|Q99252 Saccharomyces cerevisiae
                     YOR092w ECM3 or uniprot|P53932 Saccharomyces cerevisiae
                     YNL095c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448934.1"
                     /db_xref="GeneID:2890537"
                     /db_xref="GOA:Q6FLG0"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:Q6FLG0"
                     /translation="MSITLGAVIWSSVKPIIKIYLIIGSGFLLARMGILTVEATKSIS
                     NIVLTLLLPCLSFNKIVANIEDQDIKMVGIICLSSVLIFGTGLFFAWVISKTMPVPKE
                     WKGGILAGGMFPNISDLPIAYLQTMDQGFIFSEEEGEKGVANVIIFLAMFLICVFNLG
                     GFRLIESDFKYNDVENAITESESTITNDSNETSTSVSYTSNIHTEKQSLDKARDNTNE
                     KSNDSDRSKNNSESDLENESLDSSSAAGDLSLRTTSTSDDIDDINRSQGKSATRRRNH
                     TPMPLREKNPRTISRVTLPLQHTRRNSVTASIRSTKSLQAQDMNDLIQIYSNVDQYGN
                     DINADQSQNLGSLGNANTGKVITTENKTNAARTVLDRIRGSNLTRILTSDATVSRKDI
                     EESGKSLPKWLHKKLPITKFIVFFLKNCLRPCSMAVIVALTIAFIPWVKALFVTTKHT
                     PHIRQAPDRQPALSFIMDFTAYVGAASVPFGLILLGATLGRLKIGKLYPGFWRSAVVL
                     VFLRQCIMPIFGVLWCDRLVKAGWVSWEKDKMLLFVIAISWALPTMTTLIYFTASYTP
                     PELLEPIQMQCVSFFLMIQYPLMVVSLPFLVSYFLKVQMKV"
     gene            complement(<428701..>433782)
                     /locus_tag="CAGL0L03718g"
                     /db_xref="GeneID:2890539"
     mRNA            complement(<428701..>433782)
                     /locus_tag="CAGL0L03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448935.1"
                     /db_xref="GeneID:2890539"
     CDS             complement(428701..433782)
                     /locus_tag="CAGL0L03718g"
                     /inference="similar to AA sequence:UniProtKB:Q12275"
                     /note="similar to uniprot|Q12275 Saccharomyces cerevisiae
                     YOR093c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448935.1"
                     /db_xref="GeneID:2890539"
                     /db_xref="GOA:Q6FLF9"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010506"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF9"
                     /translation="MESRVDLSVPSNLPLGIQYQLNELIQDYKQENLTIKGYQTKRRQ
                     LLENYELQTNSSKISLSSSLYSRDTSTIDLERPNDPSRFSNSRPTSSYVTSTKGKERQ
                     TNTHYRSFSDDLMTSPNYNTTSRLSNIIAHKTMRQNSVYRVTTMNSASKNSLPLASPA
                     KFKRKSQYSLASSVDDASLSGQSEMEGSYTPMIPLLPRKPSYVSPENKEVETIAKEFL
                     PSILRKRFEYFNGQTAMISINNKGKETFITWDKLYLRAAKVAHELTKEQLYKMDKVLL
                     WYNMEDSIEFAVALFGCFIAGMVAVPVSFQTYSLSDIIEIIRMTGAKLILISNNCQKQ
                     LDNLHSTSNHNKVKLVKSEVFKSVKFLKTDDLGIYSKAKKSVPIFETPNIMYIEFTRT
                     PLGRLSGVVMKHKVLMDQLSLLALILNSRVMPHWKRKNNVIVPLKQKSLNVTSVADRF
                     VVMSSLDPTRSSGLIFGVLFNLFSGALLIAANSQILQTPGGYEHLIDKYRADVLLNDQ
                     LQLKQVVINYLENPELTLTKKHKIDFSCIKYCLTSCNTIDTDVTDMVIHKWLKNLGCI
                     DASLCYSPMLTLTDFGGLFFSLRDELGNLDNFPVHDSKLRLQDELYISREKLKKNIIE
                     PSVTAMINSSSSFKDYLKVEPFGFPIPGSILCVVDPDDNTLVNDLTVGEIWISSDKLT
                     DEFYQMDKINEFVFKAKLNFNKMFAFAKSDEYIDTNDDFKNSLERVETIYNICPKATH
                     FLRTKLMGFVFNGKIYVLSLVEDMFLQNRLVRLPNWAHTSNLLHTKPEKKDKNYTSEL
                     KDSAQSSLHTRNREENKKLIKRSVESHYLQQITETLVRTVNTVFEAVTFELNHHKEEH
                     FLVLVVESSLARDPRRVNYDKDEHLLEISNKEKFNTEKKMNELTDQIFRILWIFHKIQ
                     PMCVLVVPRNTLPRRYCSLELATSTVVKKFYNGELDASFAKFQFDNVILDYIPHSSYY
                     NESIFSEHLSALRFKALKEAIDVRQDDSMPYENDNWQASGINFKDFSIDDKSGKSMKS
                     FHSILEILEFRISASPNDLAFNDGGSSSKTTSGNTSNNIHKKVSWKAFEVICASFLRK
                     IVVSKTPLKPSDCVIIMADNSVEYIAMIYACFYCNFIVIPVPSVTVENANKIIGPLVK
                     IIKNYKVKRIFMDAKNYVLVDSHNIVSKIFKTYKQNFPKITVFSKVKRKNTLTLSIFK
                     KTLREKYSLKGKKHNNSPCFVWTNLMSSTEQDIHPTMTHSTFLKTCKILKETLNMSND
                     RVIFSLCPDSSISSFTINNLLGVFIGCPTNLFNISDFKNDPVDFLIGIQNLNVKEIYL
                     PLSVLSTVLEKANQLLENNKKAGYQNTTKKNSNSTSLLRSDFLRNVQNLIIPFSGRPN
                     SAMIEKLLKRYSNVMISTNQICCTYEHKFNPIISMQTGIDTIPKYMYLDPTALREGII
                     DEISLTEVGSEGYIRIQDSGCVPYCTDVTIVNPETEVPCIDGEYGEIWCCSEANVYSY
                     YLSDKKLRKDPFITSQFSSKLKGEADKGLTYLRTGDFGFIKSVNFVDHNGVLNRKKLL
                     FILGSMNETVEILGLTHFVIDLEQTVKNVHSSISDCYIAKMGGLLVCLIRTRDRLLSK
                     YANLCALITSSLLDKHGVILDMCAFVRVPKFNDSTSPAPPNWSKERLSLFKRWLQCEL
                     QIDSQFGINYGENISMYLLSEFENN"
     gene            complement(<434489..>435271)
                     /locus_tag="CAGL0L03740g"
                     /db_xref="GeneID:2890542"
     mRNA            complement(<434489..>435271)
                     /locus_tag="CAGL0L03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448936.1"
                     /db_xref="GeneID:2890542"
     CDS             complement(434489..435271)
                     /locus_tag="CAGL0L03740g"
                     /note="highly similar to uniprot|Q12189 Saccharomyces
                     cerevisiae YOR095c RKI1 D-ribose-5-phosphate
                     ketol-isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448936.1"
                     /db_xref="GeneID:2890542"
                     /db_xref="GOA:Q6FLF8"
                     /db_xref="InterPro:IPR004788"
                     /translation="MSYTPLPNINDFPTLGNPLEDAKRAAAYRAVDENLNFDEHRIIG
                     VGSGSTVVYVAERIGQYLKDEKYHDKVSKFICIPTGYQSRNLIQDNGLILGSIEQHPH
                     VDIAFDGADEVDHNLQLIKGGGACLFQEKLVSTSAKIFIVVADSRKKSDTNLGINWKR
                     GVPIEIVPSAWSRVQHDLTSILHANSAPVRQGGSAKAGPVVTDNMNFLIDADFGEIQD
                     PKALHEQIKMLVGVVETGLFIDNAHRAYFGKPDGSVEVIDKK"
     gene            complement(<436416..>436865)
                     /locus_tag="CAGL0L03762g"
                     /db_xref="GeneID:2890540"
     mRNA            complement(<436416..>436865)
                     /locus_tag="CAGL0L03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448937.1"
                     /db_xref="GeneID:2890540"
     CDS             complement(436416..436865)
                     /locus_tag="CAGL0L03762g"
                     /inference="similar to AA sequence:UniProtKB:Q12274"
                     /note="similar to uniprot|Q12274 Saccharomyces cerevisiae
                     YOR097c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448937.1"
                     /db_xref="GeneID:2890540"
                     /db_xref="GOA:Q6FLF7"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF7"
                     /translation="MEKAIPFIRSNQEIEFRVGDRDVYIHLPSFVLGALVIGLVGPIL
                     KTVIGGIWVGLILFSKFAVVIGIALTIIWILSGSQKRQVKRSKPTYTETINKIRPQED
                     SEADIGSYKYFNIPVEKEPYIKRKPSISTISIDEKDLYTNFVRKARR"
     gene            complement(<437192..>439813)
                     /locus_tag="CAGL0L03784g"
                     /db_xref="GeneID:2890541"
     mRNA            complement(<437192..>439813)
                     /locus_tag="CAGL0L03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448938.1"
                     /db_xref="GeneID:2890541"
     CDS             complement(437192..439813)
                     /locus_tag="CAGL0L03784g"
                     /note="some similarities with uniprot|P20676 Saccharomyces
                     cerevisiae YOR098c NUP1 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448938.1"
                     /db_xref="GeneID:2890541"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF6"
                     /translation="MDTSIVQEKSQRPNVKRSISSTFKSLFRSSSDTTKSDNCGDRNS
                     EGKKRRKLLNTVEEQNLDYSKHDSDDSIILFDPVHSTEGQRPPLLPILPRQRLKLLKY
                     KQLKRIEQDFKELSALIKNNKESYKPDNKLKFKSLLKKTDTKPKHSYKSNKWSAMYEY
                     DPSEFDESETLVVEEDKRQTPINFEIQKANTPLSNRLIEVPDSTKKITSAESDVLFNI
                     PKAKKPSANGTSSNILSEKPVIKNASKLPTGLPKQENVLLPTVGFDFIKDSNETPSKT
                     LPSKNKPQLVNIDKTTDIIDSEKPKAPLFSFGNNKTNATEKQEATIAENDKTGLAMDK
                     PKAFSFGLNKEKPGQTLLGNTSSKFSFGTSGSLSGESDATTKADNASQTNISSKIKPL
                     FTLNSSESNKNREEKSDDEEDERDNKRKRRSSGNDKVPSFSFGNKATSLAPESQQKPS
                     FSFGAKPAESTSTKGTTATEKPVFSFSIPPVQSDEKKDKPIPLFGGLKATTDSGNVGN
                     EKKDEQSQNKTKPLFNFGPKVSNDNSGSPVTNESSTKPNFSFLKPANANTNGTPADES
                     TKTDSSAATLSLPFGAKVSKPSEDKPAISFGFGSSQSTEKQEQSKSTGTPSFTFSATK
                     SETQPKNDAQTSTGSLFSLGSKATETAANPTTSQPTFQFGKAALKNDAASPSPSSVFG
                     SSTGLAQSQQSKPAFSFNSAPNQVPGSGAQSSFSFGKPNASAPPTTFPASQSPTPFGQ
                     TPAPQISTPNALFNAPMGANPQPQEPAQVFKPAQTPNFNFMSGSSNINPAAVFAPSQP
                     ASVQPQQIFGGGMNSNPSMNTAGAPVSGMANPFTSGMGNGMATNAPQMGMASEQKSTP
                     PPGFTQRRLARMRAPRR"
     gene            <440385..>441152
                     /locus_tag="CAGL0L03806g"
                     /db_xref="GeneID:2890544"
     mRNA            <440385..>441152
                     /locus_tag="CAGL0L03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448939.1"
                     /db_xref="GeneID:2890544"
     CDS             440385..441152
                     /locus_tag="CAGL0L03806g"
                     /inference="similar to AA sequence:UniProtKB:P53927"
                     /note="similar to uniprot|P53927 Saccharomyces cerevisiae
                     YNL110c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448939.1"
                     /db_xref="GeneID:2890544"
                     /db_xref="GOA:Q6FLF5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF5"
                     /translation="MGLSAMLCIGIYILWRIVIVCRYHPISGFRKGLEYQREITMAKS
                     TDKKKVVAKEAEVQEDAIRLESGSDLSSESGESELEVSESESEDEIEGMETEQSGHHI
                     KKLDTSKKQKATKKDDKDSDISGIIYVGRLPKGFHERELSKYFSQFGDLKEVRLARNK
                     KTGNSRHYGFVQFVNTDDSRVAYDTMNNYLLMGHLLQVRLLPKGSKIEKLYKYKQRAF
                     MSPPKAKKSAKELKKLAEEKHKERMEKLSKAGIDYQY"
     gene            <442660..>443025
                     /locus_tag="CAGL0L03828g"
                     /db_xref="GeneID:2890543"
     mRNA            <442660..>443025
                     /locus_tag="CAGL0L03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448940.1"
                     /db_xref="GeneID:2890543"
     CDS             442660..443025
                     /locus_tag="CAGL0L03828g"
                     /inference="similar to AA sequence:UniProtKB:P40312"
                     /note="similar to uniprot|P40312 Saccharomyces cerevisiae
                     YNL111c CYB5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448940.1"
                     /db_xref="GeneID:2890543"
                     /db_xref="GOA:Q6FLF4"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF4"
                     /translation="MSKVYTYKQVSEHNKEGDCWIIIDGSVYDVSKFLDEHPGGDEII
                     FEHRGTDATGDFVDIGHSDDALKILKTLKIGEVDPNSERVVIDNRESDMVQKSTEGGG
                     KLVIVLGLLALAVAYYTLN"
     gene            complement(<443677..>446411)
                     /locus_tag="CAGL0L03846g"
                     /db_xref="GeneID:2890547"
     mRNA            complement(join(<443677..444047,445148..>446411))
                     /locus_tag="CAGL0L03846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448941.1"
                     /db_xref="GeneID:2890547"
     CDS             complement(join(443677..444047,445148..446411))
                     /locus_tag="CAGL0L03846g"
                     /note="highly similar to uniprot|P24783 Saccharomyces
                     cerevisiae YNL112w DBP2 ATP-dependent RNA helicase of DEAD
                     box family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448941.1"
                     /db_xref="GeneID:2890547"
                     /db_xref="GOA:Q6FLF3"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGYRDALYNKTNYNSRGGDFRGGRSSDRNDYNRDRNQGYSHGGL
                     RGRHDDGPRELIKPDWESELPNLPPFEKNFYVEHEVVRNRSDQEVAQFRKESEMTITG
                     HDIPKPITTFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGK
                     TLSYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVY
                     GGVPRGQQIRELIRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEP
                     QIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQLVE
                     VVSEFEKRDRLVKHLDTASQDKESKILIFASTKRTCDEITSYLRQDGWPALAIHGDKD
                     QRERDWVLNEFRTGNSPIMVATDVAARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGR
                     AGATGTAISFFTEDNKSLGASLISIMREAKQNIPEELMKYDRRPRGPHPRYGGGYGRG
                     GRGYGGGRGGYGGRGGGRGGRGGFNRSRDGGWGNRR"
     gene            complement(<447274..>447687)
                     /locus_tag="CAGL0L03872g"
                     /db_xref="GeneID:2890545"
     mRNA            complement(<447274..>447687)
                     /locus_tag="CAGL0L03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448942.1"
                     /db_xref="GeneID:2890545"
     CDS             complement(447274..447687)
                     /locus_tag="CAGL0L03872g"
                     /inference="similar to AA sequence:UniProtKB:P28000"
                     /note="similar to uniprot|P28000 Saccharomyces cerevisiae
                     YNL113w RPC19 DNA-directed RNA polymerase I III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448942.1"
                     /db_xref="GeneID:2890545"
                     /db_xref="GOA:Q6FLF2"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF2"
                     /translation="MSTEERIAKAESEDVEMTNGGALENVEEEDIEDQEEESLKTKIK
                     LLPQATSEDGTCASFQIAQEDHTLGNALRYIIMKNPEVEFCGYSIPHPSEELLNLRIQ
                     TYGNITAVDALQKGLDDLIDLCDAVKDKFVQRLQS"
     gene            complement(<448143..>448634)
                     /locus_tag="CAGL0L03894g"
                     /db_xref="GeneID:2890546"
     mRNA            complement(<448143..>448634)
                     /locus_tag="CAGL0L03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448943.1"
                     /db_xref="GeneID:2890546"
     CDS             complement(448143..448634)
                     /locus_tag="CAGL0L03894g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448943.1"
                     /db_xref="GeneID:2890546"
                     /db_xref="GOA:Q6FLF1"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF1"
                     /translation="MAIVVAKSEKDCVPAPSPRHSGTLKLFSLFNSLRPPVIPFPIPP
                     SPLVTHFTYNAVMQSVLLSTGLNTQDRLCILKRLFSYSAASTKTHSPGLYTILTDKRS
                     TSTLAYRSYVRYSVKTQECTIFVSVKTKKEEIERPHPVVCNTIYARSSLQDFIAGIPC
                     FIF"
     gene            complement(<450952..>452880)
                     /locus_tag="CAGL0L03916g"
                     /db_xref="GeneID:2890549"
     mRNA            complement(<450952..>452880)
                     /locus_tag="CAGL0L03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448944.1"
                     /db_xref="GeneID:2890549"
     CDS             complement(450952..452880)
                     /locus_tag="CAGL0L03916g"
                     /note="weakly similar to uniprot|P41696 Saccharomyces
                     cerevisiae YOR113w AZF1 asparagine-rich zinc finger
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448944.1"
                     /db_xref="GeneID:2890549"
                     /db_xref="GOA:Q6FLF0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FLF0"
                     /translation="MTDHPESGENYPPNNFEVRQRDIPTIRVRNQMFFNQQPYINKPL
                     ANNNNTPYGKNSTSGISSTNNYAKLDDPNNNFFNFDSSLNPASVFNPVDNKNVRTSFV
                     NPQIDSMAQYYSQKPGGGSVGQGVMGPTNSQYLYQQGTKENTVGGLKSKNASSESYPQ
                     NQAHQQTATHQQQQQQQPQQQFRPYTNSVSTGYENIMNPLIQKNVNSDRNFYGAGANA
                     TTPYSTYGYNTQRKSSLQFDQSNDFAHDNKNYRQQLPIEGHSLPAGSQNNSINSSNNN
                     LIFKDGMYTTSEQLNPEYFDSSQFNPQNLKPYIEASGLPLATARYNDEVGLGKRTSTL
                     SNEAVQAMAQKNGPLDVARHSKSQSVPGKIDSFNRVGVTDRELQPQKDPNESSSPKLG
                     ATSIDKLMLIIEARQKGFMGQVPTTQDGDLLIDDDASKSILLPNAAQLVGGVPKPEGR
                     YTKHIKKPEDSNNPDKPAKPRKKRPKVKKYQCAYCSKMFSQSTHLDVHIKAHMGYKPF
                     ECEFCGKRFTQAGNLRTHRRLHTGERPFKCDKCDKTFARRGNLTAHEFTHESIKPYIC
                     RLDNCFKRFSQLGNMKSHQNKYHPQTIKELTQKLALLDPDPTKNNISQNEMELLSYFA
                     SLYKYSNKGIKGRGKSSN"
     gene            <461519..>463432
                     /locus_tag="CAGL0L03938g"
                     /db_xref="GeneID:2890548"
     mRNA            <461519..>463432
                     /locus_tag="CAGL0L03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448945.1"
                     /db_xref="GeneID:2890548"
     CDS             461519..463432
                     /locus_tag="CAGL0L03938g"
                     /inference="similar to AA sequence:UniProtKB:P53925"
                     /note="similar to uniprot|P53925 Saccharomyces cerevisiae
                     YNL115c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448945.1"
                     /db_xref="GeneID:2890548"
                     /db_xref="GOA:Q6FLE9"
                     /db_xref="InterPro:IPR019431"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE9"
                     /translation="MPTSIIASDKSVKSLPQTSLNQSEMNGDYSNEQVDERQLAVSTN
                     TTVENEREPLINVPESKRNIGGRYSSNECVNREAHDNDNPALAVAHNIQDKLYQMHKD
                     YRVFIHNSKWILNLMILLNTIWLVITFINDFFFNMSLFGYSNRYGSFNDLCLIFVAIV
                     ANSLNLWFNQLGLYSSLDVVQNISLCLLTLFNLFLLLIVKYTRERIGSIAIFTYLWTA
                     FAFVIGSVLDFYLLKFNDELYKNNNIIAERETQGHEQYDNKHTLREWLYIAIRSVAKL
                     GLLIFMAFYTLNTLLTAWDISRTSNTVVSSYPSQMVFTEAASYENYHWVDDNHTYKIH
                     ITCYGDIFNNTDLDNDNNQAIVLFEHGGYDTGYRSGTWIQELYHLNRIKRFCMYERPG
                     YGLSDSPPAPISISMVAEGLKYALLNEAKIKGPFVTVGYDMGGLFTRVFTAKNIDIVQ
                     GMMLVDAWHEDLLLKNYLKRMLPPVDDDDPSRNPDDRSWLPQEIGRHNEFKLWWQGLW
                     STLGLRLQSSWLVAHHGSRDRIFGRDLPYQGRFLRAKFLESITSSILSYRDVINSNDR
                     LIDVKTSIVSSKDMVKKSYRWGNWQRELTKISRKTQEWKVVDGGHEVYKYNLGKQQTQ
                     DVLLRLVGEKDRY"
     gene            complement(<463751..>465562)
                     /locus_tag="CAGL0L03960g"
                     /db_xref="GeneID:2890760"
     mRNA            complement(<463751..>465562)
                     /locus_tag="CAGL0L03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448946.1"
                     /db_xref="GeneID:2890760"
     CDS             complement(463751..465562)
                     /locus_tag="CAGL0L03960g"
                     /inference="similar to AA sequence:UniProtKB:P53924"
                     /note="similar to uniprot|P53924 Saccharomyces cerevisiae
                     YNL116w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448946.1"
                     /db_xref="GeneID:2890760"
                     /db_xref="GOA:Q6FLE8"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE8"
                     /translation="MYTPVQIGTPTSSGSNRSRQQRSGSNNQNTLFGSNSSNQDTGRS
                     QSNPNSANRNGSTHNNSNMSSGPSGFSSLLTSFGIRHNSNNNSNNASTNTVNNNNMSN
                     SNQGTVNPTTSSSNVVTQTAGNARRLTGDLNNGRSRTASNEGTSITLTSRQQQHQQQV
                     QLQRQIQNNMSNNNVASSLRTRNHDNCHLPISLSLSSQREQAQDATNANLDGHPETES
                     SNNAEDNMVIDLTEPANEDLIQGPGNNNNPFFQHSNDPARHDTNVESTSNSFQNMRNT
                     VHNGEQNASLNVNTSINNHNKNLRHYVYGADQVNADELLNLQLPTDKPGPEAVDEETV
                     RKRKDKNGFFSLRLTPFVDSSSGTNQGLFFEPVIRKAGPGSQLVIGRYTERVHEAISK
                     IPEQYHPVVFKSKVVSRTHGCFKVDSQGNWFIQDIKSSSGTFLNHQRLSQASTLSKDV
                     LLHDGDILQLGMDFRGGTEEIYRCVRMRVELNRSWKLKANAFNKEALQKMRKLQKMTT
                     GSDEEDCSICLSKIKPCQAIFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLEA
                     SLDNSDSESESDLDSEGDELVDQLNGLLDQQKDISIT"
     gene            complement(<466897..>468561)
                     /locus_tag="CAGL0L03982g"
                     /db_xref="GeneID:2890761"
     mRNA            complement(<466897..>468561)
                     /locus_tag="CAGL0L03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448947.1"
                     /db_xref="GeneID:2890761"
     CDS             complement(466897..468561)
                     /locus_tag="CAGL0L03982g"
                     /note="highly similar to uniprot|P30952 Saccharomyces
                     cerevisiae YNL117w MLS1 malate synthase or uniprot|P21826
                     Saccharomyces cerevisiae YIR031c DAL7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448947.1"
                     /db_xref="GeneID:2890761"
                     /db_xref="GOA:Q6FLE7"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006252"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="InterPro:IPR019830"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE7"
                     /translation="MVKISLDNVKLLVDIDDKPQFEPSKTTVKTILTKEALEFIVLLH
                     RTFNARRKQLLENRQEVQKKLDSGNFKLDFLPETANIRNDPTWQGPTLAPGLIDRSTE
                     ITGPPLRNMLINALNADVKTYMTDFEDSASPTWLNQIYGQVNLYDAVRNQIDFKTPRK
                     EYKLRDRFENLPTIIVRPRGWHMVEKHLYVDDEPISASIFDFGLFFFHNAKELIKLGK
                     GPYFYLPKMEHHLEAKLWNDIFNVSQDYIAIPRGTIRATVLIETLPAAFQMEEIIYQL
                     RQHSSGLNCGRWDYIFSTIKRLRNLPEHVLPNRDLVTMTSPFMDAYVKRLINTCHRRG
                     VHAMGGMAAQIPIKDDPVANEKALAKVRNDKIRELTNGHDGSWVAHPALAPICNEVFI
                     NMGTPNQIHFVPENEVTAQDLVNTNITDAAVTLDGIRQNLDIGLQYMEAWIRGSGCVP
                     INNLMEDAATAEVSRCQLYQWVHHGVKLSDTGDKVTPDLTQKILEERVQKLSKESPLG
                     DKNKFALAAKYFLPEIRGEKFSEFLTTLLYDEIVTANSSATDLSKL"
     gene            <471245..>474151
                     /locus_tag="CAGL0L04004g"
                     /db_xref="GeneID:2890762"
     mRNA            <471245..>474151
                     /locus_tag="CAGL0L04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448948.1"
                     /db_xref="GeneID:2890762"
     CDS             471245..474151
                     /locus_tag="CAGL0L04004g"
                     /inference="similar to AA sequence:UniProtKB:P53550"
                     /note="similar to uniprot|P53550 Saccharomyces cerevisiae
                     YNL118c PSU1 suppressor protein of a yeast pet mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448948.1"
                     /db_xref="GeneID:2890762"
                     /db_xref="GOA:Q6FLE6"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE6"
                     /translation="MSLPLRHALENVTSPERVLEDLLVRFIINCPPEDLSSVERELFH
                     FEEASWFYTDFVKLMNPSLPSFKIKAFAQLIIRLCPLVWKWDIKADQALQKFSKYKKT
                     IPVRGAAIFNEKLSKILLVKGTESDSWSFPRGKISKDENDIDCCIREVKEETGFDLTD
                     YVDESQFIERNIQGKNYKIFLVYGIPEDFDFKPHVRNEIEKIEWRDFKNITRTMHKTN
                     VKYYLVNSMMRPLSLWVRRQKQIRNEDQSKKYAEEQLKLMLGITKEENIDPGRELLNM
                     LQSSVHFSTNSTDSDEHNSNEGTDDSPRFDNTETSTIPINNFQQQQQQSLPPSVFQGF
                     PMPVNGSGYPSQFPILPPHLMNIPNQQRGVLPFINGPLPFMPSQFQHANIPQHSQPLV
                     GSNPPAMFANINGKSQESQSNDLDNQAENSKELLNLLRSKPKEQGKPKETITAKPKIK
                     ILKRGENLSLNNHPQNDSNQMINSLKNFKFEDSGNTQHGNNNSPGVFASNKHFDNNSN
                     GASSHSDDDNLPDESSESIYEDFESSSEGTISSAESDECSEFEKSDVEEAELKKIGRD
                     EEDNISSSESEVLKGNNFGVNNEIPSVIPNSESTRSVNESSSVTTQVAGPKPKVKILK
                     RGEILNSPSPANTQFTGAHTQFNGANTQTNDIASNQGNPLLEMLKNPQNKGQRETLKA
                     DESFKGDHDDNYSSPLNSSGKNTDDSKALLDILKQPHSTKAESQANYSQFLSSPQLSH
                     DSTDLLNLLKTSSQNIESNNSTNEPKNSNPLLDLLHRGQKSHESLSTQTATPVETLNS
                     NNYPMNSQYQEQLSEHSLSLKGTHDTDANEELINMLRRNSVLNTSNMNSDSDFKNFSP
                     INRDILATPVENKNQSSATLLNILHGRKEMNNASAEFSLDPSQHNNREPYENQTASHD
                     LLNMLKSPTIGHTDAQKDSYMNPSTNSLPQHQQSGTPVNESASKNLLNILHRGL"
     gene            complement(<474277..>475686)
                     /locus_tag="CAGL0L04026g"
                     /db_xref="GeneID:2890763"
     mRNA            complement(<474277..>475686)
                     /locus_tag="CAGL0L04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448949.1"
                     /db_xref="GeneID:2890763"
     CDS             complement(474277..475686)
                     /locus_tag="CAGL0L04026g"
                     /inference="similar to AA sequence:UniProtKB:P53923"
                     /note="similar to uniprot|P53923 Saccharomyces cerevisiae
                     YNL119w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448949.1"
                     /db_xref="GeneID:2890763"
                     /db_xref="GOA:Q6FLE5"
                     /db_xref="InterPro:IPR019407"
                     /translation="MTAEQCQRCNKNAVEVISRKELFCAECFRVFVMQKQRKQMMSDD
                     YYRDIFKVMYKDKIRSAEEAEQQNKNSTILIPLSFGSSSLMMLDIVHLTLLEQKMQHQ
                     KTGFNVDVLICYRESNDELLTNIQSNIKELSTVRYSENKDNIRFHTLCLDSMFEIDKE
                     LIDQVVLHNVEFTGRQVSINESEHANLSLQTVLTSCPNRSTKEDIIDFVTKHLVKKYA
                     YQNGQKAILWGHSMTRLADEIISCVVKGRGAQISSKLNTTNLDVNYGSRFKNLYPLKD
                     ILLTEVDAYCALFDLSKYLIKYELQDSLLVNKLKKEKHIGNQRLAKNMTINELARKYF
                     NDIEGEYSNVIATVLRTGDKLDEPLATLGEKHCRICKSTVHDDVSKWLRDITVNVGQP
                     LESQLERDLHEKWATSHIGLETTAYYQLRDRVWEQGDDVDLCYGCIVTMQGVKNLNVP
                     WPKNNEQELNEVLAEYSLE"
     gene            <476407..>478170
                     /locus_tag="CAGL0L04048g"
                     /db_xref="GeneID:2890764"
     mRNA            <476407..>478170
                     /locus_tag="CAGL0L04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448950.1"
                     /db_xref="GeneID:2890764"
     CDS             476407..478170
                     /locus_tag="CAGL0L04048g"
                     /inference="similar to AA sequence:UniProtKB:P07213"
                     /note="similar to uniprot|P07213 Saccharomyces cerevisiae
                     YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
                     YHR117w TOM7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448950.1"
                     /db_xref="GeneID:2890764"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE4"
                     /translation="MSSDSNTVGFWVKNKKAVVASVATVSAVVAAYFYYKQVQELKKS
                     LDDGNDVGTASSKVEYKYLMINDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDY
                     ENAINYYKFALQLKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSKVLLKRA
                     AVYENIGKFADALLDLTAVSLNGDYNDATIQPIVERVLNKQAMMALKDHLEASEKNKV
                     LPSYTSMAAFFGVFDAETDIPGHDATEESDKILSDALTHLYSQTKEGYDRCDSEFTKA
                     TELYKAKLENDRTNSVTNEKAAIAFEHTAILSFLKNDPLTARELVDEAIKLHPRPKSY
                     IYLGLLMADKGLDEEYYSNFQKAIDLDPNMAAIYYHRGQMNFIIQKYEKAGEDFDKAK
                     ECDPTNIFPYIQLACMSYREGHFDDCETLFSEARRKFPDAPEVPNFFAEILSDKGEIE
                     KAAAEYDKAIELESKSENIHVGIAPLVGKATTLLKYPTVENFIEADDLFEQANNEDPR
                     SEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLDEKLQATTFAEATKVQMRVRADE
                     RLQAKTMKALDEIRRNGGQGF"
     gene            <478686..>478973
                     /locus_tag="CAGL0L04070g"
                     /db_xref="GeneID:2890765"
     mRNA            <478686..>478973
                     /locus_tag="CAGL0L04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448951.1"
                     /db_xref="GeneID:2890765"
     CDS             478686..478973
                     /locus_tag="CAGL0L04070g"
                     /note="highly similar to uniprot|P53921 Saccharomyces
                     cerevisiae YNL122c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448951.1"
                     /db_xref="GeneID:2890765"
                     /db_xref="GOA:Q6FLE3"
                     /db_xref="InterPro:IPR021137"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE3"
                     /translation="MTLFNNAITACTSRLLSMKTMGVSSFGMVFCRTLMKTHRGALKR
                     WRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHPTQMKRLRRLMPYK"
     gene            complement(<479287..>482226)
                     /locus_tag="CAGL0L04092g"
                     /db_xref="GeneID:2890766"
     mRNA            complement(<479287..>482226)
                     /locus_tag="CAGL0L04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448952.1"
                     /db_xref="GeneID:2890766"
     CDS             complement(479287..482226)
                     /locus_tag="CAGL0L04092g"
                     /note="highly similar to uniprot|P53920 Saccharomyces
                     cerevisiae YNL123w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448952.1"
                     /db_xref="GeneID:2890766"
                     /db_xref="GOA:Q6FLE2"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR025926"
                     /translation="MTIMNEGKKRSHSSSSDDHLAKRQYVEHGNECIMADEDIDTAIF
                     EDGIKNNMQWQDTISKVVKAVVSIHFAQVAPFDCDPALVSEATGFVVDSELGIILTNR
                     HVVGAGPFVGYVVFDNHEECDVIPIYRDPVHDFGFLKFDPKKIKYTKIHALELKPSLA
                     KVGSEIRVVGNDAGEKLSILAGFISRIDRNAPDYGELTYNDFNTEYIQAAASASGGSS
                     GSPVVNVDGYAVALQAGGSTEASTDFFLPLDRILRALKCIQADQPITRGTIQTQWLLK
                     PYDECKRLGLTPEHESTSRALFPDRIGLLVAETILREGPSDGKIKEGDILIAINGQRI
                     STFIQVDDILDSNVGNNVEFTVQRGGTDINVTCTIGDLHAITPSKYVEVCGATFNELS
                     YQMARFYALPIRGVFLSSASGSFNFDNKEKIGWIVDSVNYQDTPNLDAFVEVMKTIPD
                     KSRVTVRYHHLTDQHSPNVTSIYIDRHWCSEFRIYERNDKTGIWDYTNVADPISEEPL
                     KPHTAKFIPIPSTNPEIAKLSSSLCMVHTVAAIPIDSLSAETLKTSGLIIDAEQGYVI
                     VSRRAVPHDCLDVFVTIADSIVIPATIEFLHPMQNYAIVKYDPNLVKAPVVTPKLSNR
                     RMKRGESAQFIGYTHNNRLITSETSVTDISSVSIPSNLIPRYRATNLEAISIDSNISP
                     RCNFGIMTDQDGTVRALWLSFLGERQENKEKVYLMGLDIMDCKNVINILKSGKKPQVH
                     IIDAGFGSISILHARIRGVPEEWIQKMEAESNNRLQFITVSRVSYTEETVKLQTGDVI
                     LSVNDKLVTEMDQLSGIVHASDENIDSHVLHFKVVRDGKIVDLDMKTVQVDETDQIVI
                     FAGCILQKPHHAVRQAMSDIPKGVYCTFRGESSPAIQYGISATNFITHVNEIPTPDLD
                     KFLEVVRQIPDNTYCKIRMMTFDNVPFAISLKTNYHYFPTAELKKNKDTGKWIEKEYN
                     NSQEIPK"
     gene            complement(<482705..>484447)
                     /locus_tag="CAGL0L04114g"
                     /db_xref="GeneID:2890767"
     mRNA            complement(<482705..>484447)
                     /locus_tag="CAGL0L04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448953.1"
                     /db_xref="GeneID:2890767"
     CDS             complement(482705..484447)
                     /locus_tag="CAGL0L04114g"
                     /inference="similar to AA sequence:UniProtKB:P53919"
                     /note="similar to uniprot|P53919 Saccharomyces cerevisiae
                     YNL124w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448953.1"
                     /db_xref="GeneID:2890767"
                     /db_xref="GOA:Q6FLE1"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE1"
                     /translation="MSEDLFTKALQNPDEKVDGHLSDDIRIESKSENITKLEEKLDNA
                     TEQENDNVSVEESPTFNSKLHENDHGLETEQSDEKTENTEVTLNKDETTISSTNRGEI
                     EQNITSSAEKPTEDQQQEVSDHSQEDSNSNLNEDSDTSSLDSSSSQSSSSSSDEEDIN
                     VDVENESDLEDNGTSAPIVSKNEVLEDQTADLPESYVIDEKTNISSIGTVKSVLDNNL
                     IITADISGEKRVLEEGSIFCLEDRTPLGVLREVFGPLQAPFYRVGVSESYKKNNDLKS
                     LIGIKVFIVLKDVHWIDTFQIKMIKGTDASNMFDEELPEEEQEFSDDEKEAMYKKQKK
                     QKKRKPEKTGRADTNDSNTKKVRSDNFPVVQKMRPPIGMSRPKNYTSRSSREKTKILD
                     YDDGNASIRSHAVDQSKGVQVSQLQPSINLPSTSSYIPPNDGNFHNPSGFPTGNPTGF
                     IPNMPQNQFIPPVFPYPTNFNPQYSQYNAPPMQGSFPNFQPQPMSSQGMYPPPTNNGY
                     PYLPNMPFNGQQQFQNQQQIMQQNPQSYQSSQQAYQLHQLLMQQQQSPHHTEQNQGQS
                     NSPTNQGNQSFFHQ"
     gene            complement(<484823..>487312)
                     /locus_tag="CAGL0L04136g"
                     /db_xref="GeneID:2890768"
     mRNA            complement(<484823..>487312)
                     /locus_tag="CAGL0L04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448954.1"
                     /db_xref="GeneID:2890768"
     CDS             complement(484823..487312)
                     /locus_tag="CAGL0L04136g"
                     /inference="similar to AA sequence:UniProtKB:P53540"
                     /note="similar to uniprot|P53540 Saccharomyces cerevisiae
                     YNL126w SPC98 spindle pole body component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448954.1"
                     /db_xref="GeneID:2890768"
                     /db_xref="GOA:Q6FLE0"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:Q6FLE0"
                     /translation="MELGNSLSLLLETYLPPEFPDTVIQLFAKDVLFLLSSPYKNKQQ
                     LSKLIENFQSKIPVTLRHRNTLPKLLSSLEPLFSMSNEQEMLNYVNELQMEYSDNPND
                     QFILNRLNISPYDGNLNMGRPGSQYSESFENLDRYSERSMLSSQAYNNIGKSPNRLPL
                     RSLLEPYMKNMIDEQEIMKSIPFVLLGTTSELFDIEYDKIIIPSNIPNSESGILHLIF
                     EAGLLYKELGNLCDKYRRMPISPMKKAFIIAVGSELNTYNGLINQLASNDKISTNNGV
                     YVSIYDSINKLRVFYSIMLKFEGLTGDQLLSLLEQLRHHGDLTIENIADKLFSTLLTL
                     YYDYLSQWLTLGSIDNTNNELFIEVEQENTDGEVIFKLNTDKIPSFLTYMQARQIFVI
                     GKSYIFVQKYCKELEYSNEFSNRYKQIYDGLRKNGISIEFIEAVNTQFKEIVSYIDTI
                     ICTKFHYHDVLKTLRNILLMGRGDLINTLITKLSSALTSSSDLLSDYSLTRILQESVQ
                     QSSLRSLINRGDNNYIINKLDARLLDLGHGAIGWDVFTLDFIVDRPLSFVLNVNRTNG
                     RKEYLRIFNFLWKLKKNQFYFEKESKRTKEILRTFRKFPEFSPVMGDITKHISKCSIL
                     LTQLQIFHTKLDNYYLQYVINERYLDLENELSVIFDKEKTDNIKVKINKHGEKRVNGV
                     LKPDINILNEGRKHLGNQNLRDIEQLDNTHNQFLGRILAHKLLSTNSGNNLGERSNKP
                     YPATVIVILNSIAEFLVKYNELNEISYKIYMQLSLEHHPEISVHLQSLVHTIKLLSKQ
                     YSHCKEQISTLCDDLRADGDEELMRLSRHLR"
     gene            complement(<487865..>490663)
                     /locus_tag="CAGL0L04158g"
                     /db_xref="GeneID:2890769"
     mRNA            complement(<487865..>490663)
                     /locus_tag="CAGL0L04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448955.1"
                     /db_xref="GeneID:2890769"
     CDS             complement(487865..490663)
                     /locus_tag="CAGL0L04158g"
                     /inference="similar to AA sequence:UniProtKB:P53917"
                     /note="similar to uniprot|P53917 Saccharomyces cerevisiae
                     YNL127w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448955.1"
                     /db_xref="GeneID:2890769"
                     /db_xref="GOA:Q6FLD9"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="InterPro:IPR021819"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD9"
                     /translation="MTKKAKVHLLDRDSEAIGRSQSLEDLKYARKTGGTDTSFQHFID
                     DIPTENRGASSYPSSPRAKGAIDKGISDLDKMLRKKLDIVSSVLNVHNEESSISNLEN
                     ANRSPYLNRSLIDTDLSNIELSPLDFGQYNSNPISGDQFGDSDSIDDDNDDEEFQNVD
                     EIDGPIVSNPSSDSDSDSEIIDYNMPVNAAYRRSLEECAEKITNECGFKPSLQPRVEW
                     YLEDSISLDDEISDWFTLADYSSFTHIHNAFIKHINNAEAFLTDETIAQLHIQKLLSN
                     MNDNDESIVMCVAYISFGLFAFVEGKDDHLKYIKRNNMLLAEHLPEILKKFIEIADCC
                     KDSSTNLNCYSKSLLYLSSVIYLITLQCIVFRCNKEQQHIVDKVIGNFDDAGILSYLT
                     KYIEAWRWNSRLSMRIRNIIMLLSKVILLQFGDIRTYKKTKKDLYKYHGLRKIENRKN
                     KWTISPLQYEAFTSDIVTRYPSCKLPTTNLPKEFDKSNSLSQFLEIPRPKSKNAINIT
                     LNVPEQHIATPAPSPPSSPQLLHFNETSKGRKSFQTNLLYPCLYPSDNEEDIDELDRR
                     LHSELTPKQTSESKIPFSIEEAATILAENLQIKLTTKQLWHERDLFMATERGWEEDNL
                     TDPYDYSSLTGTANESLKRMIRVDNFYKECFTSLNSLVFVLLQTIELNLTNQFTSNAE
                     DVDENTLLPQLELTKAKESSLKSSVELLFMLMKWFKLSHILKFEQLGVILYDSQFINI
                     CSAVLGKYSDIYGDRIFNRIITSNKSFWSECSKYNFEYKNSFRYVHQVQKAVNLDFLP
                     SLAYLLRILQKVVGNKTQRIKELPQSIGTIVKKYYHIFNLDIYHPLLKIIKELTPFKN
                     KRWKSEHMELISGVFLYEKLELIDNWVAGKDITGELSDAYGQEIALRALLQFYNFEHY
                     QVAMEDLGYQKKNNSIAS"
     gene            complement(<491185..>492477)
                     /locus_tag="CAGL0L04180g"
                     /db_xref="GeneID:2890770"
     mRNA            complement(<491185..>492477)
                     /locus_tag="CAGL0L04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448956.1"
                     /db_xref="GeneID:2890770"
     CDS             complement(491185..492477)
                     /locus_tag="CAGL0L04180g"
                     /inference="similar to AA sequence:UniProtKB:P53916"
                     /note="similar to uniprot|P53916 Saccharomyces cerevisiae
                     YNL128w TEP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448956.1"
                     /db_xref="GeneID:2890770"
                     /db_xref="GOA:Q6FLD8"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD8"
                     /translation="MPTINRSTDYTIRGPMGNLHLNPKKFVRTLYAIPFNVENSSSES
                     SLDISYITPNLLVCSYPVTKYPKLLYRNGLDEIVEYLNKHHGKGTWKIFNFKVEKNGS
                     DYDDIDIKNADDKTLYFPNYQRPSSTSCRGQRTTTLNGINSLICRKGWLDHCPPPFLL
                     LQEIIDDMNLHISQSESNVAILHCRMGKGRSGTISIAYMMKYMNCPFEEAKELFMEKR
                     FRMGLSKGVTINSQIRYIRYHELSLYYGINCNSMIVDQIKMSRFQLESITLQAMSGIL
                     FSHPYYTAVKISKYNNNRDGLIDLISVQTPEQVSTTKALYFKNSKNITIDINVPVEVS
                     DIKIEFSLVARSHAMSHRITTLASNSNCWLNLYWETVRCSKTNSTNNFLLNELRHEQN
                     NGLKFIFIIRWNELDGTSGTRSKGLRLFSSCILKWSLL"
     gene            complement(<492759..>493490)
                     /locus_tag="CAGL0L04202g"
                     /db_xref="GeneID:2890771"
     mRNA            complement(<492759..>493490)
                     /locus_tag="CAGL0L04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448957.1"
                     /db_xref="GeneID:2890771"
     CDS             complement(492759..493490)
                     /locus_tag="CAGL0L04202g"
                     /inference="similar to AA sequence:UniProtKB:P53915"
                     /note="similar to uniprot|P53915 Saccharomyces cerevisiae
                     YNL129w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448957.1"
                     /db_xref="GeneID:2890771"
                     /db_xref="GOA:Q6FLD7"
                     /db_xref="InterPro:IPR026681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD7"
                     /translation="MTNSDSTQVVLVSLSGCSSSGKTTIAKLLARIVPDLTLIHEDDF
                     FKHDKDIPVNSKYGIQDWDCVGALDFDSFRAELDNIRHTGRIDAKLIHNNNVDSLDKF
                     NLNEASLQPIREKFESLPDNLRIVLVDGFLIYHDKSVASKFDVRLLIRAPYETLKKRR
                     AARPGYQTLDSFWVDPPYYFDDFVYKNYKEAHAHLFIDNNVEGQLKYELNDSIKDFNN
                     DEDVQISTALTWVSDQIVNYCSSLR"
     gene            <493841..>494344
                     /locus_tag="CAGL0L04224g"
                     /db_xref="GeneID:2890772"
     mRNA            <493841..>494344
                     /locus_tag="CAGL0L04224g"
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /transcript_id="XM_448958.1"
                     /db_xref="GeneID:2890772"
     CDS             493841..494344
                     /locus_tag="CAGL0L04224g"
                     /note="highly similar to uniprot|Q12487 Saccharomyces
                     cerevisiae YOR150w MRPL23"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL23"
                     /protein_id="XP_448958.1"
                     /db_xref="GeneID:2890772"
                     /db_xref="GOA:Q6FLD6"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR005823"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD6"
                     /translation="MSQKVGHTGLAFARLWHHVDLAKDKRTLGRVASSIAVTLIGKHK
                     PVYHPSQDCGDYVVVTNCQKVRITGKKFEQKTYWSHSTKPGNLKLTTMKTMAENKGYG
                     ELLKKAVSGMLPKNRLRKVRLARLKVFDGAEHPYGDNFTAYALKQPKVQKLIESRQER
                     TQVSQEA"
     gene            complement(<495023..>498694)
                     /locus_tag="CAGL0L04246g"
                     /db_xref="GeneID:2890773"
     mRNA            complement(<495023..>498694)
                     /locus_tag="CAGL0L04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448959.1"
                     /db_xref="GeneID:2890773"
     CDS             complement(495023..498694)
                     /locus_tag="CAGL0L04246g"
                     /note="highly similar to uniprot|P08518 Saccharomyces
                     cerevisiae YOR151c RPB2 DNA-directed RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448959.1"
                     /db_xref="GeneID:2890773"
                     /db_xref="GOA:Q6FLD5"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /translation="MSADNEDYYDEDPYGFEEENAPITAEDTWAVISAFFREKGLVSQ
                     QLDSFNQFVDYTLQDIISEDSTLILEQLAQHTTEQDNISRKYEISFGKIYVTKPMVNE
                     SDGVTHALYPQEARLRNLTYSSGLFVDVTKRTYEAVDVPGRDLNYQLIAEESEEDSES
                     GKVFIGRLPIMLRSKNCYLSDATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAG
                     NIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGRESSSARTIKATLPYIKQ
                     DIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGR
                     RGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKD
                     QDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTKDIFRYMQRTVEEANDFNMKLAINAKT
                     ITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAK
                     PRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGADPMPIITFLSEWGMEPLED
                     YVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREQELKI
                     FTDAGRVYRPLFIVEDDEELGRKELKVRKGHVAKLMATEYQDIEGGFEDAEDYTWSSL
                     LNEGLVEYIDAEEEESILIAMQPEDLEPTAVEQDIPKENVDLAKRIKVTHHATTFTHC
                     EIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNFRMDTMANILYYP
                     QKPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFR
                     SYMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDEDGLIAPGVRVSGEDIIIGKT
                     TPIAPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVRTTKV
                     PQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLL
                     SKVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGP
                     TYYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFL
                     KERLMEASDAFRVHICGICGLMSVIAKLNHNQFECKGCDNKIDIYQIHIPYAAKLLFQ
                     ELMAMNITPRLYTDRSRDF"
     gene            complement(<499667..>501010)
                     /locus_tag="CAGL0L04268g"
                     /db_xref="GeneID:2890774"
     mRNA            complement(<499667..>501010)
                     /locus_tag="CAGL0L04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448960.1"
                     /db_xref="GeneID:2890774"
     CDS             complement(499667..501010)
                     /locus_tag="CAGL0L04268g"
                     /note="highly similar to uniprot|Q99312 Saccharomyces
                     cerevisiae YOR155c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448960.1"
                     /db_xref="GeneID:2890774"
                     /db_xref="GOA:Q6FLD4"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="InterPro:IPR023214"
                     /translation="MSSRYRVEYHLKSHRKDGFIDWIKGLLAAPFVLHAVSHDGDDND
                     ELATTQRVRSQYAEIFKDIESLVSDKILFDERNDQYRQYIESNDVEEVIPLGQPRLDL
                     LVPTIGTFFTQLPLEKAFLWEDARKAISSRRMVAPSFNDIRHILNTAQVFHFIKQRKL
                     KSKDQLRMCTFDGDVTLYEDGGSIVNTNPVIPLLVKLLSEGVCIGIVTAAGYDEAKTY
                     ESRLNGLITALNGSDLPYAKKRNLCVMGGESNYLFRYYEDGESFGFEAIDKEGWLLPR
                     MCTWSQDDLTQTLDFAEKTLYRLKKRLNLPEEAIIMRKARAVGIVPGHFKDPETGNMV
                     KIQLDREQLEEVVLTLQNSLEGFAPAQRIQYSCFDGGSDVWCDIGGKDLGVRALQHYY
                     DPENPIKPSQTLHVGDQFAPVGSANDFKARLAGCTLWISSPKETVEYLRRLIHDE"
     gene            complement(<501511..>503775)
                     /locus_tag="CAGL0L04290g"
                     /db_xref="GeneID:2890775"
     mRNA            complement(<501511..>503775)
                     /locus_tag="CAGL0L04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448961.1"
                     /db_xref="GeneID:2890775"
     CDS             complement(501511..503775)
                     /locus_tag="CAGL0L04290g"
                     /inference="similar to AA sequence:UniProtKB:Q12216"
                     /note="similar to uniprot|Q12216 Saccharomyces cerevisiae
                     YOR156c NFI1 interacts with CDC12P in 2-hybrid assay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448961.1"
                     /db_xref="GeneID:2890775"
                     /db_xref="GOA:Q6FLD3"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD3"
                     /translation="MATSGGLQREMEDAANSIESLRVSDLKAICRSISLGVTGRKVEL
                     QDRIKQFIKQSMAKGHIDPWRPKAIKILAQKAILNEDLPQYEQLWLSLRTGAFAHPVA
                     TGHAPAETLGRGATNIMGASAVRPSDVNPYQISASHTAATRSTTAKSRNPNLKDPFTC
                     RASIFYKIKKMIPGSGLRLKQHNGRERKITSFKLNASDYDYIKQNPNHKVYLFCGLFA
                     SLESGGDKSIEFPLPNEITINNTVLRENLKGLKNKKGTVKPVDITEHIRPAGQHNVLE
                     IIYVYAKVDYYMYCCTVEEKTPEFLIDSIKDRQVIPKLETLQYIDKMMNDEDDEFVTT
                     STIMSLQCPISYTRMKLPVKTRKCDHLQCFDAYWFLHSQKQVPTWECPVCSKEVDLNS
                     LATSEYVLEILKNTDDEVEQVEISADGSWKPIQEEEEDHRPQSGAVGMKRSASDNDED
                     ENLLHPKKKHTEEPVVISLDSSDEEDLPLNETIRANSTRDSETNRLPNESVSRSSTVS
                     NSNSVVMNGDSVLPGTEIGQTSGDDSARTTTGNHINSTVIENTTVSNGEDVTVTALAS
                     NQPQTPVSEPPVVNNVAGSTSGDSVGSSPPRRASRLERRGSVISTTENLLGLSGSPVQ
                     LNSITTSTQDQTETTQQAKDTEQEKTHQQKANKSISAPTPTTEPSPALRDIPVVERNI
                     FSKRTNEPQLVSPFIPKKPYAYLARRRQQPPAASQPEKMNTSSSSTGPSASFNSSTHA
                     STSVSDIIDLTSDD"
     gene            complement(<504465..>505250)
                     /locus_tag="CAGL0L04312g"
                     /db_xref="GeneID:2890776"
     mRNA            complement(<504465..>505250)
                     /locus_tag="CAGL0L04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448962.1"
                     /db_xref="GeneID:2890776"
     CDS             complement(504465..505250)
                     /locus_tag="CAGL0L04312g"
                     /note="highly similar to uniprot|P25043 Saccharomyces
                     cerevisiae YOR157c PUP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448962.1"
                     /db_xref="GeneID:2890776"
                     /db_xref="GOA:Q6FLD2"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD2"
                     /translation="MAGLSFDNYQRNAHVSKVSGADVKATSTGTTIVGVKFAGGVVIA
                     ADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGSNIELHSLYTNRS
                     PRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYQSLGSGS
                     LAAMAVLESHWKPDMTKEEAIQLAADAIEAGIWNDLGSGSNVDVCVMEIGKDAEYLRN
                     YRTPNVREAKQKSYKFERGTTAVLKESIVTICDIEEHAVDITA"
     gene            <505910..>506827
                     /locus_tag="CAGL0L04334g"
                     /db_xref="GeneID:2890777"
     mRNA            <505910..>506827
                     /locus_tag="CAGL0L04334g"
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /transcript_id="XM_448963.1"
                     /db_xref="GeneID:2890777"
     CDS             505910..506827
                     /locus_tag="CAGL0L04334g"
                     /inference="similar to AA sequence:UniProtKB:P17558"
                     /note="similar to uniprot|P17558 Saccharomyces cerevisiae
                     YOR158w PET123"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="XP_448963.1"
                     /db_xref="GeneID:2890777"
                     /db_xref="GOA:Q6FLD1"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD1"
                     /translation="MSGKGVYRKSGTLPVTRQILKKPTTGQKYLLDELKKPKPKGMKG
                     VGYAAGVLQPRGSHRISPPVEFVDVEKLIDSTVRTPSKDTEARSQQAKDKLNKAELRR
                     QYLAESFRKEEERLIKMHELIQKREQLVQEQRQREMEELNEPRSSDLTIPSLNEMVSG
                     KLMRDRTPEEKELLEMKRRYNRETQELRIQENKLKKLLNLYHMSSEFITTEEQLLATI
                     ENVFSTRTATSSFDSIKSLPKNSITKGNNAFAQDLFFGTNTRNDTSEVGLPMVQDFIS
                     GELNRLHTKAKENLEVQLEQQKNSSKIDL"
     gene            complement(<507045..>507329)
                     /locus_tag="CAGL0L04350g"
                     /db_xref="GeneID:9488039"
     mRNA            complement(<507045..>507329)
                     /locus_tag="CAGL0L04350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999542.1"
                     /db_xref="GeneID:9488039"
     CDS             complement(507045..507329)
                     /locus_tag="CAGL0L04350g"
                     /note="highly similar to uniprot|Q12330 Saccharomyces
                     cerevisiae YOR159c SME1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999588.1"
                     /db_xref="GeneID:9488039"
                     /db_xref="GOA:B4UN45"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:B4UN45"
                     /translation="MSGKSKGKAIVPPINCIFNHLQQQTPVTFWLYEQVGIRIRGTIR
                     GFDEFMNVVIDDAVEVPIEAKSGRELVDQGTKLGRILLKGDNITLITPIE"
     gene            <507792..>510683
                     /locus_tag="CAGL0L04356g"
                     /db_xref="GeneID:2890778"
     mRNA            <507792..>510683
                     /locus_tag="CAGL0L04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448964.1"
                     /db_xref="GeneID:2890778"
     CDS             507792..510683
                     /locus_tag="CAGL0L04356g"
                     /note="highly similar to uniprot|Q99189 Saccharomyces
                     cerevisiae YOR160w MTR10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448964.1"
                     /db_xref="GeneID:2890778"
                     /db_xref="GOA:Q6FLD0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FLD0"
                     /translation="MATVNNVVGALQCISSNNSQDEKNKALQYLEQFQRSSEAWMICH
                     DILNNNSTEQSLELQIFAAQTLRNKVTYDLTQLGDNLSSFKDSVLQMLTSHNNNLVIT
                     QLNVALARLSIQYLNWKNPIQEIITVLNPYPVALLGFLRVLPEETLDIDSTPLTEDEF
                     NSRIHELINTIAQDVLQFLITCAENIRSGNSNIKLDHVLKCISSWSFEFSVDQLVSVT
                     PLMNLIFDALLNGNEDHPDIFDAAVDCLCVVLKESRDASNDQMVLALYEKLIELQQKL
                     LPDLESVSADNDSWDPDLLEGLTRLFVEAGEAWSVFVSKSPEIFRPLVKVILLLSCKN
                     TDLDVVAYTFQFWFTLRQNLVLPRYQKSKLAYTDLYLDLINGIILHLRYPDEQFSSKE
                     EEDKFKDFRYHMGDVLKDCTAVVGTSKALTQPLDALNIAISSNSSWQYIEAPLFSMRT
                     MAQEISLTENKLLPQIMQIICTLPEHPKVRYASTLVLGRYTEWTSKHPETLELQIQYI
                     LNGFQQASAGDKELIPASAHALMYFCSDCAELLSSFVDQLIEFFFNVQESIDIESQFE
                     LCQGLSAVINKQDGPILITTFQKLLDQNLNKTNSLIPKWKQNPSEFSRLIADQIDLLY
                     ALFEELKPKFHYPAQGADPLLPQIELIWTTLRSLLIEHGALTDEQIAERTSKFLRRLF
                     ENYHIFCESILPSVAEVLVQGYSSTGFGSYLWCSGSVIVIFGDDESFPVSPQLKDSVW
                     NFALSQCQTFMVNFNKINQRELKNYHDLVMDFFSMISDLLMFYPENFIFSTELIQQIL
                     KVAELSLTNIEQYDTYILIIRFIDDLISWGFKTPPISTLAIELVPDEWRKSILETVIV
                     KNGSTLIDSFFVGIIYKFDSSAHSDAISTIVKCLRLAFEGSNNQPDVIVGWLEHACLT
                     LGNVDLKEKERLLTEVVRGLNRRDFRKVREGVRFFVEWYLRKNVNSRLG"
     gene            complement(<510907..>512580)
                     /locus_tag="CAGL0L04378g"
                     /db_xref="GeneID:2890635"
     mRNA            complement(<510907..>512580)
                     /locus_tag="CAGL0L04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448965.1"
                     /db_xref="GeneID:2890635"
     CDS             complement(510907..512580)
                     /locus_tag="CAGL0L04378g"
                     /inference="similar to AA sequence:UniProtKB:Q12412"
                     /note="similar to uniprot|Q12412 Saccharomyces cerevisiae
                     YOR161c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448965.1"
                     /db_xref="GeneID:2890635"
                     /db_xref="GOA:Q6FLC9"
                     /db_xref="InterPro:IPR007603"
                     /translation="MSTEKQYQPQQPPPAYTGQGPDNGNAYGYPESYGKTETHSGDSC
                     SGDTSMNPQQQGQQYQFRKDDEFYNLNHEGAGAPIGSYAEVFPTEDNNKPKFNDWPFI
                     IVFLLTLCGFIVVASLTLRAWSQTYSSTGSGIYHDFDTGTLNTNSVILLVFSVVIAIF
                     FAFIGIVLCRAYPKFFIYAGMIVNILAALGTAIMYMSLKYWSAGIVFLIFTFMTAWCY
                     WGMRSRIPLTVAILRVIVLAMKNCPQSLFVSFFGTIVASAFAMLFSTVVVATYMKYDP
                     SNTNSGCNVSGGDCSHAKLIGVLVVVFFCGYYISEVIRNVMHCTVSGVFGSWYYRYKS
                     DQGMPKWPAMGAFKRAMTYSFGSICFGSLIVSIIETFRQLLQLGKQAAIASTDNANWI
                     RIIFWLIDMLVGFIQWIAQYFNHYAYCIIALYGKPYLKAAKQTWYMFREKGIDALIND
                     NLVNVALGFYSLFASYMSCLFAFLYLRFTKPGYNSDGDFNAPLMAFAFVIALQLTNIA
                     NETIRSGCATFFTALGHDPEVFQAQYPDRFDEIFRSYPQVLNKLTHQDV"
     gene            complement(<513759..>516722)
                     /locus_tag="CAGL0L04400g"
                     /db_xref="GeneID:2890636"
     mRNA            complement(<513759..>516722)
                     /locus_tag="CAGL0L04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448966.1"
                     /db_xref="GeneID:2890636"
     CDS             complement(513759..516722)
                     /locus_tag="CAGL0L04400g"
                     /inference="similar to AA sequence:UniProtKB:Q12340"
                     /note="similar to uniprot|Q12340 Saccharomyces cerevisiae
                     YOR172w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448966.1"
                     /db_xref="GeneID:2890636"
                     /db_xref="GOA:Q6FLC8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC8"
                     /translation="MSTSPPVEEEPVQSPRDNDKNSDCKRPKKRFKPLKSCAFCRKRK
                     LKCDKQKPRCSSCARRNLPVCVYIENAFTAEMVQNGTVSSLQLLERIRTLEKQLADKE
                     TKNMLKSINESRSNDYGLNMMSDASKSPLGIPGSIDTLSPDSVSGRSSYSVNPYLNHS
                     YLQAKSYGRVTLYGPTSLRTYILNQNSDFAKKYQSLWVKIKEERQKYKKKHEISLLRE
                     LKTVETLPISDHGSLLADICKELPSYAQIAQIVSSFFDTEETNELNQILDKQKVMKDF
                     ADYFITGNRKNDDGELLIEKLVPDNKYNLYKLGIILMILCIKHFFEEMPASIEKYFIF
                     IAGLTSGKTMYIEKAQFLVMYCYYRTIYSSRGDTTHLLNLLFSLTGLVQTLALNTDLE
                     HTYGNMQNLVGSIDSLKKLYVWILYLDYWVCFEAGRPLLLQYKPNELKQIKPSKNQYD
                     SYYKRMIGFLSLARPMMNVLFNSAVDPPLNAYCKLIYQFIEDEFRSIGNCRNLSLVES
                     FPLNDLRVLTLALATLETFYSMRIKYRNEDDVDLKDDSVHCLTVSLSLTISLLVRCFN
                     IDKIKNKEFFSPNCPHLPPYMALSISISNNLFARSISILSVFLYFKVTLFEDNPRLLS
                     RPEEVGFVSPGLRRGKGKSISVLHAFQEYSDVFDNFLSMENNSMKNIMLRSYIFFIQI
                     SLEKVNRKIIDKVIEYRKKTEETMLRNETRPTANEYVKDNAVMHDSATLNQSITTGSN
                     ELNNSKVMLPSIVGKDYNNNTYYKQGMPNIMGQNTNANVGQYVTNRFPNNIDQVDMMS
                     NVYQSAMLSPNNGSPYPRSPSVHSPYNGRLPGAQGDGYRQYEQSTRNIQYEAYPSQMQ
                     LPNRTIPQIADRSPYSLSSHSGVGSPQAIIPTVKYTQEPKSIGLPPLAYKNDSPFGER
                     PKPPSLDKYDEAQFPSGHAMAKGIPIANIANPAQMPKVMSTNPLSQAMAEEFWQNYNL
                     GWEKLVSQTDPSSFI"
     gene            <517372..>517902
                     /locus_tag="CAGL0L04422g"
                     /db_xref="GeneID:2890637"
     mRNA            <517372..>517902
                     /locus_tag="CAGL0L04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448967.1"
                     /db_xref="GeneID:2890637"
     CDS             517372..517902
                     /locus_tag="CAGL0L04422g"
                     /inference="similar to AA sequence:UniProtKB:Q99321"
                     /note="similar to uniprot|Q99321 Saccharomyces cerevisiae
                     YOR163w DDP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448967.1"
                     /db_xref="GeneID:2890637"
                     /db_xref="GOA:Q6FLC7"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC7"
                     /translation="MSLSMEARSGRANQVYGEDGARLVAGCVCLTSDRHHVLMISSSA
                     NRNKWILPKGGIETDEPDYKQTAIRETWEEAGCTGEIVSSLGVVKDMRPPKAKTMDRA
                     TFERAKSDAEVNKNPPRSEFHFYELIIGKLEDNFPEMHKRDRKLFTYREAKQNLVEAK
                     RPELLEALTRSSIIKD"
     gene            complement(<518055..>518978)
                     /locus_tag="CAGL0L04444g"
                     /db_xref="GeneID:2890638"
     mRNA            complement(<518055..>518978)
                     /locus_tag="CAGL0L04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448968.1"
                     /db_xref="GeneID:2890638"
     CDS             complement(518055..518978)
                     /locus_tag="CAGL0L04444g"
                     /note="highly similar to uniprot|Q12125 Saccharomyces
                     cerevisiae YOR164c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448968.1"
                     /db_xref="GeneID:2890638"
                     /db_xref="GOA:Q6FLC6"
                     /db_xref="InterPro:IPR007317"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC6"
                     /translation="MDSAVGAKLAKTLQRFESRIAAGDYYEAHQTLRTIANRYVRSKS
                     YDHAIELINQGALSFLKAKQGGSASDLIFYLLEVYDVADIKVSETSVGRLAQLLVLVD
                     DQEPNLKDIVTGMNNWSIKHSEFKFGDPTLHNVIGNKLVAGGLVYEAERYYMLGTHES
                     VGKYVDLLWSWFTQANDNSSVADYFSRLVMNYLFIQNIAYAYEAKELFLKKFIDHVSP
                     KVQTVDKNSFKLNYFNDYSDLNFLQLLLLTCQTGNKDLFQNLKEHYSESASKYKNELS
                     YLGQEYFGITAPKQSNFLQDMMSGFLGGPGK"
     gene            <519292..>521643
                     /locus_tag="CAGL0L04466g"
                     /db_xref="GeneID:2890639"
     mRNA            <519292..>521643
                     /locus_tag="CAGL0L04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448969.1"
                     /db_xref="GeneID:2890639"
     CDS             519292..521643
                     /locus_tag="CAGL0L04466g"
                     /inference="similar to AA sequence:UniProtKB:Q99287"
                     /note="similar to uniprot|Q99287 Saccharomyces cerevisiae
                     YOR165w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448969.1"
                     /db_xref="GeneID:2890639"
                     /db_xref="GOA:Q6FLC5"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTSQAIQLIDVNKEYNKESLEYFKQCVGTRDVGFNYHVISVFGS
                     QSSGKSTLLNILFNTQFDTMDAQVKRQQTTKGIWLAHTQNVNNHKSTTDTDSDYFILD
                     VEGSDGAERGEDQDFERKAALFAISVSEVLIVNMWEQQIGLYQGNNMGLLKTVFEVNL
                     SLFGKRGNDHKVLLLFVIRDHVGVTPLKSLQESLITELEQIWSELNKPTGCEETTLYD
                     FFDLEFKGLGHKLLQEEQFYDDVKSLGDSFIDSESNEYLLKPNYHHKLPIDGWNMYAE
                     QCWEQIENNRDLDLPTQQILVARFKTEDIANEAYAKFTEEYETETEKRINDKTELVSY
                     LKKIKDECLGEYDEHASRYAKAVYEEKRIELVDKVNERLFTTASKYLDMLTAVLLTKL
                     ENGMKEKENIKLPFEDRYLKLFKDIEAEFDAAITEFFSKDLLTKIKDFELKFAADVHE
                     KKLQLRESELNALLSKIKKQLTLRIKDEEIELLSKPTPDLWDKVTDTFENIMKKTLSR
                     FATGEGEYEFKMGLSEDENKKQYHAIRAFAWTLLETVVHDYLKEDTIVSLLRDRFESK
                     FRYDSNDVPRLWKNEDEIDQSFRVAKEHALEILDILTLAVKTDGTEVIPDAFEDEPNE
                     GLIYDDSHDVYHSNRFAHILNETQKEKVQQQFRRQINVTVLDCKRSIVTSSTHIPIWI
                     YAVIVVLGWNEFMIVIRNPLFVTLALLSIVSFYFIQKFGLWGPVMNVVNTALGESRTT
                     IKEKLRQFVLEEHELKKTAKVEEEIELQDLSKNSSSSGNEDSD"
     gene            complement(<521846..>523090)
                     /locus_tag="CAGL0L04488g"
                     /db_xref="GeneID:2890640"
     mRNA            complement(<521846..>523090)
                     /locus_tag="CAGL0L04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448970.1"
                     /db_xref="GeneID:2890640"
     CDS             complement(521846..523090)
                     /locus_tag="CAGL0L04488g"
                     /inference="similar to AA sequence:UniProtKB:Q12104"
                     /note="similar to uniprot|Q12104 Saccharomyces cerevisiae
                     YOR166c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448970.1"
                     /db_xref="GeneID:2890640"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC4"
                     /translation="MLKSKHGNAKYTVADIERQAGLEPTPQNRQERQGPERQGPERQG
                     PATPHPEDNAVPEQLILDTDGDQDFEMSDVVSEVQIESISNYLAEQRMAVDPISPQSY
                     TIPQSMLSEQDVSTDKTVFVVDTNFLISHLNTLEELRKLAGQFNHIIVAPITTVRELD
                     GLKLASDKSIAKLARHANEWLFKNLGDRSSGLVGQRLKERINPSASKDDAILDCCLYL
                     QQKLNHKLVILLSNDKNLCAKALSEGMLTVSYRPGMTAQLISQMAYSESISLGNATPS
                     PQFSKLDFHEVANKIFNDIQAMVITIVDHIMNKSYGEDIIAINYDPKNMKDLNDVARV
                     ISKFWLSVFSDYFDRNSMRKEDWKELPSQMVTVPNSSSDLNTFLGFWEGILLKLNRDL
                     GENDQHVVQAAIAEWKQYIDLV"
     gene            complement(<523561..>523764)
                     /locus_tag="CAGL0L04510g"
                     /db_xref="GeneID:2890641"
     mRNA            complement(<523561..>523764)
                     /locus_tag="CAGL0L04510g"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_448971.1"
                     /db_xref="GeneID:2890641"
     CDS             complement(523561..523764)
                     /locus_tag="CAGL0L04510g"
                     /note="highly similar to uniprot|P02380 Saccharomyces
                     cerevisiae YOR167c RPS28A or uniprot|P02380 Saccharomyces
                     cerevisiae YLR264w RPS28B"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_448971.1"
                     /db_xref="GeneID:2890641"
                     /db_xref="GOA:Q6FLC3"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /translation="MDNKTPVTLARVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNV
                     KGPVRENDILVLMESEREARRLR"
     gene            <524088..>526475
                     /locus_tag="CAGL0L04532g"
                     /db_xref="GeneID:2890642"
     mRNA            <524088..>526475
                     /locus_tag="CAGL0L04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448972.1"
                     /db_xref="GeneID:2890642"
     CDS             524088..526475
                     /locus_tag="CAGL0L04532g"
                     /note="highly similar to uniprot|P13188 Saccharomyces
                     cerevisiae YOR168w GLN4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448972.1"
                     /db_xref="GeneID:2890642"
                     /db_xref="GOA:Q6FLC2"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /db_xref="InterPro:IPR007638"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC2"
                     /translation="MSLEKFGYEEAKIKEITKNQKILSELEKLLGEVQVGELDKTQRA
                     ILHQFATLLAKRKDAGEVSTALVVENVVNGGIKTNLQIDAAFKYVVAHPDVDQETLAA
                     EAGIGVHVGEEDVRRKVVEYIESNKSKIEEQRYKLVPGIMADVKKMPELKWAEPRLFK
                     PIIDEEILKAIGPKDERDVVKKQPKAKKNAKKDDSGDKSSDSKGEKRTMFTEGFLGDL
                     HKVGENPQAYPELMAEHLKATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGV
                     CYLRFDDTNPEAEAPEYFESIKRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKG
                     YVCHCTAEEIKRGRGIKEDGTPGGERHACKHRDQSVEKNLEEFRAMRDGKYKPGEAIL
                     RMKQNLESPSPQMWDLIAYRVLNAPHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCT
                     TEFYLSRESYEWLCDQVHVFRPAQREYGRLNITGTVLSKRKIAKLVDEHFVRGWDDPR
                     LFTLEAIRRRGVPPGAILSFINTLGVTTSTTNIQVVRFESAIRKYLEDSTPRLMMILD
                     PIEVVVENLPEDYEELVTIPYRAGTKEFGDRNVPFTNKFYIERADFSENTEDKEFFRL
                     TPNQPVGLIKVPYTVSFKSVEKDADGKITRIHVKYDNEDKPVKPRTYIQWVPISKKYN
                     SPVRVSETRVYNQLFKSENPSAHPDGYLKDINPESEVIYDKSVIEHNFDHVIKNSPWV
                     VDSVKNSEFYVKEDKSGKEICRFQAMRVGYFTLDKESTDDKIILNRIVSLKDNTK"
     gene            complement(<526735..>528417)
                     /locus_tag="CAGL0L04554g"
                     /db_xref="GeneID:2890643"
     mRNA            complement(<526735..>528417)
                     /locus_tag="CAGL0L04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448973.1"
                     /db_xref="GeneID:2890643"
     CDS             complement(526735..528417)
                     /locus_tag="CAGL0L04554g"
                     /inference="similar to AA sequence:UniProtKB:Q12246"
                     /note="similar to uniprot|Q12246 Saccharomyces cerevisiae
                     YOR171c LCB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448973.1"
                     /db_xref="GeneID:2890643"
                     /db_xref="GOA:Q6FLC1"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC1"
                     /translation="MRHEVAVRATVTDAGIKIKSQTRGFCCPEVVHKPQGLSSILGGC
                     FLSCCAPLGVNDAELSLDPDNSTFSMDEDIAEAPTVSDTIPFGRILGARYRDSSANSQ
                     THETEGLLHGIGHQRYIDLTYACMKDHHVVPCTVPLQIDYVPMAHENPDLVELIIEKS
                     YQNVKRNRSILVIINPHGGKGKAMHIFKKRIEPILIASECSFELMETKYSRHATDIAR
                     EIDLEEFDTIACASGDGVPYEVINGLYMREDKVDAFNKITVTQLPCGSGNAMSISCHW
                     TDNPSFAALCLVKSVESRIDLMLCTQPDSEDPEPKLSFLSQTYGVIAESDINTEFIRW
                     MGPLRFDIGVAFNVLQKKCYPCDIYVKYAAQSKRELSVHYTKNKTTQYLEFENLITET
                     DTESSDSGIPVENITEENLRIKYPVEDGIPNDWVKLDDEIGNNLSVFYTGKMPYVAAN
                     TKFFPAALPADGTFDMIIMKANLPVAKSFPILLSIDKGEHVLDSEVIHSKVLAYKIIP
                     KIENSLISIDGERFPCKPLQVEVLPKLCKTLLRNGKYIDTDFDMLCADTKLP"
     gene            <528957..>531554
                     /locus_tag="CAGL0L04576g"
                     /db_xref="GeneID:2890644"
     mRNA            <528957..>531554
                     /locus_tag="CAGL0L04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448974.1"
                     /db_xref="GeneID:2890644"
     CDS             528957..531554
                     /locus_tag="CAGL0L04576g"
                     /inference="similar to AA sequence:UniProtKB:Q12340"
                     /note="similar to uniprot|Q12340 Saccharomyces cerevisiae
                     YOR172w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448974.1"
                     /db_xref="GeneID:2890644"
                     /db_xref="GOA:Q6FLC0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FLC0"
                     /translation="MLVSTSEGQSVEPSVDTKSILNGNVKKRSKRVKKKVIRTCAFCR
                     RRKLKCDNARPMCSTCVSRKFSTCIYEDTVDTRKVKLEEVFDSVPNLTLLKKVEELEK
                     ALQAVDPDTAAKISHQENSVVNPVADIFFLQSKGSGRKILYGPTSSRTYIRLQSQDFL
                     DRFKQLYAKVKEERNKWKSKNKLSVLKELEVIDGEFELGDTRSLFTQAVAALPSYEAT
                     RRAIQQFFDNTLFHEISSTLDFSKVMNDFYQEFEPGEYINDGKERRIAGVKVSQKRNF
                     YKMAVIVMIVCLQHYNEGVPIAIQRFHIALSGTTTSKILYLERTQFLLLRYYYRELYA
                     PCGDEIHMLNLVDTLCTSATNIGLHLNHSIYEGQEASIGSMKAMENLWIWVIYADVNT
                     SLHVGRPLLINRDLLDDSLPSVLDNDTDKPGSYYWKLKRLLKIARRHIHGIYNRRVIP
                     NLVQYSEDIAQYIEKEFPELYRYTTYEGIDAQSASDYRVLTLAMNLSITYYSLRFIVT
                     KERSLELKNNILQQSLIGVSMVVNLTLYCYTQDLHYYPDAVGTSKYITPYLSFSLSAT
                     NTLFQKAITLFCAMLYYKLTLFERGKFLKKELKDIDQHDLTTLRVAPGRNISLISSFR
                     VYSDLFDRWHNGNASKGMMEVVVRSHTFIVSLALERVNRTLLAKIIEYRTKAEDVWIP
                     LEEMENGVAATSGSMAPPAQIQHEPQQVQPQQAQQTQVQPHTHMAHAHEGSTNGSGAS
                     TRTHSSGTSQGTSQGTSVGMQGNGCPSRIMDVETPLSMVSPVITRDKSANGSIAGSDI
                     SSMYADEILNVPNVDIAADSFLDMDSTEPEDENSNKLAQMLADEFWTNYNSGFPDIVD
                     RIDYNTLFE"
     gene            <531918..>533084
                     /locus_tag="CAGL0L04598g"
                     /db_xref="GeneID:2890645"
     mRNA            <531918..>533084
                     /locus_tag="CAGL0L04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448975.1"
                     /db_xref="GeneID:2890645"
     CDS             531918..533084
                     /locus_tag="CAGL0L04598g"
                     /note="highly similar to uniprot|Q12123 Saccharomyces
                     cerevisiae YOR173w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448975.1"
                     /db_xref="GeneID:2890645"
                     /db_xref="GOA:Q6FLB9"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="InterPro:IPR011145"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB9"
                     /translation="MPTAMNTPPSSSEVYKNKIFRQEAGGVPTIEVEEEKWVPDAGSK
                     NLAKLINEFRFERVLDSDPQTKKISLLGKIGGEDAILTCEKTHFMFEETVRRPSADGR
                     STPVFYHRENQYSCLTGIEGVQEISSNDIYYWGLSVIKQHLQKNPTAKLNLIYPATNI
                     HIRRYDQQELHMVRETPEMYKKYVIPYIKKMTTSEMMKWVNNILYNGAEDHRIVYKHL
                     DPHDEDGFLIFPDMKWDGVNLDALYLMAIVYREDIKSLRDLNSSHQEWLKKLNTTLRT
                     IVPACFNYSIRPDELRIFVHYHPSFYHFHVHIVNVKHPGIGEEMGQGKTVLLDDIIET
                     LNYLGPEGYMNRDLTYVIGENHSLWRHGFDRELDNQLKEDGIPRIPRSISNAIQ"
     gene            <533791..>534585
                     /locus_tag="CAGL0L04620g"
                     /db_xref="GeneID:2890646"
     mRNA            <533791..>534585
                     /locus_tag="CAGL0L04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448976.1"
                     /db_xref="GeneID:2890646"
     CDS             533791..534585
                     /locus_tag="CAGL0L04620g"
                     /inference="similar to AA sequence:UniProtKB:Q12343"
                     /note="similar to uniprot|Q12343 Saccharomyces cerevisiae
                     YOR174w MED4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448976.1"
                     /db_xref="GeneID:2890646"
                     /db_xref="GOA:Q6FLB8"
                     /db_xref="InterPro:IPR019258"
                     /translation="MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFK
                     PQLEIGKQLIEADKKLYSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECH
                     DDLNALPLLEEVEFEKKMILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNF
                     IWPAEDALRKGMLAMASLHGKELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQ
                     DDKKEDDSFVFGANANDAEGDEDKNAGEDEDEAMDSDLDLFNPDEF"
     gene            complement(<534787..>536655)
                     /locus_tag="CAGL0L04642g"
                     /db_xref="GeneID:2890647"
     mRNA            complement(<534787..>536655)
                     /locus_tag="CAGL0L04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448977.1"
                     /db_xref="GeneID:2890647"
     CDS             complement(534787..536655)
                     /locus_tag="CAGL0L04642g"
                     /inference="similar to AA sequence:UniProtKB:Q08548"
                     /note="similar to uniprot|Q08548 Saccharomyces cerevisiae
                     YOR175c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448977.1"
                     /db_xref="GeneID:2890647"
                     /db_xref="GOA:Q6FLB7"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB7"
                     /translation="MYNPIDAGILRISQTYGVDDFMIRFALCLLGSFPLNAVLKRLPN
                     DKKNLKCVYIISMCMLYLVGIMNLIGGVRTLLISSLFTYATSRFYKSSLMPHLVFVFV
                     MGHLALNHSYIQFFVEKAPGQNSVDITSAQMVLAMKLTSFAWSYYDGTYLKDHSYEEL
                     SSYQKSKAIRKHPSLLRFMAYTFFYSTILTGPSFEYADFESWLDCEMFHDLPDQKQGS
                     NKYYRTIPKNGTLAGWKVIQGIFWIVLSTLGPKYFPVSYVLNRETFMKRSFIYRIHYM
                     SLLGFIQRLKYYAAWTIAEGACILCGLGYNGYDPKTKKIKWNRVQNIDVYHVEFAQST
                     KECLEAWNMNTNKWLKYYIYLRVAKKGKKPGFRSTLFTFLTSAFWHGTRPGYYMTFAT
                     GALYQTCGKFYRRNFRPIFLQADGKTAAASKWLYDLICFYVIKLSFGYLVIPFIILDF
                     KTSMQAWSTVYFYGHIIVALSFFAFRGPYAKKVVNACKSLQPLQVEAKQQKEVEKKIA
                     ASSGTLGDILKEKHAYEETRQKSEEPSITLGIPTIDIQDGQWSNAKHEWEEFQKDYFE
                     WREQKGLEIEEENLTKAFQKFKEELVGAKDDSGQRLRRMSFSDYSTDALVQEKENK"
     gene            <537360..>538496
                     /locus_tag="CAGL0L04664g"
                     /db_xref="GeneID:2890648"
     mRNA            <537360..>538496
                     /locus_tag="CAGL0L04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448978.1"
                     /db_xref="GeneID:2890648"
     CDS             537360..538496
                     /locus_tag="CAGL0L04664g"
                     /note="highly similar to uniprot|P16622 Saccharomyces
                     cerevisiae YOR176w HEM15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448978.1"
                     /db_xref="GeneID:2890648"
                     /db_xref="GOA:Q6FLB6"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="InterPro:IPR019772"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB6"
                     /translation="MIMKSIARPGLGFVRHFSHTCSRRTTGIVLMNMGGPSTIEETHD
                     FLYELFADNDLIPISKKYQPQIAKYIAKFRTPKIEKQYKEIGGGSPIRKWSEYQAAEV
                     CKILDETCPDTAPHKPYVAFRYARPLTDETYKQMLQDGVTRAVAFSQYPQFSYSTTGS
                     SINELWRQIKKLDPERKVNWSCIDRWPTNDGLTTAFAENIKKSLETYPKDIRDKVVLL
                     FSAHSLPMDVVNTGDAYPQEVGATVQKVMEKLNFCNPYRLTWQSQVGPKPWLGAQTAQ
                     MAEYLGERAEGVIFIPIAFTSDHIETLYEIGKEVIGESKYKDKFRRCESLNGSPVFIK
                     GMADLVKDHLKSNQLYSKQLPLDFKLGKSNDPVTDFSKMFGKQN"
     gene            <539203..>540558
                     /locus_tag="CAGL0L04686g"
                     /db_xref="GeneID:2890649"
     mRNA            <539203..>540558
                     /locus_tag="CAGL0L04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448979.1"
                     /db_xref="GeneID:2890649"
     CDS             539203..540558
                     /locus_tag="CAGL0L04686g"
                     /inference="similar to AA sequence:UniProtKB:P53264"
                     /note="similar to uniprot|P53264 Saccharomyces cerevisiae
                     YGR110w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448979.1"
                     /db_xref="GeneID:2890649"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB5"
                     /translation="MSISKFGKRSFRNVASKLLRLSSLGEKSSEVVGKDGSAIIHATA
                     PTAKPLYEIVRDLPRLFPRSLAESKRDYATFHSNVDLMQLELLRTLPFFERTGYNKRA
                     YLRKTEIDSDGNYINELVIEPANVDPNKKRKRLIFVHGYGAGLGFYLKNYEHLPLLDD
                     SWSIHAIDLPGYGFSSRMDFPFQFPRDDTSVVCDWFISRLRTLFEKRGFDKSDNIVMA
                     HSMGAYLMAFYLNKYPDSVKKMVMCSPAGISRSQYSINNNITEDISSGKEEIKLKIKK
                     VPWWYTKLWDRNISPFVLVRKTGILGSKITSGWTYRRFKPILLNKENNYEQFEKLHRY
                     SFAIFNMKGSGEYLLSFVLECGGDPRSPLENSLFSSDANKFGIDNAGIKNSSCEWVWV
                     YGANDWMDIHGAERVTKDFLMNNRKKSRVVTIPESGHHLYFDNYPMFNSLLIDEMKSL
                     Q"
     gene            <541185..>542444
                     /locus_tag="CAGL0L04708g"
                     /db_xref="GeneID:2890650"
     mRNA            <541185..>542444
                     /locus_tag="CAGL0L04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448980.1"
                     /db_xref="GeneID:2890650"
     CDS             541185..542444
                     /locus_tag="CAGL0L04708g"
                     /inference="similar to AA sequence:UniProtKB:P53265"
                     /note="similar to uniprot|P53265 Saccharomyces cerevisiae
                     YGR111w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448980.1"
                     /db_xref="GeneID:2890650"
                     /db_xref="GOA:Q6FLB4"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB4"
                     /translation="MTVQSHPPNLIFEEVFDPEVIRFTLHVNSEAWKGVLTNDEYVDR
                     ELVLGSSDICTKYTSGSEYAKRFPESHNLLGIKYFVLKDTSLPSTDKMSQIVSRCETL
                     NRLGSCITPNSKGKIEPSLTICIGGVFTPIEYRGKGYAKIMIEKLNSYYDDIYDKAST
                     ITHELSRTLVRNMVINLYSEVGEYYSKMGYVSKHVPIHDIPGLDTLNEEYCKTATVTP
                     TAGRMFKYDDYTDMIDLQSKQFKNSLVRLAKDNPEGFTFTVDADIDIFKWFEDRDIFI
                     FSKLLEKKKSPFTVDDLRYGYAITDGEYKDAHIIWHHSWNGNELIITKIYIPEDRQQN
                     ADDIAKILFGEAIKEAKKFGLTKLEFWDEEIPANKFPELFTVLENMSKHESKTFLSNG
                     SLSAVRPPHGIHPELVRWDNNTKFCWF"
     gene            <542849..>543973
                     /locus_tag="CAGL0L04730g"
                     /db_xref="GeneID:2890704"
     mRNA            <542849..>543973
                     /locus_tag="CAGL0L04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448981.1"
                     /db_xref="GeneID:2890704"
     CDS             542849..543973
                     /locus_tag="CAGL0L04730g"
                     /inference="similar to AA sequence:UniProtKB:P53266"
                     /note="similar to uniprot|P53266 Saccharomyces cerevisiae
                     YGR112w SHY1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448981.1"
                     /db_xref="GeneID:2890704"
                     /db_xref="GOA:Q6FLB3"
                     /db_xref="InterPro:IPR002994"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB3"
                     /translation="MALSLYLRIPSRRFCNLLNTSGQSNYRVVNGISHKLLLSRGLIT
                     STVDWKPIKTEKTPNEESQNKSTLGKKIALGLMIAMPVIAFGLGTWQLKRLAWKTQLI
                     AECETKLTYDPIKLPKNFTVDMCEDWEYRKVLLKGKFLHEQEMFVGPRVRNGHKGYYL
                     ITPFIRNDTGEKLLIERGWIAEEKVPPENRTLHHLSMPEGNNVEVVCLIRPPKERGSL
                     QWEQEDKQSRLWQVADIYDMAAKVGCTPIHFQALYDMKDHHWDTNDEQSTASNGKSSW
                     KFWQKNEADKQPVKQPVKRPTFEKEFDELQFARAGVPIGKQPKIDLRNNHLQYLVTWY
                     GLSLLSSIFLIVALRKYNKGTAIAPDQLKSDKLKHAKKYM"
     gene            <544410..>545333
                     /locus_tag="CAGL0L04752g"
                     /db_xref="GeneID:2890705"
     mRNA            <544410..>545333
                     /locus_tag="CAGL0L04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448982.1"
                     /db_xref="GeneID:2890705"
     CDS             544410..545333
                     /locus_tag="CAGL0L04752g"
                     /inference="similar to AA sequence:UniProtKB:P53267"
                     /note="similar to uniprot|P53267 Saccharomyces cerevisiae
                     YGR113w DAM1 essential mitotic spindle pole protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448982.1"
                     /db_xref="GeneID:2890705"
                     /db_xref="GOA:Q6FLB2"
                     /db_xref="InterPro:IPR013962"
                     /translation="MSQDIRKEDGVRSATEYKLSMSSNPGSRRSSMADAESFNDDNMV
                     LKNDVLREYLLPQIKDLTDSVVTLDSNMTRLNFIHDNLVDLNESFGSLLYGLMCNSWC
                     VEFPNAPTRFDKEIRLMNEIEELSAEKSKLKSRLNSLREKPNAQTSDEKMKKPSGISQ
                     PIFQKPNVRRPRNALNDENLHKFNRENPPVYDDKREADEDTNSEASFVSNPANSKDMQ
                     LFANGSSNNDPKSRLRRKSILHTIRNSIASTSDAYDRKKQQGIQMGRVSLGGGAARVV
                     SGRNMFEQQRTTRHSTTGIPNRVVKKRPPFK"
     gene            <546017..>550366
                     /locus_tag="CAGL0L04774g"
                     /db_xref="GeneID:2890706"
     mRNA            <546017..>550366
                     /locus_tag="CAGL0L04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448983.1"
                     /db_xref="GeneID:2890706"
     CDS             546017..550366
                     /locus_tag="CAGL0L04774g"
                     /note="highly similar to uniprot|P23615 Saccharomyces
                     cerevisiae YGR116w SPT6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448983.1"
                     /db_xref="GeneID:2890706"
                     /db_xref="GOA:Q6FLB1"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR006641"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017072"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="InterPro:IPR023323"
                     /db_xref="InterPro:IPR027999"
                     /db_xref="InterPro:IPR028083"
                     /db_xref="InterPro:IPR028088"
                     /db_xref="InterPro:IPR028231"
                     /db_xref="PDB:3GXW"
                     /db_xref="PDB:3GXX"
                     /db_xref="PDB:3PJP"
                     /translation="MSDQESASLREEKNEIINGMGSGAPSDEEEGEDVFDSSEEEEED
                     DEDEARKISEGFIVNDEDEDEDEDDENVADKKKKRRHKRRAREEEDDRLSEDDLDLLM
                     ENAGVKRPTTEGSSGGKLKRLKRVGDEVESGAADREQESSQEKESSRLNDFFSDDEDE
                     EPYDEENRERSRGSREYDRGESNHQGDNRKSGMLDELDDFIEEDEFSDEDEETRQQRL
                     LERKMMREQRMKAPTKITGLSSDKIDEMYDVFGDGHDYDWALEIENEELEGGDINEQS
                     EEFDEETGMTKSSKKKISLQDIYDLQDLKKNLMTDEDMLIRKTDIPERYQELRSGLVN
                     HGNLSDNDQELEKNWISEKIAVDKNFSADYDLTEFKEAVGNAIKFITKENLEVPFIYA
                     YRRNYISSRERDGFLLTEDDLWEIVHLDIEFQSIINKRDYVKRFYSELGISDPLVDEY
                     FKNQSTGSVAELNSLQDIYNYLEFKYAQEINDNLQKESDKSGKKHLKNSNYEKFKSSA
                     LYKVIEAVGVSADQIGNNISSQHQIHIPKDHEALKPLELIELVLNENAGDLQVFLSNI
                     KLAMDTIQKYYSWEISKNTKVREKVRADFYRYYLVDVVLTTKGKREIQRGSLYEDIKY
                     AINRTPLHFRREPEIFLKMLEAESLNLMTLKLHMSSQKQYVDHLFQIALETTNTSDLA
                     IEWNNFRKAAFTQAIEKIFNDIAQEIKDDLEKTCQKLVCKVVRHKFMTKLDQAPYVPD
                     LKDPKLPKILTLTCGQGRFGSDAIIAAYVNRKGEFVRDFKITENPFDRSNPDKFEEVF
                     EDIVQTCQITAIGINGPNPKTQKLFKKLIEVIHKKNLVDSKGTHIPIIYVEDEIAIRY
                     QNSERAAQEFPNKPPYVKYCIALARYMHSPLMEYANLSPEELKSLSIHPFQSFLSPEY
                     LNRAIETAFVDIVNLVGVEVNKATDNSYYASVLRFVSGFGKRKAIDFLESLQRLNEPL
                     LARQQLITHNILHKVIFMNSAGFLYISWSKKRQRYEDLEHDQLDSTRIHPEDYHLATK
                     VAADALEYDPDTIAEKEENGTMSEFIEFLREDPNRRSKLESLNLESYAEELEKNTGQR
                     KLNNLNTIVLELLDGFEELRNDFHIMQSEEVFSSLTGETDKTLFKGCVIPVRVERFWH
                     NDIVCVTNSEVECIVNAQRHLGAQVRRPPNEIYELNKTYPAKVIFIDYPNITAEVSLL
                     EHDVKNEYNPLTYSKDPAIWDLKQELEDSEEEKKVTMAESRAKRTHRVINHPYYFPFN
                     GKQAEDYLRSKERGDFVIRQSSRGDDHLAITWKLDKDLFQHVDIQELEKENPLALGKV
                     LVVEGQRYHDLDQIIVEYLQNKIRLLNELTSNEKFKAGTKKEVVKFIEDYSKVNPKKS
                     VYYFSLNYENPGWFYLIFKLNAESKLYIWNVKLTHTGFFLVNYNYPTVIQLCNGFKTL
                     LKSSNTRNRSGYR"
     gene            <550938..>551963
                     /locus_tag="CAGL0L04796g"
                     /db_xref="GeneID:2890707"
     mRNA            <550938..>551963
                     /locus_tag="CAGL0L04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448984.1"
                     /db_xref="GeneID:2890707"
     CDS             550938..551963
                     /locus_tag="CAGL0L04796g"
                     /inference="similar to AA sequence:UniProtKB:P45978"
                     /note="similar to uniprot|P45978 Saccharomyces cerevisiae
                     YPR129w SCD6 suppressor of clathrin deficiency"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448984.1"
                     /db_xref="GeneID:2890707"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="InterPro:IPR025768"
                     /db_xref="UniProtKB/TrEMBL:Q6FLB0"
                     /translation="MSQYFGKTISLISVTDNRYVGLLQNIDSEKGTVTLNEVRCFGTE
                     GRKNWGPDEVYPNPTVYQSVKFNGNDVKDLSILEVKLHEVQPVMPPPHVLQQQQQQQV
                     EPNSNANEGSFPAQTPSDQAPVPQQQAQQAPKPDVPAAVSGYGVYAPSASDSTAVGTA
                     TFSDSIASSTQSGNANSDDFNKSSQGSRQQHRKPSHQHAAPHKVEIPDSDFDFATNNA
                     KFSKTEEEVLEEKPELPDQDKFYDKKSSFFDSISTSAEENTNMRWSEEKELNLDTFGQ
                     ASVRPRFQNGRGGRGGRGRGRGRGRGRGRGGRGSFNNYGHDNYQNRQHFNQFQAASNA
                     HNEKLEF"
     gene            complement(<552334..>553653)
                     /locus_tag="CAGL0L04818g"
                     /db_xref="GeneID:2890708"
     mRNA            complement(<552334..>553653)
                     /locus_tag="CAGL0L04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448985.1"
                     /db_xref="GeneID:2890708"
     CDS             complement(552334..553653)
                     /locus_tag="CAGL0L04818g"
                     /inference="similar to AA sequence:UniProtKB:P53270"
                     /note="similar to uniprot|P53270 Saccharomyces cerevisiae
                     YGR117c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448985.1"
                     /db_xref="GeneID:2890708"
                     /db_xref="GOA:Q6FLA9"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR016520"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA9"
                     /translation="MSPDYTKLLVARYLEENGFTNTLSAFLDETDLSLVDLNNVALSG
                     ERMKLTELVKDRIKFDEQLLLKKERNRADNEFPLTKWNYRNTFKCEELEQSKSLPVTA
                     KLVLLPTKELYLLISKANKTTTVMKFSSDCKWESNNIIQHDNICKEIGYFEGTNCCYF
                     ISIDGKLVTYDILNTTMLQTFPLNTRMVSHAKIIPSNIKGRWYLSYCGLDSKLRVAEI
                     ILKQDDTFDLNILNQVQLLSKCTAIEATLHPETGDPVIFVSRFEYSSILVFCMTQANT
                     ILHLSNIALNDAQFMSHSFHGLDMTINENASNPKKSQIVVATSHTPFMRLIVINLGDI
                     WKEIPSMLSEETFTSYNSIILNMLTNIPQDSYSQPILEWSDREKGLIVGSNDGLYAVD
                     LSKNDSWQLSTYFANRRIKLLTSDHRGLLVVGTADKALFSCSFVKMS"
     gene            complement(<554284..>554478)
                     /locus_tag="CAGL0L04832g"
                     /db_xref="GeneID:9488040"
     mRNA            complement(<554284..>554478)
                     /locus_tag="CAGL0L04832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999543.1"
                     /db_xref="GeneID:9488040"
     CDS             complement(554284..554478)
                     /locus_tag="CAGL0L04832g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999589.1"
                     /db_xref="GeneID:9488040"
                     /db_xref="GOA:B4UN46"
                     /db_xref="UniProtKB/TrEMBL:B4UN46"
                     /translation="MKQTHDDTQCLAYSGEDNRTIAMLLSLAFGRVPGGDFTAHLLYI
                     VSPPRGGSPRRATKRLRHKR"
     gene            complement(<554508..>554702)
                     /locus_tag="CAGL0L04836g"
                     /db_xref="GeneID:9488041"
     mRNA            complement(<554508..>554702)
                     /locus_tag="CAGL0L04836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999544.1"
                     /db_xref="GeneID:9488041"
     CDS             complement(554508..554702)
                     /locus_tag="CAGL0L04836g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999590.1"
                     /db_xref="GeneID:9488041"
                     /db_xref="GOA:B4UN47"
                     /db_xref="UniProtKB/TrEMBL:B4UN47"
                     /translation="MGIEGSQGSGQRKELACPANASLPGSSLLTIPSTLGPYHKPVLH
                     GMGTEVSHCKALRFFRSEVG"
     gene            <555087..>556300
                     /locus_tag="CAGL0L04840g"
                     /db_xref="GeneID:2890709"
     mRNA            join(<555087..555151,555928..>556300)
                     /locus_tag="CAGL0L04840g"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_448986.1"
                     /db_xref="GeneID:2890709"
     CDS             join(555087..555151,555928..556300)
                     /locus_tag="CAGL0L04840g"
                     /note="highly similar to uniprot|P32827 Saccharomyces
                     cerevisiae YPR132w RPS28B and highly similar to
                     uniprot|P32827 Saccharomyces cerevisiae YGR118w RPS28A"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_448986.1"
                     /db_xref="GeneID:2890709"
                     /db_xref="GOA:Q6FLA8"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKLGIESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLLALWKEKKEKPRS"
     gene            complement(<556881..>558692)
                     /locus_tag="CAGL0L04862g"
                     /db_xref="GeneID:2890710"
     mRNA            complement(<556881..>558692)
                     /locus_tag="CAGL0L04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448987.1"
                     /db_xref="GeneID:2890710"
     CDS             complement(556881..558692)
                     /locus_tag="CAGL0L04862g"
                     /inference="similar to AA sequence:UniProtKB:P48837"
                     /note="similar to uniprot|P48837 Saccharomyces cerevisiae
                     YGR119c NUP57 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448987.1"
                     /db_xref="GeneID:2890710"
                     /db_xref="GOA:Q6FLA7"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA7"
                     /translation="MFQMNRSNTGGFGTQNTGSTSLFGQNNTNQATSALSFGAQNNQQ
                     AQGNTGGLFGTQQNNQQQQPGGGLFGQNQNQNQNQNQNQQPGGGLFGQNQTQNQNQQQ
                     AGGLFGQNNQSGTSGGLFGSSSSQPQQGSTGLFGNKPAGSTTGGLFGQSQTQQTQPGQ
                     TGGLFGNSNTQTGATNTTGSLFGSKPAASGGLFGNQGASNTAPAASGGLFGSAPTAAS
                     NTGGGLFGNNQQPGASTSTGGGLFGSKPAGTTTSGGLFGAKPTGTSTGGLFGNTATQP
                     QTSGGLFGNNNQQNTFSGGSLSQPSFGLSNTATQGTLGQQSLVQPQNQQPQLAAQQLQ
                     SQQLSRYPQLIQEQILKCKESWDSNSYKTSLRSFVYNKVNETDAILYTKPTNVSQEEW
                     DKAIENKPSSDLIPIQVFGFEGLNNRNQIQVENVAQARVILNQILDKTKQLQQSHSFE
                     TSARIMKVQARNAQIEKRILKLGTQLAILKNRRLPLTISEEKMWGQFQELLKSSNDPA
                     GLGKTNELWARLAVLRERAKTISEQLDSKLVIIGENGGQTGKPSASGDNNRVSDEVYD
                     RIDKIAEILKNQQSGIAYLNDVLEKDNKALDSVVELK"
     gene            complement(<559230..>560045)
                     /locus_tag="CAGL0L04884g"
                     /db_xref="GeneID:2890711"
     mRNA            complement(<559230..>560045)
                     /locus_tag="CAGL0L04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448988.1"
                     /db_xref="GeneID:2890711"
     CDS             complement(559230..560045)
                     /locus_tag="CAGL0L04884g"
                     /inference="similar to AA sequence:UniProtKB:P53271"
                     /note="similar to uniprot|P53271 Saccharomyces cerevisiae
                     YGR120c SEC35 required for ER to golgi vesicle docking"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448988.1"
                     /db_xref="GeneID:2890711"
                     /db_xref="GOA:Q6FLA6"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA6"
                     /translation="MGLDINDAETLRKDELELPTVTEVSRDLFAEETEGIQDVKLNRD
                     STIVPFDVDHFLIKNNFQYISLDMLTRQLKDLSDEMMTVLLDRVAANYDSYLNFCKVY
                     QGGNNNDTLFELQKILPDLDSFMNQLRILTEKEMPRTQETVQDTLDYLEKLEEIKALL
                     NNHITISEDMTVLKQLSKSLHTLCDTEPLEEELCIAVTQKLFRLFQKIHTLLETLSEL
                     DSQSLHHIRNDFLGISQEFQISLKLLTDITLQHTTDYPKLASLLTDIFHQIKI"
     gene            560501..560572
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0L04906r"
                     /db_xref="GeneID:2890712"
     tRNA            560501..560572
                     /gene="tRNA-His (GTG)"
                     /locus_tag="CAGL0L04906r"
                     /product="tRNA-His"
                     /db_xref="GeneID:2890712"
     gene            complement(<560846..>563920)
                     /locus_tag="CAGL0L04928g"
                     /db_xref="GeneID:2890713"
     mRNA            complement(<560846..>563920)
                     /locus_tag="CAGL0L04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448989.1"
                     /db_xref="GeneID:2890713"
     CDS             complement(560846..563920)
                     /locus_tag="CAGL0L04928g"
                     /inference="similar to AA sequence:UniProtKB:Q02630"
                     /note="similar to uniprot|Q02630 Saccharomyces cerevisiae
                     YMR047c NUP116 or uniprot|Q02629 Saccharomyces cerevisiae
                     YKL068w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448989.1"
                     /db_xref="GeneID:2890713"
                     /db_xref="GOA:Q6FLA5"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA5"
                     /translation="MNSNTNAFGANSNAFGTSTQTGFGNNTSNAFNTGANTGLNAGGG
                     LFGSQNTQGNTGNAFNQGNTAQNSPFGAAGGSNNTPGFGINSNQPQNVFGAQSSPFGN
                     SKPVGSTGLFGSQPANTNNAFGNANSTNNAFGSTNNMQNNSPFGTNSFGNNTSNTNTG
                     LFGQQNTSGGGLFGNNQNQTNAFGGPQNNNANNFTQNKPANAFGQPNTMNNAFGNNST
                     GGLFGSTGTSSTGGLFGQNASNSFGNNNSTTTGGVFGQNSNPTNQFGSQNTGLFGSQN
                     NQQQSGLFGQNQQNQQNQQNSTGLFGSNNTSNAMTGGLFGQKQQSNTNTSTGLFGQQN
                     KPATGGLFGQSNSTGLFGNSNLGNNTQSTTGGLFGTSNTANNAFGSSSTPTTGLFGQN
                     NNQNNSSGLNQNVLQNNNTQGQNSFGQATNTGIGFGNNTATGFNQNQQTSTSGLFGNK
                     TPASGGGGLFGTQNTTNGTNTLSGGFGNTQANQASGSLFGSKPPGSANTSGTTGLFGA
                     SQQSGQTSQPGGLFGSKPTVGGLGAPQTTGTSLFGQNNAQSTPGGLFGNKQPTVTGVG
                     SANTTTPTANTLGTGSTSLFGNKSSTGSTGSTFGNSLGNNTSATTSSTGGLFGSKSQN
                     NNSSIAFGTQTPSTLAPSTAPALTSLNHSAQAPNTVKTTSLGTGSSINTTNPTLPLAN
                     STNSEQKLPNSLTQPVKIPPSTMKAASKKDSSLTSAYRLAPRALFMSSDDKTTSTLRS
                     HSASKDSKNSTEITHLPLENITNTSRSLGDQLLFNPDKKSFRSLIIKNKKVPEKIANS
                     EYKRITFEAKNKNQGVDESELESPRNDTPSPYVNTSGRISTPSKAMAAMEFNTTSVNK
                     SSAIDSNNTKKEQLSDVNDISFTDHGYYIIPSLDTLNGMPLVELRSVNGLVVGHKDYG
                     KVEFLEPVDLVNVPLNSICDKLIHFEPKTCILYPNSPIKPKKGEGMNVPAKITCFDCF
                     PINKSTREPILDANSTLLKKHIDKLKKVPGTKFVSYEEKTGKYVFTVDEPIL"
     gene            complement(<564488..>566905)
                     /locus_tag="CAGL0L04950g"
                     /db_xref="GeneID:2890714"
     mRNA            complement(<564488..>566905)
                     /locus_tag="CAGL0L04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448990.1"
                     /db_xref="GeneID:2890714"
     CDS             complement(564488..566905)
                     /locus_tag="CAGL0L04950g"
                     /note="highly similar to uniprot|Q04660 Saccharomyces
                     cerevisiae YMR049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448990.1"
                     /db_xref="GeneID:2890714"
                     /db_xref="GOA:Q6FLA4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR028598"
                     /translation="MVKGRKSQKADKVTKAKKRVADEVDESESEPELQVEGLIDAEAE
                     SEDDESFESAEENASAEEDEEDEEDEEDSDAELNKLLAEEEGDDSESEYNTSDFSEDD
                     TKSMTDKLSGVKLTTIAEPIIKTKFSDGTPRVIKPEINPVYDSDDSDIESKNTIGNIP
                     LSVYDEMPHIGYDVNGKRIMRPARASALDQLLDTIELPEGWTGLLDKESGASLNISKE
                     ELELISKIQRNEQTDESTNPYEPLIDWFTRHEEVMPLSAAPEPKRRFVPSKNEAKRIM
                     KIVKAIREGRIIPPKKMKELREKEKSEDFNYDLWGDSTETNDHIMNLRAPKLPPPTNE
                     ESYNPPAEYLPTEEEIKEWENTEYSERERNFVPKKYDSLRKVPGYTESVRERFERSLD
                     LYLAPRMRKNKLNIDPESLIPELPSPKDLRPFPIRCSTIYSGHEGKIRTLSIDPTGIW
                     LATGSDDGSVRIWEILTGREVYRVQLVNKEDNPEDNIHSVEWNPDGSVGILAVAVGNN
                     IFLIVPPIFGYDIENAGKVRIEHGFGYDTFGSTKKANLEVNGSDLESDDEAANANTAV
                     KKQVAQWHKPTQRQMEQDICIVIVCKKPVKKLSWHRKGDYFVTVQPDSGNTSVLIHQL
                     SKHLTQSPFRKSKGIIMDAKFHPFKPQLFVCSQRYVRIYDLSQQVLVKKLLPGARWLS
                     NIDIHPRGDNLIASSYDKRVLWHDLDLAATPYKTLRYHDKAVRSTTFHKKLPLFCSAA
                     DDGFIHIFHATVYDDMMKNPMIVPLKKLTGHKVQGHLGVLDTIWHPKEAWLFSAGADN
                     TARMWTT"
     gene            567590..567661
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0L04972r"
                     /db_xref="GeneID:2890715"
     tRNA            567590..567661
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0L04972r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2890715"
     gene            <568070..>568678
                     /locus_tag="CAGL0L04994g"
                     /db_xref="GeneID:2890716"
     mRNA            <568070..>568678
                     /locus_tag="CAGL0L04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448991.1"
                     /db_xref="GeneID:2890716"
     CDS             568070..568678
                     /locus_tag="CAGL0L04994g"
                     /inference="similar to AA sequence:UniProtKB:P46671"
                     /note="similar to uniprot|P46671 Saccharomyces cerevisiae
                     YMR052w FAR3 involved in pheromone-mediated cell cycle
                     arrest"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448991.1"
                     /db_xref="GeneID:2890716"
                     /db_xref="GOA:Q6FLA3"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA3"
                     /translation="MNEGSYDNFEYLNLLAKNLSVGCRDSRKETDKIELLLKRLSKQS
                     VVSYEEFSQRPSEETLDAYKKLSEPTTTEQLIRENYQLMYEIEQQEYINKRIIALVNS
                     INEHLISIRNFIIEQKLARDQNNEIYMHENFTVRENLLKNSTELLKAREQCSRTNTEV
                     VVEKFKKLYAEIDWDTLPSNLPDIIQVKEKIKHIKETYKLDL"
     gene            complement(<568886..>571300)
                     /locus_tag="CAGL0L05016g"
                     /db_xref="GeneID:2890717"
     mRNA            complement(<568886..>571300)
                     /locus_tag="CAGL0L05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448992.1"
                     /db_xref="GeneID:2890717"
     CDS             complement(568886..571300)
                     /locus_tag="CAGL0L05016g"
                     /inference="similar to AA sequence:UniProtKB:P36085"
                     /note="similar to uniprot|P36085 Saccharomyces cerevisiae
                     YKL072w STB6 SIN3 or uniprot|P46679 Saccharomyces
                     cerevisiae YMR053c STB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448992.1"
                     /db_xref="GeneID:2890717"
                     /db_xref="GOA:Q6FLA2"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA2"
                     /translation="MDVRAKSYESLQSHNSLTSEAKHELVSFIFPDCRALYKLHIDRC
                     RELNYSEIQLEGFDIYIVEQWAAVRKLSTLITTYTGNSQDSIFAVRVLLPREPSLWPP
                     EFKAYHDQLLKFCKPMVRDKGIVFVTELSTIPSNLNILHVDTGDQREAWKNFKVNYDL
                     KRLHCGGRSALLLRGPSSAAVGKFAQLFKISMDHFPQDSAPGSSDTTPQNGAADSSHH
                     NDKKTLGQALHLVKMASHYDQHMYCPVAELITLVQISLNYFNMFEGCPYKDGLLCEET
                     KKAIENWWDSYGKIYLGIEKPKNEAILGPTTVASLFSFVLCCFFKLMLEDCISSKDPF
                     DEEEFFTGIYTFQKKYNLVREEERTYLDLLTIQKLFAVTNKETNRDLFKFHKVVKSAV
                     HDIKGNGNFRQLSNDVLTTDLDNLIKNVHCGSLGWLWKTKNGKRDNSYLWKRNEFANF
                     TYENGDLETELEKQTALCKQRRELKEELKKQKKESDIIFVEEREWIDDEKIPDIPQVT
                     EIASSNESISSMLCNYDVGKFMRMNDTNQSYRNEYFRRNSFPFMKAETYQKYHTFAVG
                     YEPLASVRHRAGSISCIQDGLEVWDLPFDSSAVKIARDIMRTERLEDPNGPQLESFSE
                     NVIEEDICYEDEELMRECSKFSDKFKSILQEHKTYYSNLKTLDDAKWKVGHDQALLEN
                     DMEEINSLSSKLAYNVKVLERRVRDVERSINRFQDKISTVQDSILEGGCGIKDSLFAT
                     CDEKELQEIILGMMNKEKTKYQALCLKVISMEVFSQFKDDLMGWCKWLFGEFSFHKGI
                     KKNAND"
     gene            <571776..>573317
                     /locus_tag="CAGL0L05038g"
                     /db_xref="GeneID:2890718"
     mRNA            <571776..>573317
                     /locus_tag="CAGL0L05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448993.1"
                     /db_xref="GeneID:2890718"
     CDS             571776..573317
                     /locus_tag="CAGL0L05038g"
                     /note="weakly similar to uniprot|P36084 Saccharomyces
                     cerevisiae YKL074c MUD2 pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448993.1"
                     /db_xref="GeneID:2890718"
                     /db_xref="GOA:Q6FLA1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA1"
                     /translation="MSETEKTLEDLRAKIIQSMGGKPSGAGTGTGAGTGAGTGAGTGS
                     GTGESRMERDKGGRSDMSRQDHGRSTRYSNERRGNYQNAAQYNNNMSRDDYYQTQRYS
                     RNAQRNPIHQYGGYRQTQNHGQNPNHNQNYRYQNQPQQYTNQNQRNRYNNGNPQPNSV
                     HKPPHHQTKKVANLDDPIFRNITKNRAACHIVIEIDGKQDIEKIITLQKLLLTKIEQL
                     LESQDFLKDFFLKPVSFHDIEELESKAVLHLETSEPEQASLIIACHKFLVSQLNEQQT
                     ITITRPENYIATNDRINKICNKDTLCVENVETGGSTKQEILANLKAPKSGDFDFMEPI
                     FYKDSDNDDIKFTKLILVLLKNSGSESTIDWKLNGQSVETYKINDNRGLFQPIEELQF
                     DTLPKLATSEGRKPNETIILLNCIDPMELKEKKNIAELKESLKEILNFENYELQVAIP
                     SVDYRINIDHIKELAGTVFIKFQNEGDATSALNELSGKKFNGRTILGTYAMQSDIETP
                     GLHIE"
     gene            <573804..>575231
                     /locus_tag="CAGL0L05060g"
                     /db_xref="GeneID:2890719"
     mRNA            <573804..>575231
                     /locus_tag="CAGL0L05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448994.1"
                     /db_xref="GeneID:2890719"
     CDS             573804..575231
                     /locus_tag="CAGL0L05060g"
                     /inference="similar to AA sequence:UniProtKB:P36083"
                     /note="similar to uniprot|P36083 Saccharomyces cerevisiae
                     YKL075c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448994.1"
                     /db_xref="GeneID:2890719"
                     /db_xref="GOA:Q6FLA0"
                     /db_xref="UniProtKB/TrEMBL:Q6FLA0"
                     /translation="MSVATAEHANHSPEQSAQPISDGSAGAKGDNIGERRRRRSRRRR
                     PRFNFVKEMAVSGTVYDTITSIEYLNFKYGLRKSHYIKKFVRCIHRKINEDVSRISDE
                     IVEMLSPWVKIKLFLLLVTLSERGGPEYWFDKNEADKDQKDTEKDGSPEAEGNNDQTE
                     GQNEENKSKIDNATSGKSKDDTKKLINKKTKMKLLPTLTEQIMQQNINLEFTEETYDE
                     NYIFSSIWANFMEGLINYYLEKVIVPHSEMKVCQQLYKPMMKIISLYNEYNELMEKSE
                     RNGFLPKSNGLEDLETENSEDQEKTKKEAADEIEELSANLQNINLNNADNVVAQERLQ
                     RAQKLLWQARQDIPKTISKELTLLSEMYSTLSADEQDYELDEFVCCAEEYIELEYLPN
                     LVDVLFANCGTNNFWKIMLVLEPFFYYIEEVNGHEDTEDDEFEERYITDTDGASGPAR
                     QSFKPDPRVITLEKICEVAARQKWI"
     gene            complement(<575477..>576640)
                     /locus_tag="CAGL0L05082g"
                     /db_xref="GeneID:2890720"
     mRNA            complement(<575477..>576640)
                     /locus_tag="CAGL0L05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448995.1"
                     /db_xref="GeneID:2890720"
     CDS             complement(575477..576640)
                     /locus_tag="CAGL0L05082g"
                     /inference="similar to AA sequence:UniProtKB:P36081"
                     /note="similar to uniprot|P36081 Saccharomyces cerevisiae
                     YKL077w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448995.1"
                     /db_xref="GeneID:2890720"
                     /db_xref="GOA:Q6FL99"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:Q6FL99"
                     /translation="MLEFVSFLLSLLLLQPVLGYRPVIHPKEKETTSEEPKPWIRTVY
                     STKVEIVTPTVIAGVTFSAKPLATPDPLLPWVSLQKDGRPKTIKPEIKNGHTRKGRPD
                     YSTYFKTATIHKYTYDELKAHNMDPNDVYEEEVWLDEDDTYVSLNPVIRCTPNRYVNK
                     KQDIVEGPFCTPKENSRFKVGSTYFVTWFTKFFEEPTTGKVADKVRLHISYVKEKARE
                     KGYHRRALPATFYTSEWFHNVDGLYAIEPENDWLGKEYERRVVISIQPDYIPDDEFDP
                     LEHGVLLYLIKGTKVAKKTKDELRLEDAGISDDTWYYVALTIPTLVVVALVFMYFFLY
                     LNKGNRDFSDITMQEMKKKHRVLGKISDMKGFKKFKNHKYSELPTFQKTDKQS"
     gene            complement(<577023..>579050)
                     /locus_tag="CAGL0L05104g"
                     /db_xref="GeneID:2890721"
     mRNA            complement(<577023..>579050)
                     /locus_tag="CAGL0L05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448996.1"
                     /db_xref="GeneID:2890721"
     CDS             complement(577023..579050)
                     /locus_tag="CAGL0L05104g"
                     /inference="similar to AA sequence:UniProtKB:P32364"
                     /note="similar to uniprot|P32364 Saccharomyces cerevisiae
                     YKL079w SMY1 kinesin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448996.1"
                     /db_xref="GeneID:2890721"
                     /db_xref="GOA:Q6FL98"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6FL98"
                     /translation="MHWSLGSKDTERLPSDLISLTAKPIEPSPVTAVVRLATANKEKL
                     AELEKQRSADTQDVVKQVRHFTLQENNTIIHYPITNFADESIFNFEKVYDVGVPLVDI
                     HKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNEDSDGIIALTFQDIIQKKREL
                     EKDQNTIVNIQISALEISLEKVYDMLHSADDRKPLKSHHETKKFGLYYQEANNEYINS
                     IKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHGTITSSNIMFADLC
                     GSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIENKLVPSVNSSD
                     LQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQLQNILNFV
                     RADVTGLNSKKTLDLLIDNMKVIENNYDQKITLLESELNKLADTVKKAKVTEELETEI
                     VEKNDEIKKLREQLETMTQLFNNIDPKESEDTKKIIQTLMEKCESVAQLQLELEGQLH
                     ENSILKGDGEIKDAKIRTLETMNSRLVEQLQNQESSTQDILKSNGILKKELEALSNIS
                     KSQQEKIKILEAKLRDSVVISSTESSPRKGSVSSSSINTMLPIDESDGQSKSWGFVSS
                     SSKTGNFWGGRKVSTSSMTTITSQDSFQPKPLKKGFSLNTVKPKNEPEAGS"
     gene            complement(<579578..>580753)
                     /locus_tag="CAGL0L05126g"
                     /db_xref="GeneID:2890722"
     mRNA            complement(<579578..>580753)
                     /locus_tag="CAGL0L05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448997.1"
                     /db_xref="GeneID:2890722"
     CDS             complement(579578..580753)
                     /locus_tag="CAGL0L05126g"
                     /note="highly similar to uniprot|P31412 Saccharomyces
                     cerevisiae YKL080w VMA5 H+-ATPase vacuolar"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448997.1"
                     /db_xref="GeneID:2890722"
                     /db_xref="GOA:Q6FL97"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:Q6FL97"
                     /translation="MATALYTANDFFLVSLPGNAKPASGQADVDTWLKNNLLGGRTFV
                     SDFKIPEFKIGSLDNLLVESEDLSKIDNQVGSSVSKIVEILSGMNEASTNDYKTIPIN
                     NMPIPEYLEHFEWQTRKFKLDKSIKELMSNLSDEASQLDLDVRATYTNYTNAKSNLAA
                     AERKKTGDLSVRSLHDIVKSDDFILDSEYLTTVLIAVPKNLKADFEKTYETLSKNVVP
                     GSAGIIAKDDDYILYNVHLFKRNAQEFTTAAREKKFIPREFNYSEELIDQLKREHDSA
                     ASLEQSLRIQLVRLAKTAFVDVFVIWFHIKALRVYVESVLRYGLPPHFIIKIIAVPPK
                     NVTKCKQELVDAFGFLGGNAFARDKKGKISKDDTSLHQYANLVDADYEPFVFYHIKL"
     gene            complement(<581274..>582506)
                     /locus_tag="CAGL0L05148g"
                     /db_xref="GeneID:2890723"
     mRNA            complement(<581274..>582506)
                     /locus_tag="CAGL0L05148g"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_448998.1"
                     /db_xref="GeneID:2890723"
     CDS             complement(581274..582506)
                     /locus_tag="CAGL0L05148g"
                     /inference="similar to AA sequence:UniProtKB:P36008"
                     /note="similar to uniprot|P36008 Saccharomyces cerevisiae
                     YKL081w TEF4 translation elongation factor eEF1 gamma
                     chain"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_448998.1"
                     /db_xref="GeneID:2890723"
                     /db_xref="GOA:Q6FL96"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FL96"
                     /translation="MSQGKLFIYNTPRAAPSKAIIEHFKLDFQVLEDPNELKAKFPRH
                     RIPSLLLKNGTQITESIAIVNYLVNQIDDEKVKADLLGKNELEKAQVLQWLSMTTVDL
                     FNHLGALYLTSIKKFAYTKPSVDYHFSLINEVADFMEQRLTHYTYLVDERATLADVYA
                     YYMCVLAFGLIFGPEFPKAHPALTRWYKTMMDHPIIKSSPSLFPAFAEKDIELTPKKE
                     TKKKEEKKTEKKAEKKEEKPAAEAPQQEKKPKHPLEALGRSTFVLDEWKRKYSNEDTR
                     PVALPWFWEHYNPEEYSLWKVGYKYNDELTMTFMSNNLVGGFFNRLSASTKYMFGCLV
                     VYGENNNNGIVGAVMVRGQDHVPAFDVAPDWESYEYTKLDPTKEEDKEFVNNMWAWDK
                     PVVVNGESKEIADGKVLK"
     gene            <583291..>584652
                     /locus_tag="CAGL0L05170g"
                     /db_xref="GeneID:2890724"
     mRNA            <583291..>584652
                     /locus_tag="CAGL0L05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_448999.1"
                     /db_xref="GeneID:2890724"
     CDS             583291..584652
                     /locus_tag="CAGL0L05170g"
                     /inference="similar to AA sequence:UniProtKB:P36080"
                     /note="similar to uniprot|P36080 Saccharomyces cerevisiae
                     YKL082c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_448999.1"
                     /db_xref="GeneID:2890724"
                     /db_xref="GOA:Q6FL95"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029188"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:Q6FL95"
                     /translation="MSDLLEERLRANSSAFDGLMALIPAKYYYDEKTQDQWKMKKKDK
                     SQVRDDKLKKLDPEQQGDEVSSALDVMKKREQNAVPVELPGAKLNKLNKKPVADVDGK
                     HKALGGEVVEEAEDDDEDEEDEDIKVIFDDEGNEIKLGDKQREQRDEPADAEEGEDDN
                     DEVNGEKSTKEVTKKSNEKAKKLKNVEELRSKLQQKIQALKEKRKAPGTNVQGAASSR
                     EAILEQRRKREEARKKRKLEHANGGDSDDDDDDDDEDHSSESENEDDLEENPKKKQKK
                     NGVSAKDVMFQNIIFDDGDRTTSDLQRLRKQPNGKKKGPAKNDIKAHLKLLETKQNKI
                     QNKDELEQIKLKEKEKWQKAMLQAEGIRLKDDEKLLKKALKRKEAKKRKSALEWQERK
                     RTVATNIAEKQKRREENLQIRKQNKGQKKNKQQKMKRKFTGSIVPKKRAGFEGRLKSG
                     KKK"
     gene            <585066..>585383
                     /locus_tag="CAGL0L05192g"
                     /db_xref="GeneID:2890779"
     mRNA            <585066..>585383
                     /locus_tag="CAGL0L05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449000.1"
                     /db_xref="GeneID:2890779"
     CDS             585066..585383
                     /locus_tag="CAGL0L05192g"
                     /note="no similarity possibly noncoding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449000.1"
                     /db_xref="GeneID:2890779"
                     /db_xref="GOA:Q6FL94"
                     /db_xref="UniProtKB/TrEMBL:Q6FL94"
                     /translation="MITASRIEFRLTVRASQRLLTCLVLSKRHCSVTISTQDNFLFSI
                     GMIAEYFMACRFLMTLIAWVECLAAFKFQCDDVELRVPMLTTCVIVDKFSFQQDFCHI
                     AIL"
     gene            complement(<586200..>587210)
                     /locus_tag="CAGL0L05236g"
                     /db_xref="GeneID:2890781"
     mRNA            complement(<586200..>587210)
                     /locus_tag="CAGL0L05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449002.1"
                     /db_xref="GeneID:2890781"
     CDS             complement(586200..587210)
                     /locus_tag="CAGL0L05236g"
                     /note="highly similar to uniprot|P17505 Saccharomyces
                     cerevisiae YKL085w MDH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449002.1"
                     /db_xref="GeneID:2890781"
                     /db_xref="GOA:Q6FL92"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q6FL92"
                     /translation="MLSRISRRAFSSTRINPYKVTVLGANGGIGQPLSLLLKLNQKVT
                     DLRLYDLRGAPGVASDLSHIPTNSTVKGFTPEEADGLKNALKDTDLVLIPAGVPRKPG
                     MTRDDLFAINAGIVRDLATAAAESAPNAAILVISNPVNSTVPIVAEVLQKKGVYNPKK
                     LFGVTTLDSIRASRFISEVVGTDPTQEKVNVVGGHSGITIIPLLSQTKYGDKLDKDQK
                     DALIKRIQFGGDEVVKAKNGAGSATLSMAQAGALFANAVLSGFAGEQNVVEPSFVDSP
                     LYKGEGIEFFASPVTLGKEGVVKIHPIGTISAEEEEMLATCKETLKKNIEKGINFVKS
                     SN"
     gene            complement(<587870..>588286)
                     /locus_tag="CAGL0L05258g"
                     /db_xref="GeneID:2890782"
     mRNA            complement(<587870..>588286)
                     /locus_tag="CAGL0L05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449003.1"
                     /db_xref="GeneID:2890782"
     CDS             complement(587870..588286)
                     /locus_tag="CAGL0L05258g"
                     /inference="similar to AA sequence:UniProtKB:P36077"
                     /note="similar to uniprot|P36077 Saccharomyces cerevisiae
                     YKL086w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449003.1"
                     /db_xref="GeneID:2890782"
                     /db_xref="GOA:Q6FL91"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="UniProtKB/TrEMBL:Q6FL91"
                     /translation="MSLQSGNLHKVSEIPLSQIHRPIVPVLDYQKIDAMVSTMKGKPM
                     ASKTCSLEGATELNGQLPPIDVMCVRENGESYYFAFGGCHRFQAYDRLAQEQNDPHIP
                     VRAKVLPATRHQLKLYVGESLDTMFEKADMQRQLEA"
     gene            <589013..>589756
                     /locus_tag="CAGL0L05280g"
                     /db_xref="GeneID:2890783"
     mRNA            <589013..>589756
                     /locus_tag="CAGL0L05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449004.1"
                     /db_xref="GeneID:2890783"
     CDS             589013..589756
                     /locus_tag="CAGL0L05280g"
                     /inference="similar to AA sequence:UniProtKB:Q00873"
                     /note="similar to uniprot|Q00873 Saccharomyces cerevisiae
                     YKL087c CYT2 holocytochrome-c1 synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449004.1"
                     /db_xref="GeneID:2890783"
                     /db_xref="GOA:Q6FL90"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:Q6FL90"
                     /translation="MTDGDESKCPVPHDQRDVWLKHSQQAQQAQQEQKLAQQKLAQQK
                     LAQQQDQPKCPVDDHSKDVWLKSGKKHGEAANDVGLASERDVSSIPRTGSEGNWVYPS
                     EKQFFDAMKRKNWDPQPEDMKTIVPLHNYVNERVWRYINMWENGLGGDSCGGIKLTNF
                     KGQSKKLTPRAWFRSTILGMAKPFDRHDWTIDRCGKTVDYVIDFYSEEVKTSKDNIAT
                     EPQIYLDVRPKLNSFEGIKMRILKSVGLL"
     gene            complement(<590178..>591812)
                     /locus_tag="CAGL0L05302g"
                     /db_xref="GeneID:2890784"
     mRNA            complement(<590178..>591812)
                     /locus_tag="CAGL0L05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449005.1"
                     /db_xref="GeneID:2890784"
     CDS             complement(590178..591812)
                     /locus_tag="CAGL0L05302g"
                     /inference="similar to AA sequence:UniProtKB:P36076"
                     /note="similar to uniprot|P36076 Saccharomyces cerevisiae
                     YKL088w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449005.1"
                     /db_xref="GeneID:2890784"
                     /db_xref="GOA:Q6FL89"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:Q6FL89"
                     /translation="MGSDDDRDMRKDVQMEQVPVSILTNKLHISGTGPVPVRDLRSSE
                     KKVGGGILNTSAKENSSVPMDNEFLSQNKSVDGNGLVSMSSGDGRVIGSRNISFSSGI
                     IQFPNGNDDGASIISDANGITVERKASITSPKSTISFTVDENEKTSHHRYSISSKPGK
                     STTSIDSLAIEGKNNSIDAKDSVKGNTKDEVEAVPEQKNSIVNMPGDFIFFESRKHEH
                     NSNETDGKEKSLKSKKSGISGASGSKEVIGSTSGPQIPFSEYFLRQDDKKFHILIGAT
                     GSVATIKVPLIIDKLLKLYTPDKISIQLIVTKPAEHFLNGLKISTHVKIWREEDVWSD
                     CKKMGDMILHHELRKWADIFLIVPLSANSLAKIANGISNNLLTAVLRDWSPNTPIYAA
                     PAMNTFMYINPMTKKHLNILASDMPYITVLKPVEKVLICGDIGMGGMREWSDIVEIVR
                     KKINEIKKARDEDTTTPEKDEDEDEEEDEDEDEDEDEDEDEDDSFRKNETDSEDDDDD
                     DEEEEDDDDDDEDDEDGHNVDKDRMILKEESESKPI"
     gene            complement(<591903..>592217)
                     /locus_tag="CAGL0L05324g"
                     /db_xref="GeneID:2890785"
     mRNA            complement(<591903..>592217)
                     /locus_tag="CAGL0L05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449006.1"
                     /db_xref="GeneID:2890785"
     CDS             complement(591903..592217)
                     /locus_tag="CAGL0L05324g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449006.1"
                     /db_xref="GeneID:2890785"
                     /db_xref="GOA:Q6FL88"
                     /db_xref="UniProtKB/TrEMBL:Q6FL88"
                     /translation="MKPRDHRHPITRIHTICERQKKAEKISEIPSVSGTSAEQCRREA
                     PRSVPTAQRFLPRQPNPHGRQASNGREAIQTIKNKVIKWASMSKLLAPLYWYCCPKKL
                     CI"
     gene            <592516..>593511
                     /locus_tag="CAGL0L05346g"
                     /db_xref="GeneID:2890786"
     mRNA            <592516..>593511
                     /locus_tag="CAGL0L05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449007.1"
                     /db_xref="GeneID:2890786"
     CDS             592516..593511
                     /locus_tag="CAGL0L05346g"
                     /inference="similar to AA sequence:UniProtKB:Q03702"
                     /note="similar to uniprot|Q03702 Saccharomyces cerevisiae
                     YKL011c CCE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449007.1"
                     /db_xref="GeneID:2890786"
                     /db_xref="GOA:Q6FL87"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:Q6FL87"
                     /translation="MMNAEVAERVLRPLKSTTLKHVSVLLGARIEATKSARISSIISQ
                     CAVLDRLRCRRDAGDLVVTAIDAGVSNFAYCSLQLRKDRKPLLVGWEKFQLESKFVDG
                     HMDGDKLALNPENFSRLATKLSQYLLALPYATQLYAIERQRARSMSSKFVLEPVLRSN
                     ILEYLLFSTLANAKETGRGTKDYEIISSDPQRMVNYWVTVGSSNTKYQELILDKNSKK
                     YRIALVSDILCNSVHDDWDFGVELTSIWRRRIAKAQNKKTSDLKLYTLIENSDTNLGT
                     KKDDDLADSFLHALMWSKWLNNYETLVYEIDNKPFNDFETGVLELIKNIQIPKIL"
     gene            complement(<593547..>595319)
                     /locus_tag="CAGL0L05368g"
                     /db_xref="GeneID:2890787"
     mRNA            complement(<593547..>595319)
                     /locus_tag="CAGL0L05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449008.1"
                     /db_xref="GeneID:2890787"
     CDS             complement(593547..595319)
                     /locus_tag="CAGL0L05368g"
                     /inference="similar to AA sequence:UniProtKB:P33203"
                     /note="similar to uniprot|P33203 Saccharomyces cerevisiae
                     YKL012w PRP40 splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449008.1"
                     /db_xref="GeneID:2890787"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="InterPro:IPR027237"
                     /db_xref="UniProtKB/TrEMBL:Q6FL86"
                     /translation="MAGQWKKATDSNGKVYYYNTVTKESRWDKPVEDTTDLKQKLRDA
                     GWNVAKTKEGKVYYYNVKTKESRWDNPLAEKATEKKTKTGQIKKTTIDQVKNTANTNE
                     HSKGNTVALATTNNTEKYANTSKILNVKSLTKDEAEKAFMDMLSEHQVDSSWSFHKMV
                     VDLGLKDERFWIVDDDPLWKQNILDKYLSNRSEEQLIKDHAQASKFLEAFGNLLKSNK
                     NIHYYTRWTTVKKMLANESIFKHAVVPEKEMKRKFNDYIRRLREEKDKKDESIKELAL
                     REVNEYLRSILIAPPNTIESTIEVKMTWSQLQREYITGNKRFAANKHFRLLSQHDILN
                     QYIELVKIIQGNLASKVSDIEKKNYSRNRMARDQFKVMLKQPKLDIRADSKWSELYPK
                     IKSEKAFLQLVGRNGSSPLDLFYDYTNEKKAAINGYASVAQQILIDNSYVWAGIEDST
                     RISKNITEFEKANFQNISGIIHEDGKLALLDEKDTQLVVKQAIAVKYDTVKEIEQRNL
                     NMTRIKKNNLVALFHRTFVTKPGRFEDAVAIIQNKPEYKALENEPDIIKELFSSFVPS
                     KQPQANTQNLSRKRKATALVQMDY"
     gene            <595669..>596184
                     /locus_tag="CAGL0L05390g"
                     /db_xref="GeneID:2890788"
     mRNA            <595669..>596184
                     /locus_tag="CAGL0L05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449009.1"
                     /db_xref="GeneID:2890788"
     CDS             595669..596184
                     /locus_tag="CAGL0L05390g"
                     /note="highly similar to uniprot|P33204 Saccharomyces
                     cerevisiae YKL013c ARC19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449009.1"
                     /db_xref="GeneID:2890788"
                     /db_xref="GOA:Q6FL85"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:Q6FL85"
                     /translation="MSQSLRPYLNAVRYSLQAALTLSDFSSLEVERHNRPEVEVPNTS
                     AELLLQPMHISRNEHEQVLIEPSVNSVRVSLKVKQADEIEQILVHKFTRFLEQRAEAF
                     YILRRVPIPGYSISFLITNKHTESMKTNKLVDFIVEFMEEVDKEISEMKLFLNARARF
                     VAEAYLSEFVY"
     gene            complement(<596534..>597451)
                     /locus_tag="CAGL0L05412g"
                     /db_xref="GeneID:2890789"
     mRNA            complement(<596534..>597451)
                     /locus_tag="CAGL0L05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449010.1"
                     /db_xref="GeneID:2890789"
     CDS             complement(596534..597451)
                     /locus_tag="CAGL0L05412g"
                     /inference="similar to AA sequence:UniProtKB:P32447"
                     /note="similar to uniprot|P32447 Saccharomyces cerevisiae
                     YJL115w ASF1 anti-silencing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449010.1"
                     /db_xref="GeneID:2890789"
                     /db_xref="GOA:Q6FL84"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /translation="MSIVSLLGIKVLNNPAKFTDPYEFEITFECLEPLKNDLEWKLTY
                     VGSSRSLEHDQELDSILVGPVPVGVNKFVFTADPPSAELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDSEELRENPPQKVQVDHIVRNILAEKPRVTRFNIVWDNENEAD
                     IYPPEQPGVDEEDEAEEEEEEEEEEEEEEEAEDEEEEVEVDVDGEVDLENEDDKTDKI
                     IDGEEAEDDDDGEEIGDEEDEDDEDDEEGDAQTETAAPNDKTTDTEKEVRLHDRDEDE
                     KADSSKKLKTENDTAKEPDTAPTPQDSTN"
     gene            <599030..>600070
                     /locus_tag="CAGL0L05434g"
                     /db_xref="GeneID:2890790"
     mRNA            <599030..>600070
                     /locus_tag="CAGL0L05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449011.1"
                     /db_xref="GeneID:2890790"
     CDS             599030..600070
                     /locus_tag="CAGL0L05434g"
                     /inference="similar to AA sequence:UniProtKB:P36135"
                     /note="similar to uniprot|P36135 Saccharomyces cerevisiae
                     YKR042w UTH1 or uniprot|P46955 Saccharomyces cerevisiae
                     YJL116c NCA3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449011.1"
                     /db_xref="GeneID:2890790"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:Q6FL83"
                     /translation="MKFNCVLLAAFMVAAAPSPKHDHEDRHAIKRDVDVVTVVEYVGA
                     DDGNGFDVKTSTKAQPSSVATSTRKTLQPSSSSSSSSSSSNGGSGSFKDGTIPCSQFP
                     NVDNVVAVDWVGLGGWASVMNFDGSYGQSCSDGLYCSYACKPGYSKTQWPSEQPSDGK
                     AIGGLLCKNGYLYRTNTNADSLCQQDIQSANAKNTLGKSVALCRTDYPGSENMVVPTV
                     VDAGSSQPMSVIDSDSYYQWQGKKTSAQYYVNNAGVSKEQGCVWGDAASGNGNYAPLI
                     FGSGKSNGVTYLSITKNPNSNSAANFNVKIEGADGADVGGTCVYENGQFSSGSDGCTV
                     AVKSGVANFIFY"
     gene            complement(<600658..>601578)
                     /locus_tag="CAGL0L05456g"
                     /db_xref="GeneID:2890791"
     mRNA            complement(<600658..>601578)
                     /locus_tag="CAGL0L05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449012.1"
                     /db_xref="GeneID:2890791"
     CDS             complement(600658..601578)
                     /locus_tag="CAGL0L05456g"
                     /inference="similar to AA sequence:UniProtKB:P46956"
                     /note="similar to uniprot|P46956 Saccharomyces cerevisiae
                     YJL117w PHO86 inorganic phospate transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449012.1"
                     /db_xref="GeneID:2890791"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="UniProtKB/TrEMBL:Q6FL82"
                     /translation="MVGDLRRAVPQIDATLNAPLDKDAPPTIYASSLTPSMATAALNL
                     PADFLKQKQGLANKTLICHPVVISAIGLFLSTYLAIQINVPKNTSSSIAGYLYQIFLM
                     NKKEVITALLFTLIAASFVFTLLSRVSDLYFRAVIDNVVESKGEQLYGVNLNDISVLT
                     KKEVEQKPKEFRENLENTHIIIYRETPIALVSIAKNNVLSTKDSLVMSISTIGSRRVY
                     IRSGIIEDLLDWAMIRTRKIGAAGNYGKSMKIICEIYSFDQDMKKILKSKGFVKVQSA
                     RIKENRLLGGLFGIKKELWGVQFHYEKKDE"
     gene            <602208..>602948
                     /locus_tag="CAGL0L05478g"
                     /db_xref="GeneID:2890792"
     mRNA            <602208..>602948
                     /locus_tag="CAGL0L05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449013.1"
                     /db_xref="GeneID:2890792"
     CDS             602208..602948
                     /locus_tag="CAGL0L05478g"
                     /note="highly similar to uniprot|P46969 Saccharomyces
                     cerevisiae YJL121c Ribulose-phosphate 3-epimerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449013.1"
                     /db_xref="GeneID:2890792"
                     /db_xref="GOA:Q6FL81"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /translation="MVKPIIAPSILASDFANLGCECHRVINSGAEWLHIDVMDGHFVP
                     NITLGQPIVTSLRRAVPRSQEEEKASGEVARPTAFFDCHMMVEEPEKWVADFAKAGAD
                     QFTFHYEATKDPLSLVKLIKENGIKAACAIKPGTPVDVLFELAPYLDMALVMTVEPGF
                     GGQKFMPDMMPKVEALRTKFPHMNIQVDGGLGKETIGVAAKAGANVIVAGTSVFTASD
                     PHEVISFMKEEVRKELKAKHILGDETKH"
     gene            complement(<603461..>603949)
                     /locus_tag="CAGL0L05500g"
                     /db_xref="GeneID:2890793"
     mRNA            complement(<603461..>603949)
                     /locus_tag="CAGL0L05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449014.1"
                     /db_xref="GeneID:2890793"
     CDS             complement(603461..603949)
                     /locus_tag="CAGL0L05500g"
                     /note="highly similar to uniprot|P47019 Saccharomyces
                     cerevisiae YJL122w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449014.1"
                     /db_xref="GeneID:2890793"
                     /db_xref="GOA:Q6FL80"
                     /db_xref="InterPro:IPR015218"
                     /db_xref="InterPro:IPR022784"
                     /translation="MPSRNSINRPKLTVNLNRKNSSISKKRDQRERAGLLQPARSSAD
                     SKSGKVKSVPLDLYFEGQKDDHASAKGITNKTLSKKRAKKIERNIKYAQQRRLLTDAT
                     AKLEADMEIDIDQKKTKDAKPKTALEQVKEALWNAVEDTSNSGLIIENGQGTVLGGPY
                     FP"
     gene            <604256..>605584
                     /locus_tag="CAGL0L05522g"
                     /db_xref="GeneID:2890794"
     mRNA            <604256..>605584
                     /locus_tag="CAGL0L05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449015.1"
                     /db_xref="GeneID:2890794"
     CDS             604256..605584
                     /locus_tag="CAGL0L05522g"
                     /inference="similar to AA sequence:UniProtKB:P47018"
                     /note="similar to uniprot|P47018 Saccharomyces cerevisiae
                     YJL123c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449015.1"
                     /db_xref="GeneID:2890794"
                     /db_xref="GOA:Q6FL79"
                     /db_xref="InterPro:IPR018814"
                     /db_xref="UniProtKB/TrEMBL:Q6FL79"
                     /translation="MVESRKSTEADEVFEFLDSLPEDKKGAEGKSKAKGAGKKDEEDV
                     FEFLEELEKSKMDLGAKKGKKVAETKKLDPQESNDGKAKSETKQEAPAVKKDTEEKSE
                     EASNAKVEANEETSKQGTNPDPIASISSWWSSAGSATVSSLWSKTTEHASQIKNRIQQ
                     EQLDITSKLNTQTITDLARNIQKIVVGETDEVLRIHLVHDLVKFPSLQYHIENRFDQV
                     MSSQVEGGIRIFVDEWGRPNRSNSISTVVDPEKREHEEKDAIEPKIKLNLFSGKVSDG
                     EKLAFANIDNSIKLFNKAHDEYIRQQKEAEGESEEGSSAEKSENRISDIFVSILPVAI
                     PDKNDSTKEDMIVTDPHHAGNFSFTVVLKDISNDITAITRSQAFPTSWVEWLEGETKK
                     NKESKKGDDNEDEEDDIVDPGEWVKDWIEDGLSLSLGILAQTYVIKRMGL"
     gene            <606070..>606546
                     /locus_tag="CAGL0L05544g"
                     /db_xref="GeneID:2890795"
     mRNA            <606070..>606546
                     /locus_tag="CAGL0L05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449016.1"
                     /db_xref="GeneID:2890795"
     CDS             606070..606546
                     /locus_tag="CAGL0L05544g"
                     /note="highly similar to uniprot|P47017 Saccharomyces
                     cerevisiae YJL124c LSM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449016.1"
                     /db_xref="GeneID:2890795"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6FL78"
                     /translation="MAEKKEDSKTKITEGEADLYLDQYNFTTTAAIVSSVDRKIFVLL
                     RDGKLFFGVLRTFDQYANLILQDCVERIYVQENGEYAEEDRGIFMIRGENVVMLGEVD
                     IDKEDEPLKSLKRIPFEEAKKLKQLKEEKRCKEEFATGKELARYGLSHDFHKQDLY"
     gene            <607008..>608132
                     /locus_tag="CAGL0L05566g"
                     /db_xref="GeneID:2890796"
     mRNA            <607008..>608132
                     /locus_tag="CAGL0L05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449017.1"
                     /db_xref="GeneID:2890796"
     CDS             607008..608132
                     /locus_tag="CAGL0L05566g"
                     /note="highly similar to uniprot|P46959 Saccharomyces
                     cerevisiae YJL125c GCD14 translational repressor of GCN4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449017.1"
                     /db_xref="GeneID:2890796"
                     /db_xref="GOA:Q6FL77"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /translation="MVEVFDKYKDLIQEGDLALIWISRDNIKPVTINANETFNTRYGS
                     FPHKDMIGKPYGSQIAIRTKVAKKFAFVHVMQPSPELWTLSLPHRTQIVYTPDSSYIM
                     QRLNCSPNSRVIEAGTGSGSFSHAFARSVGQLYSYEFHPVRYEQATEEFKEHGLLDKN
                     TIITHRDVCKDGFTIKKTDETSYQFKADEEQLQIKADVIFLDLPAPWEAIPHIDSVID
                     NDEKVGLCCFSPCIEQVDKTLEVLEKHGWFNVEMVEIQGRQYESRRQMVRSLDDALER
                     LSDIKKRKLAMVERRQKAEEELEKKIEANEKNLPELPPKSIEKSKFNPFGKGYRVKEG
                     DANFQWKEVTKVESEIKSHTSYLTFAYKIKRNEDENLDKN"
     gene            complement(<608227..>609168)
                     /locus_tag="CAGL0L05588g"
                     /db_xref="GeneID:2890797"
     mRNA            complement(<608227..>609168)
                     /locus_tag="CAGL0L05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449018.1"
                     /db_xref="GeneID:2890797"
     CDS             complement(608227..609168)
                     /locus_tag="CAGL0L05588g"
                     /inference="similar to AA sequence:UniProtKB:P47016"
                     /note="similar to uniprot|P47016 Saccharomyces cerevisiae
                     YJL126w NIT2 nitrilase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449018.1"
                     /db_xref="GeneID:2890797"
                     /db_xref="GOA:Q6FL76"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:Q6FL76"
                     /translation="MSVKIAIGQLCSSSQHAQNLSIVASLIERAIKLDARVIFFPEAT
                     DYLSQNATHSRVLAKSSPTFVDDLQLKIKDINERYKSEKRAIDVSIGVHLPPSEQDIL
                     KGDDRVKNVLLYIDSSGVIRSSYTKLHLFDVDVPNGPILKESQSVQPGDQIPSIIDTP
                     AGKLGCSICYDIRFPELALRLRSMGAQILCYPSAFTMKTGQAHWELLGRARAIDTQCY
                     VVMPGQSGTHNVTEDTWSKTADSKTNPNSVTRMSWGHSMIINPWGDVIARSDETNNEP
                     QLVVSDIDLKSMERVRVNMPLWQQRRLDLFDNNYSIT"
     gene            <609615..>611210
                     /locus_tag="CAGL0L05610g"
                     /db_xref="GeneID:2890798"
     mRNA            <609615..>611210
                     /locus_tag="CAGL0L05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449019.1"
                     /db_xref="GeneID:2890798"
     CDS             609615..611210
                     /locus_tag="CAGL0L05610g"
                     /inference="similar to AA sequence:UniProtKB:P35208"
                     /note="similar to uniprot|P35208 Saccharomyces cerevisiae
                     YJL127c SPT10 transcription regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449019.1"
                     /db_xref="GeneID:2890798"
                     /db_xref="GOA:Q6FL75"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FL75"
                     /translation="MARGESFDAHESPLQPKTILLKDGETIATMYPIPSVPKLIPDGL
                     MSFLVEEFNMEIEKGDSLPFYNTLTVDEFEKLMFVAEGHICVMVLGEIPELDYSAEDG
                     MQSRTNGKAGGKNRPGDSELMRFTPQYKRRKERKNLNLHIQWEKQCLGIFSLQSAFPG
                     RSAHVATGTFLVNAGIRGKGIGRTLVETFIDWSKLLGYTSSFFPLIYGTNVGMRRILE
                     DLNFRKIGKLPESGILKGFDVPVDSFMYGKEFTHITKSIDMLRDTQKSDDIGKYERLK
                     YYLESGTYPANCDRNEKARLRVSARSHSVMNNKLMNGSGKEVVYEPDRQHQIAYETHQ
                     VEHQGINKVTTKIAEKYHWKGIKNTVTEVIAKCPKCKIRYPDGMGVVVTQDENVPQAH
                     MLPTHRIQVVDKTSKPEIEEEPLPKKQKLHVQKLENKHLPDPTPPDNNVFNLTANTWA
                     EKLAANIGLDSSTAVPNIDMHDDHDHKGREMSLHRQDIDMAAHKDDDSNIMDAAMLSL
                     EDNVIAALEIVRKEQRDEDHYYH"
     gene            <611449..>611607
                     /locus_tag="CAGL0L05626g"
                     /db_xref="GeneID:9488042"
     mRNA            <611449..>611607
                     /locus_tag="CAGL0L05626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999545.1"
                     /db_xref="GeneID:9488042"
     CDS             611449..611607
                     /locus_tag="CAGL0L05626g"
                     /inference="similar to AA sequence:UniProtKB:Q3E828"
                     /note="similar to uniprot|Q3E828 Saccharomyces cerevisiae
                     YJL127cb"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999591.1"
                     /db_xref="GeneID:9488042"
                     /db_xref="GOA:B4UN48"
                     /db_xref="UniProtKB/TrEMBL:B4UN48"
                     /translation="MIFFYQQIRAIFTHSHSTKRQIQLSRRAFFQLLGFLGSCVVISL
                     AAQSNYLQ"
     gene            <612478..>614511
                     /locus_tag="CAGL0L05632g"
                     /db_xref="GeneID:2890799"
     mRNA            <612478..>614511
                     /locus_tag="CAGL0L05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449020.1"
                     /db_xref="GeneID:2890799"
     CDS             612478..614511
                     /locus_tag="CAGL0L05632g"
                     /inference="similar to AA sequence:UniProtKB:P08018"
                     /note="similar to uniprot|P08018 Saccharomyces cerevisiae
                     YJL128c PBS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449020.1"
                     /db_xref="GeneID:2890799"
                     /db_xref="GOA:Q6FL74"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FL74"
                     /translation="MERVRLDRKSSNDSNHSLGGESTSRSGGSGIGVAPTSGNNGTVK
                     RASSMSSNYSNINASLHARVKAFQEQRGLHRSSSLGKGDSEENIGNVGTSINPSPSLG
                     SMKDEPVPAIQKIVNKPLPPLPGQNSSSLTPSQETINMISNASQQAPDGPLNNISPVP
                     GFKEAMGGNVRRNDGQNLYGSTSPAVTASAPNMPAFNPNRKAPRPPQIPHNTVIPAKP
                     MQSLSSRRGLKLPPGGMKLKLPSKGDAPASMPSTVPAASSVKPVVHQEFAATPSNKNH
                     IKNNNGSTEGKRSNPGSLVNAVQTTSISSANDQQDTEGTEPKSNSNGTGLFANFSRYV
                     DIKSGSLNFAGKLSLSSRGIDFSNGSSSRITLDELQFIEELGHGNYGTVSKVLHKPNN
                     VLMAMKEVRLELDESKFRQILMELEVLHKCNSPFIVDFYGAFFIEGAVYMCMEYMDGG
                     SLDKIYDENPEMGGIDEPQLAFITNAVIQGLRELKEVHNVIHRDVKPTNILCSAKQGT
                     VKLCDFGVSGNLVASLAKTNIGCQSYMAPERIKSLNPDRGTYTVQSDIWSLGLSILEM
                     ALGRYPYPPETFDNIFSQLSAIVDGPPPKLPADKFSDEAQDFVSLCLQKIPDRRPNYS
                     NLYEHPWLAKYRSIDVQMGPYITKRLEIRKRILAEKGEDGLHRTVPALHKGGL"
     gene            <615765..>619823
                     /locus_tag="CAGL0L05654g"
                     /db_xref="GeneID:2890800"
     mRNA            <615765..>619823
                     /locus_tag="CAGL0L05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449021.1"
                     /db_xref="GeneID:2890800"
     CDS             615765..619823
                     /locus_tag="CAGL0L05654g"
                     /note="some similarities with uniprot|P12685 Saccharomyces
                     cerevisiae YJL129c TRK1 or uniprot|P28584 Saccharomyces
                     cerevisiae YKR050w TRK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449021.1"
                     /db_xref="GeneID:2890800"
                     /db_xref="GOA:Q6FL73"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:Q6FL73"
                     /translation="MELRRRLSRVQTLTQFNFSYNKSFGHKFRDFIAKSGHHVKPIQK
                     YIFPNFIAVHYFYIIFMTILASILLYPVKNFSYIDILFLAAGATTQGGLNTVNINELT
                     LYQQMIIYIICCLCTPIAIHGTLAFVRLYWFERYFDNIRDTSKRNYKMRRTKTILERE
                     KTARTLSRLRTNTTIPIHKSNQENSQRSNFQEKLFSGEFVNRDEQNSIESQQDAMDSQ
                     STQNSLPTFKGLGPSKIQKTASPRSLNSTLPSGSVLEDGESRTPYEQPIDYTIPNSNP
                     NLTVPVERFKRRRSRDISPQDMYRSIMMLQDKHSNIDDNEEGPALVIGSPQDRQNIKP
                     TVQSQSMGHNALTPVHSISDKEVSPKHVDANEINMGMKVKDKHGNQGPSRRSGSQSPS
                     SENAFPNENDEEENFSPYTNSRKIKLNKHPTGRNYDNSSDDLNSAGNYNSEEGLEGEN
                     ATQSTEEVSPLDSDDAYSDGDSHEYENTEVNEDSDSIQDIQSGNNRLYRRRTDQERNL
                     NYESEASITQDNIERHNNDSINSENAASDDSESNGENTNDRNARTPNKGGEPKIQFNI
                     TEPPRKRRTQNFHIMEATRPNIPHNAHKRTSSNLFLKQLSKGKRIRHNLKRRLSSGPF
                     EKNESPFNPSIKNVNKQKGSQKETNQDNGEDYFADNESDDDDNNPASSDYNGLSKTVS
                     YNNTEDRKPDPVRLTMERAMTMDNITPEDLNKLAQKPDFQKMVYKNWKRKHRKNKKNR
                     KLGWNKKFDFEDTLPTVFDSHNEGHQRTMSNDEDNEDIRNGNIDRYNTIDYNDGYQID
                     PDMNEEGYFGVSFNNDYNFSRHPFSRTMSANYLSWEPTVGRNSLFVDLSRAQKEELGG
                     VEYRSIKLLCKILVIYYLGFHIMSFTMLLPWITHKTKYKHIVRDDGVSPGWWGFFTAM
                     SAFNDLGLTLTPDSMSSFNRAAYPLIVMIWFIIIGNTGFPVLLRFIIWVMYHLSSDLS
                     QLRESLAFLLDHPRRCFTLLFPSTATWWLFGILVGLNITDWILFIILDFNNVVVKPNP
                     KGYRVLMGLFQAVSTRTAGFSVVDLSQLNSAVQVSYMIMMYVSVLPLAISIRRTNVYE
                     EQSLGLYGNVEDDDSSDSDYEDHLSSEEELLAKNGDNDDDEETLDSQYYSKSIRGRND
                     SDESSSNEGGSNSSAKKRKRTAKKESSKGKKKKRRVSEKKSKSFIGAHLRRQLSFDLW
                     FLFLGLFVICICENGKIKDVARPAFNVFPILFEIVSAYGTVGLSLGYPNTSQSLSGQF
                     TTLSKLVIIAMLIRGRNRGLPYTLDRAIILPSDRLERIDHIEDLKLKRTAGLHARHQP
                     RPEDERKKSIAKKSFKYIKKGGKGLLYPSKLL"
     gene            <621731..>628366
                     /locus_tag="CAGL0L05676g"
                     /db_xref="GeneID:2890801"
     mRNA            <621731..>628366
                     /locus_tag="CAGL0L05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449022.1"
                     /db_xref="GeneID:2890801"
     CDS             621731..628366
                     /locus_tag="CAGL0L05676g"
                     /note="highly similar to uniprot|P07259 Saccharomyces
                     cerevisiae YJL130c URA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449022.1"
                     /db_xref="GeneID:2890801"
                     /db_xref="GOA:Q6FL72"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FL72"
                     /translation="MTTPVAPITPPMETTGDRLVTLELKDGTTLQGYSFGAEKPVAGE
                     LVFQTGMVGYPESITDPSYEGQILVITYPLVGNYGVPDFNLRDEFIESLPRYFESNRI
                     HVAGLVISHYTEDYSHYLAESSLGQWLKREGVPAVYGIDTRALTKHLRNCGSMLGRLA
                     LQEASAKLEVATSESWKSVFDVPEWVNPNVENLVAKVSLKEPKLFTPPSDNKYVEVKK
                     GADGKTIRILAIDVGMKYNQIRCFVKRGVELLVVPWDYDFTKEDYDGLFISNGPGDPS
                     VLNDLANRLSKALEKKKTPIFGICLGHQLLARASGASTLKLKFGNRGHNIPCTSTISG
                     RCYITSQNHGYAVDVDTLTPGWKPLFVNANDDSNEGIYHTELPYFSVQFHPESTPGPR
                     DTEFLFDVFINAVLEHKNSGVLKPVEFPGGKIENNRKENPRVEAKKVLVLGSGGLSIG
                     QAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKVYFLPVTAEFVRKVIL
                     HERPDAIYVTFGGQTALSVGIEMKDEFESLGVKVLGTPIDTIITTEDRELFANAIDEI
                     DEKCAKSQAANSVEEALAAVKDIGFPVIVRAAYALGGLGSGFANNEQELIDLCNVAFA
                     SSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLS
                     DEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSALASKATG
                     YPLAYTAAKLGLNIPLNEVKNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTELS
                     SSMKSVGEVMSIGRTFEEAIQKAIRSTEYSNLGFNATDLEIDIDYELQNPSDLRIFAI
                     ANAFDKLGYSVEKVWEMTNIDKWFLNKLYDLVKFASKVSSCGGIEGLSPTVLRQAKQL
                     GFDDRQIASFTSSNEVAIRRLRKDYGIIPFVKQIDTVAAEFPAYTNYLYMTYNAAEHD
                     VEFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANNIKTIMINYNPETVSTDYDE
                     ADRLYFETINLERVLDIYEAEASNGVVVSMGGQTSNNIAMSLHRENVKILGTSPDMID
                     SAENRYKFSRMLDQIGVDQPAWKELTSMDEAEDFAEKVGYPVLVRPSYVLSGAAMNTV
                     YSKNDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVARNGELVMHVVSEHVENAG
                     VHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKDNEIKVIECNV
                     RASRSFPFISKVVGVNLIELATKAIMGLPFAPYPVEKLPDDYVAVKVPQFSFPRLAGA
                     DPVLGVEMASTGEVATFGHSKHEAYLKSLLATGFKLPKKNILLSVGSYKEKIELLPSV
                     QKLYNMGYKLFATAGTADFLTEHGLSVQYLEVLNEDEPEKKEYSLTQHLANNEIDLYI
                     NLPSANRFRRPASYVSKGYRTRRMAVDYSVPLVTNVKCAKLLVEALAQNISLNVSERD
                     AQTSHRTVTIPGLINITTYVPNITNVVEGPAELKETTRLFLESGFSYCQIMPRASRGP
                     VINDAASIKVATSVSNNSCHTDFAFTIAGTAHNAQQIAQSADKANALYLPLHELKNKV
                     STISELLSNWPSNKQVITEAKTSDLASVLLLASLQNRSIHITGVSKKEDLSLIMTVKE
                     KDPKVTCDINVYSLFVTQEQWPEAMFLPTEEDQEFFWKNLSAIDAFSIGSVPTQLAEI
                     TGNKVEVGLGIKDALPLLLSAVEEGKLTVDDIVEKLHDNPAKIFNIPTQNSLVELDLD
                     FSFASKKRWTPHSNTSLRGGIERVVVNDETLVLSGELVATEPKGTLKMKSELVQASVE
                     NAPAIQSTGRRMTIHDDKLMDVDSAENSIPDAPIQQKLMSSKPPRELTAPSALQNLIR
                     GNNPFQGRHILSIKQFSRADFHALFAVAQELRAAVAREGVLDLMKGHIITTIFYEPST
                     RTCSSFIAAMERLGGRVVNINPNVSSVKKGETLQDTIRTLACYTDAIVMRHSEEMSVH
                     IAAKYSPVPIINGGNGSREHPTQAFLDLFTIREEIGTVNGITVTFMGDLKHGRTVHSL
                     CRLLMHYQIRINLVSPPELRLPESLREELNSKGQLGVESVALTPEIISKSDVLYCTRV
                     QEERFKSTEEYERLKDFYIVDNKILSHAKQNMAVMHPLPRVNEIKEEVDYDHRAAYFR
                     EMKYGLYVRMALLAMVLGVNN"
     gene            <628965..>629975
                     /locus_tag="CAGL0L05698g"
                     /db_xref="GeneID:2890802"
     mRNA            <628965..>629975
                     /locus_tag="CAGL0L05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449023.1"
                     /db_xref="GeneID:2890802"
     CDS             628965..629975
                     /locus_tag="CAGL0L05698g"
                     /inference="similar to AA sequence:UniProtKB:P47015"
                     /note="similar to uniprot|P47015 Saccharomyces cerevisiae
                     YJL131c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449023.1"
                     /db_xref="GeneID:2890802"
                     /db_xref="GOA:Q6FL71"
                     /db_xref="InterPro:IPR019815"
                     /db_xref="InterPro:IPR029427"
                     /translation="MIRSILCCRPVRQFHSSFLSLNSASPALNAGIAIDAWLKRGTAK
                     SNIKNRKKYDHHHNGENRRRKKPMAVRWSSGTERAKEAANHMLSKVFETNSKGNIRFF
                     NQISGKVEDSNIREFAKGIDLSQHGINIVNIINTETEQLPFVKLVDTKTALKKYSDYL
                     AEKKEEELKSMGLLPRKFFENSKTNEDNLKHIKISWSIKEDDLAKQKAHDITSMLKKG
                     NKVNLYIADKEDLGGSKWMENFENVEEEKPPSKKRLRPSEIERRESIIEQLKLLVSDI
                     STDPIIEGRANGKMIIRLTPKVNKDDSIDKRSLKELKKQQRIEKLNKKLQRKKERELQ
                     DD"
     gene            complement(<630145..>632361)
                     /locus_tag="CAGL0L05720g"
                     /db_xref="GeneID:2890803"
     mRNA            complement(<630145..>632361)
                     /locus_tag="CAGL0L05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449024.1"
                     /db_xref="GeneID:2890803"
     CDS             complement(630145..632361)
                     /locus_tag="CAGL0L05720g"
                     /inference="similar to AA sequence:UniProtKB:P47014"
                     /note="similar to uniprot|P47014 Saccharomyces cerevisiae
                     YJL132w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449024.1"
                     /db_xref="GeneID:2890803"
                     /db_xref="GOA:Q6FL70"
                     /db_xref="InterPro:IPR029002"
                     /db_xref="UniProtKB/TrEMBL:Q6FL70"
                     /translation="MRVVYINTLILVTYCTFSYAAGVGSHLTFLLRVISDPSVFEETQ
                     LNINSQYYFPWLKSGAFFPDALYSCSLNNKKWHDFAEYTHWSPFLELAINYWRDTYGD
                     KKNDIMSEESQKLAAFLLGIFTHQVVDVPWHALGEGYRDHGLLKVLAELEFNSDLNKA
                     HSYLDIIGDFLIMADMLEGVDNEADNLIWKFFNSLDWALPSPRDISALVSLSGFSEVD
                     INYRDIEKCVTRGMTALNSEVRLIATDKLPYLLLAYNSSPKARELIKYNKVGGEFDLI
                     LTLKRKVKGFLRKFKNNEMVSYLGDGDTGYDSIDIIERSMPNRVVPLHSKSFGSFKKY
                     WIGRKDSHLGENMLFVKLNDTKFYLISCSSFTDRYGQVYIIPICKDNKQLIYDSTISP
                     VLKIKGSSIGKIEISYNDSHALIVIDSFSRVIKIYHSASEHYSYQIDDCDMNNLKIVS
                     IIYDRSTDMNTIFLADKLYGKNEKGKVISFEIDGSGRPIKNTGTGKVLLQTVMDPSTF
                     KLGNYVHTASSVLISGKSMYIAAAGAGVVMRCHVSAVPLSEESCSIVNIPNNPENSDI
                     SEIVPLPSRIHGDFGKTLLSIFHQDEIYILISQPLHNFVHVYKEIFGNLRYLTKLTVP
                     IRLDEIPQLVGFGTSMVFDKVEGVLHIASPGINGGKGAIWTVSFSEIVEAAHRNTIEL
                     NPNNHVKYTNPLSSIHARSFGFSLAWCDEGQLAVGVPEFGYNSIGLEEVAGAILIY"
     gene            complement(<632841..>633758)
                     /locus_tag="CAGL0L05742g"
                     /db_xref="GeneID:2890804"
     mRNA            complement(<632841..>633758)
                     /locus_tag="CAGL0L05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449025.1"
                     /db_xref="GeneID:2890804"
     CDS             complement(632841..633758)
                     /locus_tag="CAGL0L05742g"
                     /inference="similar to AA sequence:UniProtKB:P10566"
                     /note="similar to uniprot|P10566 Saccharomyces cerevisiae
                     YJL133w MRS3 or uniprot|P23500 Saccharomyces cerevisiae
                     YKR052c MRS4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449025.1"
                     /db_xref="GeneID:2890804"
                     /db_xref="GOA:Q6FL69"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FL69"
                     /translation="MESSDVIDYEALPDHAPLAHQLMAGAFAGIAEHSVIFPLDALKT
                     RLQAMHAISTTGGQPIPSTMLRQLSSISAQEGSMVLWKGVQSVLLGAGPAHAVYFATY
                     EMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQLNTNISVWDT
                     AKRIYSKEGFQAFYSSYPTTLAINIPFAAFNFGIYDTATRYFNPSGVYNPFIHCLCGG
                     ISGAACAGLTTPLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSG
                     VKPRILANMPATAISWTAYEFAKHFLFHY"
     gene            635740..635812
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L05764r"
                     /db_xref="GeneID:2890805"
     tRNA            635740..635812
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L05764r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2890805"
     gene            complement(<638173..>639219)
                     /locus_tag="CAGL0L05786g"
                     /db_xref="GeneID:2890806"
     mRNA            complement(<638173..>639219)
                     /locus_tag="CAGL0L05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449026.1"
                     /db_xref="GeneID:2890806"
     CDS             complement(638173..639219)
                     /locus_tag="CAGL0L05786g"
                     /note="some similarities with uniprot|Q12145 Saccharomyces
                     cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
                     cerevisiae YPR015c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449026.1"
                     /db_xref="GeneID:2890806"
                     /db_xref="GOA:Q6FL68"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FL68"
                     /translation="MNNYMLMHQNNYQYPVQVQTPVPMPNHQHQQAGAAQPANHILPL
                     TSNANAGYHNTNVVNSQERGNITLPPISSIVGNCVPPQAQQQDVCVQAHVAEPYPQYQ
                     SITHNNGMIKGGQQYHYYVPPPRAITPCLSSQGSPSFSHSNLVMVPKLDKQTSYLNAN
                     GTVVMDRTPSNYSNSSLVSYNSQNAESPGMTTPMSTPPSAFSSRSASASGMPMPTVFE
                     GRTTDISRTASTSPKTPSLPDSSKSIRKSTEGIKKSKSKSQSPKTKSKVTPTSITVSA
                     IDELSKLRKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHL
                     KCHERKKQAKAQAA"
     gene            <651511..>652161
                     /locus_tag="CAGL0L05830g"
                     /db_xref="GeneID:2890808"
     mRNA            <651511..>652161
                     /locus_tag="CAGL0L05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449028.1"
                     /db_xref="GeneID:2890808"
     CDS             651511..652161
                     /locus_tag="CAGL0L05830g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449028.1"
                     /db_xref="GeneID:2890808"
                     /db_xref="UniProtKB/TrEMBL:Q6FL66"
                     /translation="MAHSRTFTEQLHHLRCLNDEILKTTDDINESLVESEITHIESKS
                     VGESITTATTTTFTMKQNSEIVHYLLPFLNSLIKSFYSFYEHINDVEQLDFQFSQFRK
                     SMTFSPVCKFSHNTTQTKDLVGTEVVNKNEWYEYHNGNMTKLFEILDTILILQTQLLN
                     AYNNKHNSLKTNYQLDILYSIFIDPKSYGLKESDHVKSLRLEMFNVLLELFKSEFK"
     gene            complement(<652387..>653901)
                     /locus_tag="CAGL0L05852g"
                     /db_xref="GeneID:2890809"
     mRNA            complement(<652387..>653901)
                     /locus_tag="CAGL0L05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449029.1"
                     /db_xref="GeneID:2890809"
     CDS             complement(652387..653901)
                     /locus_tag="CAGL0L05852g"
                     /note="some similarities with uniprot|Q02199 Saccharomyces
                     cerevisiae YGL172w NUP49 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449029.1"
                     /db_xref="GeneID:2890809"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:Q6FL65"
                     /translation="MFGLNKPSTGLFGNNNAGANTGSGFGSNAGQSSGGGLFGSTSNN
                     NTGLFGGANSNNMAGQNNTTTGGGLFGNSNATGAGGGLFGNSNSNTTGNAASSGGLFG
                     NNNTNTATGTTTGGGLFGNNTSTGGLFGTNNNAGSTSTGGGLFGTNNNTGNTSTGGGL
                     FGASKPATGGLFGNNSNNTATTNSASTGGGLFGNSSNTMNATGGMGGLFGNKPAQGIG
                     STGTSLFGNNQNSAGTTSGLGGGGLFGSKPTTGSSLFGGNSSNTGFGSNTNGGLFGAV
                     QQQQQPQSALESINQLAITPLTRISDLPPQIRAEVEQLDQYIQKQVQISEHLKADDKD
                     HDELVSSIPRDIAYLTKVQSMTMQSLQMDLKRISKSKELTDNNLSDTQMFAIILQQIL
                     TPGSKISSLELEKFFQAKIAMYQSKLDDYFRVLSDIESAVNGIHCDIFGGSHEISGSD
                     GLSNNDNAQEDLYAMKTGLNAIISTVIEEFKLFMSTADQIASLHQKVKLLTSTK"
     gene            <654937..>659505
                     /locus_tag="CAGL0L05874g"
                     /db_xref="GeneID:2890810"
     mRNA            <654937..>659505
                     /locus_tag="CAGL0L05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449030.1"
                     /db_xref="GeneID:2890810"
     CDS             654937..659505
                     /locus_tag="CAGL0L05874g"
                     /inference="similar to AA sequence:UniProtKB:P22147"
                     /note="similar to uniprot|P22147 Saccharomyces cerevisiae
                     YGL173c KEM1 multifunctional nuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449030.1"
                     /db_xref="GeneID:2890810"
                     /db_xref="GOA:Q6FL64"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:Q6FL64"
                     /translation="MGIPKFFRYISERWPMILQLIEGTQIPEFDNLYLDMNSFIHTCT
                     HGNDDEGVTQKMSDEELYSRIFTYIDHLFLMIKPKKVFYMSIDGVAPRAKMNQQRSRR
                     FRTAMDTEKALQKAMDEGEEIPKGDAFDSNCITPGTEFMAQLTRNLNYYIHDKVTNDA
                     NWRDIEVILSGHEVPGEGEHKIMDFIRNITAQEDYDVNTRHCIYGLDADLIMLGLSTH
                     APHFALLREEVTFGRRNNSRNKNLEEQNFYLLHLSLLREYLELEFKEIGDDLQFEFDF
                     ENILDDFILVMFVIGNDFLPNLPDLHLNKGAFPVLLQTFKEALLHVDGYINERGQINF
                     KRLKVWLDYLSQFELMNFENDDIDVAWFNQQLENISLEGERKRQRMGKKLLIKQQKKL
                     VGMVKPWLLKEINKEIPANLEDSDIPQLPLSVDTETLKENLDFLKKFALDLGLIIVHS
                     KSKDTYSLKLDIDAINPSETDEQRQNRINETRKTIKKYQSAIIVEDKEELEEEKDIYN
                     ERFENWKAEYYRSKFGIKRDEPERIVEIANNYVEGLQWVLYYYYQGCPSWSWYYHFHY
                     APRISDLAKGLDQIIKFEQGSPLTPFQQLMAVLPERSKNLLPAAYRPLMYDPKSPILD
                     FYPSEVQLDKNGKTADWEAVVLLPFVDENRLIEATNHCLAKLSPEEKQRNSFGKNLTF
                     MYNPQVDNVYRTTLKGIFSDIQHNHCVALEYQPKPMEGKQFRYGLLPNAKLKTQLLAG
                     FPTLYSLPFTNSLEYNESYVFQQPSRQQSMVLRITDIYKENNLTMKDIADRYLNKIVY
                     TRWPYLRESKLISITDGETIHECIPNPAKNTVKIITRPLENNERKQFNSTKNSMLRSY
                     GKQKAVILKKIDIIVQVLAVTGLVRKPNGAYVKTYASQPDYYPMQLVVENVSNHDERY
                     IERPPKPIEKEFPINSKVIFLGDYAYGGEATVDGYSSESRLKITVKKRFLKTEPTIGK
                     DRLKMDESMIKYYPSYVISKELQLHPLFLSKITSKFLVTDCNGSHVNVGIPIKFEARH
                     QKVLGYARRNIKGWDYSNVAVALIKRYREMFPAFFAKLSKTSGDIPVMQDLFPDLSSR
                     AIMSMLDDIKQWIKFSTENFVVVSLESNSLTKASIRACEDYIEKYSSSIEQHETKQLA
                     KVPREAVLSPRVSFSQLRAQKFDLGDRVVYIQDSGKVPLFSKGTVVGYTTLGLSLSIQ
                     VLFDHEIVAGNKFGGRLRTKRGIGLDASFLLNITNRQFIYHSKASKKVSQVDNSKSAK
                     QQKNTNAKPKPETKQAKQPRREKPEDPAAKELLSYIKKGDKTQKNSTERKTSEKSFKD
                     PQAKNNTEVVEIEQLNLTENQAEPTLANAANLYSAVTNQYDSSTGNPIIPMSNTGAAP
                     GVSLPYFVPNGQIPYGVPPNPPMFPMGVPMQGPPMPNGMMPPPQFANPNMHMNPLPPT
                     SNISIAIDKEGSKDLLKSVRRKPDQRNKDNNSGRNENKSGHFGSKSNRKTDTNAPKKS
                     SGKPRKPGKKIASGFESKKNEPDTRAEF"
     gene            complement(<659623..>660330)
                     /locus_tag="CAGL0L05896g"
                     /db_xref="GeneID:2890811"
     mRNA            complement(<659623..>660330)
                     /locus_tag="CAGL0L05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449031.1"
                     /db_xref="GeneID:2890811"
     CDS             complement(659623..660330)
                     /locus_tag="CAGL0L05896g"
                     /inference="similar to AA sequence:UniProtKB:P46947"
                     /note="similar to uniprot|P46947 Saccharomyces cerevisiae
                     YGL174w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449031.1"
                     /db_xref="GeneID:2890811"
                     /db_xref="GOA:Q6FL63"
                     /db_xref="InterPro:IPR018609"
                     /translation="MSLHDYLLKEYGPSDRKKKSKKVDSKSTAQKPNNEDVNSNANNP
                     LRDNSEKSLWLSHGVNNIPGAPLSDNLTNKQKNGINIEPPSRTVLEPKTHNIETVFRN
                     AQGHKIDVEAKTLDSDSGKRNSQEERIRILNMGEIQLAGLDGVSTISSKYTAEIRDND
                     PATEFDHNKGVNHQKISPLGRKLYAGTATENRFGILPGNKWDGVDRSNGYEKKWFKRQ
                     GELAESKIQEFTNSEDY"
     gene            <660823..>661854
                     /locus_tag="CAGL0L05918g"
                     /db_xref="GeneID:2890812"
     mRNA            <660823..>661854
                     /locus_tag="CAGL0L05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449032.1"
                     /db_xref="GeneID:2890812"
     CDS             660823..661854
                     /locus_tag="CAGL0L05918g"
                     /inference="similar to AA sequence:UniProtKB:P46946"
                     /note="similar to uniprot|P46946 Saccharomyces cerevisiae
                     YGL175c SAE2 meiotic recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449032.1"
                     /db_xref="GeneID:2890812"
                     /db_xref="UniProtKB/TrEMBL:Q6FL62"
                     /translation="MPNDEIIKTVTAMNVTQLLDLQDFITKTLRERLINPSNDLKSTE
                     DQPKEVLLPNEIQEEGKVDGKPKNGNLVTVLQVKREDSQDSDDFILTQFDSQDVGSAK
                     KQSQFEKSSIKPEFSSPLKFSQVSNDSKADNPLPKEVCHANGGDHLSIEKTIPFKRRL
                     DLENIKEYDWKWSHHNDKVQNNKQSILDFNKNPFSKRPWILEDFCPNSNAIAKKKHEI
                     DFEKFQKKVSNFIENKTNNAKESDIECAKYEGRLRNIHFDNMRNRSPSPPGYGRLDFP
                     STQERADDKSKAQSIIRDKTLYRFLEATNNRVPPMKREFLFKKRELNDVVDDGNFDWT
                     EESLEIFSR"
     gene            <662250..>663698
                     /locus_tag="CAGL0L05940g"
                     /db_xref="GeneID:2890813"
     mRNA            <662250..>663698
                     /locus_tag="CAGL0L05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449033.1"
                     /db_xref="GeneID:2890813"
     CDS             662250..663698
                     /locus_tag="CAGL0L05940g"
                     /note="weakly similar to uniprot|P46945 Saccharomyces
                     cerevisiae YGL176c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449033.1"
                     /db_xref="GeneID:2890813"
                     /db_xref="GOA:Q6FL61"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FL61"
                     /translation="MAVELPGYFYDTEKRRYFKITNSINASIELSGNKYSRDVLNNVK
                     VNLLGQQSKKAYTDPYKIQDEYLKDRSIRYMVDNNVLSKGQIFKQSESSASIVSTNNI
                     TFPYSDKIIAAQDVNYIEDGLHRTKTLYITSAGQILETRIDSPPNTAILLFRPEDTEE
                     STIDLANFEVSQYYLGLVLVHMVGSHGKNILFWSVQNRNETINFRSKVIENKYMTYVT
                     LLDPNHIFYLLGNKLHFVSSENFSFDNKLTLYPKERSYWRLKGQITCVKFNPIDNETY
                     RIYAGSRNGILTSFIFSVKYGVMPKSVQTWDRPGNLITIVSMLSTNIDGIIFVSGLTN
                     KKDHSQTIIALNTKSLLPNLTHMLTLKSHFRNVTQSTEIFLLNQHENILLYGCKRGVR
                     VEPDFEIFKLDSNSPINDKSHHILPNLKFSSLLDKKYFTSPFELIQIVGEIGEQNVKK
                     NIDDRIFIKRLLIKVFAKVSHHNQTCMIIVKL"
     gene            complement(<664295..>666988)
                     /locus_tag="CAGL0L05962g"
                     /db_xref="GeneID:2890814"
     mRNA            complement(<664295..>666988)
                     /locus_tag="CAGL0L05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449034.1"
                     /db_xref="GeneID:2890814"
     CDS             complement(664295..666988)
                     /locus_tag="CAGL0L05962g"
                     /inference="similar to AA sequence:UniProtKB:P39016"
                     /note="similar to uniprot|P39016 Saccharomyces cerevisiae
                     YGL178w MPT5 multicopy suppressor of POP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449034.1"
                     /db_xref="GeneID:2890814"
                     /db_xref="GOA:Q6FL60"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FL60"
                     /translation="MSSNHQPHLSINSIQSLIEPVTPPSLGQMNNKKNHQKTHSLDLS
                     VFNQFITSNTPIDSLGTSSSSTQTSPLGLLQKDLQQKQQLQGYSQAASLGLLNGHSHN
                     ITPNLPLIDEFDISFDVTNAVDNLADNSNVLEPHLNSVAPVNQVNITVSPLVPEMESM
                     TLADNKKLNSSSMDKQRTVSHSRQGKDEKMKGKKTPQNNRSNNQTKAKYTNKLNDVET
                     DSINMTDISNTPLKELDYVKLATDQFGCRFLQKKLETPSESNLVRDLMYDQIKPYFLE
                     LILDPFGNYLIQKLCDFLTPDQRTALIEAIYPNVFQISINQYGTRSLQKIIDTVDDEQ
                     QINLIVKGFSNEYTSIRQVVTLINDLNGNHVIQKCIFKFPASKFDFIIAAIIDQNNII
                     AISTHKHGCCVLQKLLSVCTLQQTFKISVKIVQFLPNLINDQFGNYIIQFLLDIEELD
                     FYMLAEFYNRLSGEICQLSCLKFSSNVVEKFMKKLFSIISKVIDLYTENTEKYRNSGV
                     LESLILPPTITEDIFNAAVCILIKMVDVFTMKLNLLIRDNFGNYALQTLLDIKNYGKI
                     ISFYSTINKEKFQLESDFNKNICNNLSQLSTDFGSKISNLVILTKELLPSIKTTSYAK
                     KIKLKVKAYAEFTGVPFTELTSKKQLHSDAQSSKTPPNNRSNRVYSSDVNNIDSKSSV
                     YAKQHARHYSLPSNTFNGRSTNTLPNTLYNYPPPTMLQNMNENPYNNDMFGKQHNIQS
                     ATGYGSNRYVGGPLLGNISQYPQIPFIPPIEQSQQNIPTSFNTMTPTIPGMVGRQGSS
                     SQSSVYMMNDNCASGGSSSSTLYPNGMIGSFSDVNPNQQPVRFKGSVYPSEVIDNSRQ
                     QRIVSSPYPQYGFANEALGNQKNFGNTNDNNDEAKFGFGFH"
     gene            complement(<669150..>669527)
                     /locus_tag="CAGL0L05984g"
                     /db_xref="GeneID:2890743"
     mRNA            complement(<669150..>669527)
                     /locus_tag="CAGL0L05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449035.1"
                     /db_xref="GeneID:2890743"
     CDS             complement(669150..669527)
                     /locus_tag="CAGL0L05984g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449035.1"
                     /db_xref="GeneID:2890743"
                     /db_xref="GOA:Q6FL59"
                     /db_xref="UniProtKB/TrEMBL:Q6FL59"
                     /translation="MEVSRRCRKLEEKGALVPPTTALPLTITHLWITWIITMLPLLKE
                     TSPIQLNRSAENTRHQRKALLNCSRPLMIFWIVLIFFRLVARPKVQIFNLTLAPIVPI
                     QYHFIYVVLKRYGSLFISSLLAA"
     gene            complement(<672704..>675532)
                     /locus_tag="CAGL0L06006g"
                     /db_xref="GeneID:2890744"
     mRNA            complement(<672704..>675532)
                     /locus_tag="CAGL0L06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449036.1"
                     /db_xref="GeneID:2890744"
     CDS             complement(672704..675532)
                     /locus_tag="CAGL0L06006g"
                     /inference="similar to AA sequence:UniProtKB:P53104"
                     /note="similar to uniprot|P53104 Saccharomyces cerevisiae
                     YGL180w APG1 essential for autophagocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449036.1"
                     /db_xref="GeneID:2890744"
                     /db_xref="GOA:Q6FL58"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR022708"
                     /translation="MDRFRIQDGKYVVEKEIGKGSFATVYRGHVTTDPKSHIAVKAVA
                     RSKLKNKKLLENLEIEIAILKKIKHPHIVGLIDCERTTTDFYLVMDYCALGDLTFLIK
                     KRKELENNHPLLQTVFNKYPPPSKEHNGLNRAFVVCYLQQLASALKFLRSKNLVHRDI
                     KPQNLLLATPLTNYRDSKTFHELGYVGIYNLPILKIADFGFARFLPSTSLAETLCGSP
                     LYMAPEILNYQKYNAKADLWSVGTVLFEMCCGVPPFTASNHLELFKKIKRAHDEINFP
                     EVCEVEDGLKELICSLLTFDPAKRIGFEEFFNNKIVTEDLSHYEVDENTELESKSKDL
                     QESNMFVSEFLIKKRNQKGVSSRKDTEFIPKSKQEPMLDQAYKDETEMETGVKYGVNI
                     APEVYQNEMIDPEKLAAKLIAAKQLGSDEKLTNKNISHLLSSNSSRVNKLDKSNLSGK
                     SDSSLDRDYVVVEKKAVEVNSLADDLAQANVGNNDEAVKDQNIKTLEQPHIQVHQPHN
                     DIQNLQRAPSTTSGGTSSRRASLVERRLSISSLNPSNALSRALGLASTRIFGSSAQTN
                     KNQTSNSTSPNYTQPLLNSQIFYDLTENLILHTETLNQPALINVDHAKGINEVIRILE
                     SLSAKAFVVYSYAEVKYAQIIPLPQAVIRASPALQFEKRLSDDSNPVIDEDSDEELDV
                     QKNLSNTLLSETVNTRYRLRNDSSRNSYNKRNSFNKERFSFSSQGSNNSKRTNSYSST
                     LLPAEIISISKEAIVLYMKALQILAQSMKITSKWWYSCQEKICSLRLNILVQWIREKF
                     NECLDKTDFLRMKLEEYENSKPGTHNQSPKSKISNDSNEDNVAEKVYLEKLLYDRALE
                     ISKYAANLELQGQNLHICELAYATSLWMLTISLENSPYTDQGEDEYDEFLKDTNDVLD
                     SEDKIIIGKYIKSISHRLKMLRQKMAKY"
     gene            complement(<677581..>679098)
                     /locus_tag="CAGL0L06028g"
                     /db_xref="GeneID:2890745"
     mRNA            complement(<677581..>679098)
                     /locus_tag="CAGL0L06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449037.1"
                     /db_xref="GeneID:2890745"
     CDS             complement(677581..679098)
                     /locus_tag="CAGL0L06028g"
                     /note="weakly similar to uniprot|P40956 Saccharomyces
                     cerevisiae YGL181w GTS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449037.1"
                     /db_xref="GeneID:2890745"
                     /db_xref="GOA:Q6FL57"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:Q6FL57"
                     /translation="MRFKRSGSRSAFDANIDGELKDIVNAPENGNRCGECGSAVPTWC
                     STNLGVFLCGRCASVHRKILGTDPDEESGIFSNVKSLSMERWEAEDIDSVASSGGNKG
                     NMRKWNPKNEPFPFDGDEDKSAVERFVREKYIIGKYRNDQIMPSDYGSRSNGRRKSTA
                     RFDNDDYDDYGMPRHRSRSRSRSVSGRSRTSSFYRSGSSAHISEHDFAYSKYGRELRQ
                     LRELGFTNEQKNIDAITYSHGDVNGALDYLNRREQDRPLSRATSRSNVHSPVNNMSGS
                     SSQMASNPPLPSRPQQTGPKPAVFDGTGVVNPTSQQEPQPAIFDGSVQQYYDPATNMI
                     YVDQQQYMAAVQGQGQQFQQQSQPQMGMPIQQTIGVQPTMTGIGSQVPMQFNATGSVN
                     MIPTQVQTMTGSVPMMQPAGMQTTGFAQQSVQPQIDKNAIMNLYSKPDQYTTPVEITP
                     NTPQYQQVLQQQQLQQQQLQQQQLQQQQLQQQQLQQQQLQQQPTYPNQYNPGFYM"
     gene            <680245..>681063
                     /locus_tag="CAGL0L06050g"
                     /db_xref="GeneID:2890746"
     mRNA            join(<680245..680247,680398..>681063)
                     /locus_tag="CAGL0L06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449038.1"
                     /db_xref="GeneID:2890746"
     CDS             join(680245..680247,680398..681063)
                     /locus_tag="CAGL0L06050g"
                     /inference="similar to AA sequence:UniProtKB:P53102"
                     /note="similar to uniprot|P53102 Saccharomyces cerevisiae
                     YGL183c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449038.1"
                     /db_xref="GeneID:2890746"
                     /db_xref="InterPro:IPR005647"
                     /db_xref="UniProtKB/TrEMBL:Q6FL56"
                     /translation="MAPKRQVITIEQKKASILKFFQDDFAFYSMKDLEKLIPKKCAGV
                     SPVIVKELVTAMIEEDGVISCEKCGQINVYWCFKNQVVNKIYNAAEHLKADKLKIQGE
                     IYSTNDILNITIATTRQEEFEVDGENFNRNRLLESKRLLEKAIIQKQRKLEDLEDIRW
                     DSHKIIDKKREINSLISMIDIATDNMELLVVYLSKRSCLESSQIRQELSIPSEFQQYE
                     MIAL"
     gene            complement(<681921..>682823)
                     /locus_tag="CAGL0L06072g"
                     /db_xref="GeneID:2890747"
     mRNA            complement(<681921..>682823)
                     /locus_tag="CAGL0L06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449039.1"
                     /db_xref="GeneID:2890747"
     CDS             complement(681921..682823)
                     /locus_tag="CAGL0L06072g"
                     /note="some similarities with uniprot|P39959 Saccharomyces
                     cerevisiae YER130c or uniprot|P33749 Saccharomyces
                     cerevisiae YKL062w MSN4 transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449039.1"
                     /db_xref="GeneID:2890747"
                     /db_xref="GOA:Q6FL55"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FL55"
                     /translation="MSTELDLQMMLFDQFLNSSEATLAIQDTSITSGDEYEQAKDSFS
                     SPPLFASDMLDMSSLNMDLSSTDTTATNTTVTTPSQDNILFNEKFLEFNFTQFDFSNN
                     SNYKKNSSLQNATPSPLHINEEVSSQIQNADPIDLNNLLNLNPDMFVPSPTSGSMNAS
                     PLSTNNNSNNYASSAATPISSLSKKRSKSLTATQNNRGSIPKIRGRKPSLLFDDAKIF
                     KCDMCERRFKRQEHLKRHVSSLHMGERPYSCDICLKSFSRSDNLNQHKRTHNNPHPNK
                     RRTSSSATAPEKTTPAHSNEDDLK"
     gene            <693250..>694602
                     /locus_tag="CAGL0L06094g"
                     /db_xref="GeneID:2890748"
     mRNA            <693250..>694602
                     /locus_tag="CAGL0L06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449040.1"
                     /db_xref="GeneID:2890748"
     CDS             693250..694602
                     /locus_tag="CAGL0L06094g"
                     /inference="similar to AA sequence:UniProtKB:P53101"
                     /note="similar to uniprot|P53101 Saccharomyces cerevisiae
                     YGL184c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449040.1"
                     /db_xref="GeneID:2890748"
                     /db_xref="GOA:Q6FL54"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006238"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FL54"
                     /translation="MSQHYGASVAPLYLSTTFKVDLENENNQYDYSRSGNPTRTLLQQ
                     QVAKLYDDIDPNFVFAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLL
                     KISIDTMHFDLSHTENFKAKFYDLVTIKKTIVDIIVLESPTNPLCKIIDIPHLIKFIR
                     KYSPETLIVIDNTMMSGLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAE
                     KIYFLINSTGSGLNPMDSWLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNN
                     NNLKTRYIGLKSHPDYELHRSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSF
                     GCVNSLISMPCLMSHASIDPELRKERQFPEDLIRLCCGIEDVKALQEDLLGAFVEAGV
                     ITIKKHDGRTYLINNLNGHIGEHFIYSELEHKNVYDQFFSYQNYIEKNLLAKQRLSKL
                     "
     gene            <695130..>696308
                     /locus_tag="CAGL0L06116g"
                     /db_xref="GeneID:2890749"
     mRNA            <695130..>696308
                     /locus_tag="CAGL0L06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449041.1"
                     /db_xref="GeneID:2890749"
     CDS             695130..696308
                     /locus_tag="CAGL0L06116g"
                     /inference="similar to AA sequence:UniProtKB:P53100"
                     /note="similar to uniprot|P53100 Saccharomyces cerevisiae
                     YGL185c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449041.1"
                     /db_xref="GeneID:2890749"
                     /db_xref="GOA:Q6FL53"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FL53"
                     /translation="MASANSLPSILFIAAPNEASKLLQSTYVKGKFNVLYHILEDKDK
                     FMQFLHDHKEDNIAGIYAGYPAFHTIHGLTREIIEHPDFPLDTLKCISVCSRGYNALD
                     LDALEDHGIQLYNYQDDIEEEGISEYIDDFQLGEVGNDVADCALWHVLEGFRKFSYQQ
                     KLLRDVGHSIQARQIAANKPHKFAFGHELGMIQAHDGSSVPLYVESPRGKKVLILGFG
                     SIGKRIAFKLQYGLGMEIHYCKRTKDEQLIREHPEWVYHSMDEDLLFPVLKQFDAIVI
                     ALPGTPETKGLINEKFLSHCKEHNLILVNLGRGFILDMEYIDELLKQNKIRHLAVDVF
                     PKEPIVDDLLRESHHNTTITPHLGSATRQVFEQSCELALTNIIKCINGEEAKNHCRVL
                     "
     gene            <697563..>699458
                     /locus_tag="CAGL0L06138g"
                     /db_xref="GeneID:2890750"
     mRNA            <697563..>699458
                     /locus_tag="CAGL0L06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449042.1"
                     /db_xref="GeneID:2890750"
     CDS             697563..699458
                     /locus_tag="CAGL0L06138g"
                     /inference="similar to AA sequence:UniProtKB:P53099"
                     /note="similar to uniprot|P53099 Saccharomyces cerevisiae
                     YGL186c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449042.1"
                     /db_xref="GeneID:2890750"
                     /db_xref="GOA:Q6FL52"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="UniProtKB/TrEMBL:Q6FL52"
                     /translation="MVDAGLGSSKNEDSKDLQNVVQQFEVQSVDNSDYDLEKRSTHKT
                     DPDSRTNRRNKKLFDLDRHDPNLNIFMKGLAYLLWLSDKLDSFGVETSGIERVPPYER
                     GTKKQFLHVAGLWLSATGGLSSMSSFLLGPLLFELSFQQALTSSMISVTVGCLVAAYC
                     SIMGPQSGCRQMVTARYLFGWWFVKFVALAAIIGVMGWSVTNSVVGGEMLAAISNDRV
                     PLWVGIVIVTVCSFVVAIFGIKQVLRIETYISVPVLTSFLLLYISSGNRDYLVREYKP
                     IDVPSKTIKGNWISFFSLCYSITSTWGSITADYYILFPEDTPHYQVFLLTLAGTLIPT
                     TFVGILGLTLASIAKSYQPYGEEYDTHGMGGLLWAGFSRWNGFGKFLVVVLILSLISN
                     NIINTYSAAFGIQLSAVWAARVPRWFWCIVCTIVYLVCALVGRNHFATILGNFLPMIG
                     YWISMYFILLFEENVIFRRYFLHLYTKEFPEFLQQSPDQLSDQSSEEINVLHKEDTGS
                     DTELKFKGTTSKTAQVLREKMKMREKATNIHTLKRKHIHTKHRYNWDEWDNPDVLTHG
                     YAATFAFLCGVAGVVVGMAQTYWVGPIARKLGGPYGGDIAMWLSMGFSGIVYPWLRYW
                     ELVRYGR"
     gene            <701186..>701650
                     /locus_tag="CAGL0L06160g"
                     /db_xref="GeneID:2890751"
     mRNA            <701186..>701650
                     /locus_tag="CAGL0L06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449043.1"
                     /db_xref="GeneID:2890751"
     CDS             701186..701650
                     /locus_tag="CAGL0L06160g"
                     /note="highly similar to uniprot|P04037 Saccharomyces
                     cerevisiae YGL187c COX4 cytochrome-c oxidase chain IV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449043.1"
                     /db_xref="GeneID:2890751"
                     /db_xref="GOA:Q6FL51"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="InterPro:IPR020893"
                     /db_xref="UniProtKB/TrEMBL:Q6FL51"
                     /translation="MMLRSTFRFARPATRSLWTSRVLFNSKPVTKTAQSLADVNGPES
                     LLGPGGKEGEIPTELEQATGLARLELLGKLEGIDVFDTKPLDASRKGTMQDPIVVDSY
                     DDYRYVGCTGSPAGSHTIMWLKPTVNQVARCWECGSVYKLNPVGVPNEHDHH"
     gene            <702461..>703948
                     /locus_tag="CAGL0L06182g"
                     /db_xref="GeneID:2890752"
     mRNA            <702461..>703948
                     /locus_tag="CAGL0L06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449044.1"
                     /db_xref="GeneID:2890752"
     CDS             702461..703948
                     /locus_tag="CAGL0L06182g"
                     /note="highly similar to uniprot|Q00362 Saccharomyces
                     cerevisiae YGL190c CDC55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449044.1"
                     /db_xref="GeneID:2890752"
                     /db_xref="GOA:Q6FL50"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="UniProtKB/TrEMBL:Q6FL50"
                     /translation="MAQDNFDFKFSQCFGDKADIVVTEADIITAVEFDHTGDFLATGD
                     RGGRVVLFERGNDTKHCEYKFLTEFQSHDAEFDYLKSLEIEEKINQIKWLKPTNKSHF
                     LLSTNDKTIKLWKVYEKNIKLVSSNNLSENSRRRSGAGLSSNNSLMLQSLKLPQLSQH
                     DKIIAAAPKRIYGNAHTYHINSISPNSDQETFISADDLRVNLWNLDIPDQSFNVVDIK
                     PANMEELTEVITSAEFHPQQCNLFMYSSSKGTIKLCDMRQNALCDNKSKIFEEYLDPM
                     NHNFFTEITSSISDIKFSPNGRYIASRDYLTVKIWDINMDTKPIKTINIHDQLKERLS
                     DTYENDAIFDKFEVCFSGDSSSVMTGSYNNNFMIYPNVVTSYDDAMQDSAKGTESQVK
                     NNERPFDTQKSKNSITRRNDSNNSGLRDQAINNEHTDEIVLQADKSAFRNKRFASMNS
                     SAAIKNKEWDDDIDFKKSILHFSWHPKENSIAIAATNNLFIFSAL"
     gene            complement(<704527..>704913)
                     /locus_tag="CAGL0L06204g"
                     /db_xref="GeneID:2890753"
     mRNA            complement(<704527..>704913)
                     /locus_tag="CAGL0L06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449045.1"
                     /db_xref="GeneID:2890753"
     CDS             complement(704527..704913)
                     /locus_tag="CAGL0L06204g"
                     /note="highly similar to uniprot|P32799 Saccharomyces
                     cerevisiae YGL191w COX13 cytochrome-c oxidase chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449045.1"
                     /db_xref="GeneID:2890753"
                     /db_xref="GOA:Q6FL49"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="UniProtKB/TrEMBL:Q6FL49"
                     /translation="MYRQALRRYATLPPHALKPAFGKPNEAAAKAFKQSLEATEKHAV
                     GTTSVWVKISLFVALPAIALTAVNTYFVEKEHADHREHLKHVPDSEWPRDYEFQNIRS
                     KPFFWGNGDKTLFWNPVINRHINHDE"
     gene            complement(<705599..>707044)
                     /locus_tag="CAGL0L06226g"
                     /db_xref="GeneID:2890754"
     mRNA            complement(<705599..>707044)
                     /locus_tag="CAGL0L06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449046.1"
                     /db_xref="GeneID:2890754"
     CDS             complement(705599..707044)
                     /locus_tag="CAGL0L06226g"
                     /note="some similarities with uniprot|P38199 Saccharomyces
                     cerevisiae YBL032w or uniprot|P32583 Saccharomyces
                     cerevisiae YKR092c SRP40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449046.1"
                     /db_xref="GeneID:2890754"
                     /db_xref="GOA:Q6FL48"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6FL48"
                     /translation="MDLESQVRLRCLYSKEEFYALKIIYPDWRNRINNIPKFDNRSRT
                     AKPNSIQTAKRNHEVPNGNSVVKKKFASAVTVKNTKEDEYLRDYVITLTGSINDVSLG
                     LLNLLIMVNNPKVTRIIDSVEKPFLKRLLIRADPTFFNNVNDIKKLSFIRMLVSNTNL
                     SKVLGSEGHRIADLRDKYDLRMKASKYKLSQSTDRVFEIEGLAQNIIEALVEINNIIL
                     REKTTNSEQVSQVEYEPTPIKPNKKKKRSKKKTKKPNGDSIQGKSSTQEGVDRSESNL
                     SEKKRDNSNQNKNDTGSDSASMSKTIISPKEAHDQNNTPELQTSNHSKRAVSNEQTQE
                     HNTLQKVSSQRSLNSNHSRKTSDSSTASKTLLLHTSGTDTIISSDQQMFVDIILIPEG
                     YVGRLVGKGGSRLANLRKFTRTKILIDERGSKDESKYRKFTITSSDEKNVQRAKALLQ
                     ANLVEEQRRDREKLENKIKKHLLNENNEEHL"
     gene            complement(<708815..>709081)
                     /locus_tag="CAGL0L06248g"
                     /db_xref="GeneID:2890755"
     mRNA            complement(<708815..>709081)
                     /locus_tag="CAGL0L06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449047.1"
                     /db_xref="GeneID:2890755"
     CDS             complement(708815..709081)
                     /locus_tag="CAGL0L06248g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449047.1"
                     /db_xref="GeneID:2890755"
                     /db_xref="GOA:Q6FL47"
                     /db_xref="UniProtKB/TrEMBL:Q6FL47"
                     /translation="MYKTGNNDTTHSTGSFLQSAPVELTTLKGYEEFMAKQEKHYGKE
                     NMGKITTILKEEPTEPGYLLRDGEVVATVQGELKAHLLKQTEGM"
     gene            <710007..>710756
                     /locus_tag="CAGL0L06270g"
                     /db_xref="GeneID:2890756"
     mRNA            <710007..>710756
                     /locus_tag="CAGL0L06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449048.1"
                     /db_xref="GeneID:2890756"
     CDS             710007..710756
                     /locus_tag="CAGL0L06270g"
                     /note="highly similar to uniprot|P29311 Saccharomyces
                     cerevisiae YER177w or uniprot|P34730 Saccharomyces
                     cerevisiae YDR099w BMH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449048.1"
                     /db_xref="GeneID:2890756"
                     /db_xref="GOA:Q6FL46"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:Q6FL46"
                     /translation="MSLSREDSVFLTKLAEQAERYEEMVENMKDVASAGQELSVEERN
                     LLSVAYKNVIGARRASWRIVSSIEQKEESKENSEHQIKLIKDYRAKIEAELTKISDDI
                     LSVLDKHLIPSASSGESKVFYYKMKGDYHRYLAEFSQGDVRENATKASLDAYQKASEI
                     ATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKD
                     STLIMQLLRDNLTLWTSDMSEADDQKNEESK"
     gene            <711681..>712106
                     /locus_tag="CAGL0L06292g"
                     /db_xref="GeneID:2890757"
     mRNA            <711681..>712106
                     /locus_tag="CAGL0L06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449049.1"
                     /db_xref="GeneID:2890757"
     CDS             711681..712106
                     /locus_tag="CAGL0L06292g"
                     /inference="similar to AA sequence:UniProtKB:Q03860"
                     /note="similar to uniprot|Q03860 Saccharomyces cerevisiae
                     YDR100w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449049.1"
                     /db_xref="GeneID:2890757"
                     /db_xref="GOA:Q6FL45"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:Q6FL45"
                     /translation="MDLPQKLIKYSNLFFGATTSLAAIGQLSYVFQQFGLFLLGLYAL
                     ALTIPIIWLEFRVPPKLYKYASTYFSFLGRAIIYLLLSAMTMYGSLFNKLNAVLLMLT
                     GLVYLFLHASSIIDEPENFKGQNASIALNDDIDDEEDII"
     gene            complement(<712402..>714168)
                     /locus_tag="CAGL0L06314g"
                     /db_xref="GeneID:2890758"
     mRNA            complement(<712402..>714168)
                     /locus_tag="CAGL0L06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449050.1"
                     /db_xref="GeneID:2890758"
     CDS             complement(712402..714168)
                     /locus_tag="CAGL0L06314g"
                     /note="highly similar to uniprot|Q03862 Saccharomyces
                     cerevisiae YDR101c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449050.1"
                     /db_xref="GeneID:2890758"
                     /db_xref="GOA:Q6FL44"
                     /db_xref="InterPro:IPR000994"
                     /translation="MDLAVSNEDSQILLKDKNVLQETVLDKYRTSGQITQTALKFVTD
                     LINDVYHYKKVQTPLSISELCLMADSFIVNRLEQYYKHKVNERGIALPTMIDVDAVAS
                     GWCPEVDDTENIKKWNNNSDETSPFASSITGYLRHGDVVKISLGCHIDGYTSQVTHTM
                     VIYPTDETNTKPTGPLLGSKADAVAASHIASESVTALLACSLTPEKLPQSLRNANTNS
                     VTGHQIRSVVDTIAKAYNCAVVPGSRVRRIRRFLAGQNEGIVAEKDYKGVVWTEAHQE
                     ANLLANTEVQDIVVANNQNKLVASSAIPSDDFSVDVGEVYLIDLKFCPLTDCQKKGLI
                     TLETVDSYTGKSHKKNQLIARSGAYVRDYAQSYTLKLKTARQLLTKIDKNGVYPLKLS
                     HLSTDFPLTEFTAEESDAVKKDLRSFRLGMNEITNNFLCVETPIQVAKWVPWDHILNS
                     TNKNGALSYDASAALTLPGHEIPLPKLGISGIKLKSLMNSTNEVMTLPVARECSTVIL
                     CGSDVSVSGKPELFRLTGGSKTAQPSWVHSARELNPADPVVQGIFNLAELSKDKRFGL
                     TMRETQPMKKNINLASDTTMEM"
     gene            <715056..>716858
                     /locus_tag="CAGL0L06336g"
                     /db_xref="GeneID:2890759"
     mRNA            <715056..>716858
                     /locus_tag="CAGL0L06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449051.1"
                     /db_xref="GeneID:2890759"
     CDS             715056..716858
                     /locus_tag="CAGL0L06336g"
                     /note="some similarities with uniprot|P32917 Saccharomyces
                     cerevisiae YDR103w STE5 pheromone signal transduction
                     pathway protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449051.1"
                     /db_xref="GeneID:2890759"
                     /db_xref="GOA:Q6FL43"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR021106"
                     /db_xref="UniProtKB/TrEMBL:Q6FL43"
                     /translation="MFHRFHLRKKQVSSHEISPEAKVEYKFIRSDKRSFINHICTLCD
                     EPIAYKSGGEKVIELECGHMCHMDCLMLFVNSTALPICKYCKKFNNRAKECIPKENCL
                     KDTLISQYLVNNKMNSPVHETSHKSIDKHSNQKYTSSTSQNKEEYPIHLLRTFFSDWF
                     INQSKEYTTITPWELDHNFGLLRLVDKFEISYYPFIKKKLAVCLLFENILAIVQVQRE
                     SIKCNEFSEIHAESIHLYHTENSRADLKYQKIDYINCQIRKADYTGNKLRISLSNTTL
                     RMFEIETEKNGVLLNWLRGFHDKKQMFDAKYFTSNCLELPVMQIFENESTILGLFNSN
                     RLIEMGSINSVHNSIILRRSFYLRNSMETDIMGTYNTITSSVLSIKKEKPSDILLLIQ
                     IDEQKITDQKDQIKQVIKNTLMALKLKYPEYFLVILSATGEVLLMDSIDRLNLDNQLL
                     SGEEPKNPFRLEISSIRTHVYGTSILENLAIVAVSNSAMVETTSILFKNFSPLISKGR
                     LRPNEIRIKVGYSNNDYSDVVSELVEIESWDYLLEALCHTFSLDYDDDYTSYETSYDI
                     NSLEADSVTTLEIESPFKYDHLYTNVGNHSSENI"
     gene            complement(<717030..>718463)
                     /locus_tag="CAGL0L06358g"
                     /db_xref="GeneID:2890651"
     mRNA            complement(<717030..>718463)
                     /locus_tag="CAGL0L06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449052.1"
                     /db_xref="GeneID:2890651"
     CDS             complement(717030..718463)
                     /locus_tag="CAGL0L06358g"
                     /note="highly similar to uniprot|Q12116 Saccharomyces
                     cerevisiae YDR105c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449052.1"
                     /db_xref="GeneID:2890651"
                     /db_xref="GOA:Q6FL42"
                     /db_xref="InterPro:IPR005016"
                     /db_xref="InterPro:IPR029559"
                     /db_xref="UniProtKB/TrEMBL:Q6FL42"
                     /translation="MGAIISLPISAASTFTFSMLSGCCFNLLSNIASKVGSSSLGVRL
                     LYAIWLLMNSLLSWITLSANKSLLFPGKSCTSTGECGFFTVHRLNFALGMLHLILAGA
                     LIKVKSTKDARATIQNSWWSLKFLTYILLIVASFLIPNEFYIFFSKWVSVPSGVIFIL
                     VGLILLVDFAHEWAETCIFHVEQEDENSNFWKNFLVAGTASMYTGAIAMTIAMYIVFC
                     RDNCNMNKVAVNMNLVLILITLIIAIHPRVQQSNPKSGLAQSSMVAFYCTYLTMSAMA
                     SEPDDKMCNPLVRSNGTRKASVILGSLFTFVAIAYTTTRAAANSAFQGSAAEGPIYLP
                     DDIEYEGLGGQSRNQLRYEAIKQAVEEGSLPESALYDHSWMGASPSLNNRNETELDIN
                     DDEVNGTQYNYSLFHVIFFLATQWIAILLTINVTHDDVGNFVPVGRTYFYSWVKIVSA
                     WICYGLYSWTVLAPVFMPYRFDYEDYY"
     gene            complement(<719053..>719259)
                     /locus_tag="CAGL0L06374g"
                     /db_xref="GeneID:9488043"
     mRNA            complement(<719053..>719259)
                     /locus_tag="CAGL0L06374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999546.1"
                     /db_xref="GeneID:9488043"
     CDS             complement(719053..719259)
                     /locus_tag="CAGL0L06374g"
                     /inference="similar to AA sequence:UniProtKB:Q3E784"
                     /note="similar to uniprot|Q3E784 Saccharomyces cerevisiae
                     YER180ca SLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999592.1"
                     /db_xref="GeneID:9488043"
                     /db_xref="GOA:B4UN49"
                     /db_xref="UniProtKB/TrEMBL:B4UN49"
                     /translation="MDSQDTTKSNSEISKEQYQETKLLRDTLDLLWNKTLEQRKLCNQ
                     LEQENENLKDYINNLMTSSNVLDK"
     gene            complement(719593..719666)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0L06380r"
                     /db_xref="GeneID:2890652"
     tRNA            complement(719593..719666)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0L06380r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2890652"
     gene            <720723..>725330
                     /locus_tag="CAGL0L06402g"
                     /db_xref="GeneID:2890653"
     mRNA            <720723..>725330
                     /locus_tag="CAGL0L06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449053.1"
                     /db_xref="GeneID:2890653"
     CDS             720723..725330
                     /locus_tag="CAGL0L06402g"
                     /note="highly similar to uniprot|P39109 Saccharomyces
                     cerevisiae YDR135c YCF1 or uniprot|P14772 Saccharomyces
                     cerevisiae YLL015w BPT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449053.1"
                     /db_xref="GeneID:2890653"
                     /db_xref="GOA:Q6FL41"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FL41"
                     /translation="MEHFSMQGYNLLSSNSTYGGHNHTNNGTLLDWACTMCKSPEGFG
                     PISFYGDFTLCFIDGVLLNVVALFMLIFGTRDLWRLCVMKHPGIKYRRNWLIISRIAL
                     VLLQIVFLAVASLSIPKQKTVDYTIITQYTLTLLSLFVAVSLHWIEYHRCRVANSVVL
                     FYWLFTFAGNLMKTLNFIVRHNYEGGWELGHKVFILTMFQAINALAILLLEALPSKPM
                     KSLHDIQGHVSRRKENPYDTANIFSRISFTWMSGLMKTGYEKYLTETDLYKLPESFNS
                     TELSGKLNAQWENQLKHKANPSLVWAMIRTFGGRMLLAGFLKIIHDVLAFTQPQLLKI
                     LIRFVTMYNKEREEENVMMDMQRQLPIVKGFYIAVSMFLVGFTQTSVLHQYFLNTFNT
                     GMNVKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKLQDLTQWIHLIWSGPL
                     QIVLCLISLYKLLGHSMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISE
                     ILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCST
                     FAVFVYTEDKALTTDLVFPALTLFNLLSFPLMVIPNVITAIIESSVSVSRLFNFLTNE
                     ELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIVG
                     KVGSGKSAFLQSLLGDLFRVKGFATIHGSVAYVSQVAWIMNGTVRDNVLFGHKYDPEF
                     YEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDP
                     LAAVDEHVSRHLVEHVLGPNGLLHSKTRILATNKISVLSAADSITLLENGEITQQGTY
                     ADCRKDEESALGKLLKEFGRKESKNDDTITSSSSAVSISDKEPTVPLEDELEELKKLD
                     KCVYNENDAGSLRKASDATLTSIDFDDEENVNTREHREQGKVKWNIYLEYAKACNPKY
                     VCVFIVFIILSMFLSVAGNIWLKHWSEVNTAHGDNPHAIRYLAIYFALGVGSAFSTLI
                     QTVILWIFCTIHGSTYLHNLMTNAVFRAPMSFFETTPIGRILNRFSNDIYKVDSILGR
                     TFSQFFVNTVKVLFTIGVIAYTTWQFVFVIVPLGIFYIYYQQYYLRTSRELRRLESVT
                     RSPIFSHFQETLGGLATIRGYGQQKRFEHINECRVDNNMSAFYPSINANRWLAYRLEF
                     IGSVIILGAATLSIFKLRAGTMTAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSV
                     ERIKEYSELKSEAPLVIESNRPPKEWPVAGEIKFEHYYTRYREDLDYVLKDINLEIKP
                     REKIGIVGRTGAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDS
                     QVFEGTIRENIDPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQ
                     RQLMCLARALLVPSKVLVLDEATAAVDVETDKVIQETIRTSFKDRTILTIAHRINTIM
                     DNDRIIVLDKGKVVEFDTPEALLKNTNSIFYSLSKEAGLQH"
     gene            <728331..>728999
                     /locus_tag="CAGL0L06424g"
                     /db_xref="GeneID:2890654"
     mRNA            <728331..>728999
                     /locus_tag="CAGL0L06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449054.1"
                     /db_xref="GeneID:2890654"
     CDS             728331..728999
                     /locus_tag="CAGL0L06424g"
                     /note="some similarities with uniprot|Q12127 Saccharomyces
                     cerevisiae YLR110c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449054.1"
                     /db_xref="GeneID:2890654"
                     /db_xref="GOA:Q6FL40"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:Q6FL40"
                     /translation="MQFSTVASVAAVAAVASAQANVTTATATQHTTTLVTITDCEEHI
                     CSEKVSPAWVSTATVTVNDVVTLTTTWCPIETTVHNTTKPAPAPTTAKPAPAPSSAKP
                     APAPAPKPVTNSTVKPAPAPSSAKPAPAPSSAKPAPAPSSAKPAPAPSSAKPAPAPSS
                     AKPAPSSKADTTTTTKFVQTTTLTSSSKAAPSTHAVSSYTGAAAKALPAAGALIAGAA
                     ALLL"
     gene            <730754..>732433
                     /locus_tag="CAGL0L06446g"
                     /db_xref="GeneID:2890655"
     mRNA            <730754..>732433
                     /locus_tag="CAGL0L06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449055.1"
                     /db_xref="GeneID:2890655"
     CDS             730754..732433
                     /locus_tag="CAGL0L06446g"
                     /inference="similar to AA sequence:UniProtKB:Q03900"
                     /note="similar to uniprot|Q03900 Saccharomyces cerevisiae
                     YDR132c or uniprot|Q12259 Saccharomyces cerevisiae
                     YLR108c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449055.1"
                     /db_xref="GeneID:2890655"
                     /db_xref="GOA:Q6FL39"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:Q6FL39"
                     /translation="MSVTSGSALSPEQFDPNIPEILPHEKMYRIQVGKQLFKISGASL
                     NSDGPSFFTNYFLKRTNRATSNNNNAGNNANNAAANNNNAFSPSSVNSTNSPPSGGSY
                     HGSDNEVLFIDRSADIFELIYQHLQGYFIEIQDEVQYTMLFADAMYYNLPRLKAILKD
                     CDYYYTNIGGKSYKLAKSLFKREGDSPNYFEITSGTLYIDVEELILTRKLLRPPPHSA
                     PYVARSNVLFEDLLILLGGGSINLDDDRRSSLIRECKFYRFLNLEQRLVKCSINYNPL
                     TRKEEICLHLKDVSRKGLVISQTTKRDLSYLFQPATVMNQNNEHVPSLMQSQFDQAGL
                     DFSQNSGGMDPRVKRQKLYEQQVGSWDIVGYKRPYLDKYSREFIFQVDSREAILIFNR
                     DTKRVHIDFIDQTAKNFFNLFYKELLNSPDCGIDLNHYKCKLAPSFYDMNMMSPVESN
                     NSNYKPNPHPDLVLPALLTLGDLSIDGVRYPRVASLIDEPRIASKQIPNLDVRPKGSE
                     YSPNEFSQGFQLFLHKSLWKIGVTNGRIILLLLKADSITGTSEYCKSLSYI"
     gene            <732956..>734599
                     /locus_tag="CAGL0L06468g"
                     /db_xref="GeneID:2890656"
     mRNA            <732956..>734599
                     /locus_tag="CAGL0L06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449056.1"
                     /db_xref="GeneID:2890656"
     CDS             732956..734599
                     /locus_tag="CAGL0L06468g"
                     /inference="similar to AA sequence:UniProtKB:Q03899"
                     /note="similar to uniprot|Q03899 Saccharomyces cerevisiae
                     YDR131c or uniprot|P47005 Saccharomyces cerevisiae
                     YJL149w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449056.1"
                     /db_xref="GeneID:2890656"
                     /db_xref="GOA:Q6FL38"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6FL38"
                     /translation="MPFEKLPQEVVQKILSNVSQDDKVALTYVSRNAYFHGIRSLYRN
                     IYLANTSYIPSDYDGSLGTHYWSTLCCNYRNISTDFESLDLAELGNLFKGSERAMYKF
                     NCLIRSIEERPGKLCPLIESVHCTWHLDPKLLERFIYLLTRHGHNLKSFDNFIGGEIN
                     DQLTSIYGQLQTLTMTASSRTPADPPTIQFVDSLDKFCKQYSWENLNTLNIHMDLRNY
                     FHNLDKPLKIRNLTLNLRKDMLLGEDYNRGRLPYHKILDKNELRELEVLSWIEPKDMN
                     FDMYQLWGLYEFLEFHNIEELSLLSLTDNHFFITEAVSHWHHLRRLKLDYMFELTMEN
                     EFLDLLASSPCAKTLEYIDFRINQFEGVPISVAVGLQPKFELTLMCKCDFCKGVYEDI
                     IIKKYFPTVASLRKPSYKELELNKIFYQMIKVYPIIPHAHYCDVYPAMGFRYYSLHDH
                     ANIQNRMRQDDENMKRLPLLSGDDIKKLYHYYLHSMKRTYDYFILRFQNLRYLTINDL
                     PTTIVQMDEHQRCNIPIFHATGYESNQLYELVDAESLFS"
     gene            <735080..>736021
                     /locus_tag="CAGL0L06490g"
                     /db_xref="GeneID:2890657"
     mRNA            <735080..>736021
                     /locus_tag="CAGL0L06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449057.1"
                     /db_xref="GeneID:2890657"
     CDS             735080..736021
                     /locus_tag="CAGL0L06490g"
                     /note="highly similar to uniprot|P50085 Saccharomyces
                     cerevisiae YGR231c PHB2 or uniprot|P40961 Saccharomyces
                     cerevisiae YGR132c PHB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449057.1"
                     /db_xref="GeneID:2890657"
                     /db_xref="GOA:Q6FL37"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:Q6FL37"
                     /translation="MSGSPEFQRFARALRQQITKVQQQGGRPGGPPRGGAGGAFAGIG
                     GLLVLGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDV
                     RAKPRNVASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVL
                     KAVVAQFNASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEA
                     KQIAQQDAQRAAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVELKRLDTA
                     KDIAKILANSPNRVVLDNEALLLNTLVDARSATGSKK"
     gene            complement(<736255..>736479)
                     /locus_tag="CAGL0L06512g"
                     /db_xref="GeneID:2890658"
     mRNA            complement(<736255..>736479)
                     /locus_tag="CAGL0L06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449058.2"
                     /db_xref="GeneID:2890658"
     CDS             complement(736255..736479)
                     /locus_tag="CAGL0L06512g"
                     /inference="similar to AA sequence:UniProtKB:P50084"
                     /note="similar to uniprot|P50084 Saccharomyces cerevisiae
                     YGR230w BNS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449058.2"
                     /db_xref="GeneID:2890658"
                     /db_xref="GOA:Q6FL36"
                     /db_xref="InterPro:IPR007727"
                     /db_xref="UniProtKB/TrEMBL:Q6FL36"
                     /translation="MMDNESKRRVDVTVQKRLRSILKQRFVSPTDAMLSPCSKRLNLY
                     RSKVYAAKKTPRKLQFSESATKTPSKKHQS"
     gene            <737748..>739502
                     /locus_tag="CAGL0L06534g"
                     /db_xref="GeneID:2890659"
     mRNA            <737748..>739502
                     /locus_tag="CAGL0L06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449059.1"
                     /db_xref="GeneID:2890659"
     CDS             737748..739502
                     /locus_tag="CAGL0L06534g"
                     /inference="similar to AA sequence:UniProtKB:P32566"
                     /note="similar to uniprot|P32566 Saccharomyces cerevisiae
                     YGR229c KNR4 beta-1 3-glucan synthesis protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449059.1"
                     /db_xref="GeneID:2890659"
                     /db_xref="GOA:Q6FL35"
                     /db_xref="InterPro:IPR009203"
                     /db_xref="InterPro:IPR018958"
                     /translation="MNLFRKKVKEWVYSFSTEDHYAEYNSNDQFNMGMRSQGASHHDV
                     EAHAQSANDNILSMEDDIDLDSMDGTPSEGVSEVLLAWRHIDTWTSEYNPDLNATLSD
                     PCTANDIKHAEEDLEVVLPKALKASYRIHDGQEDLESMTGTSGLIYGLQLMTLDEIVA
                     MTQRWRSVADKLNKQATMSKHSSVGVSNGSSMGSTASIGSSSQQQREKPRNKFKLPYI
                     PEQKSIPPETVLPLYAHAMWIPVLTDNAGNHIGIDLSPARLGKHGQVIMFGRDFDTKY
                     VVAENWGDFLLSFANDLEAGNWLLVDDSDDYLAGEGELVFRDKKSNGPIQDYLEVLKK
                     RSWNKYQEQLRTNQETMQSGEPTLTSTRTHKKTSSFELDDDFDHTTTTTEHNGNEFIE
                     SSVPETNSDIPQIVKKEELDETAEETKEESNELDVKTEEIAPESTQIIEETPETKEEE
                     VSEQPEEAVAEVTVDANIEEPEQQVEEQEVLLENEVTDSVNNADANTEAVPEVEEKKT
                     EIETETPAEPIEEEEESTNVEAPQVEEEEDSTTAEPAETVSKSKKKKNKKKNKKKNKA
                     NQDDNVNELSHDFETVQL"
     gene            complement(<739754..>741322)
                     /locus_tag="CAGL0L06556g"
                     /db_xref="GeneID:2890660"
     mRNA            complement(<739754..>741322)
                     /locus_tag="CAGL0L06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449060.1"
                     /db_xref="GeneID:2890660"
     CDS             complement(739754..741322)
                     /locus_tag="CAGL0L06556g"
                     /note="highly similar to uniprot|P50076 Saccharomyces
                     cerevisiae YGR227w DIE2 ITR1 expression promoting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449060.1"
                     /db_xref="GeneID:2890660"
                     /db_xref="GOA:Q6FL34"
                     /db_xref="InterPro:IPR016900"
                     /translation="MSDAAAPEEQDELSGGSVQELLPGLQRDLEAEVIRGFIANIAIY
                     PVLLLYFFGTFAYVTRNVVPYEFIDEQFHIGQTITYLKGHWFTWDPKITTPPGLYILG
                     WLNYKVLKPLLKSWSTLTILRLVNAFGGLVYFPLVVLRPIFLFNAISFWPVALMSFPL
                     MATYYYLYYTDVWSTIFIIQSLSIGLTMPFGLSKSIWLSALFAGISCLFRQTNIVWCG
                     FIMLIVVERQAIIAKQFNTHGLNNYLKLFIHSVEEFQTLVLPYALNFVGFFLYLIWNR
                     SITLGDKSNHNAGIHLVQVFYCFAFLTVFSVPLWFSKNFLRMYLERTNRKQVQVFFEI
                     FLIMMVIRYFTKVHPFLLADNRHYTFYLFKRLINHNRRIIKYGLMAPIYHFCTFVYLE
                     ILRPSELLFDPISPLPIKDPNLLPVQLTHISWTALILCTFATVVPSPLFEPRYYILPY
                     FFWRLFITCSAEPIWGEIVPGKSNEEPVTISSTSRLFLEFVWFILIDIVTLIIFVRYS
                     FPWASEAFMQRIIW"
     gene            complement(<741735..>743709)
                     /locus_tag="CAGL0L06578g"
                     /db_xref="GeneID:2890661"
     mRNA            complement(join(<741735..742333,742449..>743709))
                     /locus_tag="CAGL0L06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449062.2"
                     /db_xref="GeneID:2890661"
     CDS             complement(join(741735..742333,742449..743709))
                     /locus_tag="CAGL0L06578g"
                     /inference="similar to AA sequence:UniProtKB:P50082"
                     /note="similar to uniprot|P50082 Saccharomyces cerevisiae
                     YGR225w AMA1 required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449062.2"
                     /db_xref="GeneID:2890661"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FL32"
                     /translation="MDRYIPLLTCKKAYKASNYKRNFDLNDVEIMDSSSSPERLSSPE
                     FFTDLRYTGNYEHINYRGDNLSGQDMQLSSAESSNSTRSSVSTMTSSASSSSNLHAND
                     RSPIMRYRLSRKKKKRRAGKIKEKNISKEVQKHKEYIARYLDFKSPERVLKFEYKTHI
                     KSLKCNLTSDETKCLNTVPCEDFLSKINPLLQTLPPFEARYLFSNLLITDQNDGLAIF
                     RDSKRPKSLIPYRVLDAPCLRNDFYSNLISWSRTTGNVIVGLGYSVYIWSERDGAIPV
                     LNHSFLGLKHDLVTCLSFCPFNELFLVGTKQGRVMLFDQNRCIESYRSLGSSNRSEPL
                     YEYQSLSCKGVSCFEWFLEDKICCDGANSAQIARLFIGEETGEVAYVEINSKISNCNV
                     RDDYSKKGLDDLQILCLSKFQAQSQQVCGLSLNQYSKNLAVGGNDNSCTIWDISDIRS
                     PRLVHTLPHNAAVKAVSYCPWSKSLLATGGGSKDRKIKFWHTLTGTLVKEIQTTGQIT
                     SLIWSVRYKQLVATFGFGDIDNPILLTVYSYPSLERLIHVRSSTPLRVLTAVPSSNLN
                     AICLATNDETIRFYEIWGEDENTISEVQEAGIYNSKLIDFVEGISTHSEEYIR"
     gene            <744800..>745495
                     /locus_tag="CAGL0L06600g"
                     /db_xref="GeneID:2890662"
     mRNA            <744800..>745495
                     /locus_tag="CAGL0L06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449063.1"
                     /db_xref="GeneID:2890662"
     CDS             744800..745495
                     /locus_tag="CAGL0L06600g"
                     /inference="similar to AA sequence:UniProtKB:P50086"
                     /note="similar to uniprot|P50086 Saccharomyces cerevisiae
                     YGR232w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449063.1"
                     /db_xref="GeneID:2890662"
                     /db_xref="GOA:Q6FL31"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FL31"
                     /translation="MEFPLHKACLNNEPRKVQELLESSDPFKAVVQRDDDGRVPLHWA
                     VSIQSDAIIKLLLPYMKSVDIDTLTDEAGWTPFHISCSIGHLDIVDQLYNNNPDARPN
                     LDLQTSQGVTALHLAVAKKHLEVCKYLIKLGASVRIKDKKGQIALHRAAAVGSIGVVE
                     FLCSTAKSPVNWKDASGWTPLFHAIAEGHADIAVLLVNKFSADYEVEDSDGKKPIDVA
                     PSESVKEYFSKNI"
     gene            complement(<745599..>749012)
                     /locus_tag="CAGL0L06622g"
                     /db_xref="GeneID:2890663"
     mRNA            complement(<745599..>749012)
                     /locus_tag="CAGL0L06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449064.1"
                     /db_xref="GeneID:2890663"
     CDS             complement(745599..749012)
                     /locus_tag="CAGL0L06622g"
                     /inference="similar to AA sequence:UniProtKB:P17442"
                     /note="similar to uniprot|P17442 Saccharomyces cerevisiae
                     YGR233c PHO81 cyclin-dependent kinase inhibitor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449064.1"
                     /db_xref="GeneID:2890663"
                     /db_xref="GOA:Q6FL30"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FL30"
                     /translation="MKFGKYLEARQVELAEYNTHFIDYKALKKLMKQLATVPMINDDD
                     LNASKNLINVDIDFNEASVYRSLQANKASFFFKLERELEKVNLYYVDKESELKVKLDV
                     IVSKMNDYRSSGRLNSKQAVVYKNISAVIKKFLKDVRNLEQYVELNRTGFAKVLKKWD
                     KRSHSNEKEFYLATVVSVQPIFTRTEVARLSDEALNLLVDLNDLVEYSVGNGVNSPST
                     ALGPGSSSNAVAISMDGGKNNSNNTKARRSSSSTGSEKGFFKVLGFSSTDLDLEIEYW
                     IQDIINISTLKDDQRRLATISNFVPTKVLPRLEELLQNNEQKEQIEKECITKLFSLLI
                     DSNLVDECLSVVYLACEQYIDFNHIDEDAEIFSNVNLFHEACACSTAPRSFLLYEALK
                     FKNITSADLKNLMNMKDIHGRIPLHHAAEQGKTEFVELILESNLVDMLDIPDQDRKTP
                     LILALESNDIKAVKLLLQHGSNAYPNAQDKVLDPLSVACKKGNFEAVKLILDFLGDKI
                     EGPSLDKMELLHIVSKNSNSSALAELLISKGANVNYGDKFLGRTPLFYAVMNGKDNIV
                     SLLLRCNASIDVMDDEGYTPLFYTIWESDVKVLNAMLPSIKSIKQKKIHSDLLQPKKL
                     TLPNNDLLDLDSSSINDLTDSFENIPAFSLPPPIIPLRKYGHNFLEDKIYVKVIFKAG
                     TESITLENDNDSLINAPGRIMLSSGSSDIIPRNVLFPVGGTSVTAVDDDLDEEGEIIF
                     YPDTLENFSIQFDVFPTTGNRLIARTVTPPSFLLSSSMNGTNSLKIPLVDLKLSVIGT
                     LSVEYQVIQPFSGTSLKVTECEPYWKSTNEEKEPQNSEPSKIDNGYITETSLCGSFET
                     IKIYYLNDGRLVASKEMFVTVNGAKILLMDLTTEQLQAILQSSLFIDNEMINTSNDLK
                     ILLCKGVFDFKTLLDLIPSSIKLNIQICFPTAEEIVSIPVRPSPLIAVDKLINNLLEM
                     IFSNERYLKSTTNHSRSLVFSSCCWEVCATLNWKQPIFPVFLKFDNLVSYVDPESSTE
                     CYKYDTAHHILDLVQNQEEYKKLIKKIDIFGMVKFAIKSHLLGLILPEKLLHICDTVV
                     DSIRKKGLLVISFSDSPINEAEKELNANGVSDEDEIIFLKSGDDKNLML"
     gene            <750307..>752793
                     /locus_tag="CAGL0L06644g"
                     /db_xref="GeneID:2890664"
     mRNA            <750307..>752793
                     /locus_tag="CAGL0L06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449065.1"
                     /db_xref="GeneID:2890664"
     CDS             750307..752793
                     /locus_tag="CAGL0L06644g"
                     /note="some similarities with uniprot|P38850 Saccharomyces
                     cerevisiae YHR154w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449065.1"
                     /db_xref="GeneID:2890664"
                     /db_xref="GOA:Q6FL29"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="UniProtKB/TrEMBL:Q6FL29"
                     /translation="MSLFGSLTLLLVSEEQQVKRWAQVIRDDSRDATILSKRQIDDPG
                     LDVFPLQRDDIHNIGADILTYQTIDFVITDTTDFEEYSQLAFLYMVPVVTPEWLYKCI
                     EEKRVIPQVHKYSPDARHILRYCQLYISPFTIDSSERQFLEDITQTLGGITQNFISDK
                     TTHIVIKTFDDPLVKEMDDNVILKEVLNPTMKIVSYQWLLDCFKTVSWANEIKYSSPG
                     PYMSITCNNSNPLSPVFQNISIHLSDSIPGDIRQFLSEFVRSNGGSTVTAEDKESYRI
                     IDYQDTPTDDQNSFTITWLFYQWSLDKFDDCLRLQRTNRLLYGHNGGNNDTDTSKTKV
                     SYTCFLGMRRWYIHRMLEWLGYTCSSCVTSDTSLLIVNELADRLGPNGSLMPKVQLYE
                     GEKLTTQFVLASLERNPLLSTLNGSSAETENPSDRYTEYRYVHRSLLPSRSLHKRAST
                     MGSLEVVPTDKAVVSSNAVPGSVPGSVLGATDAQQEGTQLDTQVETADDVIITKHRTK
                     RRIIPDSNESRSATTSATASATASATASATASATASATTSTIPSTIASVSTSGHASQN
                     GSSGPEDTEESYSSFNSIDQLGDREDNRPTKRSKRSKMPERSLNKMYDIRAVCTNCLK
                     TLSARDKKVLSQLGIDIRDTLSDDINTIVAPRRVKTEKFLKALALPTLAHVITPGFVE
                     RVLKLHKAEKLHEAPQLKLGQYQLSDIPMGVNNRNGLFQKFGIYTINLVNDIPVGTNQ
                     IRSILEYHGLTTNILPSRFSLEDLKAQGMDHKIRYILVAHRASQVHRLSKLVDNRPVL
                     AVQWDWLVNCMFTGQVLLTGNAEGILRYTA"
     gene            <754333..>755529
                     /locus_tag="CAGL0L06666g"
                     /db_xref="GeneID:2890665"
     mRNA            <754333..>755529
                     /locus_tag="CAGL0L06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449066.1"
                     /db_xref="GeneID:2890665"
     CDS             754333..755529
                     /locus_tag="CAGL0L06666g"
                     /note="highly similar to uniprot|P39676 Saccharomyces
                     cerevisiae YGR234w YHB1 flavohemoglobin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449066.1"
                     /db_xref="GeneID:2890665"
                     /db_xref="GOA:Q6FL28"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:Q6FL28"
                     /translation="MLSEQTRTIIKATVPVLEKQGTQITKCFYGHMLTEHEELLNIFN
                     RTNQKIGAQPTALATTVLAAAKHIDNLAALLPHVEQIGHKHRALQILPEHYPIVGKYL
                     LIAIKEVLGDVATPEIITAWGEAYQEIADVFISVEAKMYKEAAWPGWKQFEVVGKDKV
                     AEDIYEFTVKPTGDSGVDLAKLPIIPGQYITVNSHPVRQDNKYDALRHYSICSADTTN
                     GLKFAVKLQTSTNNPDGLVSEFLHKDVKVGDVLKLSAPAGDFAVNKDLINQNDIPLVL
                     LSSGVGVTPIVSMLEAQVKENPSRPIVWIQSAYNEPHVAFKNHVDNLLKQAKDAKKVV
                     VLTDSQPRIDDKFLKENVPAHADVYICGSLNFMQSMIDHFQVLEHKNDMIHYEPFGPK
                     MSTVKV"
     gene            complement(<756016..>758073)
                     /locus_tag="CAGL0L06688g"
                     /db_xref="GeneID:2890666"
     mRNA            complement(<756016..>758073)
                     /locus_tag="CAGL0L06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449067.1"
                     /db_xref="GeneID:2890666"
     CDS             complement(756016..758073)
                     /locus_tag="CAGL0L06688g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449067.1"
                     /db_xref="GeneID:2890666"
                     /db_xref="GOA:Q6FL27"
                     /db_xref="UniProtKB/TrEMBL:Q6FL27"
                     /translation="MPRKAGDDYSKLNDDCCELAKNNMLHDDESNYYGRTNTPDENSF
                     VTANEDSCNESSGMLGGIENDNNTNRNNNKSNSSTLFTDSFRNWFLGKGNDNSEVNTR
                     QVKDIGADSTTIHETNNPNTIRRGIKNFLRIVDVGYEKDSIESQKLLRTSRIGWKLGS
                     KMEDHHTNENFDDQSTKSDKLKMIKNEGRVNVKRLNDELEGYWNVQNNSSASNLQDSL
                     TSSSESSSTEQVSTIRRTLSKVLHPLCTNNELLIEKARNHKMSADSRKEFDNTGVNKP
                     VDSTSLSRVSVSSCILRNDNNQNSYDKDLMKRKLNGSLTAGVTGCATLKGEISDQQLN
                     SHNGIDTGSQNAVISSEDDNISKYKTIRLKDMRISDPKQSYSKNIYKLRSKNVKRVDE
                     TDVNPYKFVFNSPNQYNLDGEQIDNIQLPMEAACYHNFKECLEILQAKTLPTLITLSI
                     EEFSIRILELVKINFNEFDNVSGNINDGKQPGASTGKGECISDEIQQLKEDNFQLSTK
                     LKTANFDLETLKTKLEDLEKKQDFKVKLNDLKSSRSGIHERNLQIINMSKRLKVTSIV
                     SEHLISLLGELVDIIRFDLQSSNYNFLTNSLTEILSVVSLKDTTNLNMETWNLRLTYI
                     INYYLASFRDLIEAMVRQNAGNENAVSFMSSALHQLRLENEKIKRRGGLMQKKQTRSS
                     ITT"
     gene            complement(<758294..>759283)
                     /locus_tag="CAGL0L06710g"
                     /db_xref="GeneID:2890667"
     mRNA            complement(<758294..>759283)
                     /locus_tag="CAGL0L06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449068.1"
                     /db_xref="GeneID:2890667"
     CDS             complement(758294..759283)
                     /locus_tag="CAGL0L06710g"
                     /inference="similar to AA sequence:UniProtKB:Q12010"
                     /note="similar to uniprot|Q12010 Saccharomyces cerevisiae
                     YOL092w or uniprot|P38279 Saccharomyces cerevisiae
                     YBR147w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449068.1"
                     /db_xref="GeneID:2890667"
                     /db_xref="GOA:Q6FL26"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FL26"
                     /translation="MHLEPIELNRRTVSEIAGSISIACWVVVFAPQIYENFRRKSSDG
                     LSLMFIILWLIGDIFNIVGAIMQNLLPTMIILAAYYTVADIILWFQCIWYNKNNANKK
                     PSLNRTNNTTHINSTNIQSKITSNSENDTNDGDIVENTTECEPMLTGDSIEHHSSAMR
                     RHADTPTKTPEMEDIESRTTKAKKKENYINDLFIVTVVMFAGFLSWYISYCNNTDSRK
                     SPKTPPSLGDSEKMNILAQIFGYLSAVLYLGSRIPQILLNFKRKSCEGVSLLFFLFAC
                     LGNINFILSVLAVSVSKKYLLVNASWLIGSAGTLLLDMTIFAQFFIYTHSKDS"
     gene            complement(<759865..>760731)
                     /locus_tag="CAGL0L06732g"
                     /db_xref="GeneID:2890668"
     mRNA            complement(<759865..>760731)
                     /locus_tag="CAGL0L06732g"
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /transcript_id="XM_449069.1"
                     /db_xref="GeneID:2890668"
     CDS             complement(759865..760731)
                     /locus_tag="CAGL0L06732g"
                     /inference="similar to AA sequence:UniProtKB:P38120"
                     /note="similar to uniprot|P38120 Saccharomyces cerevisiae
                     YBR146w MRPS9"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /protein_id="XP_449069.1"
                     /db_xref="GeneID:2890668"
                     /db_xref="GOA:Q6FL25"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /translation="MWMRVNRMLGNVSVRQFSNVRLVAQEYSMRVQQARNRIVPKSLT
                     FYSANPLHEEKISRLESLLKKYALPSSQKLPGADISAEENLKQNPRPSWISFSDYALI
                     GGGTRLKPRHYEHFIQLLNKLNNIDPQLVNTEIKNELSKYIKKSSIQSQKTQQKELDE
                     FGRSVAIGKRKAATAKVYLVRGEGKILVNGRQLNDYFLKMKDRESIAYPLQVVDSLGK
                     YNVFATCRGGGPTGQAEAIMHAIAKALLVFNPLLKPRLRKAGVITRDYRHVERKKPGK
                     KKARKMPTWVKR"
     gene            <761178..>762494
                     /locus_tag="CAGL0L06754g"
                     /db_xref="GeneID:2890815"
     mRNA            <761178..>762494
                     /locus_tag="CAGL0L06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449070.1"
                     /db_xref="GeneID:2890815"
     CDS             761178..762494
                     /locus_tag="CAGL0L06754g"
                     /note="highly similar to uniprot|P12385 Saccharomyces
                     cerevisiae YBR143c SUP45 translational release factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449070.1"
                     /db_xref="GeneID:2890815"
                     /db_xref="GOA:Q6FL24"
                     /db_xref="InterPro:IPR004403"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR024049"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6FL24"
                     /translation="MDTDAEKNIEIWKVKKLVRSLEQARGNGTSMISLVIPPKGQIPL
                     VQKMLTEEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNSLPPNGLVLYCGDIITEDG
                     KEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGALFGLLQG
                     NTRSVLHKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVNV
                     KGLILAGSADFKTDLAKSELFDQRLAAKVVQIVDISYGGENGFNQAIELSADALANVK
                     FVQEKKLLDEYFDEISQDTGKFCYGIDDTLKALDLGAVEKLIVFENLETIRYTFKDSE
                     DNEVIRFAEPKAKDKSYAVDKATGQEMEVVTEQPLIEWLAENYKNFGAALEFITDKSQ
                     EGSQFVTGFGGIGALLRYKVNFEQLVDESEDEYYDDDEVESDYDFI"
     gene            <763580..>766066
                     /locus_tag="CAGL0L06776g"
                     /db_xref="GeneID:2890816"
     mRNA            <763580..>766066
                     /locus_tag="CAGL0L06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449071.1"
                     /db_xref="GeneID:2890816"
     CDS             763580..766066
                     /locus_tag="CAGL0L06776g"
                     /note="some similarities with uniprot|P40209 Saccharomyces
                     cerevisiae YMR136w GAT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449071.1"
                     /db_xref="GeneID:2890816"
                     /db_xref="GOA:Q6FL23"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6FL23"
                     /translation="MRIINEVTHTPVQELREEIGLQTNKIKVKLQNPSDIPRVFIKKR
                     IAGKLNPSVLNNNERIVLVSGPPDMMNSEIQDRSYLTQKYSEYKPPNNSRANVPQYFT
                     GQNRAAEQFQRSAPIGAASEIPYQPPSHPYDHEIDLNNTLPAYYESFRGNQHGPKPSW
                     GTDSLLSSPTEKSDEQYFNDDISETRINTSDIKSVGEDVSNRLKSLVSRLERYGIENN
                     SGNIYGTNNQNLRYETIKIELIETIRKVKELQQELVKIFDNNTNLKYSTTGHEDSYKS
                     TKRRRSGLVTTLNDTEIDSAPNKFEPNNLEGKGQFHSSGGAYKNSLNDYKFPPGNTAN
                     SGAFFRANGDGSINTYKARPSNIRSMSSYPLIRSPYGKILQKNTMIPAIHSRQDPYNR
                     RVLLQPPYFHRPNLSDPSGIRPQSMHRSTLPTLPFPRNQSIDETFYQSRNLPEPSGFI
                     PQTYLGKPLPRCTHNQYQDNVYQQINIIENRSTSNEIKSMGETKIGSSRVSNEIGPLA
                     QRYMAKNNDDSDSYQQRALDSKPPQQNQSRDILSTEYSNFTYEGTDVVDNIDKGNGRK
                     AYIQKRKKSVYSRDLNAKTFNLPRLGSPNLTRDTSTKISVGLQGSETEGEDSRTDISK
                     AENPNSKKQENLVSHQDHISHVEQCADNATDKPSKNERSQYKSKVTSRENRVTKKDQS
                     AADAKIQSKCDKSSIRTTGKVTKPSKENLTKRRQYEAKSNTTSSSSEKVTVEITLRCH
                     HCGESDTPEWRRGPYGSRTLCNACGLFYRKLTKKFTVPYGNLYMRYRRIQAPLDRRVP
                     LVLDVPTDIVREFDLDQNIDSNYFTIGSDT"
     gene            <766769..>767890
                     /locus_tag="CAGL0L06798g"
                     /db_xref="GeneID:2890817"
     mRNA            <766769..>767890
                     /locus_tag="CAGL0L06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449072.1"
                     /db_xref="GeneID:2890817"
     CDS             766769..767890
                     /locus_tag="CAGL0L06798g"
                     /inference="similar to AA sequence:UniProtKB:P32419"
                     /note="similar to uniprot|P32419 Saccharomyces cerevisiae
                     YDL078c MDH3 or uniprot|P17505 Saccharomyces cerevisiae
                     YKL085w MDH1 or uniprot|P22133 Saccharomyces cerevisiae
                     YOL126c MDH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449072.1"
                     /db_xref="GeneID:2890817"
                     /db_xref="GOA:Q6FL22"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:Q6FL22"
                     /translation="MVKVAVLGASGGVGQPLSLLLKLNTMISELALYDIKLAEGVATD
                     LSHINTNADCVGYSTDDIGQALKGAAVVVIPAGVPRRPGITRDDLFKLNAGIVKNLVS
                     NVAKHCPNARLLIISNPVNSLIPVAVETLKRCGVFQAGNVMGVTTLDLVRAETFLAEY
                     LNTHEAKEIGGIAGERTYDKSKMYKYVGVIGGHSGETIVPLVFNHMMTRTLEKTNKYD
                     EFINRVQYGGDEVVKAKAKDGSGSATLSMALAGSKFVNEVLQSVHRRDEHRKRVNRTS
                     DRKNVTISSTYVYLPGLSNGKEVQEKLKNLAGIRDASVRCEYFALPVVLEDGRVTRVD
                     KSILDSISPKEKEMVKIAIQELEKNVNKGKDFVSGQTKL"
     gene            <769035..>770135
                     /locus_tag="CAGL0L06820g"
                     /db_xref="GeneID:2890818"
     mRNA            <769035..>770135
                     /locus_tag="CAGL0L06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449073.1"
                     /db_xref="GeneID:2890818"
     CDS             769035..770135
                     /locus_tag="CAGL0L06820g"
                     /note="highly similar to uniprot|P38615 Saccharomyces
                     cerevisiae YMR139w MDS1 Serine/threonine-protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449073.1"
                     /db_xref="GeneID:2890818"
                     /db_xref="GOA:Q6FL21"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FL21"
                     /translation="MNIEKLTGPEIVKKQVYYGHEVVNGAAKSSEPITISFPATEVVG
                     HGSFGVVFTTVIQETNEKVAIKKVLQDKRFKNRELEIMKMLQHRNIIDLKYYFYEIDE
                     REDVFLNLILDYMPQSLYQRLRHFVHQRTPMPRLEIKIYMYQLFKALNYLHHTANVCH
                     RDIKPQNLLVDPNSWCLRLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYTNQ
                     IDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPTKQEICVMNPNYMEHKFPQ
                     IKPIPLAKVFKKEDEVTVDFLSNTFKYDPTQRYHSLQCLCTPYFDEIRFGDGKIREII
                     KDLKLLEFDEQMELAHLGPDERGAVKQKLHIQ"
     gene            <771870..>773786
                     /locus_tag="CAGL0L06842g"
                     /db_xref="GeneID:2890819"
     mRNA            <771870..>773786
                     /locus_tag="CAGL0L06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449074.1"
                     /db_xref="GeneID:2890819"
     CDS             771870..773786
                     /locus_tag="CAGL0L06842g"
                     /inference="similar to AA sequence:UniProtKB:Q07471"
                     /note="similar to uniprot|Q07471 Saccharomyces cerevisiae
                     YDL080c THI3 or uniprot|P06169 Saccharomyces cerevisiae
                     YLR044c PDC1 or uniprot|P16467 Saccharomyces cerevisiae
                     YLR134w PDC5 or uniprot|P26263 Saccharomyces cerevisiae
                     YGR087c PDC6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449074.1"
                     /db_xref="GeneID:2890819"
                     /db_xref="GOA:Q6FL20"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FL20"
                     /translation="MNYTEEYGLPSQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLD
                     KLYSIPTMRWAGNTNELNAAYAADGYSRLKHLGCLITTFGVGELSAINGVAGSYAEHV
                     GILHIVGMPPTSAQTKQLLLHHTLGNGDYSVFYRIANDIACHTAIINDTDLCADEVDN
                     CIRAAWGYQKPVYLGVPVNQVDIPVDSSRLNNPIDLSILKKTKETDAQVIDLLLKQMY
                     SASKPIIVVDACVRRHDALKETHALCELTNFPVFVTPMGKGTIDESYKNFGGVYSGSL
                     SSPEVREVTDFADFVLFIGAILPEFSTSTFHFGFKKKNCCILFPTSVKIKKATFPDML
                     LKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSDSNLLRQEWVWNEISHWFKENDI
                     IITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCSCLGALFAVEEKTVVKHNLEI
                     KLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLKPYIFIMNNNGYSVDRFLH
                     HRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELLADESFAKPDKIRMIEI
                     MLPQSDVPKTLIARWQAEKELSNKRAGDFSENSSENSSPTIDPHWVKKQYLGPVTPTS
                     SLSTELHSRSQMYL"
     gene            <774846..>776336
                     /locus_tag="CAGL0L06864g"
                     /db_xref="GeneID:2890820"
     mRNA            <774846..>776336
                     /locus_tag="CAGL0L06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449075.1"
                     /db_xref="GeneID:2890820"
     CDS             774846..776336
                     /locus_tag="CAGL0L06864g"
                     /note="weakly similar to uniprot|P40210 Saccharomyces
                     cerevisiae YMR140w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449075.1"
                     /db_xref="GeneID:2890820"
                     /db_xref="GOA:Q6FL19"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:Q6FL19"
                     /translation="MRLPARLDDRNGLDDNLFNSSDNEDEDEDDDDYLFVAQDANGQD
                     HIQGAGSGISIGSRYVSGIKNSLVSTFAFRKESTAWKSVSELEKKKEHEMFYLLSRYN
                     ESVDGGYLAPFHYLPVNKYDYSVHTVRSLIIGRKLAPFYVPLDEFQENWSREQLLSAV
                     TRLPLHERMSSLPKDHPVLKELEETSNLPVEDLGRDTIMNHIDKSLPFKKQKKLRQKI
                     FHARNIRLRIKLQEEETEIIAGIPKKGSKVESIKEKYYPNDDLKIDIYSNVEECPICF
                     FNMPAPLNKTKCCKQNLCTECFILMKRQRPQLNRISRTLTTTDNTEIDIARGIFSYTE
                     LDNNEGSRYRITIKVNSTPAKCPYCTQEDFAVTYNPPSSRRTGIGGVPPATYDPNVKP
                     FINSNRKSHIISELDRITCVKSDDIRPYWQLASKQTRVLYRTHLNQRDLLARLANHED
                     QNNHSVSQSMSGYESTGLRHVEDSAAHIFSNTIPIIAQESNMSRPN"
     gene            complement(<776762..>778025)
                     /locus_tag="CAGL0L06886g"
                     /db_xref="GeneID:2890821"
     mRNA            complement(join(<776762..777357,778022..>778025))
                     /locus_tag="CAGL0L06886g"
                     /product="60S ribosomal protein L13"
                     /transcript_id="XM_449076.2"
                     /db_xref="GeneID:2890821"
     CDS             complement(join(776762..777357,778022..778025))
                     /locus_tag="CAGL0L06886g"
                     /note="highly similar to uniprot|P40212 Saccharomyces
                     cerevisiae YMR142c RPL13B or uniprot|Q12690 Saccharomyces
                     cerevisiae YDL082w RPL13A"
                     /codon_start=1
                     /product="60S ribosomal protein L13"
                     /protein_id="XP_449076.2"
                     /db_xref="GeneID:2890821"
                     /db_xref="GOA:Q6FL18"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="InterPro:IPR018256"
                     /db_xref="UniProtKB/TrEMBL:Q6FL18"
                     /translation="MAISKNLPILKNHFRKHWQERVKVHFDQAGKKESRRSARVAKAA
                     KIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFSLAEIKAAGLTAAYARTVGIAVDHRRQ
                     NRNQETFDLNVQRLKEYQSKLIVFPRKGKAPETEQVLSVAATFPIAQASTEIETRAVE
                     DNGESAFRTLRLARSDKKFKGIREKRAREKAEAEAEKKK"
     gene            complement(<779554..>780873)
                     /locus_tag="CAGL0L06908g"
                     /db_xref="GeneID:2890822"
     mRNA            complement(<779554..>780873)
                     /locus_tag="CAGL0L06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449077.1"
                     /db_xref="GeneID:2890822"
     CDS             complement(779554..780873)
                     /locus_tag="CAGL0L06908g"
                     /note="highly similar to uniprot|Q07478 Saccharomyces
                     cerevisiae YDL084w SUB2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449077.1"
                     /db_xref="GeneID:2890822"
                     /db_xref="GOA:Q6FL17"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSHEGEEDLLEYSDNEQEIQVDNKETAVEGTTENEATQENGEAD
                     KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSG
                     LGKTAVFVLSTLQQLDPVPGEVSVVVICNARELAYQIRNEYLRFSKYMPDVRTAVFYG
                     GTPIAKDAELLKNKDTAPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELD
                     MRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQ
                     YYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTSRANELTKLLNASNFPAITVHGHMK
                     QEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLLNEADQYLHRVGRAGR
                     FGTKGLAISFVSNKEDEEVLSKIQERFDVKIAEFPEEGIDPSTYLNN"
     gene            <782195..>782392
                     /locus_tag="CAGL0L06930g"
                     /db_xref="GeneID:2890823"
     mRNA            <782195..>782392
                     /locus_tag="CAGL0L06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449078.1"
                     /db_xref="GeneID:2890823"
     CDS             782195..782392
                     /locus_tag="CAGL0L06930g"
                     /note="highly similar to uniprot|Q3E7B7 Saccharomyces
                     cerevisiae YDL085C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449078.1"
                     /db_xref="GeneID:2890823"
                     /db_xref="GOA:Q6FL16"
                     /db_xref="InterPro:IPR007513"
                     /db_xref="UniProtKB/TrEMBL:Q6FL16"
                     /translation="MARGNQRELARQKNLKKQQEAAKHQKKGDAKKRMESDAEILRQK
                     QAAADARKEAERLEKLKAGKK"
     gene            complement(<782790..>783833)
                     /locus_tag="CAGL0L06952g"
                     /db_xref="GeneID:2890824"
     mRNA            complement(<782790..>783833)
                     /locus_tag="CAGL0L06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449079.1"
                     /db_xref="GeneID:2890824"
     CDS             complement(782790..783833)
                     /locus_tag="CAGL0L06952g"
                     /note="highly similar to uniprot|P40217 Saccharomyces
                     cerevisiae YMR146c TIF34 translation initiation factor
                     eIF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449079.1"
                     /db_xref="GeneID:2890824"
                     /db_xref="GOA:Q6FL15"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR027525"
                     /translation="MRPIVLMGHERPLTQVKYNREGDLLFTCSKDISASVWYSNNGER
                     LGTLDGHMGSIWSIDSDHTSLYCVTGSADYTIKVWTLMNGQCVQTWNCPVPVKRVEFS
                     PCGKYILAILDNVMKKPGSIEIYEVKRNPETNEITEFVEEPIHSIVTHEGLDAASVAG
                     WSGEGKYIIAGHKDGKISKYDTQDGYKLVESQQVHKDSVSDLQFSPDRTYFITCSRDS
                     NAHIIDIETFKVLKTYETDSPLNSAAITPLKEFVILGGGQDASEVTTTSASEGKFEAR
                     IYHKVFEEEIGRVVGHFGPLNSIAVSPQGTSYTSGGEEGLVRLHHFEKSYFDFKYDVE
                     KAADAKEHISHEA"
     gene            complement(<784296..>785117)
                     /locus_tag="CAGL0L06974g"
                     /db_xref="GeneID:2890825"
     mRNA            complement(<784296..>785117)
                     /locus_tag="CAGL0L06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449080.1"
                     /db_xref="GeneID:2890825"
     CDS             complement(784296..785117)
                     /locus_tag="CAGL0L06974g"
                     /note="highly similar to uniprot|Q07505 Saccharomyces
                     cerevisiae YDL086w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449080.1"
                     /db_xref="GeneID:2890825"
                     /db_xref="GOA:Q6FL14"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FL14"
                     /translation="MLITESYHDVKTKEGNTLRIFVFSPKVKGYPNAKFPGVIVYSEI
                     YQVTGPVARFAQKIASEGYVVVAPAIYHNFIGPEPLPYDVKGTDLGNEYKIKKPIPSY
                     DEDNKLCCDLLYSLPQFDGKRIGATGMCLGGHLAFRALLDKRVNCATCFFPTDIHLKS
                     LGLGKNDDSLERVSQEASKDQELVLIFGTADTHVSPEGRDLIRKTLRDQGVNFTFLEI
                     LDAQHAFIRDEFSKGRYDAAITQSCLGFLFEQFNRKLKTDLGEYVPDNKPLEHVC"
     gene            <786067..>786510
                     /locus_tag="CAGL0L06996g"
                     /db_xref="GeneID:2890826"
     mRNA            <786067..>786510
                     /locus_tag="CAGL0L06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449081.1"
                     /db_xref="GeneID:2890826"
     CDS             786067..786510
                     /locus_tag="CAGL0L06996g"
                     /note="some similarities with uniprot|Q03083 Saccharomyces
                     cerevisiae YPL034w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449081.1"
                     /db_xref="GeneID:2890826"
                     /db_xref="GOA:Q6FL13"
                     /db_xref="UniProtKB/TrEMBL:Q6FL13"
                     /translation="MTTKPMVSTRLLEWQNTCKNPVINLTPDRIEQLIYAYDTKTKKI
                     NSISTLLTKLELKKEKPQSRQESPLDLLTYKDGGFFIDGTSNLNLSEVENRIHRFLWE
                     KYGKGFIYCYGCDPMGQKRHTEWFHLPIRDLSSVMRTIDAFCYSG"
     gene            complement(<786578..>787591)
                     /locus_tag="CAGL0L07018g"
                     /db_xref="GeneID:2890827"
     mRNA            complement(<786578..>787591)
                     /locus_tag="CAGL0L07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449082.1"
                     /db_xref="GeneID:2890827"
     CDS             complement(786578..787591)
                     /locus_tag="CAGL0L07018g"
                     /note="some similarities with uniprot|Q03085 Saccharomyces
                     cerevisiae YPL033c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449082.1"
                     /db_xref="GeneID:2890827"
                     /db_xref="GOA:Q6FL12"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FL12"
                     /translation="MHLRSIIGFLYKYIDTGKKLVPGRDAVLIVGGTMSKTGWNVCNL
                     LVRRYNVEVINIDSKCAYSLLKKFSVIDSDQCEAMDLLEEQMINENDLANQEEAQVDD
                     SLAELVLEGGLEQLYLEADEAKLLHPYRSSGNYTFIECRDLADSKCVIDAMLMALATG
                     KRITVFINNLQEGLYSKCLENGGYVDSLEFFEKCTNTNVTNAIIATKYFISEFIPTIN
                     TNFGPENDYYIVNFTVDPRNQKLLLPASYFTTKAAIRQLHDGLSSEKSIYETTSKIKT
                     LLVRIPETPANVDLHMERFEQIADLLIKNLKLGRAGTYNITATIFTNILADFRQFLDQ
                     LQY"
     gene            <788067..>788813
                     /locus_tag="CAGL0L07040g"
                     /db_xref="GeneID:2890828"
     mRNA            <788067..>788813
                     /locus_tag="CAGL0L07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449083.1"
                     /db_xref="GeneID:2890828"
     CDS             788067..788813
                     /locus_tag="CAGL0L07040g"
                     /inference="similar to AA sequence:UniProtKB:Q07508"
                     /note="similar to uniprot|Q07508 Saccharomyces cerevisiae
                     YDL087c EXM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449083.1"
                     /db_xref="GeneID:2890828"
                     /db_xref="GOA:Q6FL11"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:Q6FL11"
                     /translation="MSAAAEQRKQIRQLMGGHEVHYSRYNRGQFDKDRYLRNELTDPR
                     VCKSYLVGECPYDLFQGTKQSLGRCPQIHLAKHKLKYERETEIEGKRYPEFEREYFMI
                     LSKFVSECDNQISVAIRKLEHTPEEKKLIQQVTAELDNIDTKIALMTEEIEILAHNNE
                     TTKALLQSVKLQKLKQERKIVAKKVRNITENVGQSAQQKLQVCDVCGAYLSRLDTDRR
                     LADHFLGKVHIGYAKMREQYMYYKQKLNRS"
     gene            <789289..>790749
                     /locus_tag="CAGL0L07062g"
                     /db_xref="GeneID:2890829"
     mRNA            <789289..>790749
                     /locus_tag="CAGL0L07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449084.1"
                     /db_xref="GeneID:2890829"
     CDS             789289..790749
                     /locus_tag="CAGL0L07062g"
                     /inference="similar to AA sequence:UniProtKB:Q05166"
                     /note="similar to uniprot|Q05166 Saccharomyces cerevisiae
                     YDL088c ASM4 or uniprot|Q03790 Saccharomyces cerevisiae
                     YMR153w NUP53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449084.1"
                     /db_xref="GeneID:2890829"
                     /db_xref="GOA:Q6FL10"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="UniProtKB/TrEMBL:Q6FL10"
                     /translation="MTASVKQDRFSNVNLLYSIQDKYQTNQDQSFHSNQSNLSTTGNY
                     NALKSLSMLPPPSMGMATNSDVGTKNDMGSVSWYNNPKKKSNLHNNLSKRSLLLRSTG
                     NENKSETSSGIHLKNNGFNLADFSKKDSSDLLQKKDNLGATDIYNSTTDYPPTTSLHD
                     WQREDEFGIVQTASNTSNYGEPNSKSYHNNSYGGLIKTPNVFDKSGQSSGYKLSSTIG
                     KNNTDVNKNDNNSAIYSESAVIVFGYPEYLSNQVITHFSHFGNILEDFEILRSSTGIN
                     NNTFRLHANLNALQEGSMSTKLPIFTGEGWVKITYDSPTSALRALKENGTVFTGHLIG
                     CIPYSKSAVEQLALISVDKSDDIGSIDLGQINKSVNEDSRNKGSNGKVYPSLGSVDHI
                     EPINGRQKEANMKSFGTPIINNNQQYLDHSIMAHPRHKLDIQDGKSLFVHNSSHHKTQ
                     FLDNIEKKIKEKEANKNESGSWSGRLTNWVFGWDNI"
     gene            complement(<790871..>792187)
                     /locus_tag="CAGL0L07084g"
                     /db_xref="GeneID:2890830"
     mRNA            complement(<790871..>792187)
                     /locus_tag="CAGL0L07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449085.1"
                     /db_xref="GeneID:2890830"
     CDS             complement(790871..792187)
                     /locus_tag="CAGL0L07084g"
                     /note="some similarities with uniprot|Q12066 Saccharomyces
                     cerevisiae YDL089w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449085.1"
                     /db_xref="GeneID:2890830"
                     /db_xref="GOA:Q6FL09"
                     /db_xref="InterPro:IPR018819"
                     /translation="MFSWLIPDIPELFLTISVWFRLQGWEDNTKLGFIIGNTLTTIFY
                     ILRLAQDTLLAGVSRKLIRDYELFDLSKSETLLSDPAFSSYHDVLFNKHHSTANASSY
                     NKRVRKVTSTVYWSTYFLLLLSCYTCYRLFNTYKVYRIYYLKDLNLDKHPSLKKIEPD
                     YEVDEKLLKTSLKSKLLSRFIRLLQLQDEVETELPKVTEHYTLNKWDPSKLIISLSTS
                     FSPTIIICLMYTNVTFLTVIPIIIHQGIFYFMIWNRYEERFKDDALLMRENYLQYDTK
                     YVKPLKQIMYQDVMTDTATISDGGFTKFFPVSKSTLFKHHEMSGDVIIERYNKKSREF
                     ENVTDIIKPHHHINNTVKILPPTIRKDHKTNRYDHRQQSILKDRKFNIDSNEPQIINA
                     LTTAIPSRSFFNNNPSGSNDDNCSGIKVRSSPTRETFFPATPLRKK"
     gene            <793968..>795260
                     /locus_tag="CAGL0L07106g"
                     /db_xref="GeneID:2890831"
     mRNA            <793968..>795260
                     /locus_tag="CAGL0L07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449086.1"
                     /db_xref="GeneID:2890831"
     CDS             793968..795260
                     /locus_tag="CAGL0L07106g"
                     /inference="similar to AA sequence:UniProtKB:P22007"
                     /note="similar to uniprot|P22007 Saccharomyces cerevisiae
                     YDL090c RAM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449086.1"
                     /db_xref="GeneID:2890831"
                     /db_xref="GOA:Q6FL08"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:Q6FL08"
                     /translation="MSTARRAKYISKLLGRKRAIIEREITDTTVNMAEVAPLMKELET
                     DTTLARNDVLHSINKLLENLCLEPNNSTKNNLELELNKDFHKVYLEMAFDSALPPQMA
                     ALDASQPWLLYWIANSLKVLDESWLSETNKHLIVEKLFHISPDHGPFGGGVGQLPHLA
                     GTYAAINALSLCDNIDQCWESINRGAIYKWLLSLKQPDGGFKTCLDVGEVDTRGVYCA
                     LSIASMLDILTDELTEGVVEYLIACQNYEGGFGSGPFCDEAHGGYTFCAVGSLAILNA
                     LDKMNTEKLMEWCSARQYNEELGLCGRSNKLVDGCYSFWVGATAAILESYNYGECINK
                     DALRNYILACCQTETHPGLRDKPGKHSDFYHTNYVLLGLAVSECAFFSTNSNGIEMID
                     SQINNNNVNSNLSKINPVYGLPEDNFKNFITYFKAKTI"
     gene            <795787..>797073
                     /locus_tag="CAGL0L07128g"
                     /db_xref="GeneID:2890832"
     mRNA            <795787..>797073
                     /locus_tag="CAGL0L07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449087.1"
                     /db_xref="GeneID:2890832"
     CDS             795787..797073
                     /locus_tag="CAGL0L07128g"
                     /inference="similar to AA sequence:UniProtKB:Q12229"
                     /note="similar to uniprot|Q12229 Saccharomyces cerevisiae
                     YDL091c UBX3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449087.1"
                     /db_xref="GeneID:2890832"
                     /db_xref="GOA:Q6FL07"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FL07"
                     /translation="MSGSSGGNYDHIPGHFPIETNVNPISASPEETVEDSQASRYIKR
                     ILAYIFQFPLMILFYSLTVLLQALKVIKPLKNLLRFYDKKHINQMNHRDVLARLIEYL
                     EKETEKIELNRDHDSSNYSFGSLYGTDSGSLSKEIMQGSYTQLLDTCTDQLKFGMIYL
                     HDPLLDDSLNYLDKILCSEDFVKLLKRYQILLWFGDVTNSEGMQVSNALKVRSFPFLG
                     VLTVKNNKKIELFGKFEGPVHNFTAASLENILSKEYPSLLQLRQQKQHIEVERFIREQ
                     QDARFNDSLRRDQERERARLEEQNRAAYEAEQTVLRKQWLLWRKKSLKSEPNSSQDSS
                     RIAIRMEDGSRIVRKFDAGLPIEEIYAFVELYSTNLLQSEEQYDAEDPPSNYHHSYNF
                     TLIVPVPRKELNPAITISDESSIYPSGTIIIEIDNN"
     gene            complement(<797318..>797740)
                     /locus_tag="CAGL0L07150g"
                     /db_xref="GeneID:2890833"
     mRNA            complement(<797318..>797740)
                     /locus_tag="CAGL0L07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449088.1"
                     /db_xref="GeneID:2890833"
     CDS             complement(797318..797740)
                     /locus_tag="CAGL0L07150g"
                     /inference="similar to AA sequence:UniProtKB:P38985"
                     /note="similar to uniprot|P38985 Saccharomyces cerevisiae
                     YDL092w SRP14 signal recognition particle subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449088.1"
                     /db_xref="GeneID:2890833"
                     /db_xref="GOA:Q6FL06"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:Q6FL06"
                     /translation="MSESKAVISPTEFLQKAGELFKTANEKKVTVHISIKRYIKDDQV
                     EGNLEKDATKAPEYDVSKMARNIATKESSDKSYPMVVRIWCGSNAKKTKYSTIVPTLE
                     LDQFWQDYSSVVKSGMNGLIKKKKKRKTAASNKDKKKN"
     gene            complement(<798351..>800684)
                     /locus_tag="CAGL0L07172g"
                     /db_xref="GeneID:2890834"
     mRNA            complement(<798351..>800684)
                     /locus_tag="CAGL0L07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449089.1"
                     /db_xref="GeneID:2890834"
     CDS             complement(798351..800684)
                     /locus_tag="CAGL0L07172g"
                     /inference="similar to AA sequence:UniProtKB:P33775"
                     /note="similar to uniprot|P33775 Saccharomyces cerevisiae
                     YDL095w PMT1 mannosyltransferase or uniprot|P52867
                     Saccharomyces cerevisiae YDL093w PMT5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449089.1"
                     /db_xref="GeneID:2890834"
                     /db_xref="GOA:Q6FL05"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FL05"
                     /translation="MAKKSAAKKEKDAVQQRAATPELLKTVPQVELKDGPVRKYIVSD
                     PTPELFQFRTIGSKSDGILMAIVALFAIVTRFYDIGFPKAIVYDEGFVIAEVSKYFNK
                     TFSIDVFPPLGKMIYYFVGKYTGFDTSYKYHPVGTQFENASVYLPERYLAAGLGACVV
                     VFFFMTLRASGVSRPIAGIFSVALSLENSFITASRYVHLDAPFLFFVAAAIYFTKKSD
                     NLRAGSGRYIFTFTHAACLLGLAISTKWAGLFVLAWVAIVTLWRLWLLAGDLSVPICR
                     TVKVFIFNLLVLSLVPAVIYFSIFSWHIGSRTVDGNDSILMKPEFRSELYNNTVIKES
                     FADVVVGGTVRLNNIGMDGGFVEAAPAYYEAGSKQRQIDLRKNESVTTDWVVEYYNRS
                     GSTPKSFENLKNHEKIRLYSPKYKCRLHSHDHKAPISQHVDWQKEVSCYGYEGFMGDP
                     NDDWIVEIDQDLSEPGEAREFVKAIDTKFRLKHAMSGCYLFTHDVRMRTPEFVMDYEI
                     ACAHSGKYELTLWNIEQDQPHPNSPKNPKRVSYKPMSLKDKILDLHAKMIEKAKVRTD
                     KSSLITFPTTWPLLEKGIPFWNGFARQIYFLGNPAMWWSVSAFIVLFVVAFVGELIFW
                     QMGFEISSNPQFINFHIQVLQYGIGFALNYVPYILTTDRHHLYQYLPAYYFGLLALAH
                     VFELVYSFAFKNKRVGLSVAAFFLVVVVVAFFRYLPLTYATPWTVSECNATKLLSSWK
                     YGCEIYPENYRIYQKMDLTNYTKAGTKELDKIGVVLH"
     gene            <800960..>801430
                     /locus_tag="CAGL0L07194g"
                     /db_xref="GeneID:2890835"
     mRNA            <800960..>801430
                     /locus_tag="CAGL0L07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449090.1"
                     /db_xref="GeneID:2890835"
     CDS             800960..801430
                     /locus_tag="CAGL0L07194g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449090.1"
                     /db_xref="GeneID:2890835"
                     /db_xref="GOA:Q6FL04"
                     /db_xref="UniProtKB/TrEMBL:Q6FL04"
                     /translation="MASLGDGQLNSISVIYENASVYNSTDYLFQLKRVQLITLALAEN
                     PECSSPGSSYQFCQSCLHVRKHFVCTWNTMSDMKRLSSRERIEYFLENLIFLRIAMSI
                     INRKLLSMSQLDAIKSTLGLDLNLTILLYYLNDRGLLVCLVKQIFYSYNYVCIY"
     gene            complement(<801526..>804102)
                     /locus_tag="CAGL0L07216g"
                     /db_xref="GeneID:2890979"
     mRNA            complement(<801526..>804102)
                     /locus_tag="CAGL0L07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449091.1"
                     /db_xref="GeneID:2890979"
     CDS             complement(801526..804102)
                     /locus_tag="CAGL0L07216g"
                     /inference="similar to AA sequence:UniProtKB:P33775"
                     /note="similar to uniprot|P33775 Saccharomyces cerevisiae
                     YDL095w PMT1 mannosyltransferase or uniprot|P52867
                     Saccharomyces cerevisiae YDL093w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449091.1"
                     /db_xref="GeneID:2890979"
                     /db_xref="GOA:Q6FL03"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FL03"
                     /translation="MSDKKAEKQLQPVSTADSLLCMDVDPVPEVKINKGPLRPYIDFE
                     GDYDTAKLRTVKTLKEKLMVAILLIITAFVRLYKLSWPSSVVFDEVHFGGFASKYIKG
                     DFFMDVHPPLAKMLFAGVGALAGYTGDFSFKPIGEEYPDTVPFYTMRLFSASLGVFTV
                     LMLYLTLRASGVRLGVAYLFALVFAFENSFVTISRYILLDAPLICFIAAAVYSYKKSE
                     LYPTNSFRALKSLLATGIALGLASSSKWVGLFTVAWVGLLCVWKLWFMIGDLNKSPCT
                     IVKAAIGKLVLLLGVPILLYVAFFYVHFQALIHDGSGSSFFPSEFRATLEGNQIPSDV
                     VYDVGVGSIVTLKHLSTEGGYLHSHSHAYPTGSEQQQITLYPFLDDNNKWVIERSHLP
                     GASLKDFIGLKNGESISLLHLATGVRLHSHDHKPPVSESADWQKEVSGYGYLGFTGDI
                     NDHWTIEIDQSSSKPGIAQHEVRAIDTKFKLRHATGCYLFSHEVKLPKWGFDQQEVTC
                     ATQGKPELLLWYIEGSENPQLPENTPRISYKPMNFIEKFIENHKKMWKINKGLTGTHY
                     YESLAYEWPLMRRGIGYWGEHHRKIYLLGNAVTWWAVSAFILVYAAILAFEAGSFLVG
                     KPILQDKNVINFHVQVLHYLLGFAIHYVPFFLMGRQLFLHHYLPAYYFGILALAHAFD
                     IIITFVCKNRKQAAYALLILFTAASIYFFHAHSPIAYGTDWTKDVCRNSRWVSTWDYD
                     CENYFNDLSEYANYTYVPKITTDEATTDVQNVVPAAEPEQQEKKAVVSDVNGAASPHK
                     REKVEKNEAERMLDDLSNKKFLDGNGNELSPEQVKKLLEKEGIENLKIEKEVNHVRKR
                     VA"
     gene            <805291..>806556
                     /locus_tag="CAGL0L07238g"
                     /db_xref="GeneID:2890980"
     mRNA            <805291..>806556
                     /locus_tag="CAGL0L07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449092.1"
                     /db_xref="GeneID:2890980"
     CDS             805291..806556
                     /locus_tag="CAGL0L07238g"
                     /note="highly similar to uniprot|Q12377 Saccharomyces
                     cerevisiae YDL097c RPN6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449092.1"
                     /db_xref="GeneID:2890980"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:Q6FL02"
                     /translation="MISLERAKELVEQKQYAEAEQVYLGILNQEVPMDEKKKDEREKA
                     ILAMGDMYVEQGDKAKLREFIPHSTEYMMQFAKSKTAKVLKTLIEKFSLVPNSLEDQI
                     YVCKQSIDFAKREKRVFLKHSLEIKLATLHYETKEYKDSLALIENLLREFKKLDDKPS
                     LVDVHLLESKVYHKLRNLAKSKAALTASRTAANSIYCPTVTVAELDLMSGILHCEDKD
                     YKTAYSYFFESFESFHNLSTSNSYDKACQVLKYMLLSKIMLNLIDDVKSILNAKYTKE
                     TYQSRGIDAMRAVAEAYNNRSLHEFNTALKQYRTELMSDELTRSHFNALYDTLLESNL
                     CKIIEPFECVEIAHISKMIGLDAQHVEGKLSQMILDKVFSGVLDQGNGWLYIYDTPHQ
                     DATYDSALELVGQLNKVVDQLFDKASVLY"
     gene            <806834..>807397
                     /locus_tag="CAGL0L07260g"
                     /db_xref="GeneID:2890981"
     mRNA            <806834..>807397
                     /locus_tag="CAGL0L07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449093.1"
                     /db_xref="GeneID:2890981"
     CDS             806834..807397
                     /locus_tag="CAGL0L07260g"
                     /inference="similar to AA sequence:UniProtKB:Q12368"
                     /note="similar to uniprot|Q12368 Saccharomyces cerevisiae
                     YDL098c SNU23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449093.1"
                     /db_xref="GeneID:2890981"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FL01"
                     /translation="MSNFGRRTWDRDEYDTVPELSHLQSLKDTLSDVQLEQLKKKYTN
                     YDMLLKRSMSGLNKRVLATNVSSFKKGQQYGFYCELCNITLKDSLQYVDHLNHKSHEL
                     KFEALFEEPLITETRDNDDIPIEEFNLLYKEKIRSFVKANRVVAIPNEDDTSRRKKKR
                     NNKTNISNNDNNDDDTIKKVMGFSNFE"
     gene            complement(<807622..>808650)
                     /locus_tag="CAGL0L07282g"
                     /db_xref="GeneID:2890982"
     mRNA            complement(<807622..>808650)
                     /locus_tag="CAGL0L07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449094.1"
                     /db_xref="GeneID:2890982"
     CDS             complement(807622..808650)
                     /locus_tag="CAGL0L07282g"
                     /inference="similar to AA sequence:UniProtKB:Q12191"
                     /note="similar to uniprot|Q12191 Saccharomyces cerevisiae
                     YDL099w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449094.1"
                     /db_xref="GeneID:2890982"
                     /db_xref="GOA:Q6FL00"
                     /db_xref="UniProtKB/TrEMBL:Q6FL00"
                     /translation="MSDTEEDKRAKQLEEARKRVEELKNKKNKKKNKKKKNKDKEGDD
                     KAAAVEANDSANEITEATETADSTEALEVPDSKEATPAEEVKQTEDEEIETKDDDLQE
                     ESVVADTKEESIPTEEAKVVDEAQKTIEDVEELTREVETKLQGDINEKKAAEEEYTDK
                     KEEPKAQDGLDDMFGNDDNSNDFISTINKEKEADEISELKKEIEKLIAENKTLKFANI
                     DHETVIEELQEENAKYKEMLELTQNDLQQVKNELLQTQVKLNEVSQNNNKPVNASPTL
                     QFAKFNSNSETSNYAPSNSTGQTPKLNTYGIAQTQTVDRAMLQKWRNWNIDMTTWRSI
                     GSGPIVEF"
     gene            <808974..>810026
                     /locus_tag="CAGL0L07304g"
                     /db_xref="GeneID:2890983"
     mRNA            <808974..>810026
                     /locus_tag="CAGL0L07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449095.1"
                     /db_xref="GeneID:2890983"
     CDS             808974..810026
                     /locus_tag="CAGL0L07304g"
                     /note="highly similar to uniprot|Q12154 Saccharomyces
                     cerevisiae YDL100c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449095.1"
                     /db_xref="GeneID:2890983"
                     /db_xref="GOA:Q6FKZ9"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDLTVEPNLKSLITSSTHKWIFVGGKGGVGKTTSSCSIAIQMAL
                     AQPHKKFLLISTDPAHNLSDAFGEKFDKDARKVTGMDNLSCMEIDPSAALKDMNDMAV
                     SSAGENGNDDLGGLLQGGALADLTGSIPGIDEALSFMEVMKHIKKQEQGDGESFDTVI
                     FDTAPTGHTLRFLQLPTTLSKLLDKFSEITGRLGPMLNSMMGSGNVDIAGKLNELKAN
                     VETIKEQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAEFD
                     QEHNCKRCQSRWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLKKFSQFLFKEY
                     DPVADNTVIYELEEKN"
     gene            <810529..>812049
                     /locus_tag="CAGL0L07326g"
                     /db_xref="GeneID:2890984"
     mRNA            <810529..>812049
                     /locus_tag="CAGL0L07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449096.1"
                     /db_xref="GeneID:2890984"
     CDS             810529..812049
                     /locus_tag="CAGL0L07326g"
                     /inference="similar to AA sequence:UniProtKB:P39009"
                     /note="similar to uniprot|P39009 Saccharomyces cerevisiae
                     YDL101c DUN1 protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449096.1"
                     /db_xref="GeneID:2890984"
                     /db_xref="GOA:Q6FKZ8"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ8"
                     /translation="MSLTIKRNNSVENEENSKRLKDATGERVYDVVATMVSLIPGKEQ
                     SYEIKDKSVTSVGRSRSCDIVLQEPDISTVHCEMYIVSMKLDNSERKLINIVDKSRNG
                     TYINGNKLIKRDYVLKNGDRVVFGKRCSFLFKYASTTFEDLNEEDKASDISDENRKDE
                     SSIFKKPQFSFTSSQSQVRKFAKLKPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGET
                     VAVKIFHPQQNDDQKKNKQFREETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLE
                     KIDDGELFDRIVKKTSLPQEESKAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRR
                     QSPDERQLGPWDEDEIDIQVKIADFGLAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYT
                     SKVDLWSAGVILYVCLCGFPPFSDQLGPPSLKEQIMSAKYAFYSPYWDEIDDAALHLI
                     SNLLVLDPENRYDVDAAAAHPWLDSVSHLDVSHNLKRLQIDENRMPKTYSELSSLH"
     gene            complement(<812163..>815453)
                     /locus_tag="CAGL0L07348g"
                     /db_xref="GeneID:2890985"
     mRNA            complement(<812163..>815453)
                     /locus_tag="CAGL0L07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449097.1"
                     /db_xref="GeneID:2890985"
     CDS             complement(812163..815453)
                     /locus_tag="CAGL0L07348g"
                     /note="highly similar to uniprot|P15436 Saccharomyces
                     cerevisiae YDL102w CDC2 DNA-directed DNA polymerase delta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449097.1"
                     /db_xref="GeneID:2890985"
                     /db_xref="GOA:Q6FKZ7"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ7"
                     /translation="MTTTLKRPGDEEPLDGEVLLHEKKMKVQSQDHSAGSEPVSTIEI
                     IPTQNFTKFKQKGYKAAGADKEGKQMESIFERELSLMEHEAALKDETDTSNYNRKLIA
                     EDFNPETHDISFQQIEAEQATINGFKDENTSAVVRLFGVTSEGHSILCNVTGFKHYLY
                     VPAPNSANAQDPQELQKFISYVNQMYENAIDSIEVVKRQSIWGYSGDTMLPFWKVYTT
                     HPSATNKLRTAFEKGHFNYNSWFANGTTTYDNIAYTLRLMVDCKIVGMSWVTLPKGKY
                     NVVSDSQKVSTCQLEVTINYRNLISHPAEGEWSHTAPLRILSFDIECAGRPGIFPEPE
                     HDRVIQIANVVNTVGEKKPFIRNVFTLDTCAPITGSQVFDNETEEDLLRKWRDFIIQV
                     DPDVIIGYNTTNFDIPYLLNRAKALKIENFPYFGRLKNVKQEIKESIFSSKAYGTRET
                     KNVNIDGRLQLDLLQFVQREYKLRSYTLNAVSANFLGEQKEDVHHSIITDLQNGDRET
                     RRRLAVYCLKDAYLPLRLLEKLMALVNYTEMARVTGIPFSYLLARGQQIKVVSQLFRK
                     CLEIDTVIPNMHSHGSDEQYEGATVIEPIRGYYDVPIATLDFNSLYPSIMMAHNLCYT
                     TLCNKATVDRLNLKKEEDYIITPNGDYFVTTKKRRGILPIILDELISARKRAKKDLRD
                     ETDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGRVMIMETKKA
                     VEEKYSIKNGAKHDAVVIYGDTDSVMVKFGTTDLKEAMELGAEAAAFVSKLFKHPINL
                     EFEKAYFPYLLINKKRYAGLYWTNPDKYDKLDQKGLASVRRDSCSLVSIIMNKVLKKI
                     LIDRDVDSALGFVKATIDDILQNRVDISKLIISKTLAPNYTNPQPHAVLAERMKKRDG
                     SGPNIGDRVDYVITGGGDKLYNRAEDPLYVLEHNIQIDSRYYLTNQLQNPIISIVAPI
                     IGDKQATSMFTIKSIKINTGNTKGGLMGFIKKVEACKGCRSPLKKGEGPLCSNCKSRS
                     SELYIKALYEVRELEEKYARLWTECQRCAGTLHNEVLCSNKNCDTFYMRVKVKKELQE
                     KVEQLSKW"
     gene            <815818..>817236
                     /locus_tag="CAGL0L07370g"
                     /db_xref="GeneID:2890986"
     mRNA            <815818..>817236
                     /locus_tag="CAGL0L07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449098.1"
                     /db_xref="GeneID:2890986"
     CDS             815818..817236
                     /locus_tag="CAGL0L07370g"
                     /inference="similar to AA sequence:UniProtKB:P43123"
                     /note="similar to uniprot|P43123 Saccharomyces cerevisiae
                     YDL103c QRI1 UDP-N-acetylglucosamine pyrophosphorylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449098.1"
                     /db_xref="GeneID:2890986"
                     /db_xref="GOA:Q6FKZ6"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ6"
                     /translation="MGVCEQYKTAGQDQLFEHFESLEKNEQQTLLDNLEKVANRVSPE
                     KLVSDCKKAIQLAEENSKAGSHIQPLPSSSYESIIDNREAETRYFNKGVESLERSEVG
                     VILLAGGQGTRLGSSAPKGCYDIGLPSGKSLFQIQAERIYRLQKLVGKNCKIPWYIMT
                     SEPTRNATEQFFKENNYFGLNHGDITFFNQGTLPAFDLKGEKLLLGSPTSLVQSPDGN
                     GGLYRAIKENNLVDDFNKRGIKHLYMYCVDNVLSLAADPTFIGYAIEHKFELATKAVR
                     KRDAHESVGLIATKDKRPCVIEYSEISKELAEATDNQGLLKLRAANIVNHYYSVNLLE
                     RELDNWCDNMSYHIAKKKIPIYNNKTGEFEKPETPNGIKLEQFIFDVFPTIPMEKFGC
                     LEVQRSKEFSPLKNGPGSANDNPETSRTAYLKLGTSWLRSAGAVIDDNILVEVSSATT
                     YKGENLSQFKGYKFDKNNSYVE"
     gene            <817664..>818851
                     /locus_tag="CAGL0L07392g"
                     /db_xref="GeneID:2890987"
     mRNA            <817664..>818851
                     /locus_tag="CAGL0L07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449099.1"
                     /db_xref="GeneID:2890987"
     CDS             817664..818851
                     /locus_tag="CAGL0L07392g"
                     /inference="similar to AA sequence:UniProtKB:P43122"
                     /note="similar to uniprot|P43122 Saccharomyces cerevisiae
                     YDL104c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449099.1"
                     /db_xref="GeneID:2890987"
                     /db_xref="GOA:Q6FKZ5"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ5"
                     /translation="MMLSTSWRSTGNLTRSLPLRINRFYKVLAIETSCDDTCVSILDR
                     FAETQPPRVLVNLKSTLNSSEYGGIIPTMAHEHHQMKIGSLVQEALTAHKCTSPKENP
                     SIDLICVTRGPGMTGSLSAGLTFAKGLSVGLNKPLIGVHHMLGHLLIPRMASNGSAPE
                     YPFISLLVSGGHSMLVLSESIDKHEILCNTLDIAIGDSLDKCGRELGFKGNMIAKEMD
                     AFINEDKNDVDHNCILEKLPNPLHGPNNAHVQAFSFSPFVSVIKDNIQNYNNLTDAQL
                     RSMSIQIQNAVFKHLITKIQYVVKKNADKLKNVTGFVCSGGVSGNPTLRETLERELAS
                     RFQNFYYPRNDLCTDNSIMIGWAGIEIYEKLGLISDYSITPIRQWPMNELLTVSGWKK
                     RIL"
     gene            complement(<818968..>820047)
                     /locus_tag="CAGL0L07414g"
                     /db_xref="GeneID:2890988"
     mRNA            complement(<818968..>820047)
                     /locus_tag="CAGL0L07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449100.1"
                     /db_xref="GeneID:2890988"
     CDS             complement(818968..820047)
                     /locus_tag="CAGL0L07414g"
                     /inference="similar to AA sequence:UniProtKB:P43124"
                     /note="similar to uniprot|P43124 Saccharomyces cerevisiae
                     YDL105w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449100.1"
                     /db_xref="GeneID:2890988"
                     /db_xref="GOA:Q6FKZ4"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ4"
                     /translation="MESEHEVQQLYRDIQNEITVLKTRLSKGGDVAVAQDVYKRAEAL
                     FPKVSSLKNNRLFAQDARVVADLSELTQICIRNLDFDDEFSLVSLDDVVQYSKAYMLR
                     DYLQLSGVEVKTEKTFDLSADSDGTGGGTVEGGNDAGGETSDAAPQRPEHISEMLQIN
                     KKRKVLRQYDQYTHFTQFNWYRMGTLFNKVSKLPPTTDHLLGPFGFERKKRVLKERAA
                     RDGLAEKSTAENLSKETLTSGQEITTPEQVQRCFKILKRKNGMNSINLFQFVLDPNSY
                     SKSVENLFYTSFLLKENKLQMTEGNDGMPEIAIYKHSKDRTNDNNDGQRGRGDHQNHI
                     IFQLDMPTWQKLVAKLGIKEPFLDY"
     gene            <820507..>822054
                     /locus_tag="CAGL0L07436g"
                     /db_xref="GeneID:2890989"
     mRNA            <820507..>822054
                     /locus_tag="CAGL0L07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449101.1"
                     /db_xref="GeneID:2890989"
     CDS             820507..822054
                     /locus_tag="CAGL0L07436g"
                     /inference="similar to AA sequence:UniProtKB:P07269"
                     /note="similar to uniprot|P07269 Saccharomyces cerevisiae
                     YDL106c GRF10 homeodomain protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449101.1"
                     /db_xref="GeneID:2890989"
                     /db_xref="GOA:Q6FKZ3"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ3"
                     /translation="MDGHTKSKRTRAKGESLDILKSSFQLNPNPSLQERNRISELTGM
                     PEKNVRIWFQNRRAKVRKKGKLDGDKPKLHDGESRVVSGTGAGAGTATAGPGAGAGVT
                     RTQGTATRTTATTDVTTVDTSGPPYFDKLPLNINNNYYFIDVFSITVGSWNRMKSGSL
                     TANSLPVVKDLPNLSPVSMNQLMSDATDLMVVISKKNFEINYFFSAMANNTKILFRIF
                     FRINTVASCSLSFDKTDEEINNRTDPANKQAELKLKVNKPPKFAVYFLNQPENNNTNQ
                     WCLCEDFSEGKQVNDAFVGGSNVPHVLKGLESSLKILNSLILDYISTNDTITSAPLPP
                     PPTNVGSDILHPQMHPAPHGLMAYNAGMSGQMAPSSHTSETLHSIANAGGSISPPGFG
                     GPYAALPHIQPQPSVDSTYFFNQYNPQPVAHEHIMSGPETISTYDGHTILQHPPAMQG
                     MIQANHNPIINSAYAHNPMDNMLVGVPSVNNSESMLTFTNESGMTNNIPEFLRNPSEV
                     NEDNRWI"
     gene            complement(<822605..>823699)
                     /locus_tag="CAGL0L07458g"
                     /db_xref="GeneID:2890990"
     mRNA            complement(<822605..>823699)
                     /locus_tag="CAGL0L07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449102.1"
                     /db_xref="GeneID:2890990"
     CDS             complement(822605..823699)
                     /locus_tag="CAGL0L07458g"
                     /inference="similar to AA sequence:UniProtKB:P38241"
                     /note="similar to uniprot|P38241 Saccharomyces cerevisiae
                     YBR065c ECM2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449102.1"
                     /db_xref="GeneID:2890990"
                     /db_xref="GOA:Q6FKZ2"
                     /translation="MNKLILGSEEVPQICEKCLGTSNTNENIRMNEVPNGAACKICTL
                     PYTLYHFKKSHRSADIIKTLICKKCAIQRNVCQCCMLDMKLHISIQLRDKLMSIVSGK
                     ETITEEAKNIMMKKFIAMKGGSLGSADLTRNVDSIEDILLNLREKLEGKPLNDENEPI
                     SALQNKELGDNPHLKSVDIQPYWDKFPLQETFPNAIQIPKGNDSFKSFFIYNIDSSVP
                     EWKISDKITELLGSDSWKTKESIPIIINHKAMCGAFRIGNNELSEKFLQTINNSDNMI
                     RINRSNGLRRGILKVDHFQLFIIPWKQGFSVESFGRTPNESKKIAFALREIIVEEMGG
                     FKDKNDRCKAKEKPKKITKKSKKRVKSIKI"
     gene            complement(<824237..>825181)
                     /locus_tag="CAGL0L07480g"
                     /db_xref="GeneID:2890991"
     mRNA            complement(<824237..>825181)
                     /locus_tag="CAGL0L07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449103.1"
                     /db_xref="GeneID:2890991"
     CDS             complement(824237..825181)
                     /locus_tag="CAGL0L07480g"
                     /note="some similarities with uniprot|P38082 Saccharomyces
                     cerevisiae YBR066c NRG2 or uniprot|Q03125 Saccharomyces
                     cerevisiae YDR043c NRG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449103.1"
                     /db_xref="GeneID:2890991"
                     /db_xref="GOA:Q6FKZ1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ1"
                     /translation="MYLTAPMYSPSATSTMNIQKVVSQLNVNEQNNILLPSLATCGTH
                     LKSNTDDDMKLLLNKFAFHNSNYFLQPTIHTSNSSSASSTAVSSPVVAPMLQNSLPSP
                     SLSPQQFKLDSESPNNIVPPKIVVEEADQIQESPKPKRVKRRTKSASSMKKAPIKVVF
                     DSSNSHNMSTEAIVNGVPSPATSPKPKRKNSTGTMSRSPFKTFNGCLNVNGKQDKKVL
                     LGHISKPSNKVYSNRSSVIKLKDNTQKIEQRRKHICQICLTGFTTSGHLSRHAKIHTG
                     EKSHVCPHEGCNQSFSRHDNCLQHYRTHSKKKEQSQSP"
     gene            complement(<828380..>829066)
                     /locus_tag="CAGL0L07502g"
                     /db_xref="GeneID:2890992"
     mRNA            complement(<828380..>829066)
                     /locus_tag="CAGL0L07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449104.1"
                     /db_xref="GeneID:2890992"
     CDS             complement(828380..829066)
                     /locus_tag="CAGL0L07502g"
                     /inference="similar to AA sequence:UniProtKB:P33890"
                     /note="similar to uniprot|P33890 Saccharomyces cerevisiae
                     YOR010c TIR2 or uniprot|P27654 Saccharomyces cerevisiae
                     YBR067c TIP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449104.1"
                     /db_xref="GeneID:2890992"
                     /db_xref="GOA:Q6FKZ0"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:Q6FKZ0"
                     /translation="MSKFAVLIAAIAATLVNAQNAVEVAEIQVLVNDINSNLAQYLSL
                     ETNPDSGFQIPDNLLSLYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWYSSRLLPA
                     LESASSAAAGSGDAAAAPASANASSVSAAVTSLSSAINSTSSASASATGAVVTSANLT
                     SVSANSTRSGSRSATRSASATGGVAGGNRTNGSTNGTKTSSTKSKNGVAKVEAGLAGA
                     LLAGAAAMLL"
     gene            complement(<833821..>835725)
                     /locus_tag="CAGL0L07546g"
                     /db_xref="GeneID:2890994"
     mRNA            complement(<833821..>835725)
                     /locus_tag="CAGL0L07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449106.1"
                     /db_xref="GeneID:2890994"
     CDS             complement(833821..835725)
                     /locus_tag="CAGL0L07546g"
                     /note="highly similar to uniprot|P38084 Saccharomyces
                     cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
                     cerevisiae YDR046c PAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449106.1"
                     /db_xref="GeneID:2890994"
                     /db_xref="GOA:Q6FKY8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY8"
                     /translation="MFSKVKNYGSSSKKESTAEEFTIPEYSRDDGEKYAGNSNDYSQR
                     DSDNTSIESEPRTKLVHRFVDSFKRAQDVPTGRKSKEIGNNGGSKTKGGFEEDSLDLE
                     GSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLV
                     SFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELI
                     TASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFII
                     MSIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFAL
                     SVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPY
                     VLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQ
                     GRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAM
                     KLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANY
                     LAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGS
                     FMMRMYHFWC"
     gene            complement(<837393..>837713)
                     /locus_tag="CAGL0L07568g"
                     /db_xref="GeneID:2890995"
     mRNA            complement(<837393..>837713)
                     /locus_tag="CAGL0L07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449107.1"
                     /db_xref="GeneID:2890995"
     CDS             complement(837393..837713)
                     /locus_tag="CAGL0L07568g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449107.1"
                     /db_xref="GeneID:2890995"
                     /db_xref="GOA:Q6FKY7"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY7"
                     /translation="MFLATVNHMVDCAIGVGGKPGSRTEGSTSVEMPTTEDGTGICGM
                     GSGEIMLNNGPEIFVTSETLVQGDTFFSYLYRRSFYEIKESRRSHFPKTYQIGTDNSF
                     CIMF"
     gene            complement(<838293..>838499)
                     /locus_tag="CAGL0L07590g"
                     /db_xref="GeneID:2890996"
     mRNA            complement(<838293..>838499)
                     /locus_tag="CAGL0L07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449108.1"
                     /db_xref="GeneID:2890996"
     CDS             complement(838293..838499)
                     /locus_tag="CAGL0L07590g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449108.1"
                     /db_xref="GeneID:2890996"
                     /db_xref="GOA:Q6FKY6"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY6"
                     /translation="MISRRDTVTFQRSRAPSPCSLYDIKEKEESTTVVTEIKEMEKPA
                     VHLYNIFSIPMKRIPETEDSPSNK"
     gene            840211..840283
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0L07612r"
                     /db_xref="GeneID:2890997"
     tRNA            840211..840283
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0L07612r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2890997"
     gene            complement(<840409..>843801)
                     /locus_tag="CAGL0L07634g"
                     /db_xref="GeneID:2890998"
     mRNA            complement(<840409..>843801)
                     /locus_tag="CAGL0L07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449109.1"
                     /db_xref="GeneID:2890998"
     CDS             complement(840409..843801)
                     /locus_tag="CAGL0L07634g"
                     /note="some similarities with uniprot|Q04257 Saccharomyces
                     cerevisiae YML002w and some similarities with
                     uniprot|Q04257 Saccharomyces cerevisiae YML003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449109.1"
                     /db_xref="GeneID:2890998"
                     /db_xref="GOA:Q6FKY5"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY5"
                     /translation="MTTHSNFQLPPLLNPLLNAICNCGEPNSSPLKKLYTQLGKKDKY
                     LILVPPTELLLYYSDKESNSELHDLCYTPNFASAHILLLDATDTEVNNGDEAVLIKNI
                     EKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNNYMKTT
                     DNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYENSKS
                     KATFDSILRVNKHWSSKFEQHFQKFRLLANQDDLPIDVFHNIIEEMHEEMVSDNLFKN
                     IVDLRNIIYEYVELNLFDDIWKMILRMNKEVEIDLNPFGNISIYQVDSEFLSTEYSKF
                     FLENVITAERNIKEASKSLQKIESASNYKSKANILILTLRTLTGNKENDGYSSKNDDG
                     NLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHLSYLQNFYNNDSDTKFGILGYALST
                     LEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSSTKKYETNAALYFLRKYEGSLRY
                     RDSLGQSLLALCIIHGRNDFLYHILNEYETLFPIEDLLADESIDGSTLLIQAVKHDNQ
                     YSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTNELEVLKLMGKYINWVQKDN
                     AGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYGLNGKNFNYLDHVDKKGNTLLHILK
                     CNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLCDPRLRVDITQKNNALT
                     AFDFSKDDEITHLLGEHELLNSPWLAVYAHTLKYTNSRWNLSLTVKLKDAPKTTNFTL
                     KTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFSELMRIKVLEMLPFISFCLSAL
                     VHIKVLDLNVFQTEENAIKWVKMNGSVDKKTNQTSDITPEDISMIQNFLKFNITEIER
                     TKNKLEIAEKLSLFSRLKSKDLLNSNENYVTIVSQLSSKRFRSTLKYSAEDTKLLSVR
                     AEKALLSKITYLKICAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELANV
                     TTENRDLALHRMISNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFI
                     DLKTKFTLEYALQSYLTISKQEHIEKDRLHWEFQENKTVFKQ"
     gene            <845021..>845980
                     /locus_tag="CAGL0L07656g"
                     /db_xref="GeneID:2890999"
     mRNA            <845021..>845980
                     /locus_tag="CAGL0L07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449110.1"
                     /db_xref="GeneID:2890999"
     CDS             845021..845980
                     /locus_tag="CAGL0L07656g"
                     /note="highly similar to uniprot|P50107 Saccharomyces
                     cerevisiae YML004c GLO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449110.1"
                     /db_xref="GeneID:2890999"
                     /db_xref="GOA:Q6FKY4"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY4"
                     /translation="MSYPHKIAAAHDDPTLMFNHTCLRIKDPAKSIPFYQKHFGMELL
                     NKLDFPEMKFSLFFLSFPKDNVAKNSEGKNDVFSTSGILELTHNWGSENDADFKICNG
                     NEEPHRGFGHICFSYADINAACSKLEAEGVSFKKRLTDGRMKDIAFALDPDGYWIELI
                     RYDRENSPKKDVGSRFNHTMVRVKDPKASLEFYQNVLGMKLLRTSEHEAAKFTLYFLG
                     YKVSSEDNEFSHEGVLELTHNWGTENEADFKYHNGNDKPQGYGHICVSCKDPAKLCNE
                     IEQTYGDKIQWAPKFNQGKLKNIAFLKDPDGYSIEVVPHGLIV"
     gene            complement(<846285..>847238)
                     /locus_tag="CAGL0L07678g"
                     /db_xref="GeneID:2891000"
     mRNA            complement(<846285..>847238)
                     /locus_tag="CAGL0L07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449111.1"
                     /db_xref="GeneID:2891000"
     CDS             complement(846285..847238)
                     /locus_tag="CAGL0L07678g"
                     /note="highly similar to uniprot|P41819 Saccharomyces
                     cerevisiae YPL266w DIM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449111.1"
                     /db_xref="GeneID:2891000"
                     /db_xref="GOA:Q6FKY3"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020596"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /translation="MAKADKKKYSGATTNKQVAAEKHLTSVFKFNTDLGQHILKNPLV
                     AQGIVDKAQIKPSDIVLEVGPGTGNLTVRILEQARKVVAVEMDPRMAAELTKRVHGTP
                     AEKKLEIMLGDFMKTELPYFDICISNTPYQISSPLVFKLINQPRPPRVSILMFQREFA
                     MRLLARPGDSLYCRLSANVQMWANVTHIMKVGRNNFRPPPQVESSVVRIEIKNPRPQI
                     DFNEWDGLLRIVFVRKNRTISAGFKSTTVLEILEKNYKTFLAINNQSIDETENLQSLI
                     KQKIETVLKETGLAEKRAGKCDQTDFLKLLYAFHQVGIHFS"
     gene            <847607..>849313
                     /locus_tag="CAGL0L07700g"
                     /db_xref="GeneID:2891001"
     mRNA            <847607..>849313
                     /locus_tag="CAGL0L07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449112.1"
                     /db_xref="GeneID:2891001"
     CDS             847607..849313
                     /locus_tag="CAGL0L07700g"
                     /inference="similar to AA sequence:UniProtKB:P25615"
                     /note="similar to uniprot|P25615 Saccharomyces cerevisiae
                     YCR014c POL4 DNA polymerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449112.1"
                     /db_xref="GeneID:2891001"
                     /db_xref="GOA:Q6FKY2"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY2"
                     /translation="MGILSGKKFLILPNSHTASVNILAGIVKEQGGFLVSSADRLSND
                     VVVLVNDSFVDKTNKIVNRGLFLKEFELDASVVWTYVLENELVCLRVSLVPSWVENGT
                     FHFSDSERIILLDSESQERDTKNVQFHSAGNEEAGSDDETDVEGNKESTGDMTDVSDT
                     ATPQLQSSPLSKYIKQEEDIDNQVLINALGRLVKKYEVKGDQYRSRSYRLAKQAVEKY
                     PHKITSGSQAQRQLSNIGSSIAKKIQLLLDTGTLPGLEDPATDEYESSLGYFSECYGI
                     GVPMAKKWITLNISTFYRAVRLHPKLFISDWPILYGWTYYEDWSKRIPRDEVTAHFEL
                     VKEEVRRVGNGCSVEMQGSYVRGARDTGDVDLMFYKENCDDLEEVTIGMENVAASLYQ
                     KGYIKCFLLLTDKLERMFRPDILSRLQKCGIAEISNEHTFRNSDRGKKLFFGVELPGD
                     YPIYPFDDKDILQLKPQDKFMSKSKDADHFCRRLDFFCCKWSELGAARIHYTGNTDYN
                     RWLRVRAMDMGYKLTQHGIFKDDVLLESFDERKIFEYLHVPYLNPVDRNKTDWVNIPI
                     PK"
     gene            complement(<849743..>850993)
                     /locus_tag="CAGL0L07722g"
                     /db_xref="GeneID:2891002"
     mRNA            complement(<849743..>850993)
                     /locus_tag="CAGL0L07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449113.1"
                     /db_xref="GeneID:2891002"
     CDS             complement(849743..850993)
                     /locus_tag="CAGL0L07722g"
                     /note="highly similar to uniprot|P00560 Saccharomyces
                     cerevisiae YCR012w PGK1 phosphoglycerate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449113.1"
                     /db_xref="GeneID:2891002"
                     /db_xref="GOA:Q6FKY1"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /translation="MSLSSKLTVQDLELKDKRVFIRVDFNVPLDGKKITSNQRIVAAL
                     PTIKYVLEHNPRYVVLASHLGRPNGERNEKYSLAPVAEELQSLLGKPVTFLNDCVGSE
                     VDSAVKASAPGSVILLENLRYHIEEEGSRKVDGQKVKASAEDVAKFRKELCSLADVYI
                     NDAFGTAHRAHSSMVGFDLPQRAAGFLLTKELQYFGKALENPTRPFLAILGGAKVADK
                     IQLIDNLLDKVDSIIIGGGMAFTFKKVLENAEIGDSIFDKAGAEIVPKLMEKAKAKGV
                     EVVLPVDFVIADAFSADANTKIVSDKEGIPAGWQGLDNGPESRKLFAATIAKAKTIVW
                     NGPPGVFEFEKFASGTKAMLDEVVKSSTSGNTVIIGGGDTATVAKKYGVTDKISHVST
                     GGGASLELLEGKELPGVAFLSEKN"
     gene            <851958..>855125
                     /locus_tag="CAGL0L07744g"
                     /db_xref="GeneID:2891003"
     mRNA            <851958..>855125
                     /locus_tag="CAGL0L07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449114.1"
                     /db_xref="GeneID:2891003"
     CDS             851958..855125
                     /locus_tag="CAGL0L07744g"
                     /inference="similar to AA sequence:UniProtKB:P25371"
                     /note="similar to uniprot|P25371 Saccharomyces cerevisiae
                     YCR011c ADP1 ATP-dependent permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449114.1"
                     /db_xref="GeneID:2891003"
                     /db_xref="GOA:Q6FKY0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKY0"
                     /translation="MAKWPSYSGNQIYVPDTSVPDTSVPDSCPPCFNCMLPMFACSQF
                     SECDSYTGQCECIPGFGGLNCSDALCGALDLPNRDRPPRAQNLTYGRDNSCACADGWG
                     GINCNLCQRDDVCDSFMPDSSLKGTCYRGGALVHKVFQGCDVTNEKILQVLHGQKPQV
                     TFSCDRAKEECNFQFWVDQIESFYCGLDNCTFEHNINDNTTHYKCANAQCKCVPGTLL
                     CGLKGSIDISEFLTETITGPADFACERDQASDKIVQNCKFSEPSMNDLISTVFGDRYI
                     TLSCNSGECVHHSEIPGYKIPSRSPDMTLKGRLMLAFTSLVVLVGVSFVAWYVSQSPL
                     FKAGSIQLLNADSLLVNGSADETENFLQSSKSATLTFENINYYVAASANSRSDEKQRV
                     LNDISGLVKPGEILSIMGGSGAGKTTLLDILAMKRKTGDVSGSIRVNGKVVSRKDYTK
                     LIGFVDQDDYLLPTLTVYETVLNSALLRLPRTMSFEAKQARVFHVLEELRIMDIKDRI
                     VGNDFERGISGGEKRRVSIACELVTSPLVLFLDEPTSGLDANNANNVIECLVRLARNY
                     DRTLVMSIHQPRSNIFYRFDKLVLLSRGELVYSGEALRVNEFLKNNGYQCPSNYNIAD
                     YLIDITFESGDKKKKKSKASHILSEILPDLEVGTPANEDGHDHAAEILGGGDDRSGSI
                     STATQREWEHYATHREEISTLLRHETEENLENEIQSAGDLNTIILSKKFKDGQYYGEL
                     KFNIEEIKREANPTGETNTTSETSSTSFEIPTTLKAASFSEQLSILCSRSFKNIYRNP
                     KLLLGNYLLTVLLGVFLGVLYYKVENDISGFQNRMGLFFFILTYFGFVTFTGLSSFAL
                     ERIIFLKERSNNYYSPLAYYGSKILVDVIPLRVIPPILLCMIVYPLVGLNMRDDAFFK
                     CIGILVLFNLAISMEILTIGIIFEDLNNSIVISVLVLLASLLFSGLFINTKDITNMAF
                     KYLKNFSVFYYAYEALLINEVKTLMLRERKYGLNIEVPGAIILSTFGFQVQNLVFDIK
                     TLALFNAIFLVLGYLALKLIVVEQK"
     gene            <856627..>857475
                     /locus_tag="CAGL0L07766g"
                     /db_xref="GeneID:2891004"
     mRNA            <856627..>857475
                     /locus_tag="CAGL0L07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449115.1"
                     /db_xref="GeneID:2891004"
     CDS             856627..857475
                     /locus_tag="CAGL0L07766g"
                     /note="some similarities with uniprot|P25613 Saccharomyces
                     cerevisiae YCR010c or uniprot|P32907 Saccharomyces
                     cerevisiae YNR002c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449115.1"
                     /db_xref="GeneID:2891004"
                     /db_xref="GOA:Q6FKX9"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX9"
                     /translation="MTTGTGTTVGGGSSHHEEGRSIYSNNTAPYNAQDCNSEGSIGRI
                     YTTADNEKYIYIGRQRFLISDLYDAFGGTLNPGLAPPSSHKFGNPAPLGLSAFALTTF
                     ILSMFNARAQGVVIPNVVVGPAAFYGGLVQLVAGIWEIALENTFGGLALSSFGGFWMS
                     FAAIYIPWFGILEAYEGHEDQLRSALGFYLLGWSIFTFGLTLCTMKSTVAFFALFFLL
                     AVTFLLLSIGNFANNEGCTRAGGVVGVVVAFIAWYDAYAGVATKHNTYFIVKKIPLPT
                     NEKVFF"
     gene            <858202..>858999
                     /locus_tag="CAGL0L07788g"
                     /db_xref="GeneID:2891005"
     mRNA            <858202..>858999
                     /locus_tag="CAGL0L07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449116.1"
                     /db_xref="GeneID:2891005"
     CDS             858202..858999
                     /locus_tag="CAGL0L07788g"
                     /note="highly similar to uniprot|P25343 Saccharomyces
                     cerevisiae YCR009c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449116.1"
                     /db_xref="GeneID:2891005"
                     /db_xref="GOA:Q6FKX8"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX8"
                     /translation="MSWEGFKKAINRAGNSVIIKNVDKTIDKEYDMEERRFRVLQKAG
                     ESLQKEAKGYLDSLRAVTASQVTIAEVISNLYDDSKYISGGGYNVGNYYLQCVQDFDT
                     ETVKQLDGPFRETVLDPVTKFATYFKEIDEAIKKREHKKKDYDAAKAKVRRMIDKPAK
                     DASKLPRAEKEMALAKDIYENLNNQLKTELPQLVSLRVPYFDPSFEALVKIQLRFCTD
                     GYTRLAQIQQYLDQQSRDDYANGLLDDKIEELLHQMMGLDICALGLK"
     gene            complement(<859653..>861443)
                     /locus_tag="CAGL0L07810g"
                     /db_xref="GeneID:2891006"
     mRNA            complement(<859653..>861443)
                     /locus_tag="CAGL0L07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449117.1"
                     /db_xref="GeneID:2891006"
     CDS             complement(859653..861443)
                     /locus_tag="CAGL0L07810g"
                     /inference="similar to AA sequence:UniProtKB:P25333"
                     /note="similar to uniprot|P25333 Saccharomyces cerevisiae
                     YCR008w SAT4 serine/threonine-specific protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449117.1"
                     /db_xref="GeneID:2891006"
                     /db_xref="GOA:Q6FKX7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX7"
                     /translation="MSNNNSSISNKVINLFRSGSKSSKAVKPTDKTAIKQNAKPTVAA
                     ITTRISSETGEGSSPPRSGSSESILSSDIHKQKSSPTTRSSSSLALDNSAAVSNTVQA
                     GAPISANVQASSSTVKLSTMDSSRSESNTHHDNSHSHTNCMRFMVHEDGSHEHHLKNA
                     RRQEKLTSMIKNIMKTNNYSTAQKKLRNEAKSAVPDIITSPVVSTPITPKLQSPLNPS
                     QGGPQYKGPPSLFAGYMKQVVGNDGQVAINGPVSGAFNGDQKVMYQDNETNEDIQQAP
                     LTLPPHFNDSLSFAEKYGSCKEILGKGAFGVVRICHKKVPENPKVEKLYAVKEFKRKA
                     TEPKEKFAKRLTSEFCISSSLHHTNIVDTLDLFQDANGDYCEVMEYCAGGDLFTLIIA
                     AGKLEYMEADCFFKQLLRGVVYMHDMGVCHRDLKPENLILTHDGVLKITDFGNSECFK
                     MAWEEDIHLSGGVCGSSPYIAPEEYVLEEFDPRPVDIWACGVIYMAMRTGRQLWTAAK
                     KDDPFYNKYLQGRRQKSGYEPIESLKRARCRNVIYSMLDPAPHRRINGKQILNSEWGR
                     EIKVCYDKQIAVTSRSDSQQSRVHAPITVK"
     gene            <863297..>864124
                     /locus_tag="CAGL0L07832g"
                     /db_xref="GeneID:2891007"
     mRNA            <863297..>864124
                     /locus_tag="CAGL0L07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449118.1"
                     /db_xref="GeneID:2891007"
     CDS             863297..864124
                     /locus_tag="CAGL0L07832g"
                     /inference="similar to AA sequence:UniProtKB:P25617"
                     /note="similar to uniprot|P25617 Saccharomyces cerevisiae
                     YCR016w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449118.1"
                     /db_xref="GeneID:2891007"
                     /db_xref="GOA:Q6FKX6"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX6"
                     /translation="MDHVPAWKRFAIKNKNEGKREIEDDPLNVTTHLATGSLTKKQKK
                     SILNGTDNDLPKKVKNKDKKQKKAKLPREERLEKKQRVLKDQLRYLIEFYLKDSDELP
                     DKLYQLESIRSNYDENDIKSKKDESAVVDVWKFSKQKQNWLLKHFHNFDEIPAEYDEL
                     LLNYFKDMKGRSKYELIKLCNEKLETWNKYIAEQEEKMQKIINGEENEDNKNVEQNEE
                     NKEDEEQKHKVEELPMPNKAVICRSYKLLSLWEKNKNEDEQDFEVVILQKFPEEDLK"
     gene            complement(<864319..>867249)
                     /locus_tag="CAGL0L07854g"
                     /db_xref="GeneID:2891008"
     mRNA            complement(<864319..>867249)
                     /locus_tag="CAGL0L07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449119.1"
                     /db_xref="GeneID:2891008"
     CDS             complement(864319..867249)
                     /locus_tag="CAGL0L07854g"
                     /inference="similar to AA sequence:UniProtKB:P25618"
                     /note="similar to uniprot|P25618 Saccharomyces cerevisiae
                     YCR017c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449119.1"
                     /db_xref="GeneID:2891008"
                     /db_xref="GOA:Q6FKX5"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX5"
                     /translation="MVELNAKLIVAAHTVCAASAFLAALVTGYNLHFHKIVENAHYGY
                     PDEWFPSVSATIGDRYPERSIFQILIALTAFPRFLLLLSHYYINGSLTTFIIGTARTV
                     TCGGWVYITSTDDHDIHDIFMIAYIILTLPWYILVTKHSNYKQAKTIVGTTFFSTLVP
                     MIYWYIQHQVHHVAGAYSIYAYFEWSLIILDITFDATAYKDFKKLTFTLKHDANEAGK
                     WFFKINNQQNDTMKNETIVEIDDEKIERPIEAEVELDEIIRAKGIAAIEDHLISPKIF
                     TYDSFVYITVNIIESFIFWSNLTSLTCSVWHFPLWYMGISGYEAAILGFMGPAILAIP
                     YMSSAVTQYGALLGGLITIGAYLIDTPEPRLITICVGTIFSMATFAQYLRKLTNAQLN
                     FSFAITWSLGLIFTLIIKMWFFSNNPTWAIMKEETGGYNKTAIVISTVIGMIYPYINS
                     IHMKQEKPMVSGCFFKKFMLATGFGGLIFSIHQSLTDASTLIYWSWEGYSKENQGPLA
                     WPWASLTIVVMLFGALTSLKFINRPVFPSLLLIIGTIVLSIRSITGWNKFIFGGLFYA
                     LSIMWLIPTYVSALGYLGSTWVFTLAFFYHVIGILAHVWVVAYAFVPMGWILRERIEV
                     VLSIATGMVILGALSVSNSFFLPKSISFTKKFGTYLTLYAFAALALTSYCTYDLRPTG
                     VPTPYHPDKKLITAGIWTIHFGLDNDMWASEERMIELIKDLEIDVVGLLETDTQRITM
                     GNRDLTRKMAYELNMYADFGPGPNKHTWGCVLLSKFPILNSTHHLLPSPVGELAPAIH
                     ATLKTYDDVLVDVIVFHSGQEEDEEDRRLQSQYLAKLMGSTNRPTFLLSYLVTDPHEG
                     NYNTYVSELSGMHDIDPSDDDRWCEYILYKNIKRTGYARVSRGTITDTELQVGKFQVL
                     NDRELLEANDSLYTDEYTEEIDDDGFKFPSMFEGEGERDHFYHVFDRPRYFGFKKDEE
                     QNDE"
     gene            868116..868188
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L07876r"
                     /db_xref="GeneID:2891009"
     tRNA            868116..868188
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L07876r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2891009"
     gene            <868378..>869430
                     /locus_tag="CAGL0L07898g"
                     /db_xref="GeneID:2891010"
     mRNA            <868378..>869430
                     /locus_tag="CAGL0L07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449120.1"
                     /db_xref="GeneID:2891010"
     CDS             868378..869430
                     /locus_tag="CAGL0L07898g"
                     /inference="similar to AA sequence:UniProtKB:P23060"
                     /note="similar to uniprot|P23060 Saccharomyces cerevisiae
                     YCR019w MAK32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449120.1"
                     /db_xref="GeneID:2891010"
                     /db_xref="GOA:Q6FKX4"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX4"
                     /translation="MITTNGMFILDDIEGKVTYNGIPGGGGTYAVLGAAICTPSAHVR
                     SQVLWIVDGGHDFPDSIRQTFDQWGVTTKYRIDSNRETIRGLNYYPNLEAEGKDRDLR
                     LFKFLTPKIQINVEDWVGTFGEDKVREDINCFHLVCSAERCLAIINDLKVIKSNPNMG
                     YTIVWEPLPSLCDNDHIEDFKKVFQSEIPIIFSPNAEEASRLLTNNSEEPSTLEQCTE
                     LLNSIYQLADGNQVIIRCGKLGSVTRSPIDGKLLHYPAYHSKTPDKVIDPTGGGNTYL
                     GGFAQIYETTKDYHIANICANVAASFAIEQVGIPEYKKNENTWNGTTFVDRLTSYLQG
                     NDYKATIEEIIRKIEK"
     gene            complement(<869521..>870174)
                     /locus_tag="CAGL0L07920g"
                     /db_xref="GeneID:2891011"
     mRNA            complement(<869521..>870174)
                     /locus_tag="CAGL0L07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449121.1"
                     /db_xref="GeneID:2891011"
     CDS             complement(869521..870174)
                     /locus_tag="CAGL0L07920g"
                     /inference="similar to AA sequence:UniProtKB:P25362"
                     /note="similar to uniprot|P25362 Saccharomyces cerevisiae
                     YCR020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449121.1"
                     /db_xref="GeneID:2891011"
                     /db_xref="GOA:Q6FKX3"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX3"
                     /translation="MSESTSQILLDKYADLYKRTVTHPLPKELCEGTLQDRALYIYLT
                     QDLEFFETGLRLICRVTSMCPEVPSLITLAKKIGFFASDENDYFRKCLSFLESELDKD
                     TVKEIKDKKIIPGVDAYIDYLVELTKDQRYDYPALISYLWCAEQCYLDWAHGLPKKEG
                     LHWKHQTWIDLHDGEHFITWCEFLRAEVDKFSVRQVEEVFAKTLQHEFNFFDSCYKA"
     gene            complement(<870612..>870890)
                     /locus_tag="CAGL0L07942g"
                     /db_xref="GeneID:2891012"
     mRNA            complement(<870612..>870890)
                     /locus_tag="CAGL0L07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449122.1"
                     /db_xref="GeneID:2891012"
     CDS             complement(870612..870890)
                     /locus_tag="CAGL0L07942g"
                     /inference="similar to AA sequence:UniProtKB:P23059"
                     /note="similar to uniprot|P23059 Saccharomyces cerevisiae
                     YCR020ca MAK31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449122.1"
                     /db_xref="GeneID:2891012"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX2"
                     /translation="MEYKDLLRVSDFIGSTLFIEIDDDRSLQGILVAVDCQMNLLLDH
                     VHEHTKSIGSRTLGLVSVPQYTIKNIKISQAKFNALVDFKKELQRNIV"
     gene            871816..871887
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0L07964r"
                     /db_xref="GeneID:2891013"
     tRNA            871816..871887
                     /gene="tRNA-Gln (TTG)"
                     /locus_tag="CAGL0L07964r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2891013"
     gene            <872205..>874139
                     /locus_tag="CAGL0L07986g"
                     /db_xref="GeneID:2891014"
     mRNA            <872205..>874139
                     /locus_tag="CAGL0L07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449123.1"
                     /db_xref="GeneID:2891014"
     CDS             872205..874139
                     /locus_tag="CAGL0L07986g"
                     /inference="similar to AA sequence:UniProtKB:P25353"
                     /note="similar to uniprot|P25353 Saccharomyces cerevisiae
                     YCR026c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449123.1"
                     /db_xref="GeneID:2891014"
                     /db_xref="GOA:Q6FKX1"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024873"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX1"
                     /translation="MEEGRAASIRSEDFEIEDPLEDDHLMNTDDALNDQKGIWSRITE
                     WQYRDQADTEANTGAKRIPWYARYFVRNLEEIERRGVPLYELDHEGNLRHVDRDEYIS
                     ETRWFNQMTGDWLNTSKYYDSLRLTRGMKKLAVLLLTIVILSFLWMKVLTSTNNDNPD
                     LNRHHQFTEFDPFITYSNGTHEFNPLNIVISLSGFYPGLISDERTPFISALFKREHNE
                     ILKQNITTSPYMRPQFPLQSIPNMWTMVTGLYPSMHKMIANSFWDSKNEVEYRPGIID
                     PRVWVNNSEPIWETVQRAYNHDDNMNFKVYANMWPGSDVNYTSLNYIKLERQPYYMDV
                     FDAQETMETKKSKIFNYIDTEDITQRPQMILSVVNDLDTFGHLHGYPIDRDSPHKVEF
                     LDKLKSVDQFINDTFAGLHERNMSAFTNILLVSNHGMADINFDNNVTIWEDLIHNERE
                     YLRENDVISHMYMEGASLGIYVREAAHINPVYKIIKKHIDLERYNVFLAGNFPKEWNY
                     DSINKDLGRGPTTNADTGTADTGTAQLKGRLPTIWIVPKIGNSIMLKEKYDIIAKKAK
                     KEKKKYHGDTGPYVIGSHTFSEVDDARLQALFIATGPYFKDQEIGPINNLDIYNLLCD
                     INGVSIRDRNPNNGTTSIYS"
     gene            <875742..>875861
                     /locus_tag="CAGL0L08008g"
                     /db_xref="GeneID:2890550"
     mRNA            <875742..>875861
                     /locus_tag="CAGL0L08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449124.2"
                     /db_xref="GeneID:2890550"
     CDS             875742..875861
                     /locus_tag="CAGL0L08008g"
                     /note="highly similar to uniprot|P40975 Saccharomyces
                     cerevisiae YEL017ca PMP2 plasma membrane ATPase
                     proteolipid 2 or uniprot|P32903 Saccharomyces cerevisiae
                     YCR024ca PMP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449124.2"
                     /db_xref="GeneID:2890550"
                     /db_xref="GOA:Q6FKX0"
                     /db_xref="InterPro:IPR012589"
                     /db_xref="UniProtKB/TrEMBL:Q6FKX0"
                     /translation="MLPGGVILVFILVGLAACAIVAVIIYRKWQERQRSLQRF"
     gene            <877103..>878506
                     /locus_tag="CAGL0L08030g"
                     /db_xref="GeneID:2890551"
     mRNA            <877103..>878506
                     /locus_tag="CAGL0L08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449125.1"
                     /db_xref="GeneID:2890551"
     CDS             877103..878506
                     /locus_tag="CAGL0L08030g"
                     /inference="similar to AA sequence:UniProtKB:P25345"
                     /note="similar to uniprot|P25345 Saccharomyces cerevisiae
                     YCR024c asn-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449125.1"
                     /db_xref="GeneID:2890551"
                     /db_xref="GOA:Q6FKW9"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW9"
                     /translation="MIRYIAKRHVSIKTLYDSVPKDGQKLDMVNGWVRSVRLMKKVAF
                     VDLYDGSSNKDVKIVIKNPQESSLVRHLKTGQCISVDSPLLKITQGSRIQPFELLVED
                     SVKDLKLLGDVETNYPLQKKSHSLEFLRTLPTLKHRSLFYGSILRFRSHMEEYAINFF
                     NKQENFLKVSPPIFTTNDCEGAGEQFEVKSSVLENKKAFLTVSTQLHLEILSMAIANC
                     WTLSPCFRAEKSATPRHLMEFWMLEAEMSFIDNLDQLLDFTRNFLQSMVTQCYENRED
                     LLPDNISTLINKEKILERWQMLRNSENWKRITYTDAIQILKEKHSQEPFPRYKPKWGE
                     ALQTEHEKWLAEKYFQSPVFVTDYPMDCKAFYMKSNEDGKTVACFDLLVPEMGEIIGG
                     SMREDNYESLQYQIKKRGMNNTGELDWYVNLRKQGVAPHGGFGLGFERFISYLLGIQN
                     IKDTIPFPRSASSSIDL"
     gene            879627..880774
                     /locus_tag="CAGL0L08044r"
                     /db_xref="GeneID:2890552"
     ncRNA           879627..880774
                     /ncRNA_class="snRNA"
                     /locus_tag="CAGL0L08044r"
                     /product="uncharacterized ncRNA"
                     /note="noncoding RNA H1"
                     /transcript_id="XR_002648372.1"
                     /db_xref="GeneID:2890552"
     gene            complement(<880993..>882447)
                     /locus_tag="CAGL0L08052g"
                     /db_xref="GeneID:2890553"
     mRNA            complement(<880993..>882447)
                     /locus_tag="CAGL0L08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449126.1"
                     /db_xref="GeneID:2890553"
     CDS             complement(880993..882447)
                     /locus_tag="CAGL0L08052g"
                     /inference="similar to AA sequence:UniProtKB:P25621"
                     /note="similar to uniprot|P25621 Saccharomyces cerevisiae
                     YCR028c FEN2 high affinity H+/pantothenate symporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449126.1"
                     /db_xref="GeneID:2890553"
                     /db_xref="GOA:Q6FKW8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW8"
                     /translation="MRKEIIEVERTDEFDPESKKEPVNKRWVIAKIDLFVLSFVCLQY
                     WINYVDRIGFTNAYVSGMKADLKMVGKDLSIANTCFTVGYVVGMIPHNLILLKVPPRI
                     WLSFCTFAWGILTLGMYHVTHFHQVCVLRFFQALFESCTFSGTHLILGSWYLEKELPI
                     RSAIFTSSGLVGSMFSGFMQSSIFHHLNGRNGLAGWRWLFIIDFCITIPIALYGLLFF
                     PGMPESTNDNSRLSMTKVIFNEHELQYARRRLPPRDETTSLDRSVVFRVLKRWHWWMF
                     SLVWVLGGENLSFASNATFAQWLQHQQYSITHRNNYPSGIYAVGIVSTVASAVYMTKF
                     RKARNWHIAVVIAVVMCVVAIMIRVKPMDPHVQFAAQYLGGVAYAGQSVFFSWANVVC
                     RDDLQERAIVLASMNMFSGAVNAWWSILFYSSAMVPKFQRGCYALIATSVASGIVSIL
                     IRSLHIRSQDKKKEIGYIDANDIYDDEDDEEADI"
     gene            complement(<882891..>883439)
                     /locus_tag="CAGL0L08068g"
                     /db_xref="GeneID:9488044"
     mRNA            complement(join(<882891..883038,883198..>883439))
                     /locus_tag="CAGL0L08068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999547.1"
                     /db_xref="GeneID:9488044"
     CDS             complement(join(882891..883038,883198..883439))
                     /locus_tag="CAGL0L08068g"
                     /inference="similar to AA sequence:UniProtKB:P32445"
                     /note="similar to uniprot|P32445 Saccharomyces cerevisiae
                     YCR028ca RIM1 ssDNA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999593.1"
                     /db_xref="GeneID:9488044"
                     /db_xref="GOA:B4UN50"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR011344"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:B4UN50"
                     /translation="MSMLRQVRQFHATARKLDFSKMSIVGRIGSEFTENTSANNHRYL
                     RYSIASQPRKDGQTNWYNITVFNEPQINFLTQYVRKGALVYVEADAANFTFERQDGTK
                     GTTLSLVQKDFNLLRNGKAEETPEGSS"
     gene            complement(<883836..>886271)
                     /locus_tag="CAGL0L08074g"
                     /db_xref="GeneID:2890554"
     mRNA            complement(<883836..>886271)
                     /locus_tag="CAGL0L08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449127.1"
                     /db_xref="GeneID:2890554"
     CDS             complement(883836..886271)
                     /locus_tag="CAGL0L08074g"
                     /inference="similar to AA sequence:UniProtKB:P25623"
                     /note="similar to uniprot|P25623 Saccharomyces cerevisiae
                     YCR030c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449127.1"
                     /db_xref="GeneID:2890554"
                     /db_xref="GOA:Q6FKW7"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW7"
                     /translation="MTKERTLYADRLLTTKTPFEATEVMRVRLSESKLVSKEFLELFA
                     EVSKIKRSYVQKLNKIVSEKENLKSIIDKKIIQNNVYTSEELSKLDMDLLGNVVPLWD
                     IVIKELRTEVKANKEFLDVIESQVLYEINDSIDTDNRWHQREKHAKLSKIAAMIEKND
                     PKDDIADASQRWDVESPYLFEMFERIDYNRLDVLKNSLLRYQTGYGDFLQQFSKGSED
                     SMTKLLEFSPDEELERFATEAINHKFNIKTEKSHDSPQKIENYKSSPQKDKRRSTFGN
                     ITHRFASHSSQNNLMNNEFSDSNNNATLSSKKSPNKLKSRVGSIFGRNKLKKKNTEST
                     LNSAISEESDLGTSRSMSNNRRGSEISHGTPYSVSRGHERSRAHTESSRANPKKFHVE
                     ESPSKPPKPVSQSTEMHTPMASAAGKDVSPVRGVPLSASSPPLQPHPRSDSISRSGHQ
                     LGTINQGQTSASNVSSPALPPSRKQINNSTANTVAGMHDSMMGVQQTQYSQQQNYAIT
                     QQQYQSAAIINPQITGELGELNPQETGSSTSLRGQSMFRHSTLDQAGAYGLNASVAEV
                     INASFKDGVVADSQLVGEVALNYTAANPAQALPIGINLKVNNGSQFEKVILNQAFMER
                     VNSEEFKVNPVFIASRTLGAIKYSISHVTPPVVVHPVWRFEPHQASVVLNVKMSPMLP
                     DNVNQIVLNDFAVFISIDGANTTSALSKPQGSFNKEKNRISWRYTQPLVLNRDSDGER
                     IIARFMTDQIAHESPNGVLVRFTTNPQLNSDIGSGMSIICQELDEENPFGADWKPIAL
                     KKTLATGKYSGLA"
     gene            complement(<886827..>888521)
                     /locus_tag="CAGL0L08096g"
                     /db_xref="GeneID:2890555"
     mRNA            complement(<886827..>888521)
                     /locus_tag="CAGL0L08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449128.1"
                     /db_xref="GeneID:2890555"
     CDS             complement(886827..888521)
                     /locus_tag="CAGL0L08096g"
                     /note="some similarities with uniprot|P46982 Saccharomyces
                     cerevisiae YJL186w or uniprot|P38069 Saccharomyces
                     cerevisiae YBR015c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449128.1"
                     /db_xref="GeneID:2890555"
                     /db_xref="GOA:Q6FKW6"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW6"
                     /translation="MWVPFLGRAGWKLLLAIVGLVYVVSRVPRENSNFLIKESIVETA
                     DVEGLDAAVEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLK
                     QLSYMTLDYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLG
                     GNERTLSLLASIPRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLPRYNGKCIYMSKALP
                     EYVLKAHKFDEKMIRMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWP
                     GRSRRSTSPAFYQIVNRKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHD
                     LDGAIPDAVTHVGHYMIDKQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIV
                     AAAHALELSYYQVHLIPRSMRGGSKDTLQSGETFMHFDPDFDYRKHQALADKVKSKLI
                     DVHSFDRKYTAIRTFEKDLLAGNQDVKSIFIEMPSPQFDPLALFFKAKSLQKLDRKDK
                     VDDLMALERQNYSNLMEVLCRDTDPLVLQMMVNHPSKYKMKDMCVYLKKIVTSLKV"
     gene            complement(<889774..>890479)
                     /locus_tag="CAGL0L08110g"
                     /db_xref="GeneID:9488045"
     mRNA            complement(join(<889774..889923,890474..>890479))
                     /locus_tag="CAGL0L08110g"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_002999548.1"
                     /db_xref="GeneID:9488045"
     CDS             complement(join(889774..889923,890474..890479))
                     /locus_tag="CAGL0L08110g"
                     /note="highly similar to uniprot|P04650 Saccharomyces
                     cerevisiae YJL189w RPL39"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_002999594.1"
                     /db_xref="GeneID:9488045"
                     /db_xref="GOA:B4UN51"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR020083"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="UniProtKB/TrEMBL:B4UN51"
                     /translation="MPAQKSFKIKQKLAKAKKQNRTLPQWIRLRTNNTIRYNAKRRHW
                     RRTKMNI"
     gene            <891458..>891850
                     /locus_tag="CAGL0L08114g"
                     /db_xref="GeneID:9488046"
     mRNA            <891458..>891850
                     /locus_tag="CAGL0L08114g"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_002999549.1"
                     /db_xref="GeneID:9488046"
     CDS             891458..891850
                     /locus_tag="CAGL0L08114g"
                     /note="highly similar to uniprot|P04648 Saccharomyces
                     cerevisiae YJL190c RPS22A or sgd|S0004359 Saccharomyces
                     cerevisiae YLR367w RPS22B"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_002999595.1"
                     /db_xref="GeneID:9488046"
                     /db_xref="GOA:B4UN52"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:B4UN52"
                     /translation="MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQRH
                     GYIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            complement(<892503..>892910)
                     /locus_tag="CAGL0L08118g"
                     /db_xref="GeneID:2890556"
     mRNA            complement(<892503..>892910)
                     /locus_tag="CAGL0L08118g"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_449129.1"
                     /db_xref="GeneID:2890556"
     CDS             complement(892503..892910)
                     /locus_tag="CAGL0L08118g"
                     /note="highly similar to uniprot|P06367 Saccharomyces
                     cerevisiae YCR031c CRY1 or uniprot|P39516 Saccharomyces
                     cerevisiae YJL191w CRY2"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_449129.1"
                     /db_xref="GeneID:2890556"
                     /db_xref="GOA:Q6FKW5"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW5"
                     /translation="MVVQARDASQVFGVARIYASFNDTFVHVTDLSGRETIARVTGGM
                     KVKADRDESSPYAAMLAAQDVAAKCLEVGITAVHVKIRATGGTRTKTPGPGGQAALRA
                     LARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            <894198..>900467
                     /locus_tag="CAGL0L08140g"
                     /db_xref="GeneID:2890557"
     mRNA            <894198..>900467
                     /locus_tag="CAGL0L08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449130.1"
                     /db_xref="GeneID:2890557"
     CDS             894198..900467
                     /locus_tag="CAGL0L08140g"
                     /inference="similar to AA sequence:UniProtKB:P25356"
                     /note="similar to uniprot|P25356 Saccharomyces cerevisiae
                     YCR032w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449130.1"
                     /db_xref="GeneID:2890557"
                     /db_xref="GOA:Q6FKW4"
                     /db_xref="InterPro:IPR000409"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR023362"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW4"
                     /translation="MDLLSKIELEVLEEDDGTGTHTKDILNDIVNRYTNDRAAKEPLE
                     DYISVELNEKFYIHNSMDSFEFIDEKNSPMRLLETSSIELQIILALIDFSSVNAQRIA
                     DWCHQDAKFMKELHDKVLSENKKELKGFTALFYHILKISCSVHDLNKLLSEENAVTSN
                     ILKKLFHNSLQLRNFHEYENVYKGFKFKPNVHLNATIHMVIELSDILSNRIATLNNQL
                     YLEIRDGKFCVSNDEYTIAMYESFEFELGKKYNVTLVLKSQDLELFIDGDSINKLTII
                     TEGFTSIDAIDIGSPICSFKLFEFCVFDTVLPEAVITSLTTLNIINMFNEDLMQYAGT
                     NERKTNNWNHRIPIGKNLEKFLIYQYTFEEQLASQNKSTTKMVFDNTEKSEYTSGNFN
                     AYKEADVVASFEALNGVCTLMEQIYKSENLSVIEDRVLLLLYTLKHPSIRSQYYKDYD
                     INLLAYTLLEGPLKRLKTLPSIALIKGISELCCWNTNDPTQSYITDHDIFLDLYLNLN
                     FWRFYEELIEEDHCQAESVKNNMIEIVSYQLYQLESLVKESTYKEENSIILESHNLLQ
                     TMCNTLCFLEKSKRLRITNKCTTQLVKLFSCLLANAHNPTTFTWYINTIYYNLKVNCH
                     TNFIMMTKAFNEYLNGMTKDYDNTSIGVNIITPKILLIILEELSTHKLDPSDFTFLLF
                     RYFSINSNVWKKTLKNGGWDILLTYITDLDLSYFESLTEIILLFAVNDLDHYNTETFA
                     LNTQTTNNQKENVIRYEAIELLCTYMQWRLHDPSMLDTKNIQLLDTTISRALATINDT
                     IKFDNIQSLDINRTTNLILAIENLALTLTQIATGEKSLNALELAKGLLNNFLITDLEL
                     GKHDSYKHYCINRVEAMNSSFLRRMHSDKPNHLLCFFSKELLPNLVDHFFVKYKQNEP
                     ARSKAALRLCELILFVHSETSRYHILENDHRFWLELFLKCSDLFSDKVIHNSKMKIAF
                     LKCLKKLLIKIMYAIQFQKLNKKTEENCFFYKYLLAYQLMLFGKEYLGCDRILIMNMI
                     ILIGLQINENKADSLALDCLRSVILHQSYDLIHLANNINHEYRMEVMQTLENLLTMDN
                     DEAISMLTESGYFLFSVNQKYRLEDYLNDHTKNLSAIKLEDNNTTIYPRDIYSTDLEA
                     LLKNCKSTTVLFANDNANYSPNIIKMQARISQIYESDINEERFLSHSKLLNLLKRRQN
                     ILDTQDELELNKTWNLDFLEDCGKQRQRILQTYKVDETGLGNYYNKFSRGVKITDSNA
                     ESIRSFDMVPELEQVGTVNSLQTNENRKILKLLKAGDSIQSIWNCSLIKGLNISEGML
                     IIGSSFVYFVDGFYYLSSERRVLRIEDAPENVRDINIKYLKGMEGNTNSITSYTGIHT
                     FEKNELAFVTKRPYLLRDTALEMLFTDGRSFLLNLKNKLVRNELHDLLSYIACRDTVD
                     IALATTLNDINRNSSNITTQNGIAKDSVRYMFSNAFSGPIELFDKSKITKLWKEGEVS
                     NFHYLMMINMMAGRSCNDLTQYPVFPWVIKEYTTDTLQTTNPINYRDLDKPMGAQTEK
                     RCNEFIERYQLLSELDSDGSLPFHYGTHYSSAMITANYMLRLEPFHSTFMTLQDGNLG
                     HADRLFSSVERTWRSAASESTTDVRELIPEFFYLPEFLKNINDYNLGTRQDGSKVADV
                     ILPPWAKGDPKIFTEVNRKALESRYVSEHLHNWIDLIFGAKQRGKEAIESVNVFNSLS
                     YPGTINLDNVNDENERMAITGIIHNFGQTPLQIFRDFHPQKKHIDSYQAKELFLAKLP
                     EIERHIKHVNSDSSATGYCSLEPSANGFGAKNGECWNVSFVGHSVIEKKNMKPMNISI
                     KDGNYIQIEDKILRNLHNTTISYLKILREGMFITGDTNGLLRLWGISNWKEKRVELKA
                     TFCGHMNEIKTTNVMYSSSIMISIDQKRQVFQWDLCSGMFIRRLGTDIKNIAISQLEG
                     NIALLKLDNTLYLKNINGDTYWSGKIPNIGDLEVTCLDFFDFTNLEQGFAKHRYWEEK
                     EILIVGTSDCKLRFYEFGLDFSNMSWTVTPVCYVSVHSPVLAVGNYGTRINDARILQI
                     AALDISNVSIWNIDW"
     gene            <901219..>905289
                     /locus_tag="CAGL0L08162g"
                     /db_xref="GeneID:2890558"
     mRNA            <901219..>905289
                     /locus_tag="CAGL0L08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449131.1"
                     /db_xref="GeneID:2890558"
     CDS             901219..905289
                     /locus_tag="CAGL0L08162g"
                     /inference="similar to AA sequence:UniProtKB:P25357"
                     /note="similar to uniprot|P25357 Saccharomyces cerevisiae
                     YCR033w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449131.1"
                     /db_xref="GeneID:2890558"
                     /db_xref="GOA:Q6FKW3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW3"
                     /translation="MGYPPSARRMGDSKRYYYSNNPNRRHSSQMAYPKKPYQGGQPSR
                     ENPYSHESNTHGSMIDRTGTPTMPSGHNANTSSPSTPTQSQNQTQSAHQNDVPRTSRY
                     DPSPIQRSSSAPHRPTGLVSRKSTSRYNSSIDYPSATSPHKSEIADIPRSRYSGSSLS
                     RYNSHTNPAPTVAQSIKNGVSSPASNNKPLLMNKSPRTSESSVFGNEYSMSSYRSPNS
                     NNPSSNTSYFTRANKWRMGSNPDLKNEHEHPSMNRQPLTAPSNPSTRNKFWKHSTPKY
                     PSTVSPQTKFSESFHSQRHDSNSSINMNYDKHRPSFSEYQENEKKWGGKSANSQHEEH
                     EKDDETRSPLGSPNPHSLGSSLINSVSQTTRETEAQLLKDLREKEGRVKKVRSTSINK
                     PSQNILHKAVATNNGESTLWTSVDKNENSMKDNIMEDTGIPDVANRETTINEFDDPDG
                     DDDDNNDTNDIQDEDDEGEADEDDRLADISNTVFTEMRPSDMLDYEYIYDPTELQTNF
                     SNIKIKNEPDHYTIPLKPINEYIFPMNRVETKLWQLKNKSREEIVKKQKYLLKKPLRE
                     FKAYPFWKRNLLVHEQAIRGELANTIGELVQLNRYKELMMKKMCFQTLQDWKDKCGQM
                     SKISESLRSKEIEYQEKLERENQEREEQEKIAEEKRRHNNSSRRRNRADFVDDAEMET
                     VLLQIDPDYKFHQAAAVIPKMITDPLKRSSYKFCDLNNLETDKDKWASRVLLDGIDNF
                     TPNEHELFVEGYLMNPKKFSRISNFMGGLRTPEECVLHYYRTKRTVDYKSLVNERNKK
                     RKGITSKKKKKKERSSEAELELDTEQSTDVKEVTTEHAAEVSNIGDSQQQIEITKTDE
                     TDYVEVGVVREPIEDDNIAVDTEVIIPTESKHEPENTNVKPDHHSPEPPVQDSLVEPV
                     QPTQEISQEVVHNVKPSNDTYESNPLQHNDAITEHTGDFTTILPRPSPNMSPVDLGFE
                     DGGLRKKQKQSHDHRTSYWSVKETQAFPDLLNEFGSQWSLISQKLATKSTTMVRNYYQ
                     RNAAQFGWKSIVEEADAKRNAKSSGLVQQSQILLPPEPPVFNIVNGIPPQTRPAMNYF
                     GTQVKSETGQLYSGITAQPFNAENTKDAFSTVTTPTSTLPPPRLPTIQFQGNTEGPIG
                     HIAQMSTKPINGTAGGTPGQDIKAEESSNISARTEDHRHNSINSLLNASPDNRPNIIP
                     RPHDDSRTSTTIRSSSISSLLNPDSGQPPPKATISHKAVSISPPPIQKFVGSTINGTV
                     STSVPTPRIFSEGNLKLHQLPPMTTTVSPTLSNDSPTIGQHPQLIRNGQAVDRSLQNN
                     SLPPINFANDPLAALAAIASAPETVSSFISKDKEQQ"
     gene            <906077..>907132
                     /locus_tag="CAGL0L08184g"
                     /db_xref="GeneID:2890559"
     mRNA            <906077..>907132
                     /locus_tag="CAGL0L08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449132.1"
                     /db_xref="GeneID:2890559"
     CDS             906077..907132
                     /locus_tag="CAGL0L08184g"
                     /note="highly similar to uniprot|P25358 Saccharomyces
                     cerevisiae YCR034w GNS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449132.1"
                     /db_xref="GeneID:2890559"
                     /db_xref="GOA:Q6FKW2"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW2"
                     /translation="MTTIIPLLKQYSAPVFERYPVLHNYVPTVEKPFFNINLWENFDH
                     FVTLATNGKFIPSEFQFVAGELPLSELQPVLIAIATYYIVIFGGKFVLSYSKPFKLNG
                     LFQLHNLFLTTISLTLLVLMVEQLTPMIYHHGLFYAICNEGAWTQPMVTLYYMNYIVK
                     FIEFIDTLFLVLKHKKLTFLHTYHHGATALLCYTQLVGTTSISWVPISLNLGVHVVMY
                     WYYFLAARGIRVWWKEWVTRFQIIQFILDIGFIYFAVYQKATHLYFPTLPHCGECVGS
                     TTATFAGCAIISSYLVLFISFYINVYKRKGSKASRVVKRVHGGVAAKVNEYVNVDLQN
                     VSTPSPSPVAKDRRRKR"
     gene            complement(<907586..>908806)
                     /locus_tag="CAGL0L08206g"
                     /db_xref="GeneID:2890560"
     mRNA            complement(<907586..>908806)
                     /locus_tag="CAGL0L08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449133.1"
                     /db_xref="GeneID:2890560"
     CDS             complement(907586..908806)
                     /locus_tag="CAGL0L08206g"
                     /inference="similar to AA sequence:UniProtKB:P25359"
                     /note="similar to uniprot|P25359 Saccharomyces cerevisiae
                     YCR035c RRP43 rRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449133.1"
                     /db_xref="GeneID:2890560"
                     /db_xref="GOA:Q6FKW1"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW1"
                     /translation="MTETISVHPVSFPPEVLARISPDLTLQRHLSLGIRPSLRKFDEF
                     RDVQINEETLSRYSEQCQFDANDTSNGILGSNVLKSGNTMVITTITGGIIEDAYNNEF
                     GDLDIGEQELLHLEDAPADSLSNYTSIYPVVEVERGRVGACTDEEMTISQKLYQSLLY
                     SRVLPKSSLKVKPGVRSTDENGISTITYPDGNVNDDEMSNVVQIKKKWSYVLYAKITV
                     FGRTGPVFDLCWNSLIYALQSTKLPMTFIDEKATDLRVSIRTKGRSTTVKETYEIFAD
                     PKRYSDLVIKKERIAYSSNFGIIELNPEEQILNGEESSENSATPDGTDATDVEMDVVR
                     PEPETVLLADIDTEAEEATINSTVNILTDEQGKMCHFSINGGGAIITPELIRNCLTLA
                     NERSSDLSRKCLRN"
     gene            <909154..>910155
                     /locus_tag="CAGL0L08228g"
                     /db_xref="GeneID:2890561"
     mRNA            <909154..>910155
                     /locus_tag="CAGL0L08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449134.1"
                     /db_xref="GeneID:2890561"
     CDS             909154..910155
                     /locus_tag="CAGL0L08228g"
                     /inference="similar to AA sequence:UniProtKB:P25332"
                     /note="similar to uniprot|P25332 Saccharomyces cerevisiae
                     YCR036w RBK1 ribokinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449134.1"
                     /db_xref="GeneID:2890561"
                     /db_xref="GOA:Q6FKW0"
                     /db_xref="InterPro:IPR002139"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FKW0"
                     /translation="MGITVIGSLNYDLVTYTDKVPDGGETIRANSFETHTGGKGCNQC
                     IAIARLKNPQDNYTVRMVGSVGNDAFGAQLLDTLRRDGVDVDQVKVLEGVSTGTATIL
                     VEEKLGGQNRILIVKGANGESKYSSQQLKDMFKETKEKEYVVFQQEIPNADCVMKWIH
                     DNISNSVIVFNPSPFQPIAKAHWNAVDVLVVNEIEALQVIEDAEGPEKVKEYKEMIND
                     NFISTYKNIAIRLKSQYVNPEGKRAVIITLGSKGVLYVSKQNPEVGYMDAIHDVKVVD
                     STGAGDTFLGALVTQLYEGKPLSEAIKFATFSSSLAIQKNGAAESIPKHNDVKAVLS"
     gene            complement(<910339..>912927)
                     /locus_tag="CAGL0L08250g"
                     /db_xref="GeneID:2890562"
     mRNA            complement(<910339..>912927)
                     /locus_tag="CAGL0L08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449135.1"
                     /db_xref="GeneID:2890562"
     CDS             complement(910339..912927)
                     /locus_tag="CAGL0L08250g"
                     /note="highly similar to uniprot|Q00578 Saccharomyces
                     cerevisiae YIL143c SSL2 DNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449135.1"
                     /db_xref="GeneID:2890562"
                     /db_xref="GOA:Q6FKV9"
                     /db_xref="InterPro:IPR001161"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV9"
                     /translation="MTDTEKHVHRPDEEDDEEQVVAKPRRVVPMMEGFFSSDDESAAT
                     DENEPDEDYDLNEDDKLTKDMTSKGNDEPEEKVMSTVRLTEKPRGRKKGAAAKSKIGT
                     ASYDKMKDRDLMADADNDIPADFVPDSVSAMFRTHDFSYLKLKPDHASRPIWISPSDG
                     RIILESFSPLAEQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVL
                     DRLSKVPVAQSIINFIKGATISYGKVKLVIKHNRYFVETTQADILKMLLRDPIIGPLR
                     IDGEHQAQVDGNKGTGTSSVDKSSINPNDVEAMFSAVVGEGANGEEDEENEDDIDAVH
                     SFEIANSSVEIVKRRCQEIDYPVLEEYDFRNDNRNPDLEIDLKPSTQIRPYQEKSLSK
                     MFGNGRARSGIIVLPCGAGKTLVGITAACTIKKSVIVLCTSSVSVMQWRQQFLQWCTL
                     QPENCAVFTSDNKEMFQTESGLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILD
                     EVHVVPAAMFRRVVSTIAAHAKLGLTATLVREDDKISDLNFLIGPKLYEANWMELSQK
                     GHIANVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHERRGDK
                     IIVFSDNVYALQEYALKLGKPFIFGSTPQQERMNILQNFQYNDQINTIFLSKVGDTSI
                     DLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEGFNAFFYSLVSKDTQEMYYST
                     KRQAFLVDQGYAFKVITHLHGMENLPNLAYASARERRELLQEVLLKNEEAAGIEIGDD
                     ADNSIGRGGSLYKKARSKAMRGEGSLAGLAGGEDMAYMEYSTKAKDLKEHHPLIRKMY
                     YKNLKR"
     gene            <913323..>914903
                     /locus_tag="CAGL0L08272g"
                     /db_xref="GeneID:2890563"
     mRNA            <913323..>914903
                     /locus_tag="CAGL0L08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449136.1"
                     /db_xref="GeneID:2890563"
     CDS             913323..914903
                     /locus_tag="CAGL0L08272g"
                     /note="highly similar to uniprot|P39076 Saccharomyces
                     cerevisiae YIL142w CCT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449136.1"
                     /db_xref="GeneID:2890563"
                     /db_xref="GOA:Q6FKV8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV8"
                     /translation="MSVQIFGDQVTEERAENARMSAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSENSLVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKMIDQARIHPQTIIEGFRIASAAALKALDSAAVDNSSDSEKFHSDLVHIAKTT
                     LSSKILSQDKEYFSNMATDAILRLKGSTNLEHIQIIKILGGKLSDSFLDSGFILQKKF
                     GNNQPKRVEKAKILLANTALDTDKVKIFGTKFKVDSTSKLAQLEKAERDKMASKINKI
                     SKFGINTFINRQLIYDYPEQLFTDMNINSIEHADFEGIERLALVTGGEVVSTFDDPEK
                     CKLGECDLIEEVIIGEETFLKFSGCKAGEACTIVLRGATDQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKAVDTQAQNVDGKKALAVEAFARALRQLPTILADNAGF
                     DSSELVSKLRSSIYNGISTSGLDLDNGTIADMRELGIVESYKLKRAVVSSASEAAEVL
                     LRVDNIIRAKPRTADRHM"
     gene            <915893..>918394
                     /locus_tag="CAGL0L08294g"
                     /db_xref="GeneID:2890564"
     mRNA            <915893..>918394
                     /locus_tag="CAGL0L08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449137.1"
                     /db_xref="GeneID:2890564"
     CDS             915893..918394
                     /locus_tag="CAGL0L08294g"
                     /inference="similar to AA sequence:UniProtKB:P38928"
                     /note="similar to uniprot|P38928 Saccharomyces cerevisiae
                     YIL140w SRO4 required for axial pattern of budding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449137.1"
                     /db_xref="GeneID:2890564"
                     /db_xref="GOA:Q6FKV7"
                     /db_xref="InterPro:IPR006644"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014805"
                     /db_xref="InterPro:IPR015919"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV7"
                     /translation="MQTIQLIYLICALLGTALCAPYEAYPIPKQIPPVARTNQQFVFQ
                     ISNDTYKSNVNDLVQISYQTYDLPKWLTFNTDSRTIQGLPPSDLFNGDNQVQYFKFIL
                     EGTDESDNSKLNNTYQLVVTNKPAITLSPNFNLLALLKNSGYTNGKNGLILTPNQIFN
                     VTFDRSNFDSSDEIVAYYGRTDQYNAPLPNWVFFDPANLKFSGSAPVVNSQIAPQTAY
                     DLTLIATDIDGYAGIEVPFELVIGAHTLTTSIQNTLVINVTETGNISYKVPLNYVYYD
                     DAPITTNNLGSLNLVNNPAWIRLNNDTIEGTVPQDMIKSANGPIGNFSVVIYDINGDV
                     IYLNFEVEATTKLFATSSLPNLNATRGEWFYYNFLPSQFTDFDNTNVSVKYEGDTDHD
                     WLNFVSSNLTLMGRVPQNFQRLTIDLVAQKNSLSQQLPFTIIGMDKLTTNHTNITTSA
                     NATNSSTLYSSTRTSATHSKTSDVEVTSTSTESSSAVAPLSKASKKHSTKTAAIACGV
                     AIPVAVIILVVLAFLFYRSKKKTEPKDEEKTPNISPPNPYNPANNPNKAATSLENPFE
                     DDSDADSAKRRLDMLNALKLDDASTTDSDTSTMDEKRSNKSDIFYDTNNTNSRDLLLE
                     HKDTNSTFFEPNIRSSSVYVDSIPAHKKSWRYTLASARSSHQPGNIRDSYSSLNTVST
                     AELMNTTISDEADIPKDPRKSTLGLRDSVFLDMGSKKKGNLTSSQGNSFSSQMLSESS
                     GHSSQNIPHDTSMRTFERPILEEEASDKHTPGTVSSSSTDDFVPVKNGTSYEWVSKNS
                     PNRKPSVKRFVDISNSSNINVSQAGNFEGHSPEHI"
     gene            complement(<918700..>919461)
                     /locus_tag="CAGL0L08316g"
                     /db_xref="GeneID:2890565"
     mRNA            complement(<918700..>919461)
                     /locus_tag="CAGL0L08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449138.1"
                     /db_xref="GeneID:2890565"
     CDS             complement(918700..919461)
                     /locus_tag="CAGL0L08316g"
                     /inference="similar to AA sequence:UniProtKB:P38927"
                     /note="similar to uniprot|P38927 Saccharomyces cerevisiae
                     YIL139c REV7 DNA polymerase zeta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449138.1"
                     /db_xref="GeneID:2890565"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV6"
                     /translation="MNYFIEKWIRVYLKCFINLILCHRNVYPKSSFTYTTYQGFNLPQ
                     YLPITRHHGLNSYIEEFISDLLGKLDHVYHLSLFVISKHNGWAIERYVLDFGQFQHGQ
                     PVDKDIVLKEGEVYDEFRSSLNSLITYLEKQTPIRDDTVTFEFVIDTIEMALGRKFGI
                     DMDPKTSKSQVVDFERDTNWIRYHEDQNVPDGKEHSGAYKPKLKVTALIGCDWGPICI
                     QQYNERLIVPNKGLSQVYYDDDQTNNFELTLGSLQ"
     gene            complement(<920067..>920552)
                     /locus_tag="CAGL0L08338g"
                     /db_xref="GeneID:2890614"
     mRNA            complement(<920067..>920552)
                     /locus_tag="CAGL0L08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449139.1"
                     /db_xref="GeneID:2890614"
     CDS             complement(920067..920552)
                     /locus_tag="CAGL0L08338g"
                     /note="highly similar to uniprot|P40414 Saccharomyces
                     cerevisiae YIL138c TPM2 tropomyosin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449139.1"
                     /db_xref="GeneID:2890614"
                     /db_xref="GOA:Q6FKV5"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV5"
                     /translation="MDKVKEKLTNLKLEAESWQEKYEELKEQMKQLEQDNIQKENEIK
                     SLTVKNQQLDQEVEKLEDQIKETKELAEESTTLKSHNENFNKKNQMLEEELEETDRKL
                     KETSDRLKEIELNSETLERKTAALQEERDEWEKKYEEVAAKYEDAKKELEEFANSLEN
                     L"
     gene            complement(<920859..>923699)
                     /locus_tag="CAGL0L08360g"
                     /db_xref="GeneID:2890615"
     mRNA            complement(<920859..>923699)
                     /locus_tag="CAGL0L08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449140.1"
                     /db_xref="GeneID:2890615"
     CDS             complement(920859..923699)
                     /locus_tag="CAGL0L08360g"
                     /inference="similar to AA sequence:UniProtKB:P40462"
                     /note="similar to uniprot|P40462 Saccharomyces cerevisiae
                     YIL137c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449140.1"
                     /db_xref="GeneID:2890615"
                     /db_xref="GOA:Q6FKV4"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV4"
                     /translation="MEEHLSMGSVFPVHYGLQIEIDPAKANFKGEEQLQLNVRNSDNI
                     NFPKQFTLHGTDLVVLSAELMDDSTGTNFDQFEITYKKEEQEIVLKYDMDNLSISNNA
                     ALKIKYIGKLNDIKTHQDKTTGVFKTNYMGGYHDDQKSNNIVISTHCQPTFARSIFPC
                     FDELSSKTTFQLSLTSLSRFSAISNSKVLKTEERADGGQELKTTHFEKTPLLPASLFG
                     FSIGDFRKINTVTEFDGISTEIGIYSPWRVEEATYSLDIMKKYIPLLSSYFNFSYPSS
                     KLDIVLLPFLSDMAMENFGMISIQAAHLLISPSMLANEEVRKQLHQLVVHELVHQWIG
                     NYISFDSWSHLWFNESFATWCSSHILEENGDLADYWNSIDYIENQLQPSIERDSDIAA
                     QSIVEMAKHSEKSLRNVYTHEIFDAHSYNKGIALLRCFQLTVGSDMFRKAFQEIFREM
                     KEGNEHFHKSAIKPIDIFNKIGSFLKSENIPKFYTSWTRTSGVPIVSVEELDGKTKLI
                     QHRYIPYSHGSEADHEDIPYYVPMFSILADGSKDKKNILLTDRSLTIDNTILMLNHNG
                     QGYFRVSYESETIYDTIVENLQNSKLDDNNLKTILIDLAYFIGDKKYQKDVHIKGLFK
                     ILSAFAANSSVIVEDYWCGLSTALDIVRRIHSTLGAAQKAKLANKIVDPLFRAMKWPQ
                     QNFATEMASMESNETKVRGDILYLLQDVKDINHGVYSLADNYFKAIMTGPASSIPIGL
                     IGGVFLLVSKRFKNVKQWKKLFELVKSSRGIASHIFQTFDSKTHTDISVIIQNIAIEN
                     LACSRNEEIIRKVLNFVATNIESNGVSRALYGLHNIGTRSTINDNGKEVGQQVRDVAW
                     QWLESNYDLWARKAMREGSQTAENLSKELDGIILYIFEMFRDSEGKVDKFILRKEELL
                     GVEKIHLAQIWLTVKETTSSNKIIAGSVKALL"
     gene            complement(<924096..>924518)
                     /locus_tag="CAGL0L08382g"
                     /db_xref="GeneID:2890616"
     mRNA            complement(<924096..>924518)
                     /locus_tag="CAGL0L08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449141.1"
                     /db_xref="GeneID:2890616"
     CDS             complement(924096..924518)
                     /locus_tag="CAGL0L08382g"
                     /note="highly similar to uniprot|Q06537 Saccharomyces
                     cerevisiae YPR153w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449141.1"
                     /db_xref="GeneID:2890616"
                     /db_xref="GOA:Q6FKV3"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV3"
                     /translation="MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWK
                     FTLYWTFIFNGAFYGGAGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIG
                     AIYRSGLFSMSTWVPMCCAVVQILLDVTMSYSMVGSIM"
     gene            <924898..>926130
                     /locus_tag="CAGL0L08404g"
                     /db_xref="GeneID:2890617"
     mRNA            <924898..>926130
                     /locus_tag="CAGL0L08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449142.1"
                     /db_xref="GeneID:2890617"
     CDS             924898..926130
                     /locus_tag="CAGL0L08404g"
                     /inference="similar to AA sequence:UniProtKB:Q06525"
                     /note="similar to uniprot|Q06525 Saccharomyces cerevisiae
                     YPR152c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449142.1"
                     /db_xref="GeneID:2890617"
                     /db_xref="GOA:Q6FKV2"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV2"
                     /translation="MQRSRSKLWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETAD
                     KEIEIKPLVAFELLAGWALIIFSDGSKKYYNCNESQWSRKISHPECLKLIDLLNKDRL
                     LLLIGIIRGYRCRTNAKDLVNEIREDIDFIREDMNAAKTSEDMKSGSTVNNLENTKNA
                     LLGYYSSDDEEEPAKRDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELN
                     KYSTWRIESEKVSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTK
                     YHYLSQLVANYDLKPDTIPEDIIKDKKLIKKYRIKDYTTKSEQRQFLSKMLAWYKHMS
                     LEDRKQMFQTYIDRIPVGKYTDIDSDAQEDVESQLLELENQLGIPTSENDLEYYCIDL
                     RSKRDILLSTIRNRVNGK"
     gene            <926880..>927302
                     /locus_tag="CAGL0L08426g"
                     /db_xref="GeneID:2890618"
     mRNA            <926880..>927302
                     /locus_tag="CAGL0L08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449143.1"
                     /db_xref="GeneID:2890618"
     CDS             926880..927302
                     /locus_tag="CAGL0L08426g"
                     /inference="similar to AA sequence:UniProtKB:Q06524"
                     /note="similar to uniprot|Q06524 Saccharomyces cerevisiae
                     YPR151c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449143.1"
                     /db_xref="GeneID:2890618"
                     /db_xref="GOA:Q6FKV1"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV1"
                     /translation="MKRVNEIFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMREN
                     PLLCHSNVRETHYYGESSNELQKKDEEPVNELLYGPEGRGGISTMGVRRMADPSKVKL
                     GLSYSIMGMEYYPEWEKVPRDVVKRIKPYEVMKVKKNV"
     gene            complement(<928396..>928917)
                     /locus_tag="CAGL0L08448g"
                     /db_xref="GeneID:2890619"
     mRNA            complement(<928396..>928917)
                     /locus_tag="CAGL0L08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449144.1"
                     /db_xref="GeneID:2890619"
     CDS             complement(928396..928917)
                     /locus_tag="CAGL0L08448g"
                     /note="highly similar to uniprot|Q12207 Saccharomyces
                     cerevisiae YPR149w or uniprot|P53279 Saccharomyces
                     cerevisiae YGR131w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449144.1"
                     /db_xref="GeneID:2890619"
                     /db_xref="GOA:Q6FKV0"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:Q6FKV0"
                     /translation="MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFA
                     AAYGIATDSLYGVFANFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAH
                     YRENNKIIQGSERRCRESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKFIRRRR
                     NNAEVGVPSVSQV"
     gene            complement(<930435..>930917)
                     /locus_tag="CAGL0L08470g"
                     /db_xref="GeneID:2890620"
     mRNA            complement(<930435..>930917)
                     /locus_tag="CAGL0L08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449145.1"
                     /db_xref="GeneID:2890620"
     CDS             complement(930435..930917)
                     /locus_tag="CAGL0L08470g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449145.1"
                     /db_xref="GeneID:2890620"
                     /db_xref="GOA:Q6FKU9"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU9"
                     /translation="MYASQSCFDLFRCVASYDVETMENGLHITIHVRRKFNESFEFRL
                     LSGIVAQQSHASGGVHCLNHLAVDLDVSAQEDQLLPAMSVVHFSPGIVPFHHTSLHIT
                     VESKDVVLVHICMYCRYIPFTHGNTIAMGCESSDPDITAADRDCHGKNSGDWRCGKRR
                     "
     gene            <931048..>932205
                     /locus_tag="CAGL0L08492g"
                     /db_xref="GeneID:2890621"
     mRNA            <931048..>932205
                     /locus_tag="CAGL0L08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449146.1"
                     /db_xref="GeneID:2890621"
     CDS             931048..932205
                     /locus_tag="CAGL0L08492g"
                     /inference="similar to AA sequence:UniProtKB:Q06523"
                     /note="similar to uniprot|Q06523 Saccharomyces cerevisiae
                     YPR148c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449146.1"
                     /db_xref="GeneID:2890621"
                     /db_xref="GOA:Q6FKU8"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU8"
                     /translation="MFKFNLESITQSISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAI
                     GNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIEGYDYPPNISESLSSWWQT
                     KEWFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHEGPPSFASAIARAGKDSQLI
                     FESIETKDEDEKEDIDELVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKN
                     FQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEK
                     EAANDKVETKEKTETNATIADETKETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSN
                     TTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDLNAIDN"
     gene            <932629..>933567
                     /locus_tag="CAGL0L08514g"
                     /db_xref="GeneID:2890622"
     mRNA            <932629..>933567
                     /locus_tag="CAGL0L08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449147.1"
                     /db_xref="GeneID:2890622"
     CDS             932629..933567
                     /locus_tag="CAGL0L08514g"
                     /inference="similar to AA sequence:UniProtKB:Q06522"
                     /note="similar to uniprot|Q06522 Saccharomyces cerevisiae
                     YPR147c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449147.1"
                     /db_xref="GeneID:2890622"
                     /db_xref="GOA:Q6FKU7"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU7"
                     /translation="MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEY
                     YQEFLAKVHDKNPTWEILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINK
                     INNDPNRELVIMGHSVGAYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTR
                     VFNYISNVNEYLSFISSNIFNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRE
                     TLRQVLGLAAHEMLEIRDDWAFQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIK
                     FLKDRYPELLLRVDVDKDIKHSFVVKDVDLVTRRYF"
     gene            <934441..>934662
                     /locus_tag="CAGL0L08536g"
                     /db_xref="GeneID:2890623"
     mRNA            <934441..>934662
                     /locus_tag="CAGL0L08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449148.1"
                     /db_xref="GeneID:2890623"
     CDS             934441..934662
                     /locus_tag="CAGL0L08536g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449148.1"
                     /db_xref="GeneID:2890623"
                     /db_xref="GOA:Q6FKU6"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU6"
                     /translation="MKIPYRYLRFLKHTPIRGGTQLDLIEMSTVELLVFTMLSRVVNI
                     SIVRFSKNWSNRVRTGFTSLAAPIARIYT"
     gene            complement(936615..936688)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0L08558r"
                     /db_xref="GeneID:2890624"
     tRNA            complement(936615..936688)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0L08558r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2890624"
     gene            <937224..>938030
                     /locus_tag="CAGL0L08580g"
                     /db_xref="GeneID:2890625"
     mRNA            <937224..>938030
                     /locus_tag="CAGL0L08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449149.1"
                     /db_xref="GeneID:2890625"
     CDS             937224..938030
                     /locus_tag="CAGL0L08580g"
                     /inference="similar to AA sequence:UniProtKB:P38886"
                     /note="similar to uniprot|P38886 Saccharomyces cerevisiae
                     YHR200w SUN1 26S proteasome regulatory subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449149.1"
                     /db_xref="GeneID:2890625"
                     /db_xref="GOA:Q6FKU5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU5"
                     /translation="MVLEATVLIVDNSEYARNGDFPRTRFEAQIDAVEFIFQAKRNSN
                     PENTVALLSSAGENPRVLSTFTTEFGKILSGLHETLIQGSIQLCTAIQVAALTLKHRQ
                     NKVQHQRIIAFVCSPIPEEHRDDLLKQAKKLKKNNIAIDIINFGESDTNEQLLNEFIE
                     LANKGNPQGDSNEDVSHLLSVSPNNIKLLYEVIASSPIILENGGMGGYDDGFGAANGM
                     DSSLMDFGVDPSMDPELAMALRLSMEEEQQRQERLRQEQQQPQDNNESNN"
     gene            complement(<938288..>939430)
                     /locus_tag="CAGL0L08602g"
                     /db_xref="GeneID:2890626"
     mRNA            complement(<938288..>939430)
                     /locus_tag="CAGL0L08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449150.1"
                     /db_xref="GeneID:2890626"
     CDS             complement(938288..939430)
                     /locus_tag="CAGL0L08602g"
                     /inference="similar to AA sequence:UniProtKB:P38698"
                     /note="similar to uniprot|P38698 Saccharomyces cerevisiae
                     YHR201c PPX1 exopolyphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449150.1"
                     /db_xref="GeneID:2890626"
                     /db_xref="GOA:Q6FKU4"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU4"
                     /translation="MPNLQQFLKQLRTVEIPRLIKQSVSTLNIVCGNESADFDSVACA
                     ISYAYFEHAKSAQNVYVPIINIPKEDLMMRRDIMFTLNKLDISQDLLFFREDLMEYNK
                     QFNTINAVIVDHNELPKPTKQLITDVIGIIDHHADKQLYPNANPRIITVTGSCSSLVT
                     NFWSKNLESNKYHEALNDCAPLLISAGLLDTANMKYKVENPDVEAFKHYGDLNIPLFT
                     QFDSAFRELRSAKDNIDGLTVKQLIRKDYKEYDLIPKSLESKKLNFGVTSIVEPVEEL
                     FKRFNSKDNFFNSCYKYREEYDLDCLVLLTSWNDPKEGRFRRELIIIPKDGLYDTVEN
                     LCNNAPKLELKVLDKESQKFVIYEQFDLSSSRKRIMPYLQDVYSTI"
     gene            <940058..>946312
                     /locus_tag="CAGL0L08624g"
                     /db_xref="GeneID:2890627"
     mRNA            <940058..>946312
                     /locus_tag="CAGL0L08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449151.1"
                     /db_xref="GeneID:2890627"
     CDS             940058..946312
                     /locus_tag="CAGL0L08624g"
                     /inference="similar to AA sequence:UniProtKB:P43583"
                     /note="similar to uniprot|P43583 Saccharomyces cerevisiae
                     YFL007w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449151.1"
                     /db_xref="GeneID:2890627"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU3"
                     /translation="MTPQRSSSSDEGRKNKKPRLEGSSLSSGTTLSIDQLFENRLKHY
                     NLDYNLDANIHAKNIYDPKSRYFSRSVEPNFPIVETLPYKIESHLDQGRYLCYVVYNL
                     YLSITSEDIQGLIPISCKDLAALRNEVDSIVLQTDLFKISNGYGDVESHSNDIGDFDE
                     TEDLEEQLDDNDFIDIGGPDFNATGKITNKSLNIINVNYWTNELKNCMHFDFPLSLRL
                     ALAKVYYYLSLVQGQKVYRQLHVSIFETLVNADDDGTNFTDLLLNSGLVLDHQVMYDF
                     LSEFLPYPDSDFVRYDLTSKDDLFLFRLLLRLAHAAKPFYDKKNTDLLSKIMSQLLSS
                     LAPSTMSTILPMITSFVPFQYKKGSNIIDYFTFLFSMWSSVSANIAVDTHMYDLVGNV
                     SEDVHKYISNNSPTENDKVSFGEFGIFTENQASFMFNSLQGHLRTDGQIHSYSRTVRP
                     FVYMMNGCNIDSFLVLLKKLAKSIETFVHPSNNGFWTKPISKFIHGFIKMYHGRVMKE
                     KKMVLEDIKSSIFLNGDIHGDIVDIFLPLIKIGSQNKNSDITNSYISSLAYLLSTQPP
                     NSSQIYDGVILDLYDSLGGEYINSRHRTIASLKQFTRVVRFMAEDPLYRTHISNILLI
                     LVSKIDLNDVQLTSNLINGIVSIVSFIPLKTFESKEEILSFESHTIPFIEQHYYYLKT
                     AAAGSLFEYEPEFLDKAFKASTTAFENILKIFVDKLYQLVDVDLEDRLITKINQTAMI
                     MQDSMDDFLFSYYADLMIRMFWENDSFKEKNPNYEIISIPLAAIIKRDSKRSKELVIS
                     LINNIKLQVERGAGSIRSASEIQLRDVKLVLYLSTLNDVLRQSHASILEYGKQLMEFF
                     EFIFEEITNPPLDVMTSILLHNTLSSLTTTELVDTRLFSQYCDLDLSEMWGGLQFDNR
                     KYQSHNLDFTWHVPSRDEVDFAIELVDKMVECCHKAVDDLKKEPSTDTVYGDKIQKYV
                     LIITHALSGSSLLFDPDYNRQLSKSTGWKYMDEKLANFQNQQDDSKEQTKEISLEPHP
                     EKNLAVESTSDDSIHISSEETNLIMEDSITSEVPSGPVTPSFGTESHTQGIPFENTFR
                     EIDIYKSNYYFGNKEEERFNDPQYLHIHKLRAQIGSFFHNLYLFLGKHFENNTSMFQI
                     LLHGMKVWFADVGREVIFNEEPNAFLDLDFLENIQSLSHLEEPFTRTCLAVKSDYFHQ
                     SRVLLQSTTRIPSALENILLRDIIHLSISIYPDIFTSAQTTLVYCMKQIVGSYHTVLN
                     VILDSLETSIKLADHMKIEVILKLLLVKKIYRKLMSDYKNLERLLFLLIDCCKINELE
                     IAVYAEQFLLSIGKGVKIPSSVCVLNMHSYKPIEPPEEFIHLQVEAVKLAKERKRAYF
                     LDLLTGLQRKFIAYIENNKDLGWKIPMFVVQYITKLQSSLETQPESVYVEAVLNQTDT
                     RHPQMIHLIIKSILGIANKILSMSDYQYDISKAYESTFDPGYIEKIATDNLDAQVQFT
                     DEVGNFTKPSYYIDSRSYVGWLCWGAEMKVMKTIPIQLSLEPSEAETLKMIGSILTKS
                     WLHEVCTHLIHDNENRGVFSSGNVSFFSFLLLLINNGFCGLQVEDIFGLCNDIYDTND
                     KPSMIMSVEIVAGLITGTKYMVPEMIGKRDRFLEKFLNQKLGAELNHDAFEIWSTLTW
                     WLPTVVDIRRCPPLYDVFRKFTETLSTDSDAATDQVFKIQMFRSFLIGLEYRSPDAEK
                     ELLNLVFDHPYEHVRESIAKLFATLVQNKSCPSYSSAQKLLEVNFNKYGGLGVPLKSI
                     PDDIDNFIRDKFALLDNEYHSLDRTLSSQKLIKSRYYYIASTLYYWIREMARGPNRVL
                     LIPYISEIVIPFLVSLIRQKELSKLSGLDLKKLYVGLAYMPYRISDLTPVINALCDKQ
                     QNDSSYLLQIQLSFMQHFFSNQLLQLSSDESNRILTFVTENLYNSDFVEVRIKAAAVL
                     SDIVHNLKENDLVTLINSFEKGLGSHPWEIKKELSKNDPVIHGNILGLGAIISAFPYV
                     FPLPKWIPKQLSTISSWARTNGISGMAAKNTINEFKKVRADTWHFDRLSFTSTELEDL
                     EGVLWRSYYA"
     gene            <946654..>948420
                     /locus_tag="CAGL0L08646g"
                     /db_xref="GeneID:2890628"
     mRNA            <946654..>948420
                     /locus_tag="CAGL0L08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449152.1"
                     /db_xref="GeneID:2890628"
     CDS             946654..948420
                     /locus_tag="CAGL0L08646g"
                     /inference="similar to AA sequence:UniProtKB:Q02724"
                     /note="similar to uniprot|Q02724 Saccharomyces cerevisiae
                     YPL020c ULP1 Ubl-specific protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449152.1"
                     /db_xref="GeneID:2890628"
                     /db_xref="GOA:Q6FKU2"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU2"
                     /translation="MSVDLHTLERSSKEYTPIYGTILTARVMSDSNTVFSRKRNLKKN
                     VNKASGRVASNLNMEERKCSNLKGSNGESMNRATRILRWISNVMGSSKNDTDDNNKST
                     EDISSIDSSTGQERSLSSNSSGTINSESPIGHKRTNQESLMDKTKTKSRKLNCVDHKS
                     MPFFDPPSANMMPRLLSFSKNHPYQWHEWECELPTSSKRSGNKASTSTKSQYGTQFVK
                     YTKTKRSSQTASIRIGTSNDVGKEFEYLRMIYNGEYDLPETIKLERERQLKLLHDDRG
                     RDAMLRASVSELTNRISSILKETLPRARNDDLIILKEKNVSELDKKRQEFERQRTKFN
                     QMKLIFDREHISYKKLQEERRKIQIENRSKQKSERLVPNLTQKEVDEVKKVLQRSDNG
                     LLMNRENLEIFVRDFKTLGKARWLNDTIIEFFMKNIEKSNANIVAFNSFFYTTLSERG
                     YQGVRRWMKRKKKQIAKLDKIFVPVNLNQSHWALGMIDIENKRIIFADSLSNGPNAMS
                     FAILADLKNYVIQESQKELGDDFELVHLQSPQQPNGYDCGIYVCMNTLYLSKENELQY
                     DYKEAVSMRTYIGHLILSDSLK"
     gene            complement(<948661..>949755)
                     /locus_tag="CAGL0L08668g"
                     /db_xref="GeneID:2890629"
     mRNA            complement(<948661..>949755)
                     /locus_tag="CAGL0L08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449153.1"
                     /db_xref="GeneID:2890629"
     CDS             complement(948661..949755)
                     /locus_tag="CAGL0L08668g"
                     /inference="similar to AA sequence:UniProtKB:P53686"
                     /note="similar to uniprot|P53686 Saccharomyces cerevisiae
                     YPL015c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449153.1"
                     /db_xref="GeneID:2890629"
                     /db_xref="GOA:Q6FKU1"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU1"
                     /translation="MEQVKVVAEHLKKYPSSKVIFLVGAGISTSSGIPDFRSPKTGLY
                     HNLSKLKLPYAEAVFDIEYYQENPQPFYLLADELYPGNFKPSKFHYLMKVLEKNGRLR
                     RVYTQNIDTLEREAGIPDDYLVEAHGSFAKNHCIGCDKEFPLDDFKKALLRYNKYKMK
                     HNNDMKEFEYLRCPECEALIKPKIVFFGENLPKRFFDSWDTDLEWLEEESNSIVIVAG
                     TSLTVYPFASLPNDVPNNVRRVLCNLDVVGDFLTSPRDMDLKFSEHTDDFANQLVKEL
                     GWDKELEKLSLSHGKESIMENEVDNVIEEIKQLSLDNNNTSLKNDGNADSEKHEDKAS
                     IKGDDNQKDMNKDTHTTEKVRDKKSIDEKL"
     gene            complement(950089..950162)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0L08690r"
                     /db_xref="GeneID:2890630"
     tRNA            complement(950089..950162)
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0L08690r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2890630"
     gene            <952133..>953113
                     /locus_tag="CAGL0L08712g"
                     /db_xref="GeneID:2890631"
     mRNA            <952133..>953113
                     /locus_tag="CAGL0L08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449154.1"
                     /db_xref="GeneID:2890631"
     CDS             952133..953113
                     /locus_tag="CAGL0L08712g"
                     /note="some similarities with uniprot|Q02606 Saccharomyces
                     cerevisiae YPL014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449154.1"
                     /db_xref="GeneID:2890631"
                     /db_xref="GOA:Q6FKU0"
                     /db_xref="UniProtKB/TrEMBL:Q6FKU0"
                     /translation="MTMSNIEQPQPMQYGDYEDLRDLHTPMMTPVNGIITNNNVNGGL
                     GFKNGKSMAPIAPLPPYLTSSRTRQNSNSSLASSVSDFPMNYSLRQQALSNTPLNGVS
                     GGNANFTPQFINLLMEAYQVICMDPTVTPFDTVNPPSAILNRVAKVAIDSAATREVEI
                     GYEKNSWLLTLVRHRLLQEVRKDGYLSRNASFSSLPPAAPMFEMLGGNSTTAPNQFGN
                     NQNGFALGNDKASVDYFNYNFAQMANQNNSTMTNYNGNNANINSANFVCTPTGMDNVN
                     FNFANPANVITRQRSSTLSPLPSSLNIPEDSTLSIPDIFKRRIDGLRLKR"
     gene            complement(<954111..>954476)
                     /locus_tag="CAGL0L08734g"
                     /db_xref="GeneID:2890632"
     mRNA            complement(<954111..>954476)
                     /locus_tag="CAGL0L08734g"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_449155.1"
                     /db_xref="GeneID:2890632"
     CDS             complement(954111..954476)
                     /locus_tag="CAGL0L08734g"
                     /inference="similar to AA sequence:UniProtKB:Q02608"
                     /note="similar to uniprot|Q02608 Saccharomyces cerevisiae
                     YPL013c"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_449155.1"
                     /db_xref="GeneID:2890632"
                     /db_xref="GOA:Q6FKT9"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR020592"
                     /db_xref="InterPro:IPR023803"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT9"
                     /translation="MACGLVRIRLARFGRVNSPLYNIVVARSHKARDAKPIEVLGTYN
                     PVPKPLKKSEVKKGVIPTKEVALDFDRAKYWIGVGAQPSDTVVRLFQKAGILGPEWGN
                     KKSTLQERPTIQPRKELLE"
     gene            <954860..>958519
                     /locus_tag="CAGL0L08756g"
                     /db_xref="GeneID:2890633"
     mRNA            <954860..>958519
                     /locus_tag="CAGL0L08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449156.1"
                     /db_xref="GeneID:2890633"
     CDS             954860..958519
                     /locus_tag="CAGL0L08756g"
                     /note="highly similar to uniprot|Q12754 Saccharomyces
                     cerevisiae YPL012w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449156.1"
                     /db_xref="GeneID:2890633"
                     /db_xref="GOA:Q6FKT8"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT8"
                     /translation="MDPEQAAYWMELEDKLAKVRAQLNSKLDNQKHVAIILSAVEEQI
                     DTTNDLSKNIVQYMVTLMTLLDQATDRETHAIKDLKLTTSVAYILDMVFHYCPKSLLR
                     KQFAEILTKIAPCITDEAAEAPLIRSAIGCLEALLIAQDAQAWNNTHDLAITPRRGLQ
                     GLLELSTDPRPKVRKRALDSISNILNNPPPAPTAQHVAAGTIVDYSLNSLISILQELS
                     TMSNKKLKAKGTMEEFSSRIIRALRLINAVVSTGQWPATKIEPLCDSLLEVTKSSDQY
                     LVSASFECFEVLFKSMAESTVTSGLADNKFLRVLDTIFTLKPSNADTHLAGAWIAVVV
                     KAMSTYAVHQPLKCFQKIPEVFRIMAHYMASETTEIYISASNCLMAIISDAIKNDQLL
                     FPPAVSEQHDQAINKVIQELSKIMEDFLSIKFIHCAKEVLNVFASLFVKLRYRSSPYL
                     IKPLLVVDKWRVNEENYLELRNEAEHVIGSAISSIGPDQVLHYMPLNLQNPSDDQPGR
                     AWMIPLIRDHTRNAKLSIFSEEMMPLIKHFESMFGSLPKESVQLRLYQTIVDQLWSTF
                     PHFCELPTDLQESFTTQFASDISSLLYSEVGLRTTLCHALKVLVESNELYVNGSLSDD
                     VLLQQHFPVEEAKKNLEYLANMSSNILAVLFNVYTETAPNSRGYIMETIEVYFKISKP
                     EDLEKTFNNVCTLLKDAMEKESTQHEKGKPQVTATLLDFVVCMTKYLPATSYSALFSI
                     FGITVKSNNALIQKRAYRIITRIAEIESGSSAVANFVGDIEQIMLDNSNTVQTAAKAT
                     RLQAIKILVNLLPHDHLHFIVRIIPEVILSTKDVNEKSREASFDTLIHMAKKMASPDG
                     IIRLADIEGYPDDTPDQQSSVTEFFKIISAGLIGESQYMVSATITAYAFLIYEFKSEI
                     DQSILMEIYDTIELYLTSNSREIVKSAIGFAKVCVLGLPEELMRPKVPELLPKLLRWS
                     NEHAGHFKSKVKHIIERLIRRFGYDYIAENFPESDLRLLANIRKIRNRSKRKDGSDDQ
                     DIVPTTSSKSSNFMNAFDEAIYDSEGEPSDDEGASASTGRKKNNKKQYIVESGENPLD
                     LLDSDILAHVSSTRPKSFKKNEGSKKYMISDDSFAFDDEGKLVVKQNAKAQNDDDEDP
                     LKSVTSGINAYLDAVKSGPVRGQRNKFKFKKNKNGDMDDDDDEPMIPKRASHPNNKSG
                     RIGKKGGKFRNKRKF"
     gene            complement(<958734..>959936)
                     /locus_tag="CAGL0L08778g"
                     /db_xref="GeneID:2890634"
     mRNA            complement(<958734..>959936)
                     /locus_tag="CAGL0L08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449157.1"
                     /db_xref="GeneID:2890634"
     CDS             complement(958734..959936)
                     /locus_tag="CAGL0L08778g"
                     /inference="similar to AA sequence:UniProtKB:Q12297"
                     /note="similar to uniprot|Q12297 Saccharomyces cerevisiae
                     YPL011c TAF47 component of the TBP-associated protein
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449157.1"
                     /db_xref="GeneID:2890634"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT7"
                     /translation="MTNNEAFFFGLLRVSMLQLLKSHGFDKALPSTVDAFTDLYVKFL
                     DLLVSEVQGAMQLRGDKYMETVAIQDITAGMEAVGLLKPMKLLDVYGERVPDDSNTGA
                     EAFKKWCTDVQVRNSRQVALPSVDLLTAEANGSKSTKPLNALPDYINQLQQKKEPSRS
                     NSITKQPMLPDMAPQLPFHSQDEHVHELIEELINNGETDDWIRMVLARQRIELGKKHS
                     RKPGTLENLPNIPSMKFSALSSLLPSEEDAKNEFLPSNGEVDETNSGKDLETTASEVT
                     ASDKTKDKLSQLTQYLPISKPENRLQNIALSYENEQDDADEINDGIDDYHSESASPAT
                     LTDEKLIDDIQSMGPMHLQNDIAVEDDDMMPMDYQFDDPDAMFDEQEDMDNTFQRRAS
                     LDFGSHFG"
     gene            <960646..>961200
                     /locus_tag="CAGL0L08800g"
                     /db_xref="GeneID:2891089"
     mRNA            <960646..>961200
                     /locus_tag="CAGL0L08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449158.1"
                     /db_xref="GeneID:2891089"
     CDS             960646..961200
                     /locus_tag="CAGL0L08800g"
                     /note="highly similar to uniprot|P53600 Saccharomyces
                     cerevisiae YPL010w RET3 coatomer complex zeta chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449158.1"
                     /db_xref="GeneID:2891089"
                     /db_xref="GOA:Q6FKT6"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT6"
                     /translation="MLSLYSVQAVLILDGQGERVFSKYYVAPHGGVEDNVFDVKKQRK
                     FEKELFAKTHKQDSEILLFDDHLVLYKEYIDVTLCLVASLEENEIVLQQVFSAFKGSL
                     DLILNSGIDKKNIQENYDMVVLAIDEMIDNGVVLETDPSTIAARVSKPPKNDTQLTLD
                     LDKGLLGAWGFAKSKLQERLQQGL"
     gene            complement(<961540..>964635)
                     /locus_tag="CAGL0L08822g"
                     /db_xref="GeneID:2891090"
     mRNA            complement(<961540..>964635)
                     /locus_tag="CAGL0L08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449159.1"
                     /db_xref="GeneID:2891090"
     CDS             complement(961540..964635)
                     /locus_tag="CAGL0L08822g"
                     /inference="similar to AA sequence:UniProtKB:Q12532"
                     /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
                     YPL009c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449159.1"
                     /db_xref="GeneID:2891090"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT5"
                     /translation="MKQRISALDLQILAVELKSALEGFRLSNIYNIADSSRQFLLKFN
                     KPDSKANVVVDCGLRIHLTEFNRPVPPTPSGFVVKLRKHLKSKRLTALRQVTGDRILV
                     LEFADGLFYLVLEFFSAGNVILLDHERKILALQRIVHEHENKVGEVYNMFDETTFDEN
                     MNDTQDERERTYSLELVNSWMNECETKFKSELSILSQNESKNKKVKVMSIHKLLLSKV
                     PHLSSDLLSKNLRIHGFNPSSSCLEYIGKKDEILNLLLETEKEYKNLLNADEKTGYII
                     AKKNPLYKIDTPGYDLEYIYENFHPFIPHIPATDEDKSKVIKIEGDYNKTLDDFFSTI
                     ESSKYALKIQNQEQQAKQKIEAARQENKKRIDALREQQASNETKGNLLIANVDLVEEV
                     KSAVLGLVNQQMDWNTIEKLIQSEQNKGNKIAKHVSLPLDLKNNKIKILLPNTDEEDS
                     TSSDDSDSDSSSDDDSEIDSSEEENSDVSDFETEEGVETSTKKDKKKVSQKRNSKVDK
                     FSLNKTVVAIDLGLSAYANASTYFNMKKDHAEKQKKVEKNIEKAMKNIEDKIGKQLQK
                     KLKESHDVLKKIRKPYFFEKYFWFYSTEGFLVMLGKSNVETDQIYSRYIEDDDIFMSN
                     SFDTKVWIKNPERVEVPPNTLMQAGILCMSASPAWQKKIASSPWWCFAKNVTKFDDVD
                     GSVLAPGVFRLRNEKQINMLPPAQLVMGVGFMWKKKTQENELENEQSETDTSESESEE
                     ISESKEIPSTNETAAEVDSLDNKTGTELTENSEETNMNITNASKQSSAASLKDIEGIC
                     DDESDNRSESVMSAEKEMSELTLSSKVKKQVRGKKGKLKKMQKKYADQDEDEKRIRLE
                     ALGTLKGVEKQKQREAEEKKKQELREHKKIRREKQKQLQALKFNKNEKVKVDYEKIRT
                     ELVPNLTKEEEISDIVPVFAPWPAMLKYKYKVKIQPGNAKKTKTLSEVLNYFKNREVD
                     PTMSNKELDWPREHEYIKTMKEQEMVLMISVDKLKATLPSQGKNSSKSSKNGKTQKKK
                     K"
     gene            <965072..>967564
                     /locus_tag="CAGL0L08844g"
                     /db_xref="GeneID:2891091"
     mRNA            <965072..>967564
                     /locus_tag="CAGL0L08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449160.1"
                     /db_xref="GeneID:2891091"
     CDS             965072..967564
                     /locus_tag="CAGL0L08844g"
                     /inference="similar to AA sequence:UniProtKB:P22516"
                     /note="similar to uniprot|P22516 Saccharomyces cerevisiae
                     YPL008w CHL1 protein of the DEAH box family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449160.1"
                     /db_xref="GeneID:2891091"
                     /db_xref="GOA:Q6FKT4"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /translation="MDNATKFHHPYSPYDIQLDLMQCVYDTLANPVKKVAIVESPTGT
                     GKTLSLICSTLTWLRDNKADILSSVDTLHSNEDDSHDSEPEWVKDTYKESILKDKLEL
                     LDEYEKYLEELHLKENKIIKFGTSIEDKSKVKRRKVTSSSKAKIEVSIEDEDEFVAKP
                     YESDGEETTDLEKKEALSKEVQELLAKFDSSKKNTDNVELGRFASASQNQVRIFFSSR
                     THSQLNQFAEQLKLTNFPSSFPDKVAHERVKYMPLGSKKQLCINPDVKKWKTLEGIND
                     ACSEVRRSKEGCPFYQNTPKWHNSKETNHFRDQVFSDIHDIEDIAKVGESLAVCPYYA
                     ARDFIPSSEIVTLPYQYLLSESTRSQLRLDLKGSIVVIDEAHNLVDTINSIHSAEISL
                     SELKQSYNSIILYMKKFKSRLNPGNRVNLLKLSKLITVLINFITTHYKKPGLEVDAFS
                     ILESNNTDMLNVHRVLKYIKTSHIAYKLDTYIQKLQEKESPSNQKPSSQPLLYKISKF
                     LECLNNTSSEGSFFFERGPSLRYMLLEPSRIFQDIIDSARCVILAGGTMEPVSQLLQY
                     LVPKLDDSSITKFSCNHVIPDSHLRTYIVNEPQFEFTFEKRNSVNLVQNHLFNFYLEL
                     STTIPKTGGIIGFFPSYKYLDEIIVSWRKAGLFEKLDKERKVFYEMKDGPDPLPDYTS
                     AVANSEGAILFAIVGGKLSEGINFGGNLCRAIVMTGLPYPNVFSGELIISRKHLEEKV
                     LNGGGSKTDANMAAKEFFENICMKAVNQSVGRSIRSINDYSLIYLLDKRYANANIQSK
                     LSQWVRSRIQSVSTVRDVMASSKEFFDQIADT"
     gene            complement(<967618..>969375)
                     /locus_tag="CAGL0L08866g"
                     /db_xref="GeneID:2891092"
     mRNA            complement(<967618..>969375)
                     /locus_tag="CAGL0L08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449161.1"
                     /db_xref="GeneID:2891092"
     CDS             complement(967618..969375)
                     /locus_tag="CAGL0L08866g"
                     /inference="similar to AA sequence:UniProtKB:Q12308"
                     /note="similar to uniprot|Q12308 Saccharomyces cerevisiae
                     YPL007c TFC8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449161.1"
                     /db_xref="GeneID:2891092"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT3"
                     /translation="MKILKDLAVTRRDISDWSHSLSWTRDGSLIIETSPELTLAQPIF
                     RTDVDNTLKNMFQLKSIELPMGDNAFEFEQSGRNTLINSDPSSTIRICKTSNIMSWKA
                     CITSNANCLIYDNNNNLYNITPSEGSIESRSIHSICWHPEDKYICLGNEVGGLFFYEI
                     AFNDGPQQNVIFNLKHTISLNSKSHDQWVTRIIWNDENHLVCSLSDNSLYIVRDYTSV
                     TKIKEATRHQIFDMVLAKDSILITCPGEFCCYQIANQILLHHPLEDYEPYYIIPLLHT
                     KEQNTQAILLSHNNGKRVMIGNRIQVETDSEISPIFAKKVKKWSTLYNELQKYDVNLN
                     IFGVALSTDGYSVAILYNIERVSIKYTITSENKYNIILLPLYKTWNLSRAALGLSWYQ
                     TYQIYGKELPKNLCSSQNSRIDYHLSFSFKDFLFFIINHQLTMQMQFNNFINDSSDIN
                     FVSRGLYDFGVSKIEDFENELDIACLNGIAGSLGLELPHKPIKFTMKGEHISETFISN
                     NRSSPECMTSEENHTWRVCALTFLPILTMHVKICPVTNKRIINISKDQYNEYGWFTRT
                     ILEVFSTESVYSGTPYLSP"
     gene            <969835..>973416
                     /locus_tag="CAGL0L08888g"
                     /db_xref="GeneID:2891093"
     mRNA            <969835..>973416
                     /locus_tag="CAGL0L08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449162.1"
                     /db_xref="GeneID:2891093"
     CDS             969835..973416
                     /locus_tag="CAGL0L08888g"
                     /inference="similar to AA sequence:UniProtKB:Q12200"
                     /note="similar to uniprot|Q12200 Saccharomyces cerevisiae
                     YPL006w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449162.1"
                     /db_xref="GeneID:2891093"
                     /db_xref="GOA:Q6FKT2"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT2"
                     /translation="MRSTILVILVGLIWPFSESIQFQQPSIQEDKGGAQCTIYGNCGK
                     KSIFGSQLPCPVDDLDFSPPMIDEETRELLVSTCGKEWEDKDFICCTVDQITALKTNL
                     QKAQTIISSCPACLENFNRLFCHFTCSPEQREFVKVTQKGKSSDGRSVVDELEVYMNK
                     TWASSFFDSCKEVKFSATNGYAMDLIGGGAKNYTQFLKFLGDKKPALGGSPFQINFVY
                     ELGDMDNYRYFNETVYACNDTVYKCACSDCELSCPTLEPLQNRKCSVGPVPCFSFTVI
                     ILYFALLSAFIMWYALMKNTNKLSSAFLSSDNLFSEFENNENMDNGMLFNNYETQTYF
                     VNDWIADCSARWTSWIVSKPCVTLLLVGTLILSMGLLLFCWGDLETKPVNLWVSKNSP
                     KFKEKQYFDDHFGPFYRIQQIFIVNDTGPVFTDYDSFTWWFEIEKNITEHLVSTEGLS
                     YQDYCFRPTPDSACVIQSYAQYFPDYLPEKEVWRNKLEECAKYPVNCLPTFQQPLKSN
                     LLFSDEDPLGTNAFVATYLLSNHTEGAIQWENELENYLLNLKLPTGLRMSFNTESSLE
                     KELNKNNDVIVVIISYFVMFLYASWALKDSSGNNRFLLGLFGILIVISSVICSAGFWS
                     IFGVKSTLIIAEVIPFLILAIGIDNIFLITHAYDSTFRSSIELLIEDRVTTSISKITP
                     SIFSSMICQAGCFLIGATVDMPAVRNFALYSAVAVLFNVFLQLTAFTAILVIYENKTN
                     KSVTQSREQLQENILVKEQSFFQNSIAWILSYRKIILGIFLGSTLFAIIFLPAIEYGL
                     DQKLAVPQSSYLVDYFNDVYKFLNVGPPVYFVVRNLDVTKRKNQRRLCGRFTTCDDNS
                     LSNILEVERSRSTVTEPVTNWLDDYLSFLNPELDQCCRFKKGTNEICPPYFPPRRCET
                     CYSQGEWSNDMTGFPENGEFMKYFDIWINTPSDNCPLGGKAPYSNSISYNDSTVISSA
                     FRSAHNPLRSQADYIRAYNDANRISKSFDGLDIFAYSPFYIYFVQYTGLGVLSIKLIS
                     GALLLIFAVSAFLLGSSKTAFLLTLTVTMVIIDIGCVMAVTGINLNAVSLVNLIICVG
                     LTVEFCIHIVRAFTLIGRDIKNTRVARVENAMKTIGETVFNGITLTKFIGVTVIAFAQ
                     SKIFEVYYFRMWFSLICLASVHALVFLPALLTTLGGKSFVNKSGISI"
     gene            <973872..>975743
                     /locus_tag="CAGL0L08910g"
                     /db_xref="GeneID:2891094"
     mRNA            <973872..>975743
                     /locus_tag="CAGL0L08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449163.1"
                     /db_xref="GeneID:2891094"
     CDS             973872..975743
                     /locus_tag="CAGL0L08910g"
                     /inference="similar to AA sequence:UniProtKB:Q12089"
                     /note="similar to uniprot|Q12089 Saccharomyces cerevisiae
                     YPL005w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449163.1"
                     /db_xref="GeneID:2891094"
                     /db_xref="GOA:Q6FKT1"
                     /db_xref="InterPro:IPR002885"
                     /translation="MNALKRLGTTLAKNGDQIIEGTKELDQISVKYFLGNTRVSNNEK
                     SLVSISSNKSRLNFNQLIKDNAHLIGKGSQYQRKVVKHYLSPLIGHKLRRQDIHNDYN
                     KQLSHTDHIITPTDRKREAFSSMELAVDILPLLIKSTKKPVTKPAKRRLFKPYYTKEV
                     PPIPDFKGDMKLFEDYIALLTHTKFLYKNSSSSNGIIPKILRVLIHPSNLNTIDLRSV
                     QCYNDILYFYSKKYDFATCRELFAQMKVEGCKPNTTTYNILLLNLVKKVHMRKIRSIK
                     NELLFYLRNMQKNGIFCDTVTWNTCYNFLNDEMSRDLYIEKLIDCGVPLTSELVYSVV
                     RNSSKAHISTKTKYILDMFGEDGESFVNLKFVNLLISDLVLDHNVERAWSVLRYFELK
                     QLKFVNQPKFLINSETMNTFLRYFAEQGRIDLCFLTYNYFVKDLVGPNKIRPNVNTFD
                     MLMKSLVKNGYTETLPTVFEVICALSERYGIKIRNDGYWSLKCKAIIKFQYKSSSCEK
                     NKTELLNKLNNFSWGKQLPLFTTKVWKNGNSEVRKICRMLGSIPIPLRKSRKLGDKET
                     VDRSQNRSVSEKKKAYRNRIKYIAIGNAMARRIPYANNWHQSFKDEVTKRGLLASER"
     gene            complement(<976256..>977194)
                     /locus_tag="CAGL0L08932g"
                     /db_xref="GeneID:2891095"
     mRNA            complement(<976256..>977194)
                     /locus_tag="CAGL0L08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449164.1"
                     /db_xref="GeneID:2891095"
     CDS             complement(976256..977194)
                     /locus_tag="CAGL0L08932g"
                     /note="highly similar to uniprot|Q12230 Saccharomyces
                     cerevisiae YPL004c or uniprot|P53252 Saccharomyces
                     cerevisiae YGR086c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449164.1"
                     /db_xref="GeneID:2891095"
                     /db_xref="GOA:Q6FKT0"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:Q6FKT0"
                     /translation="MHRTYSLRSSRAPTAAQMQSPPPPPSSTKSRFFGKGGIASTFRK
                     STAGNFGPELSRKLSQLVKTEKNVLRALEVVSNERRAAARQLSLWGSENDDDVSDVTD
                     KLGVLIFELGELQDQFIDKYDQYRVTMKSIRNIEASVQPSRDRKEKITDEIAHLKYKD
                     PSSTKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDSIRELAEKFALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYDASRQIIMDAEGALEAWTLDVAAVKPTLSFHQ
                     TVDDVYEEEDGEEVQEGEEGQQWEEEQQEEHHEGEN"
     gene            <979515..>980879
                     /locus_tag="CAGL0L08954g"
                     /db_xref="GeneID:2891096"
     mRNA            <979515..>980879
                     /locus_tag="CAGL0L08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449165.1"
                     /db_xref="GeneID:2891096"
     CDS             979515..980879
                     /locus_tag="CAGL0L08954g"
                     /inference="similar to AA sequence:UniProtKB:Q12059"
                     /note="similar to uniprot|Q12059 Saccharomyces cerevisiae
                     YPL003w ULA1 involved in protein modification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449165.1"
                     /db_xref="GeneID:2891096"
                     /db_xref="GOA:Q6FKS9"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS9"
                     /translation="MSQIFDRYDRQLRLWGHDGQHLLENSHITIVIDNDANKTVDLLE
                     ETLKNVILVGVKNITLNNLCDCKLDNVIRNVLPLNDGVHIDQTTDPLSLMNASPQTDL
                     FLLLNLDNKAEALFTNNPFKIKSIATHVNGMLGHIRMYYPSPHFISNTHSDRNIPDLR
                     LKDPWPEYKSFLNSFDDDLKNDVAAATVPYPVILYKVIDGVTNPSTKAIKQRLEEVYL
                     TRYKKDAFYDLNYEQAKKYAYLINANDNIYDTKFVPVFEFVKELITSPRECSKYLSKY
                     DKKLLNLILTTEQFISKYGRIPFRGILPDLESSSENYARLKKIFIEKFSSDCKDFSTL
                     YDMQFCDEKLNSNEIQEFLKNLDDIAVVEPNMPQTITTTNTKYSEESNSYLKLVNGET
                     NIDNIDNSLRTSLQLESYSVTTMLGSIASQEIFKLITHQFVPIKNIFIYNATNQTTEL
                     IEIP"
     gene            complement(<981008..>982861)
                     /locus_tag="CAGL0L08976g"
                     /db_xref="GeneID:2891097"
     mRNA            complement(<981008..>982861)
                     /locus_tag="CAGL0L08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449166.1"
                     /db_xref="GeneID:2891097"
     CDS             complement(981008..982861)
                     /locus_tag="CAGL0L08976g"
                     /note="highly similar to uniprot|P25808 Saccharomyces
                     cerevisiae YFL002c SPB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449166.1"
                     /db_xref="GeneID:2891097"
                     /db_xref="GOA:Q6FKS8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /translation="MGKSLEWADLDYELQPWIKKAINVSGFDSMTPVQASTIPMFAKN
                     KDVVVESVTGSGKTIAFVIPILEKIISEGINNSKFKKGHFYSLILAPTRELSMQIQNV
                     VSSFLEHYPEDQYPIRSQLVVGTNEKSVRDDVNTLLDERPQILIGTPGRVLDFLQSPS
                     VKTSSCGMVVLDEADRLLDVSFFKDVEKILNVLPKQRRTGLFSATISSAGTLIFKTGL
                     RNPVKITVNSQGKNAPTTLNLFYSVMKPEEKLQNLIHIMNNIRFKKCIVYFSTCVSVT
                     FFYQYLKYLQQTDKTLREDLQVISIHGKLTTQSRRKALSTFTESLSDCILLTTDVAAR
                     GIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRAIVFLNEGREEDYIPFMEVKN
                     VDIEETDINKNKISNDNNDEFYQRFTKWLLSDRANYDLSVKSYVAFIRYYSKHSATSI
                     FRLQSLDYVSLGKMYGLFRLPRMPEITKYLQDKEKSGETVVGYYGEGWLMNPPPIDMD
                     KYAYQDKKREKARIEELKNLAQINDKKKLKAELKKKNMAWSSKTMTKEERQERRKKLD
                     LKRKAIELEIAAEAERDESDTEITQDWKDEILQKKKKKKVGSEMQGSFDDL"
     gene            <983369..>984685
                     /locus_tag="CAGL0L08998g"
                     /db_xref="GeneID:2891098"
     mRNA            <983369..>984685
                     /locus_tag="CAGL0L08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449167.1"
                     /db_xref="GeneID:2891098"
     CDS             983369..984685
                     /locus_tag="CAGL0L08998g"
                     /inference="similar to AA sequence:UniProtKB:P31115"
                     /note="similar to uniprot|P31115 Saccharomyces cerevisiae
                     YFL001w DEG1 pseudouridine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449167.1"
                     /db_xref="GeneID:2891098"
                     /db_xref="GOA:Q6FKS7"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS7"
                     /translation="MWSFIKKFIDHPPPSTTKVQKDIVEKFSRNSSYESWNKEDLIQR
                     ILELEKVSKVKKREHPDEVIDLKKDKKAKKQKTFDFSKYNTRFIALRFAYLGWNYNGL
                     AIQKDPTPLPTIEGTIIEALNKCKLVPSITPQEFEFSRCGRTDKGVSAMNQVISLRVR
                     SNLTDEEQKDPRNDHKEIQYVAILNQLLPDDIRISAVCLRPPNSFDARFSCEYRHYKY
                     LFHKDGLDLDRMQKAAKLYEGEHDFRNFCKLDGSKQITNYNRTMISANIKHVYNDFYC
                     FDLIGSAFLWHQVRCMTAILFLVGQGLEEPTLIEKMLDVTSMPQKPMYEMASDIPLLL
                     YDCKFPAMEWQEANLNDYKSVKYGKAVSALALDYHLKATVVEIFKNTLPTSDIEFSGK
                     TRINLGDGKGKVVTDYEKMLDRQVMATVEEVNSKYLERKKRNPKKK"
     gene            complement(<984786..>985487)
                     /locus_tag="CAGL0L09020g"
                     /db_xref="GeneID:2891099"
     mRNA            complement(<984786..>985487)
                     /locus_tag="CAGL0L09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449168.1"
                     /db_xref="GeneID:2891099"
     CDS             complement(984786..985487)
                     /locus_tag="CAGL0L09020g"
                     /note="highly similar to uniprot|Q12483 Saccharomyces
                     cerevisiae YPL002c SNF8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449168.1"
                     /db_xref="GeneID:2891099"
                     /db_xref="GOA:Q6FKS6"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016689"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS6"
                     /translation="MPNFGLSAFDHLNDESYKNVSSNILERQSLELEQQLEVFQGRLI
                     DFAKKHNKDLKANPEFRSRFLRMCSSIGIDPLEIFEKDQHLFNVDDFYYEISVKIIEV
                     CRETKDMNGGVISFDELRNGYFKNLNVTMEDLEKSIDMIQVLDGGFKVFSIRGKKFLR
                     SVPNEITGDQTKILEVCSIMGYASISLLRANFQWDAVRGRSVLEDMAANSMLWIDNQA
                     GNEILYWDPSWIMRS"
     gene            <985819..>986985
                     /locus_tag="CAGL0L09042g"
                     /db_xref="GeneID:2891100"
     mRNA            <985819..>986985
                     /locus_tag="CAGL0L09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449169.1"
                     /db_xref="GeneID:2891100"
     CDS             985819..986985
                     /locus_tag="CAGL0L09042g"
                     /inference="similar to AA sequence:UniProtKB:Q12341"
                     /note="similar to uniprot|Q12341 Saccharomyces cerevisiae
                     YPL001w HAT1 histone acetyltransferase subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449169.1"
                     /db_xref="GeneID:2891100"
                     /db_xref="GOA:Q6FKS5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /translation="MSIDDFKPEKWTISSNEALKLSLVSEDNAIQFSPTFTYPIFGTE
                     EQIFGYKDLVIHLAFDAITFKPFLNVKFSSKFEGSEEELVNIKEKLLEYLPIDDTIYK
                     DEEKWIDSFKKEQESIEAYKNDQNIDEYKIDNADFEIYKVNLQDPKMKRFHRRIQIFS
                     LLFIEAASYIDEDDPKWEIFIVQTKKDKKFVGYATAYNYWYYPGANNFDSESKYRYRG
                     KISQFLILPPYQGRGHGSHLYNSIVKNWRNDSSILEIVVEDPNESFDDLRDVNDLEML
                     YKDGFFNKLPQERPIPNAWIESTRLKYKIEKRQFSRLLEMILLSTGSNNFEYQVKQRL
                     LIKNKDGLEGMEVSDIKDALNKSFESLREDYDRILGKCQFSNDADGPSKKKIKT"
     misc_feature    987127..987236
                     /note="Centromere Cen0L"
     gene            <988139..>989581
                     /locus_tag="CAGL0L09086g"
                     /db_xref="GeneID:2891102"
     mRNA            <988139..>989581
                     /locus_tag="CAGL0L09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449170.1"
                     /db_xref="GeneID:2891102"
     CDS             988139..989581
                     /locus_tag="CAGL0L09086g"
                     /inference="similar to AA sequence:UniProtKB:P43635"
                     /note="similar to uniprot|P43635 Saccharomyces cerevisiae
                     YPR001w CIT3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449170.1"
                     /db_xref="GeneID:2891102"
                     /db_xref="GOA:Q6FKS4"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS4"
                     /translation="MKVLLTHTTRSLHTSRILSSSTASSLKQRLKEVIPDKREKFTKI
                     KKNYSDVKVGDITIGSVIGGMRGNQSMFWQGTSLDPEEGIRFQGLSIPECMDQMAGIS
                     EIHGGSKSLLPESMLWLLMTGELPTKEQTNSLSKELAERGKILPQSVNTIVSNLPKDM
                     HPMTQLAIGLASLNQYSQFAKEYEKGSIGKNDYWDFIYEDVLNLIASLPHLTGQIYAN
                     ITNEGKPLGEFNENADWAYNISSLLGMTTEASSANKQNLSEKRAQDFADLVRLYTAIH
                     VDHEGGNVSAHATHLVGSALGDPFISYASGIMGLAGPLHGLAAQEVVRFLVEMNASIS
                     SPENVPEIENYLWSILNSRRVVPGYGHAVLRKPDPRFNAMLNFAKERPDEFQSDKNVL
                     LMENLSTIAPKVLQEHGKCKNPFPNVDSASGILFHHYGIQETLFFTVIFGCSRAIGSL
                     TQLVWDRILGLPIERPRSLDMAALERLCNK"
     gene            <990377..>991912
                     /locus_tag="CAGL0L09108g"
                     /db_xref="GeneID:2891103"
     mRNA            <990377..>991912
                     /locus_tag="CAGL0L09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449171.1"
                     /db_xref="GeneID:2891103"
     CDS             990377..991912
                     /locus_tag="CAGL0L09108g"
                     /note="highly similar to uniprot|Q12428 Saccharomyces
                     cerevisiae YPR002w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449171.1"
                     /db_xref="GeneID:2891103"
                     /db_xref="GOA:Q6FKS3"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="InterPro:IPR012705"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS3"
                     /translation="MLAKSLKPIVQRGLSLTMRNSSNLAAVKVNDRPDPDLVLVDIAE
                     YVHHHKIDSKLAFDTARYCLLDTLGCGLAALKYNQVQNMIKPIVPGMIVPNGVKVIGT
                     DHVMDPIKGAFAIGTIIRWLDFNDCWLAAEWGHPSDNLGGILAVADYESRLYKATEGR
                     EGKLFKVRDVLTAMIKAHEIQGVFALDNSFNRVGLDHVILVKVATTAVVSQMLGLTSE
                     QTIEAVSQAFVDGQSLRTYRHAPNTGSRKSWAAGDAVSRAVNLCYLVKNAGVGTIPSV
                     LTAKTWGFYDVLFKGEAFHFNQRTSFESYVMENILFKISFPAEFHAQTAVECAMIAHN
                     MLKEKNKTYKDIKSVRIRTQEAAARIIDKDGPLYNYADRDHCIQYMTAIPLIYGRLTA
                     EDYTDEVAGNPDIDALRAKMYCEVDDTFTADYHHPDKRSIPNALLIELEDGTTLDEIV
                     VEYPVGHKFRREEGIPLLMNKFKNLLNGHFKDNSKAENIYSVSTKDDFDNLDIDDYVD
                     LYC"
     gene            <992353..>994893
                     /locus_tag="CAGL0L09130g"
                     /db_xref="GeneID:2891104"
     mRNA            <992353..>994893
                     /locus_tag="CAGL0L09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449172.1"
                     /db_xref="GeneID:2891104"
     CDS             992353..994893
                     /locus_tag="CAGL0L09130g"
                     /inference="similar to AA sequence:UniProtKB:P34077"
                     /note="similar to uniprot|P34077 Saccharomyces cerevisiae
                     YFR002w NIC96 nuclear pore protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449172.1"
                     /db_xref="GeneID:2891104"
                     /db_xref="GOA:Q6FKS2"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS2"
                     /translation="MNNGTFPQNPARQSHNNAISKLVDDARGLPSSTSELGSIQLSIN
                     EIRRRANDLRKNKDYSGDHSKAHYLLAASGLPLQEMDSSLKDLKPKQVVEQFIPKSHG
                     SELDLYLQNQKNESILSSIETLLTVASSDFNKFVNSNINIQWENYADSVKKRFGISVN
                     RDDLEENKDVANLSNESLMWGKTEGSMLDSGNSKLDVNTNYLIREKFEHYARIIFWYN
                     NCRITKNSCKLTEEFIELLKGRNDFRTKYILEAWEFLNEFDTTLGTAKSSRKILEKQF
                     LNYVDELYQNRINEGFPTNINKIKSFIESKLRFTNGSWKIPNLSIVNGKPIWAVIFYL
                     LRAGLIDDALEVAISNASSFNKIENSFVKYFKAYASSPDNELPPDLSSDLHTEYNQYI
                     KTSIDGDPFRLAVYKIIGRCDLTNKTIPAVTLSVEDWLWLNLTLVKENCSNTDPIYEK
                     YSLNDLQATVTTFGEKRFPNNYFQVLLYSGLFERALEEAYKVNELDAIHLAIGFADKH
                     LLHIKANKHADFHGLRTTDNDQDYIDFAKLLGNYTKSFKYSDPRIASEYLFLIAICED
                     PEVIDLCHEALRQLILETNEFTKLLGEVNKDGTRVPGVIEARRQLIKLDDIKEYLHTI
                     SEQTARQANNNGRIYDSLLLYQLAEEYNIVIAIVNGLLSGILSNTNFKKGMLDLYSDL
                     SKNNKDPVALAKNLVNIYLSNPEISKQVVTKNKETCVLLLKIAEIKNTYQSKQWEYTL
                     SQIEELDMLPFTGGSSIRRKAQEFTTLSGYIMNCIPNVLLMTMTSTSELINSLRASSF
                     SSISKKQQIAALKSVGKNCMIYAGMIQYKMPREVYSQLIELDLSLETM"
     gene            <995425..>996345
                     /locus_tag="CAGL0L09152g"
                     /db_xref="GeneID:2891118"
     mRNA            <995425..>996345
                     /locus_tag="CAGL0L09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449173.1"
                     /db_xref="GeneID:2891118"
     CDS             995425..996345
                     /locus_tag="CAGL0L09152g"
                     /note="highly similar to uniprot|P43588 Saccharomyces
                     cerevisiae YFR004w MPR1 26S proteasome regulatory subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449173.1"
                     /db_xref="GeneID:2891118"
                     /db_xref="GOA:Q6FKS1"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /translation="MERLQRLMMNTKVGAADANKDDTKETVYISSIALLKMLKHGRAG
                     VPMEVMGLMLGEFVDEYTVNVVDVFAMPQSGTGVSVEAVDDVFQARMMDMLKQTGRDQ
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNNRAVAVVVDPIQSVKGKVVIDAFRLID
                     TGALINNQEPRQTTSNSGLMNKANIQALIHGLNRHYYSLNIDYHKTPAETKMLLNLHK
                     EQWQSGLKMQDYQEKETENLEATKRMVAVAQQYSKRIEEEKELSEEELKTRYVGKQDP
                     KKHLAKTAENTLEENTVSVLTAGVNSIAIK"
     gene            complement(<996457..>997740)
                     /locus_tag="CAGL0L09174g"
                     /db_xref="GeneID:2891119"
     mRNA            complement(<996457..>997740)
                     /locus_tag="CAGL0L09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449174.1"
                     /db_xref="GeneID:2891119"
     CDS             complement(996457..997740)
                     /locus_tag="CAGL0L09174g"
                     /inference="similar to AA sequence:UniProtKB:P43589"
                     /note="similar to uniprot|P43589 Saccharomyces cerevisiae
                     YFR005c SAD1 SnRNP assembly defective"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449174.1"
                     /db_xref="GeneID:2891119"
                     /db_xref="GOA:Q6FKS0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FKS0"
                     /translation="MNRNDNVRAIPFLSTVNQKALNFDLEKVCSVSLSHLNVYCCLVC
                     GKYLQGREPNSPAFSHSVNENHHIFVRFQTQRFYILPEGKIIKPVDYNEVLKTIRDNI
                     SPTYEPEAVRLFPVNCTDVSSHTYYNGFIPLYDSSHRDFANVVIVMLSHIPPIRDTFL
                     VGMDTDKFDPLVKLFGLILRKHWSKNLLRAHVLTDELLSYISINYPKLLENKDPRVFL
                     LSLLNALISKCPQLKQSFDCIKGRIDSQDIDDDGKITKRRLLPFTCLTLDLPGDSVFK
                     SSSVDEAILQTNIEDLMKKYDGEQETLVGNTIKRYRIAELPDYLILHYHRFDPNSKQP
                     VKNRKRAIVTFPTSIKILDVDFVLIENVVHKQETKNSPLKKIITDDYSSKWGIQLNNK
                     STGRWMEFYGNHIKQKDEEFLFLDETYIQLWKKQN"
     gene            <997847..>999319
                     /locus_tag="CAGL0L09185g"
                     /db_xref="GeneID:2891120"
     mRNA            <997847..>999319
                     /locus_tag="CAGL0L09185g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449175.1"
                     /db_xref="GeneID:2891120"
     CDS             997847..999319
                     /locus_tag="CAGL0L09185g"
                     /inference="similar to AA sequence:UniProtKB:P43590"
                     /note="similar to uniprot|P43590 Saccharomyces cerevisiae
                     YFR006w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449175.1"
                     /db_xref="GeneID:2891120"
                     /db_xref="GOA:Q6FKR9"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR9"
                     /translation="MSKAALFLAVLILLSVLWRRCRYNRQLSDGNVTSKILYPSRLHA
                     TKVKELFLERKNLGGSGKRTGLLLFGNKAESNKYCDTVRKFRQERYFYYLSGVELPGC
                     AIIHDFWNDKVILFLPNVNQDDILWSGMPLSLKEAKEKYECDEVYHLSSLDEVLKEQF
                     SEHSLFTTDTDNFDSDYAKSVVRSSDKDLFYSLKKSRMHKNWYEIRQIKEAVNISERC
                     HRAIISRLSHLKAELDVQAEFVYEAKRQGARILAYDPVCAAGANGGILHYVKNRDLIK
                     NQVSLLVDAGVEFQQYASDITRSLPLGGKFTHNHRLIYDAVLDMQKSVAEKMKPGVYW
                     EALHLLSHKILIKHLLRIGIFRNEFSELEIFNRKATIAFYPHGIGHLIGLDVHDCGTN
                     TDKFNDDLYFTNLRFRGKLEEGMVVTNEPGCYFNHMLLKKYLFNSPERLQVVNLEVLK
                     LFFEIGGVRIEDCYHITRMSNEKLGSLPSNPDEIEELAAV"
     gene            complement(<999571..>1001748)
                     /locus_tag="CAGL0L09207g"
                     /db_xref="GeneID:2891121"
     mRNA            complement(<999571..>1001748)
                     /locus_tag="CAGL0L09207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449176.1"
                     /db_xref="GeneID:2891121"
     CDS             complement(999571..1001748)
                     /locus_tag="CAGL0L09207g"
                     /note="some similarities with uniprot|P53394 Saccharomyces
                     cerevisiae YPR003c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449176.1"
                     /db_xref="GeneID:2891121"
                     /db_xref="GOA:Q6FKR8"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR8"
                     /translation="MSKQQRLKPADDFSYGSIDINIQQMDPRTGRMSSPTPRKYNKDL
                     SPNNGIRVRKVDLNTIDQRPKYQELLPYYLPCMSWIPHYSWEIFFGDLVAGISLASFQ
                     IPLALSYATSIAHVEPLCGLYSLAITPLIYAIFGSVPQMIVGPESAISLVVGQATEKF
                     SAHDSEISTVTITMMITFISGVVLFFLGSVRLGFLGNILSKALLRGFISSVGLVMIIN
                     SLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILSLICFLVLISTRIA
                     KKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLS
                     NENRALYSSLWNEGLAVAMLGFFESTTASKSLGSDYNLTYSSNRELIALGFMNIVGSL
                     FGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSVITT
                     VIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIVK
                     HSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENITLEQFEHCYIVKIPEPLTFTN
                     GEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTSMDSGSAQILLEIIR
                     SYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVETVQVNNAVTARYHMNDMIEKTPFF
                     TCIEEALLIIERRAIDGDTNGNDLMHVRSGSVISNTLFNSNLV"
     gene            complement(<1002225..>1003238)
                     /locus_tag="CAGL0L09229g"
                     /db_xref="GeneID:2891122"
     mRNA            complement(<1002225..>1003238)
                     /locus_tag="CAGL0L09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449177.1"
                     /db_xref="GeneID:2891122"
     CDS             complement(1002225..1003238)
                     /locus_tag="CAGL0L09229g"
                     /inference="similar to AA sequence:UniProtKB:Q12480"
                     /note="similar to uniprot|Q12480 Saccharomyces cerevisiae
                     YPR004c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449177.1"
                     /db_xref="GeneID:2891122"
                     /db_xref="GOA:Q6FKR7"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR7"
                     /translation="MLSSRLVTRAFRPNNFRFASTLTFLESTANGEISPASLSALNAS
                     SKLKNPITAVILGSGAPSAAETLKNNYKCDGLSNILVLNDSRFDHYLPEKIAPALAEL
                     LKSDDYSHFVTASSSVGKNILGRIGAELDSQPVSDVLEIKDEQTFVRPIYAGNIITTI
                     KSSQKKQLVSIRPSSFDAVASGSTSGANITEKSVDIPDSNAIEWESENILKSGRPELG
                     SAKVIVSGGRAFKDKETFEKLLTPLADTLHAAIGATRAAVDNGFCDNSLQIGQTGKVV
                     APDLYIAAGISGAIQHLAGIKDSKVIVAINNDPEAPIFKVADYALVEDVYKVLPELTE
                     KLK"
     gene            complement(<1003976..>1004824)
                     /locus_tag="CAGL0L09251g"
                     /db_xref="GeneID:2891123"
     mRNA            complement(<1003976..>1004824)
                     /locus_tag="CAGL0L09251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449178.1"
                     /db_xref="GeneID:2891123"
     CDS             complement(1003976..1004824)
                     /locus_tag="CAGL0L09251g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449178.1"
                     /db_xref="GeneID:2891123"
                     /db_xref="GOA:Q6FKR6"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR6"
                     /translation="MSLDGIINGYTVLNLNHSSDRFSIYNAKDRNGSPCLLKVCHDGG
                     SKQTAYKQATSDAMLESFIYNNNGEEIQCYIFPTSTLDYFTCNQSSNPTKSHQSRLKT
                     LKSGIRYELLKTPTPDGGMQFACHSSDDCDDDDNDDDDDDEEEEEEEEEEEEEEEELE
                     NSDSDSDEDEDLEVNIIVHDDIAKCPLEPILNSKNQPNAELEYIHTSQEHIHFVNNPV
                     LQRVCHRQHRPIVRTPVPKSCPAYHDGVQDNIQQKKLSCQKGQFELQMLQSSMLKRRS
                     TSSAGH"
     gene            complement(<1006160..>1007875)
                     /locus_tag="CAGL0L09273g"
                     /db_xref="GeneID:2891124"
     mRNA            complement(<1006160..>1007875)
                     /locus_tag="CAGL0L09273g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449179.1"
                     /db_xref="GeneID:2891124"
     CDS             complement(1006160..1007875)
                     /locus_tag="CAGL0L09273g"
                     /inference="similar to AA sequence:UniProtKB:Q12031"
                     /note="similar to uniprot|Q12031 Saccharomyces cerevisiae
                     YPR006c ICL2 non-functional isocitrate lyase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449179.1"
                     /db_xref="GeneID:2891124"
                     /db_xref="GOA:Q6FKR5"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR5"
                     /translation="MLRNYPKNLIGPRTIARTTHTSCYNGGSIKTYVEDQVKAVTEWF
                     GSDRFQNIKRTYTPLDVVKHRGSINPCEVIYPSAFPSRKLFSLVEEHFKDKKPLHTLG
                     VLDPVQMTQLSRCEDLKVAYVSGWACSSTMVGSTNDVSPDFGDYPYNTVPNQVERIMK
                     AQQMHDRKAYLEKFMTDQKSSSNAEFIDYLKPIIADGDMGHGGPTTVMKVAKLFAEKG
                     AAAVHLEDQLVGGKRCGHLSGAVLVPTGAHLSRLISTRFQWDIMGTENLILARTDSCN
                     AKLISSDIDPRDHSFIQGILNPSKTDRWADKLLELERKEVDKSIIAEAEKEWYDQNKL
                     YTYEEMIQIRFTESEYKDYLTRKDKYLQTQGKNFLSVREMKNIATEVNSTKRLEFCWM
                     APRTKEGYYMFKGGMEPAIRRSLVFAPYSDMIWLETKTPDLEQAKSFSKEIHNTYPHV
                     KFVYNLSPSFNWTAHGFNGDKLKSFIWDLAKEGFVLQLVSLAGLHTNAASFWDLAKNF
                     QKDGMKAYVDKVQKIEKQLDCDVLTHQKWSGAEYMDSLLNVVQNGSSSQTMSTSGESF
                     TENQF"
     gene            complement(<1008408..>1010390)
                     /locus_tag="CAGL0L09295g"
                     /db_xref="GeneID:2891125"
     mRNA            complement(<1008408..>1010390)
                     /locus_tag="CAGL0L09295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449180.1"
                     /db_xref="GeneID:2891125"
     CDS             complement(1008408..1010390)
                     /locus_tag="CAGL0L09295g"
                     /note="weakly similar to uniprot|Q12188 Saccharomyces
                     cerevisiae YPR007c SPO69 protein required for meiosis and
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449180.1"
                     /db_xref="GeneID:2891125"
                     /db_xref="GOA:Q6FKR4"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR4"
                     /translation="MAVSGLPLLKESDPTQYDSVAKVWLLATLSGGNGVGGYRIRRGL
                     VDSRFKKKDILNISIPKTCKVISRSNEALPLRQVSNLLYGVTICYNKKAEFILNDLDA
                     MLVQLQRRLLLTNTGKSTVTVRSTVANNSTLINLNSNNFLLRDDPLFKIDFVKNFSLD
                     ESEKQLSDAQTIRKQDYINELGGLLVPAQTNSYQNVNLKSRLLKRPYTIDSDDLEELP
                     VDESLNLNLEFDDIMSESEKTELGINSINKDIDLDINKLFPSDKTSLLGAISEETFDY
                     YHNDEEAEEDSNLKDEDTLEQPPRKKLKPKNVFSFVKIKYDDRISISNEQIRRQQELY
                     KDHMAILQRKVVDNSGKKLSTTYQLKPFEDLIVNSKETDIMIREKQQAKKPNELLTSL
                     NDLFSIEEDIERGRRASSDRQSSKSRSQSLRSEEIGRRVDSSKILDNSTADNENSSSS
                     HLMINLEQIDEDYETNDNSSEFSETDRHNFLNLDLQVPPSSSGRPSSSIRDIVDILES
                     NTMHPRIRPRQYTTDSERIDEHSIYTSELNNIESTASDQYPRSTLNVLDIQAKRFYDF
                     LKQRMEEMGTPIANSARFKNKLSLEYIIPGRKAMIVDDGHDGHVEIVSKSIAANVFFS
                     LLTLATQNLVGLKQRHQENMTQGFMIPSSSDIIVYA"
     gene            1011594..1011664
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09317r"
                     /db_xref="GeneID:2891126"
     tRNA            1011594..1011664
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09317r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2891126"
     gene            <1014256..>1016889
                     /locus_tag="CAGL0L09339g"
                     /db_xref="GeneID:2891127"
     mRNA            <1014256..>1016889
                     /locus_tag="CAGL0L09339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449181.1"
                     /db_xref="GeneID:2891127"
     CDS             1014256..1016889
                     /locus_tag="CAGL0L09339g"
                     /note="some similarities with uniprot|Q12753 Saccharomyces
                     cerevisiae YPR008w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449181.1"
                     /db_xref="GeneID:2891127"
                     /db_xref="GOA:Q6FKR3"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR3"
                     /translation="MVLINGVKYACERCIRGHRVTTCNHSDQPLMMIKPKGRPSTTCD
                     YCKFLRKNKKTIPDESRCTCGRLEKKRLQKEAEEEARRKGLPLPVPEKKTRKKKEVSS
                     MPPGIISPTSSGATRKKMISLEPRKAISSDHLHLHHSQTSPTMATNGKSLRRRNNTTS
                     SSGLTIGLKEQNSFSSFSGHVGDVTSPASINELSVHPSNMSANKFYNFSNSLNENDES
                     TNLTSNPFLDRIDSSTSLESSVFNRNIRPNNDSSSLLGRDFLDTIDTGVNNQQTAIHS
                     AGVSGTSHSSTHTHPVPTGRVTKEYHHIPSMTSISSLHSTQSLEHNFNLPQSPPLSTV
                     SFSLLSDTLSPPTHSGVFRKSNNMSHNNQPIRSLDWESGNQSDNNISPISNNNISQGD
                     RNDYIPNGKNNHNYTASQPRKIQRSVSEQNSHENATIGLNPLYNSKKITPKTRTHVGE
                     VIIPLDEYVPPDINGIGRVNGSESLTAQDWPLPIDEAPNGVEFNDVMNNRNSDRDNNM
                     ANDIQSHYSDNFSTTATEAEQAIMSDSDIITSNPKDLAYTGLLDMLSNGSSVSNMSKM
                     NFFGHGNNKNDRFSVNLNSRDPNNKQNNSIAVSRYSNDYIDDKKVTTDNASTRSVEVL
                     SLTPSFMDIPDRMESNKTEIAADSTNSYNQTRSDSDRRAEFQHFQEQQMLARQAQSQL
                     YRKKNQTSTQDEPTQSFTSSSKFDGSDPDPILGIRKPSFEDNNMFSNASSHNALANPK
                     SNSISFDASRESSDYKGVLGKQPSNLMHVREVNNIDDSLLPTFADIDRYSGGDAYMDV
                     DSSLAGVSSREEDSTRANNNQDTGEDFDNKGRFNLTHHTSPTLGRDDNSPISSLQVVS
                     PPSQLLSDEGFAELDNFMTSL"
     gene            <1018071..>1018406
                     /locus_tag="CAGL0L09361g"
                     /db_xref="GeneID:2891128"
     mRNA            <1018071..>1018406
                     /locus_tag="CAGL0L09361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449182.1"
                     /db_xref="GeneID:2891128"
     CDS             1018071..1018406
                     /locus_tag="CAGL0L09361g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449182.1"
                     /db_xref="GeneID:2891128"
                     /db_xref="GOA:Q6FKR2"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR2"
                     /translation="MPHFLLWGEKKKRDNCFWGYICNGFFSIQSHCNHLANGNQLENP
                     FSAVVCFFANSSASVRTYTYDPFVVPFISFVGTRRFLVFELAKLMKCSRLWNDFLRES
                     LSSGVLIQI"
     gene            <1020856..>1021956
                     /locus_tag="CAGL0L09383g"
                     /db_xref="GeneID:2891129"
     mRNA            <1020856..>1021956
                     /locus_tag="CAGL0L09383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449183.1"
                     /db_xref="GeneID:2891129"
     CDS             1020856..1021956
                     /locus_tag="CAGL0L09383g"
                     /note="some similarities with uniprot|P53032 Saccharomyces
                     cerevisiae YGL162w SUT1 or uniprot|Q12286 Saccharomyces
                     cerevisiae YPR009w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449183.1"
                     /db_xref="GeneID:2891129"
                     /db_xref="GOA:Q6FKR1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR1"
                     /translation="MATSITVLNRDTSLPPLLLPNLSSSRASFGDSLSSVPSSRSNSS
                     STTLSRIDSTSSAASSVSSTDLFLSSQHVNLELKKARTDDHYYYNPAFAAATLSPVSS
                     LPKPTQMLDVPTLSTLPSFTSTYTTHSPTTPGEVIGSANIGATLSKFESRAFKVSKSK
                     KAILNLASPKQKLPSPKLGVIQKPISVPPKKSSPFVSAFNTMASNIKSTSDLVANNAG
                     KRQRIGPSCDKCRSKKIKCDAKIDILCQDEAVLHMFGQSLHHELTKHEIETQLGQEVY
                     SQSSTFAYISKDLMSKIESREPDAKIIKHLDKIIYFQPCTSCSRKKNTAVCAFSKGFT
                     RADINIFSKIGSRVAQKPIYEMTYKEYKKAGF"
     gene            complement(1022510..1022580)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09405r"
                     /db_xref="GeneID:2891130"
     tRNA            complement(1022510..1022580)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09405r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2891130"
     gene            complement(1022966..1023037)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L09427r"
                     /db_xref="GeneID:2891131"
     tRNA            complement(1022966..1023037)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L09427r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2891131"
     gene            complement(<1023487..>1023843)
                     /locus_tag="CAGL0L09449g"
                     /db_xref="GeneID:2891132"
     mRNA            complement(<1023487..>1023843)
                     /locus_tag="CAGL0L09449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449184.1"
                     /db_xref="GeneID:2891132"
     CDS             complement(1023487..1023843)
                     /locus_tag="CAGL0L09449g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449184.1"
                     /db_xref="GeneID:2891132"
                     /db_xref="GOA:Q6FKR0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR024888"
                     /db_xref="UniProtKB/TrEMBL:Q6FKR0"
                     /translation="MATKKRSRSDKNGGKKRATDATTRRKQTKTTPKNTLYIRNLNEK
                     INTKRLRHGLFMLFSIYGEVLKVTINFKALRAQAFITLRSVEEASLAKAALEGEVFFN
                     IPLSIEFSKANTKDLE"
     gene            <1024207..>1025439
                     /locus_tag="CAGL0L09471g"
                     /db_xref="GeneID:2891133"
     mRNA            <1024207..>1025439
                     /locus_tag="CAGL0L09471g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449185.1"
                     /db_xref="GeneID:2891133"
     CDS             1024207..1025439
                     /locus_tag="CAGL0L09471g"
                     /note="highly similar to uniprot|P10363 Saccharomyces
                     cerevisiae YIR008c PRI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449185.1"
                     /db_xref="GeneID:2891133"
                     /db_xref="GOA:Q6FKQ9"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="InterPro:IPR014052"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ9"
                     /translation="MTETIKPNGPSSMDMQYYYQYLYPFKQIFQWVNHSQKPSRDIIN
                     REFAMAFRSGAYKRYNSYGDVQEFKEAIEKSNPDRFEIGAIYNKPPKERDSLLKSEMV
                     PLEKELVFDIDMDDYDTFRTCCSGAQVCYKCWRFISLAMEIINVALKEDFGYNDFVWV
                     FSGRRGAHCWVSDKRARALNDIQRRNVLDYLNVVRDRNYDKPLSLKRPYHPHLSRSLQ
                     ILKGHFVDIILEEQDPWRDDQHAIKTLLPAFTEKPVIEALRKYWTENPNRSSKAKWGD
                     IDTIASNLNITNKRQKEIMNNRLREAKEDLVLTTLYPKLDVEVTKQTIHLLKAPFCIH
                     PATGNVCVPIVDNFTPEKAPKLIVLQNEMEKSNNNVSETSLQPFLDYFQSYVSQLLKH
                     ELGSVKREREEDVKSLDF"
     gene            complement(<1025472..>1027637)
                     /locus_tag="CAGL0L09493g"
                     /db_xref="GeneID:2891134"
     mRNA            complement(<1025472..>1027637)
                     /locus_tag="CAGL0L09493g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449186.1"
                     /db_xref="GeneID:2891134"
     CDS             complement(1025472..1027637)
                     /locus_tag="CAGL0L09493g"
                     /inference="similar to AA sequence:UniProtKB:P40566"
                     /note="similar to uniprot|P40566 Saccharomyces cerevisiae
                     YIR007w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449186.1"
                     /db_xref="GeneID:2891134"
                     /db_xref="GOA:Q6FKQ8"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ8"
                     /translation="MDRITIKDGQFYDSRGRVIQLRGVNFDPSVKTPYGIRSADRIDF
                     ETVDDVSFVGHPVPLPEVEDHINRLKSLGFNMIRFPITWESLEHKGPREYDYQYMDYL
                     INVLSKIEEIGGIYVYLDPHQDVWSRASGGSGAPIWTLYSAGFNPSRFYETHAAILHS
                     DYVNQHSKEEFVENPYPKMLWTTNYYKLACQTMFTLFFAGNIFAPKCEINGQNLQSYL
                     QDHFIDAFIELYERIIEKAPHLIQNNCVIGIETINEPNEGLIGTPDIGEVPESRLLRL
                     GGTPSAFQSFILGEGYETEVDMYKITSFGPKKYGKRVLNQKHENCWLTGEERDRIDKL
                     YGWHRNDEWKAHTCIWRLHEVWEIDHESGNPKILKPKYFCEQDDIPKTIDDRYFIEVF
                     FRDYYINFFKKIRKLSQELIVILQAPVFRMPPSIKGTNLVDDRVACAGHFYDGYTIMF
                     KKWSGLFTIDTYGMVCKKYSNPVSSLALGTNNVKNCIKQQLYEMQIDAQKNLGLIPMI
                     FTEIGAPYDLDDKKAYSTGDYTSQISAIDAIGHALEGNNFSFSMWCYNHENNTKWGDN
                     WNNEDFSVWSNEKHKKDNIEVKMLSGNMPNSVKLMKETEAIRFGLPVDKLDLCGFRAL
                     DSLSRPFPISIDGEFLTAEFNHKKKTYHLEIKTKNINNETKIYVPRYHFELECCVIST
                     TSGEIHYDPDHQIIAWKSASVGKNTLRISKRNKSACVIC"
     gene            complement(1027973..1028044)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L09515r"
                     /db_xref="GeneID:2891135"
     tRNA            complement(1027973..1028044)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0L09515r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2891135"
     gene            <1029031..>1030233
                     /locus_tag="CAGL0L09537g"
                     /db_xref="GeneID:2891136"
     mRNA            <1029031..>1030233
                     /locus_tag="CAGL0L09537g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449187.1"
                     /db_xref="GeneID:2891136"
     CDS             1029031..1030233
                     /locus_tag="CAGL0L09537g"
                     /note="highly similar to uniprot|Q03558 Saccharomyces
                     cerevisiae YHR179w OYE2 NADPH dehydrogenase or
                     uniprot|P41816 Saccharomyces cerevisiae YPL171c OYE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449187.1"
                     /db_xref="GeneID:2891136"
                     /db_xref="GOA:Q6FKQ7"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ7"
                     /translation="MPFKHDFTPVALKDTNLFKPLKVGNTEVLQRVAMAPLSRFRADP
                     QGNVPNKNWTEEYYRQRSQRPGTMIITEATFISAQAGGYDAAPGIWTEEQMEQWKKIF
                     KAIHDNKSFVWVQMWALGRQAFPNNMARDGLRLDAPSADLYMSDKQKEVAKENNIAQH
                     ELTKEDIKQYIKDYVKAAKNSVESGADGVEIHSANGYLLNQFIDPKSNRRTDEYGGSI
                     ENRCRFALEVVDAVVDAIGAERTGIRLSPYGLFGNMSGGFEPSIVAHYAYLIGELEKR
                     GIAGKRLAYIHLVEPSVTDLMLVEDQGEYKEGTNDFAYSIWKGPIIRAGNYALHPELV
                     KEQVKDPRTLIAYGRYFISNPDIIDRLENGLPLNEQDRPTFYTPTAEGYIDYPNYNDA
                     LQLGWDKQ"
     gene            complement(1030465..1030535)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09559r"
                     /db_xref="GeneID:2891137"
     tRNA            complement(1030465..1030535)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0L09559r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2891137"
     gene            <1030941..>1031375
                     /locus_tag="CAGL0L09581g"
                     /db_xref="GeneID:2891138"
     mRNA            <1030941..>1031375
                     /locus_tag="CAGL0L09581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449188.1"
                     /db_xref="GeneID:2891138"
     CDS             1030941..1031375
                     /locus_tag="CAGL0L09581g"
                     /note="highly similar to uniprot|P33317 Saccharomyces
                     cerevisiae YBR252w DUT1 dUTP pyrophosphatase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449188.1"
                     /db_xref="GeneID:2891138"
                     /db_xref="GOA:Q6FKQ6"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="InterPro:IPR029054"
                     /translation="MSGNVLKVQLRSEHGIAPTKGSVYAAGYDIYASADYVIPAMGQG
                     MVPTDISFTVPEGTYGRIAPRSGLAVKHGIQTGAGVVDRDYTGEVKIILFNHSQKDFE
                     IKRGDRVAQLILEKIVDDAEVVVVESLEDSQRGAGGFGSTGK"
     gene            <1031742..>1033127
                     /locus_tag="CAGL0L09603g"
                     /db_xref="GeneID:2891139"
     mRNA            <1031742..>1033127
                     /locus_tag="CAGL0L09603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449189.1"
                     /db_xref="GeneID:2891139"
     CDS             1031742..1033127
                     /locus_tag="CAGL0L09603g"
                     /inference="similar to AA sequence:UniProtKB:P40568"
                     /note="similar to uniprot|P40568 Saccharomyces cerevisiae
                     YIR010w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449189.1"
                     /db_xref="GeneID:2891139"
                     /db_xref="GOA:Q6FKQ5"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ5"
                     /translation="MGDKDNGLHAGETDGDDEGFEFRRHSNLGVPTLGERLDSLHEIK
                     SARRMDHFNSSRNSLRGGTASSSQQVPEVDNRAHINGINTSLQVEGNSSVKYLVPLEY
                     VTDSGSIPRDKLIKVIDNEAALKSSLNERARNKRLSLSQRGRRLSMLSTGVDRHVIVS
                     PHKEVPEQEFYKHVGDLSFGKSLQLRQLFNWCCDRTYTRIQEADRKKTQSQTLEENGS
                     YGDPKKITMNIIKSFVHDLKKGTLDIDWEAEEEEEEDDYSGNGNDTELNALFDDHNDG
                     NTRHTSARQNLTLYDDEFDITLGIQPTRPELEYRNNKKNNRQSTRKRKIQTPHKKLPN
                     TKNVENEKNLIMLKQKIDILENDINEWANTLDSHDPQKEWQLIKDVKPDNTTPEQTIT
                     NANPVKELEDRLKAMSMNAHLLDSTSKTLLELSRIKLDKLRRAYYDTAKNEKKQIEST
                     RLLRGLASSLN"
     gene            complement(<1033560..>1034402)
                     /locus_tag="CAGL0L09625g"
                     /db_xref="GeneID:2891073"
     mRNA            complement(<1033560..>1034402)
                     /locus_tag="CAGL0L09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449190.1"
                     /db_xref="GeneID:2891073"
     CDS             complement(1033560..1034402)
                     /locus_tag="CAGL0L09625g"
                     /inference="similar to AA sequence:UniProtKB:P38637"
                     /note="similar to uniprot|P38637 Saccharomyces cerevisiae
                     YIR011c STS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449190.1"
                     /db_xref="GeneID:2891073"
                     /db_xref="GOA:Q6FKQ4"
                     /db_xref="InterPro:IPR013868"
                     /db_xref="InterPro:IPR029449"
                     /translation="MSGQMFWGKKEDGKRKRSFQESYETPKVQKCVRKRRPALNVQGQ
                     PLPPQRSLEMMSKDQLMSVLMEVMRQHPEVGSTFQAKVSSYQFASEKYQQLLKGKVEQ
                     LYSNIPYNRSYDNTNLDDYAFVRMKPYITELLNCLVDCALDNLPPRKSDLHESLKFLE
                     SCTQLVLDLPRFESGSNNYYYDKCLEQISHLWCSLIEQISKDIHMVMNTNMEEWITKL
                     NAYNERSNGLLTSAVTLFKSLASDGDLLGDQQNEMESPAYVAGPGLLLESNPSYLMHN
                     KYSM"
     gene            <1034737..>1036026
                     /locus_tag="CAGL0L09647g"
                     /db_xref="GeneID:2891074"
     mRNA            <1034737..>1036026
                     /locus_tag="CAGL0L09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449191.1"
                     /db_xref="GeneID:2891074"
     CDS             1034737..1036026
                     /locus_tag="CAGL0L09647g"
                     /note="highly similar to uniprot|P35184 Saccharomyces
                     cerevisiae YIR012w SQT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449191.1"
                     /db_xref="GeneID:2891074"
                     /db_xref="GOA:Q6FKQ3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ3"
                     /translation="MEREGSPEDEFIGNDEVDQVIEVEGGEPIEEDDGMDEAMEGGEV
                     EETIEVDLSNNSRTYFDKHTDSVFVVAHHPSLPLVASGGADNVIHLWTSHSQPPKFAG
                     TLSGHTESVIAAHFTPDGKFLVSADMTGKLLVHASVKGGAQWKLVSELQEVEEIIWLK
                     VHPKVSGAFALGATDGSVWCYQINGEGASATVEQLMSGFSHQSECTMGEFINIEKSEE
                     LGTLDLVTCSLDSSIVSWNCYTGQVNFKIAQPELKGMECPWISLSVAPVEMTKGNGGI
                     LACGSNNGVIAIINCNNNGAVLHLSGVIELKPDQEELDSSIESIAWAKGFPLMALGLV
                     GGEVLLYDTNMWRVRRKFVLEDSVTKIVFDSRDNLFVSCINGKVYEYDSRTGQEKFTF
                     LGHNMGVLDFIITEMGGDKRLITAGDEGVSLVFDVQA"
     gene            <1036568..>1041556
                     /locus_tag="CAGL0L09669g"
                     /db_xref="GeneID:2891075"
     mRNA            <1036568..>1041556
                     /locus_tag="CAGL0L09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449192.1"
                     /db_xref="GeneID:2891075"
     CDS             1036568..1041556
                     /locus_tag="CAGL0L09669g"
                     /inference="similar to AA sequence:UniProtKB:P34241"
                     /note="similar to uniprot|P34241 Saccharomyces cerevisiae
                     YKL014c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449192.1"
                     /db_xref="GeneID:2891075"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ2"
                     /translation="MENSTSENRLREVVDELFPQAESYNYSDLILLCERGFLNQVVQS
                     WSYFAQVNNHVRFGKLTNLLFKTLVVLGRDTSIEIHGSALIKLILEQYAKVMYRGLSS
                     MRRGNTIPTLKLMKQIIHFGEGKHLQDFLSYFDLKLSIIPKILTPSKAELNEPTDAPS
                     YREYFISFFIELIAKAPTIIRKDILMDNYKILSAWFKFMDKADSHEILLQTITLFINS
                     ILLEPSFKKMTKTKVLNEMVLMKLHTLYYAGDKTLKKKVNEFFKIYGSDPVHSVAFTD
                     DCVWFKTSPYNNDQKGVTITINQRNFTIYNKLLFNLLKIFKPWDDVMQTNTVVSILKN
                     VPELVAPYSHYLLSLGNHDPNITSYWSGLTLLYGKIIRLDIPKFMTVVETDEVPDATI
                     VIESIIPAPLSKGSSTKTLQYDNYLVKMMGAQLLVFSFQKLRKVFDLYEMKGWSSKKL
                     ELSSLFLSRIPEMAVISNALNQVYSNSPKKLILLLTLTMILREYAELFPNLFSLNLPS
                     SNIFMDILAKESFNEIEFAILDNFLKFQPYCGSQTKWWTSTESQRSLFTSMILLGATK
                     DLSIRKKVETLLDGLIKNTIIFSTGLIKPIAALINSLEAVCKTDSNGEQINKIATLLD
                     SSIMRCINTPYKYSDKATNFNQISPFIVTLTEQWKFVDKSTDYDLVLNWLMILTRNLW
                     VVGESRDGILALLRKELPESTGEINDYFDINIYSNNENCIKENDHILKQMTDQSFFQM
                     ITLSSVKELSKGSARIPTSQFDCASLFFYLELIILDANIAFDKICEHSIMNAISMIDG
                     YLQTDVSFKIQDITNIENILRILCTSSEDMKKGSFAMLKYFDLLISNNIKSPAFSKFI
                     LDLLNSSKFNYTSSFTTLFPKIIEYLNGYELEKINDKSILASDPTTAVRKLATETDAT
                     ISFELLEACIAESEQSDNALSLVTVIKDGRVECDDSSKLIAAVIDKTELLSAFFQSNY
                     FDEKKIESYISVINSPSPCLALHIRDVTNNPIATEYVYKVADYCIKNLNNLTDSEMEN
                     FLKIIVEDTEILNQENLLRVSEFALEEYHHKFRAVNVLLVRNIVAIDDALKKKWLTKL
                     VLYITKYLSERENMNFNFKELIKATDDYFSDFNIWENVAPSLLNTQLEVILQSKWISN
                     TDILHYLIKLTLGSSKKIASQRVIQLLLNNENITLNDNKANYITKYLTALLINSICAT
                     DIKNTCTTLTLRKCVSFYRGSLAAHDRVLLNVIETAEAQTGSSWINDVITWDYIQNAG
                     DVLDVVSDINLISQINGGFVVTLRKDFIENTCKFAGQVGRPNFTDDIRSELQHIDSNN
                     NDSFFDSINRTPRNVLESCYDPYALMLISIQNDELVQAASHAELKESVNHTYRMDVQK
                     FLDAALFQVVITCLAWDGTISDVANIILKQLLISLSEIKETSDLFIFKLLLQKIIFSI
                     EHAKARSKNSSLPKVVFHFISRLIPLLMDPANPLYESAYRWVLDSPFIRSNEIPLTHN
                     FIEISESGSNHETYFKQLVWVLESLEQGIIDKHDLGILKSKGVLDWLLSLPNINCLSV
                     RIQGLISSIIYRLQRIENGGVSLITRFAGISSFEMRSVILNDKLREAKANIEKNDKNT
                     NHQRQYLVTKEQQLASEEILEGFATIIQSQKRLREWTNYDEDNILKRICHSK"
     gene            complement(<1041796..>1044270)
                     /locus_tag="CAGL0L09691g"
                     /db_xref="GeneID:2891076"
     mRNA            complement(<1041796..>1044270)
                     /locus_tag="CAGL0L09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449193.1"
                     /db_xref="GeneID:2891076"
     CDS             complement(1041796..1044270)
                     /locus_tag="CAGL0L09691g"
                     /note="some similarities with uniprot|P25502 Saccharomyces
                     cerevisiae YKL015w PUT3 positive activator of the proline
                     utilisation pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449193.1"
                     /db_xref="GeneID:2891076"
                     /db_xref="GOA:Q6FKQ1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ1"
                     /translation="MGTVSGKGNGVRKSSTSSDPPTEKRVACLRCRQKHIKCPGGNPC
                     AKCVISSATCEYLAPTKKIAVNVNFIKQMNFGISELKKENETLRSVISMLEDKVRKFE
                     SHFGEETNKIINNTNGNSHTNIAHTLVELDKNNDLQDDSKDEMISSDFAQRSGRLIET
                     QNGLKYFVGSSSMTLFGLELQSLISSNVTEKNLEPLPINLKLDNRDDFTNYRKFIEDA
                     NVSTQLPQLSGMSPVDRINQLSLRKFEIVLTHLYWGSADRFIITLPEYEYAVLLVDKF
                     ISFNEGCFYFFNEGLVRRELDIIYAEESLPYKNDNTLQTIWFCKMFLIFAMGEMYLCS
                     DESNMENVKKHDDSKIPGYYFFTIGSKLFNCLFSGERLECVTKEGGIEALLLYSFYLQ
                     VLDCTVASYFYIGQAVRSCLILGMHVDAQGDSISRAELEHKRRLWWTVYMFERMLSSK
                     AGLPLSLSDATISTELPSDQTLHPSIDENYIFSPAENIVNCISIVRINAQILKKMYQR
                     QPNSNILPILKSIIQSLLEWRNTLSDSLQTDFTNSKLEITRLGTNIFTEFFQGINLAI
                     RPLLFHFTSIQLKKFKASNTYVDLAKYSTTISSLLNCSLQASVNTIRALRTIMDQNLV
                     AVFGYMDREYLFTSSCTLLLFNVAFGIHGQTHEYLDQALDMLTVMKTMGNIAAGLRRA
                     QLLTLMLNMDFHGIMRDLISKHSDSFQQNDEELLNTLEKHSTKEATTLYNAIKETLEK
                     SYEIPITKKDTQIMEQNKNQLEQINYADNDDLQEVLDAMDDIDQTDSKLWKEISDQAM
                     WLGDTMDPAGAAGIELELGDNLLMLK"
     gene            <1045608..>1046138
                     /locus_tag="CAGL0L09713g"
                     /db_xref="GeneID:2891077"
     mRNA            <1045608..>1046138
                     /locus_tag="CAGL0L09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449194.1"
                     /db_xref="GeneID:2891077"
     CDS             1045608..1046138
                     /locus_tag="CAGL0L09713g"
                     /note="highly similar to uniprot|P30902 Saccharomyces
                     cerevisiae YKL016c ATP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449194.1"
                     /db_xref="GeneID:2891077"
                     /db_xref="GOA:Q6FKQ0"
                     /db_xref="InterPro:IPR008689"
                     /db_xref="UniProtKB/TrEMBL:Q6FKQ0"
                     /translation="MSLSRTAAAANKLDWAKVISSLKLTGKTATQLSTFKKRNDEARR
                     QLFELEQQPVEVDFAHYRSVLNNSEVVDKIERYVKSYSPVTVDTSKQLGAIASFEKLA
                     LENAKETEEIVSKELKALKETLANIESARPFDQLTVDELVKAKPEIDERVAELVKNGK
                     WEIPSYYQKFGNMSVM"
     gene            <1046657..>1048744
                     /locus_tag="CAGL0L09735g"
                     /db_xref="GeneID:2891078"
     mRNA            <1046657..>1048744
                     /locus_tag="CAGL0L09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449195.1"
                     /db_xref="GeneID:2891078"
     CDS             1046657..1048744
                     /locus_tag="CAGL0L09735g"
                     /inference="similar to AA sequence:UniProtKB:P34243"
                     /note="similar to uniprot|P34243 Saccharomyces cerevisiae
                     YKL017c DIP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449195.1"
                     /db_xref="GeneID:2891078"
                     /db_xref="GOA:Q6FKP9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004483"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP9"
                     /translation="MSNAAIIDSFLDSLDYEKSQDIELVESLLKQIPLKGLSRLGLAI
                     SNLTVTNSRTGLAGKLVIELAQTQSTPVSSDLKNGDIVIIKPYSKKEDNDQQCQGVVV
                     KISNAESNSTSPTSLAIAIDESQENIATTMIHSNEKFYVMKTVNTVTYDRMNSTLRKL
                     KEFKEKSISNPIIDILLPTEGVKKLRASIPNAKKSNIQFFDENLNDSQKYAIRFSMEN
                     KLSIIHGPPGTGKTYTVVELIRQLISKDSTSRVLVCAPSNIAVDTILERLSKSIKDKR
                     WLLRIGHPARLLKTNWYHSLDILSKEGTDSASIINDISMEITKTIASIKSIKSSGERR
                     KAWAEVKQLRKELRLRERKVINDLIKQSRVVVATLHGSSSRELCNYYKSIEEGENDNL
                     FDYVIIDEVSQSLEPQCWIPLISHLQSKITKLVLAGDSKQLPPTIKTNNNDKVMKVLG
                     TTLFDRLVNMYGDEFKNLLNIQYRMNAKIMEFSSKAMYNGELKADSSVENIVLSDLPG
                     VDSNEETDEPIIWYDTQGDDFPEVDEEEDELKSKSAKFLYSSKLNTNEAYLVLHHVRK
                     LIESNVQQDCIGIISPYNAQVSLLKKLVNGTEDSPVYPLIEISSVDGFQGREKECIIL
                     SLVRSNDKAEVGFLKEQRRLNVAMTRPKRQLCVIGNIETLQRSGNSFLKDWTEWSEDN
                     ADLRYPDVGEIYE"
     gene            complement(<1048895..>1049875)
                     /locus_tag="CAGL0L09757g"
                     /db_xref="GeneID:2891079"
     mRNA            complement(<1048895..>1049875)
                     /locus_tag="CAGL0L09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449196.1"
                     /db_xref="GeneID:2891079"
     CDS             complement(1048895..1049875)
                     /locus_tag="CAGL0L09757g"
                     /note="highly similar to uniprot|P36104 Saccharomyces
                     cerevisiae YKL018w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449196.1"
                     /db_xref="GeneID:2891079"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP8"
                     /translation="MSVGISKDTLLKFKAVKSFRVSEKEVSPITSLCFDDHGQHLLAS
                     SASDTMHLYDSVGCRFLNTIASKKYGCHAAKFTHAQSECIYSSTMKTFDIRHLNLETN
                     QYLRYFVGHGALVSDIQMSPINDSFLSASYDESVRVWDLRTSKAQAIIPTVVPNCIAY
                     DPSGLVFALGNPESNEIGLYNVRQLKNGPFLVIKVEQGFKQWNKLEFSNDGKYILLAS
                     SYGKQLILDAFTGEQLFELVGTKPFPLREFMDSGSACFTPDGQFTLATDYDGKIAIWN
                     HGESISNRTLKPQGYVQAPEEVCPRTILFNPKYSMFVTADESVDFYVLEQ"
     gene            <1050197..>1050445
                     /locus_tag="CAGL0L09779g"
                     /db_xref="GeneID:2891080"
     mRNA            <1050197..>1050445
                     /locus_tag="CAGL0L09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449197.1"
                     /db_xref="GeneID:2891080"
     CDS             1050197..1050445
                     /locus_tag="CAGL0L09779g"
                     /note="some similarities with uniprot|Q3E7A7 Saccharomyces
                     cerevisiae YKL018C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449197.1"
                     /db_xref="GeneID:2891080"
                     /db_xref="GOA:Q6FKP7"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP7"
                     /translation="MSVGSIVRWGVDLTLVAIVLASLRRSTGLVLRYETMGFSGWIHG
                     YLQWGEMCFGYLKSYVKRSPWFRPQVTYDGFKKIEEIE"
     gene            complement(<1050844..>1051803)
                     /locus_tag="CAGL0L09801g"
                     /db_xref="GeneID:2891081"
     mRNA            complement(<1050844..>1051803)
                     /locus_tag="CAGL0L09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449198.1"
                     /db_xref="GeneID:2891081"
     CDS             complement(1050844..1051803)
                     /locus_tag="CAGL0L09801g"
                     /inference="similar to AA sequence:UniProtKB:P29703"
                     /note="similar to uniprot|P29703 Saccharomyces cerevisiae
                     YKL019w RAM2 protein farnesyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449198.1"
                     /db_xref="GeneID:2891081"
                     /db_xref="GOA:Q6FKP6"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP6"
                     /translation="MLSWCAENFGDVEPMPIEMGSDELCKILYSDEYKLLLGLCRRLM
                     SLGELSQRALLLTAKVIAIAPAFYTVWNYRYSIIKEQLSSLDKVEQGALVNKELDWLD
                     EVTLSNPKNYQIWSYRQALLKVHPSPQLKRELPIIQLMIDEDTKNYHVWSYRKWCVLF
                     FKDFNHELPFTDMMIRRDIYNNSAWTHRMFVWQHTESSSTQVIAEIDNYLRGKIELAP
                     QNISCWTYLRGLYELFLHENYDPSIIRFAEGFIDGVLDSDSTAEKIETIESSYALEFL
                     AHVYSRNPSTQEKALRAYQLLSDKFDPIRANLWQHKIKQLKSS"
     gene            <1052444..>1054675
                     /locus_tag="CAGL0L09823g"
                     /db_xref="GeneID:2891082"
     mRNA            <1052444..>1054675
                     /locus_tag="CAGL0L09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449199.1"
                     /db_xref="GeneID:2891082"
     CDS             1052444..1054675
                     /locus_tag="CAGL0L09823g"
                     /note="some similarities with uniprot|P09798 Saccharomyces
                     cerevisiae YKL022c CDC16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449199.1"
                     /db_xref="GeneID:2891082"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP5"
                     /translation="MRDQGQEGFTPVQRRVVSPVGAARSPLLTSPLVQKYAGASLATP
                     RKHLGASNSNNGNNGSLLASMSKNSMLGSTIPSTLRKVSLQREFHDNDSDVVGAGVGG
                     GPRWSKSAQGDGDVIIVGAAGGDNTASPTGDGEGLNTTTLTTTTTTVTSGAGNGSNEI
                     DIAKIPLIERLQLWRHDAWIQHLYGTAEFVATKIYTMTGDANDAFWLALIYYSMGSHN
                     RCIELLTKDDIISVSIVCRYLLARCYIDVKNYDDALDIVGETNPFADTAEASARIESD
                     GGIKLESSMCFLRGKIYVAQNDFSRAKEAFKEAVLVDPKNFEAYRQLVDSHLLTTNEE
                     WELLDSLDFDSLGDDSILVKSLYTLELSKNQNQDRITEAQDILRQDYDLADDIDIVTS
                     DIDILFNQCKFSQCLNVCELMLKRDQFNNKILPTYISCLYEVKSSNKLFLLAHELAEK
                     DPRNCITWYCVATYYMLLDRIPEARKYFSKSSIMDPTFAPAWLGFAHTFALEGEQDQA
                     ISAYSTAARFFPGMSLPNLFLGMQYMASNTLTLAEEYFSLAYESSPQDPVILNEIGVL
                     KFKKGELHKAKRYLKKAAECCKDMERSSKTVLSVQINLSHTYRRLGENEKAIKYLTNI
                     LEDTENSSEIYCSLGFLYLKTNQLQKAIDALHRVLAINPGNSSAQKLLNYALELNVTL
                     ELDENHPLVVNSNILDEEHSASKIGKRRQPFESINVDKKRNKAGQLTEQSLSPAGEAM
                     DIE"
     gene            complement(<1054843..>1056009)
                     /locus_tag="CAGL0L09845g"
                     /db_xref="GeneID:2891083"
     mRNA            complement(<1054843..>1056009)
                     /locus_tag="CAGL0L09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449200.1"
                     /db_xref="GeneID:2891083"
     CDS             complement(1054843..1056009)
                     /locus_tag="CAGL0L09845g"
                     /note="some similarities with uniprot|Q12114 Saccharomyces
                     cerevisiae YLR330w CHS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449200.1"
                     /db_xref="GeneID:2891083"
                     /db_xref="GOA:Q6FKP4"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP4"
                     /translation="MDDDELVNFLLSDDIVQKASKREKKSRWLRDSNAAADLVDTNNA
                     SPAVEGKSENVRNGNDTLEVDELEVDLDNLILSSGTAHGTKSKRPKRTRLKETTENSN
                     KDFLKLLNEIIDKEVKEERLIVGNGGSSPTDSDLTLKKKKKNKNKKTKNTGRKTVETN
                     AKDDDRPFEKVMDMFLKDENGIQTELPKAEGNSTNDSKELKAKRKKSKKKKPTKQITV
                     EEIPETPQQTQNAIHNSDEDSKIIIQRRKKDKKSKKKKKEKSHIDIGKGEGNENHDET
                     SDKTFKKEKKLKAKKHDEDQLKHIETNMKIHNAEDDINNVTNSNSTSHPSLSKKSKKK
                     KKKLIETDEHHDKPEISIEKENGGSSIKSKKNRTKQKSKRSHVNTESAPISVEF"
     gene            <1056341..>1057123
                     /locus_tag="CAGL0L09867g"
                     /db_xref="GeneID:2891084"
     mRNA            <1056341..>1057123
                     /locus_tag="CAGL0L09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449201.1"
                     /db_xref="GeneID:2891084"
     CDS             1056341..1057123
                     /locus_tag="CAGL0L09867g"
                     /note="some similarities with uniprot|P15700 Saccharomyces
                     cerevisiae YKL024c URA6 uridine-monophosphate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449201.1"
                     /db_xref="GeneID:2891084"
                     /db_xref="GOA:Q6FKP3"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006266"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP3"
                     /translation="MRMQSTVPPPQRSNVNVKKWGLLVLGALAVGTTIYSVSNEKGEP
                     KEFLEAEKRAGKQEKQAGPAFSEDQVSVIFVLGGPGAGKGTQCAKLVNDYKFVHLSAG
                     DLLRAEQNREGSEFGELIKHYIKEGLIVPQEITLSLLQKAIKENYEKNYTKFLVDGFP
                     RKMDQALSFEKQIVPSKFTLFFECPEQVMLERLLERGKTSGRADDNIESIKKRFRTFE
                     ETSMPVVRYFDSQDKVVKVRCDHPVEDVYNQVKQALTAKNIK"
     gene            <1057762..>1059915
                     /locus_tag="CAGL0L09889g"
                     /db_xref="GeneID:2891085"
     mRNA            <1057762..>1059915
                     /locus_tag="CAGL0L09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449202.1"
                     /db_xref="GeneID:2891085"
     CDS             1057762..1059915
                     /locus_tag="CAGL0L09889g"
                     /inference="similar to AA sequence:UniProtKB:P36102"
                     /note="similar to uniprot|P36102 Saccharomyces cerevisiae
                     YKL025c PAN3 component of the PAB1P-dependent poly(A)
                     ribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449202.1"
                     /db_xref="GeneID:2891085"
                     /db_xref="GOA:Q6FKP2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR011009"
                     /translation="MDKINPDWARDVPCRNVIIYGFCKKKTEGCPFKHDDDDIATPTS
                     TPKVADTVPAPSGVIQQPSKISVSSLPSLNSQPSSTAPTSAPNATAHTGSKSQVPKFN
                     AKASASFTPMSKAADGTQETQAPYLESPVAGSPGPILKAGTPVSFMQPNIYSTTPVPS
                     PASMAMPNVVMPPNDMGSPDLGLQQQSHMVNLDGSIQQNYQERPNVLMRDSSMPLTMG
                     TSGSRPMLDQQIHSISGLSNTSGPQPPGLLQSMNGASMDMGLPMNLRYPTIYPPTHSI
                     LQYHLYAPDPPPQLEIALKENERTPRMLFIPNDLREELVKRNLASLQLFPSGGNLPHI
                     VKDYFGLVPLDFHQRSSVKDRYKKHKNSLYKVFSNVDGRIYLLRRIHDVNISDPTIIS
                     KTFQKWSKIDSSNVVALKDLFLTTAFGDSSLGIVYDYYPNATSLYEAHFVNYPTVEVT
                     EDLLWSYAVQILNGLREIHNTNGVNIGDLDCDKIILTGKGRIKISAGAEYDIMNMCCP
                     EDNEDDDNEEKLRKRNFVDLGEILFKLASKMCNCHGKDVANLAQVSEKLKNLIKSLAF
                     EQLHDYVNVATIIEKYIGLDVVFKVMEAQQTYSEYAENVLSRELENGRLFRLICKLNF
                     IFGRVENRLDINWSEPGDKFVIVLFYDYVFHQIDPNTGKPVTDLTHVLRCLNKLDAGV
                     EENILLVTPDELNTAVVSYKKVKELVDKTFRAMTL"
     gene            <1064342..>1068697
                     /locus_tag="CAGL0L09911g"
                     /db_xref="GeneID:2891086"
     mRNA            <1064342..>1068697
                     /locus_tag="CAGL0L09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449203.2"
                     /db_xref="GeneID:2891086"
     CDS             1064342..1068697
                     /locus_tag="CAGL0L09911g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449203.2"
                     /db_xref="GeneID:2891086"
                     /db_xref="GOA:Q6FKP1"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP1"
                     /translation="MNPSFIIFFFLQILVRSVRADVTISADQTASTDVLYSEPVSILK
                     DVKYTVNADTLQFTNGLNNAGTLVFADTVGSDAEQKLVVSNGDFINSGEVDVTCNSVT
                     TPSYMFNVANFKNEGTMYFKGTQNGVQYGANQVTLISTTESIVNDGSMTFDGIENAYL
                     KSSGTITNNGKISVQYNSGFAVSQSILGSGSIELGLATTLWFDDPSNTDISGQKVIQT
                     EGSVIVFDTTKLTKPFTVNFGKFGGQNLFAVTTPVTSTSYDSITGILTIKVNGQDISL
                     VLGTNLDPFGFIASPVSNPVTSPLDGQQHQIYTIVYSGVSVPPLPSPETKTITEKGVE
                     HEVVVSYISTTSDNQLVTITTTSTIIPPFPKGTTSLLVENDVTIYDVYSYFIATNDQG
                     AEYTATTILSYSPPAPTTVTIYQNHEHIQEVYSYYITVDGEGKIITESKLVSSTISYD
                     PAPGPETKIVDLGNEVTEYDVISYYTTVDENGKVITTSTVDKFSPPPVSTITIYENHE
                     HIVDVYSYFITVDGDGKIITDSKIISSSISYDPAPGPETKIVDLGNEVTEYDVISYYT
                     TVDENGKVITTSTVDKFSPPPVSTITIYENHEHIVDVYSYFITVDGDGKIITDSKIIS
                     SSISYDPAPGPETKIVDLGNEVTEYDVISYYTTVDENGKVITTSTTTKYSPPPLTVTA
                     TTASDYVESDWISFFITVDEKGDIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTV
                     VLENNMTNYEVVSYWTTTNEFGGLITTSSTSTYSAPPLTVTATTASDYVESDWISFFI
                     TVDEKGDIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVVSYWT
                     TTNEFGGLITTSSTSTYSAPPLTVTATTASDYVESDWISFFITVDEKGDIVTSSTLFN
                     ATRDYKLPEAPHTSFGPAPPVETHTVVLENNMTNYEVVSYWTTTNEFGGLITTSSTST
                     YSAPPLTVTATTASDYVESDWISFFITVDEKGDIVTSSTLFNATRDYKLPEAPHTSFG
                     PAPPVETHTVVLENNMTNYEVVSYWTTTNEFGGLITTSSTSTYSAPPLTVTATTASDY
                     VESDWISFFITVDEKGDIVTSSTLFNATRDYKLPEAPHTSFGPAPPVETHTVVLENNM
                     TNYEVVSYWTTTNEFGGLITTSSTSTYSAPPLTVTATTASDYVESDWISFFITVDEKG
                     DIVTSSTLFNATRDYKLPDAPYTFLGDHTTVITSGGKPTTVVVSHITTTDSNGHSTVI
                     ETTLPVGSGSNDHTTVITSGGKPTTVVVSHITTTDSNGHSTVIETTLPVGSGSIDHTT
                     VITSGGKPTTVVVSHITTTDSNGNTVTIQQYPTLGEPSTSNRPTNVAQPQPAAGNSAR
                     HSSSSNDLNSSSSSRSTTTLEGNSIIPSASQSIFSGAPGHTNSISDTYKGSASQISMK
                     WGSLSMVLIMLILNI"
     gene            <1069785..>1071011
                     /locus_tag="CAGL0L09933g"
                     /db_xref="GeneID:2891087"
     mRNA            <1069785..>1071011
                     /locus_tag="CAGL0L09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449204.1"
                     /db_xref="GeneID:2891087"
     CDS             1069785..1071011
                     /locus_tag="CAGL0L09933g"
                     /inference="similar to AA sequence:UniProtKB:Q08412"
                     /note="similar to uniprot|Q08412 Saccharomyces cerevisiae
                     YOR042w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449204.1"
                     /db_xref="GeneID:2891087"
                     /db_xref="GOA:Q6FKP0"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:Q6FKP0"
                     /translation="MGKKSQKAEKAEDKPVLEKETGEDLDSKQQEPIEEPVEVKQDKD
                     EAKEEDLEEVKEDVGDSAKKDITEDTTTKKVENPLLLQLKEAFPNIEEQYVKAVIIAS
                     QGALDPAFNALLFLSDPESGKDIELPREPVQQNPSLPPRRKQTQLEQDEMLARQLDKE
                     YNRKRRGERRHHNEREAGRNYERYNNDDLEEDSWSQFVEKDLPEITARAKGSLQETAT
                     KVGTWFNGVKKNFIGEGEENDSAYYQDDSHGRDLDEDYGTYVEQQERRQRRGVQDPGY
                     RRGDEQRLNARHRFNSFGASATDDVEGGISLRDEEFGEDEDEEVPPQLPSRARSNDSK
                     KDSEEVKPQEGKKDKVVAETTYIDTPENKEKTKRKWQPLPPEPLNATPTKVNASTKKN
                     KNESEDEFLINSDEEL"
     gene            <1074420..>1074824
                     /locus_tag="CAGL0L09999g"
                     /db_xref="GeneID:2891052"
     mRNA            <1074420..>1074824
                     /locus_tag="CAGL0L09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449205.1"
                     /db_xref="GeneID:2891052"
     CDS             1074420..1074824
                     /locus_tag="CAGL0L09999g"
                     /note="some similarities with uniprot|Q08416 Saccharomyces
                     cerevisiae YOR044w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449205.1"
                     /db_xref="GeneID:2891052"
                     /db_xref="GOA:Q6FKN9"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN9"
                     /translation="MVKDYLLLLFRSFVLVVQYSCYAAVALLLIPFLGLYAFDLFLYV
                     YRLVDYSVRLITYRKKLTNREQQASTSSREHLTTEAGTQSTQKISRESGWGSKGLGAG
                     KLFLFYDVGTRVVRHAINSIEGPKHSRTTKSE"
     gene            <1075660..>1075845
                     /locus_tag="CAGL0L10015g"
                     /db_xref="GeneID:9488047"
     mRNA            <1075660..>1075845
                     /locus_tag="CAGL0L10015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999550.1"
                     /db_xref="GeneID:9488047"
     CDS             1075660..1075845
                     /locus_tag="CAGL0L10015g"
                     /note="highly similar to uniprot|P33448 Saccharomyces
                     cerevisiae YOR045w TOM6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999596.1"
                     /db_xref="GeneID:9488047"
                     /db_xref="GOA:B4UN53"
                     /db_xref="InterPro:IPR020266"
                     /db_xref="UniProtKB/TrEMBL:B4UN53"
                     /translation="MSSAAMFGMPGAGAAVPQQPKSRFQKFKESPLYTIALNGAFFIG
                     GVAFIQSSLMEMLAPQL"
     gene            complement(<1076197..>1077711)
                     /locus_tag="CAGL0L10021g"
                     /db_xref="GeneID:2891053"
     mRNA            complement(<1076197..>1077711)
                     /locus_tag="CAGL0L10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449206.1"
                     /db_xref="GeneID:2891053"
     CDS             complement(1076197..1077711)
                     /locus_tag="CAGL0L10021g"
                     /note="highly similar to uniprot|P20449 Saccharomyces
                     cerevisiae YOR046c DBP5 RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449206.1"
                     /db_xref="GeneID:2891053"
                     /db_xref="GOA:Q6FKN8"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSATEDKKDPASMLAELKLDKDEGNKTPETKTPESNSAETKTTE
                     EVKELKNPFTQKKEDVENDAAEEKTNEVNKDDAKDERENKDTNLIKSEYEVKVNLADL
                     QADPNSPLYSVKSFDELGLSPELLKGIYAMKFQKPSKIQERALPLLLSNPPRNMIAQS
                     QSGTGKTAAFSLTMLSRVDETQNVPQAICLAPSRELARQTLEVIQEMGKYTKITTQLI
                     VPDSFEKNTKINANVVVGTPGTLLDLIRRKLIQLQNVKIFVLDEADNMLDKQGLGDQC
                     IRVKKFLPKDTQLVLFSATFADAVKAYAQKVIPNANTLELQRNEVNVKAIKQLYMDCN
                     DEAHKYEVLCELYGLLTIGSSIIFVAKKDTANLLYGKLKHEGHQVSILHSDLRTDERD
                     RLIDDFREGRSKVLITTNVLARGIDIPSVSMVVNYDLPTLPNGMPDYATYVHRIGRTG
                     RFGRTGVAISFVHDKKSFKILSAIQDYFKDIELTRVPTDDWDEVEDIVKKVLKQ"
     gene            complement(<1078634..>1079995)
                     /locus_tag="CAGL0L10043g"
                     /db_xref="GeneID:2891054"
     mRNA            complement(<1078634..>1079995)
                     /locus_tag="CAGL0L10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449207.1"
                     /db_xref="GeneID:2891054"
     CDS             complement(1078634..1079995)
                     /locus_tag="CAGL0L10043g"
                     /inference="similar to AA sequence:UniProtKB:Q02794"
                     /note="similar to uniprot|Q02794 Saccharomyces cerevisiae
                     YOR047c STD1 or uniprot|P35198 Saccharomyces cerevisiae
                     YDR277c MTH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449207.1"
                     /db_xref="GeneID:2891054"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN7"
                     /translation="MFVSPPPATTTKQVFPKKLPKRLSAIPENNSVSNYSLDNSDNGS
                     IDSDVNMDVDSHISDATTQLQLPLQKTTSNRNDFVSAPPEYADRARLEIKKRLLPSGQ
                     TMGHFPTHSSTSRHIQRSRSHSSQSSTSDSQSLFSDNASSYQSSIFSQPSTVFSQNTS
                     STTNSTHDFLFPHPAKIITQLSLEDALPKSFYDMYAPEILTDPTNLLCNGRPKFTKRE
                     LLDWDLNDIRSLLIVEKMKPEWGSQLPEIVTADPNLPKFRFILLPLNSTDETIIQILV
                     NSDLYQEANLDFEFKLTSAKYTVAAARKRHEQLRGYHEEVMQLTKPEWRNIIENYLLN
                     IAVEAQCRFDFKQRCSEFKKWKLQQANLKRPDMPPPSMVPMNHSNKSSGSLLKRALMK
                     NLQLKNMKNEHSQENMMAGPSATPLSNKVLLTKEEKAHIWTQCQTQVYQRLGLDWKPD
                     AMP"
     gene            complement(1081371..1081442)
                     /gene="tRNA-Glu (CTC)"
                     /locus_tag="CAGL0L10065r"
                     /db_xref="GeneID:2891055"
     tRNA            complement(1081371..1081442)
                     /gene="tRNA-Glu (CTC)"
                     /locus_tag="CAGL0L10065r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2891055"
     gene            <1084445..>1088695
                     /locus_tag="CAGL0L10092g"
                     /db_xref="GeneID:9488053"
     mRNA            <1084445..>1088695
                     /locus_tag="CAGL0L10092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999551.1"
                     /db_xref="GeneID:9488053"
     CDS             1084445..1088695
                     /locus_tag="CAGL0L10092g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999597.1"
                     /db_xref="GeneID:9488053"
                     /db_xref="GOA:B4UN54"
                     /db_xref="UniProtKB/TrEMBL:B4UN54"
                     /translation="MKYLSVFATFVAILSWACAAVYPDFYEDKVVVLDGMGTEEFILP
                     FDKPLSVRNSSLTLKNFARISLPGGLIVQRNSVFNVIPPIGASKKLNFTVRGVCAIET
                     NSKFTYDSSGNTYEDEADAVNNFVFDIYGDQIGVQVYKDCSMSVTLPTIKNGIPNYRG
                     ESPNIRMAGVAPDQTALELRYISCMIISGKLDLLSPGSKTGSQFDKPLWRMDFGLSGL
                     PKSSPNTPSILRDDMSGKITCEGILAVYNDMFSFTNNAVLHTLGYIGYSVVSPITLDL
                     SMGPIRRPTNYEYLVALPAGQDGITLTGYKYTADTDISDAHQYLFYYFYDNDATKEDE
                     ISVSTDNSDVRILHSNPSQTVTVHGDSALNIGYYKGDRIDSFVGFDGLDFSKYKKELA
                     VYFYESFQYSSTTTTKSDEYTTEIIEIIVSGTLGIDNKPSPVTISSTIYNQLRETTET
                     VDLGNGVTEYHVLDYFPVPQDDKEHPYGTSTKIITYSPPPVTITATTAADYVETDWIS
                     FFITTNDKGEIITDSTLFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVIS
                     YWTTTNEFGGLITTSSTRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDST
                     LFNATRDYNLPEAPHTSFGPAPPAETKTVDLGNEVTEYLVISYWTTTNEFGGLITTSS
                     TRTYSPPPVTITATTAADYVETDWISFFITTNDKGEIITDSTLFNATRDYNLPEAPHL
                     SSSMKDVLPESEADYTTTIDKGNGEFETDLVSHITTKDSDGKPTTITTTIPLKPSEAG
                     EAGEADYTTTIVSDGHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSPAPY
                     SQPPVVTTTITEDDGSSKTVVISYFPSEGEDGVTRTGTTTVSTITPGEADYTTTIVSD
                     GHTITEVVSHVTTTDSDGKTITYITTMASYDQVDEGVFTSPAPYSQPPVVTTTITEDD
                     GSSKTVVISYFPSEGEDGVTRTGTTTVSTITPGEADYTTTIVSDGHTITEVVSHVTTT
                     DSDGKTITYITTMASYDQVDEGVFTSPAPYSQPPVVTTTITEDDGSSKTVVISYFPSE
                     GEDGVTRTGTTTVSTITPGEADYTTTIVSDGHTITEVVSHVTTTDSDGKTITYTTTIF
                     SNDWLLVDSELDVTSNYPTSFVSKENPYTTVDAQSTISSNSGNTVVTTKTPANGNENQ
                     GLSSVNGTSVSSGRNTFRSVSLIITNTLGSAGPINKPSYSTTSASSSVPQEVAGDSSK
                     YGENVSSVGIMLPQMSKPHASSASISVLHSSSRPVISTGSRPSDVSARPTENTPAFGS
                     IPVQSGAENDASVSSTNDNQNTHTAQSRIQQLGKTSSDLGTTALVLPSSSDVNISHTG
                     GPSDTQIASVLQGSGFKIKVKSEVMILLVTVFLFLGFL"
     gene            complement(<1089283..>1092339)
                     /locus_tag="CAGL0L10120g"
                     /db_xref="GeneID:2891058"
     mRNA            complement(<1089283..>1092339)
                     /locus_tag="CAGL0L10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449208.1"
                     /db_xref="GeneID:2891058"
     CDS             complement(1089283..1092339)
                     /locus_tag="CAGL0L10120g"
                     /inference="similar to AA sequence:UniProtKB:Q02792"
                     /note="similar to uniprot|Q02792 Saccharomyces cerevisiae
                     YOR048c RAT1 5 -3 exoribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449208.1"
                     /db_xref="GeneID:2891058"
                     /db_xref="GOA:Q6FKN6"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR017151"
                     /db_xref="InterPro:IPR027073"
                     /translation="MGVPSFFRWLSRKYPKIISPVLEEPQQLVDGVALPIDYAGPNPN
                     GELDNLYLDMNGIVHPCSHPENKPPPETEDDMLLAVFEYTNRVLNMARPRKVLVIAVD
                     GVAPRAKMNQQRSRRFRSARDAEIENEAREEIMRQKEQLGQIIDDSVKNKKTWDSNAI
                     TPGTPFMDKLAIALRYWTAFKLATDPGWKNLQVIISDATVPGEGEHKIMNFIRSQRAD
                     PEYNPNTTHCIYGLDADLIFLGLATHEPHFKILREDVFAQDNRKRNNVKDTIDMTDEE
                     KDLIRKQDSEKPFLWLHISVLREYLSAELWTPKLPFPFDLERAIDDWVFMCFFCGNDF
                     LPHLPCLDVRENSIDILLDIWKSILPRLKTYMTCDGKLNLESVEMVLKELGNREGDIF
                     KTRHIQEIRKKEANERRKQQKQQNVSTGQDRHPTKFNEQLQMYDTNGSLAKGSWNLTT
                     SDMVRYKKELMLANEGDENSIKIIEEVSERNNSLMKEIQSEMTPEDYKGNNNNFTAAE
                     LLKKKLNARKRELEKEKENEEQERASKQPKISETPDESDLTEEIEADVIAEVEDETTP
                     DEKDTDSIITEVPEISNGGITSGVIDTDEAVKLFEPGYHDRYYIEKFHIEPNQIPALS
                     KHMVKCYIEGVSWVLMYYYQGCASWTWYYPYHYAPLAEDFVDFHDLDIKFELGEPFLP
                     YEQLMSVLPAASGHNLPEVFRPLMSSEDSEIIDFYPTEFPIDMNGKKMSWQGIALLPF
                     IDETRLLTATRNQYKFLSEDEKRRNTRNDPVLLISNKNVNYEKFAKRLYKKGHEDNFQ
                     LVFHHFKSSLAGIVSTDTEGFKLHAKLPCPIQSGALPELSTNLFLKMQYKLLPLPSAN
                     KSLILNGFIPSEPMLTQHDFDSIVYKYGTRGFQRNQRNFGMEMKQNIVPVGPSGTTQY
                     KPRIGGYRSFFYFGQLNQQMHQHNQVYQQNQAPTHDRYRNDRSDRGGRGYGRPDHDRG
                     DYRGDYRGDGYRGGHRGGYRGGSRSRGPSSRGISSRGYSGPSRYNR"
     gene            complement(<1092916..>1093983)
                     /locus_tag="CAGL0L10142g"
                     /db_xref="GeneID:2891059"
     mRNA            complement(<1092916..>1093983)
                     /locus_tag="CAGL0L10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449209.1"
                     /db_xref="GeneID:2891059"
     CDS             complement(1092916..1093983)
                     /locus_tag="CAGL0L10142g"
                     /inference="similar to AA sequence:UniProtKB:Q08417"
                     /note="similar to uniprot|Q08417 Saccharomyces cerevisiae
                     YOR049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449209.1"
                     /db_xref="GeneID:2891059"
                     /db_xref="GOA:Q6FKN5"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN5"
                     /translation="MIPKLRFNAALIAIWGLLLICHILQLYWKQYWFSIAFICAAILE
                     VLGYIGRTASHFNVYNIDMFLLQIICLTIAPVFTMGGIYYQLAKLIEIYGHRFSLLPS
                     PMAYSYIFIFSDVVSLAIQAAGGGTSGVAVNEGTSTKKGDRIFEAGIAIQLASMIIFL
                     GLWLHFLYMIYIKVRLEYTGERRFRFSMLKIPQEKLDHLYREKYSDLRINPKRFVFHH
                     FNLALTATVLLVIVRCCYRLAELHQGWRGFLITHEWYFIILDSLMVTLATVIMTIFHP
                     GFAFKGRHLSIPVTHGRVDPETVESTDSHILSESTDSMEKDENEKVAVPEIVPDTDDI
                     EKRPFYKKVPKMSFSIPFRKK"
     gene            complement(<1095287..>1096501)
                     /locus_tag="CAGL0L10164g"
                     /db_xref="GeneID:2891060"
     mRNA            complement(<1095287..>1096501)
                     /locus_tag="CAGL0L10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449210.1"
                     /db_xref="GeneID:2891060"
     CDS             complement(1095287..1096501)
                     /locus_tag="CAGL0L10164g"
                     /inference="similar to AA sequence:UniProtKB:Q08421"
                     /note="similar to uniprot|Q08421 Saccharomyces cerevisiae
                     YOR051c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449210.1"
                     /db_xref="GeneID:2891060"
                     /db_xref="GOA:Q6FKN4"
                     /db_xref="InterPro:IPR024318"
                     /translation="MAKRPLGLGKQKQNKKTKVESSSGEVSRESTPVASQIEVELADD
                     VDADDELVQLKGLWQTYFDSDRDSEYVLNGIVHECDRLLREADKEGKIKELSDVFHAI
                     YALALSELTIFKAGEEEDEKKKKEEIAQFFDNALERCSLGESDCGKSDLLDLVKAKVI
                     IQRVPLEHMSALTVSSKSGLNLNTLVEDAKKHFKVSTKDLSLVYEVLEMFDDLLDITE
                     NFGHEEQIAEGLDSDDEEDLEPIQLDKKHPVYEMQQNLASNYKWLKEQLIALLGQLNK
                     KDHAKLYHLTAKKIGELYLKDAEEPTNVYLSLAYDDDESKQSSKDCKESQASALKLVQ
                     NAIDYLDKAQIEDEPETWAQVAEAYIDLGNLHDNESSEQEKAYQTAETLLTKANTATH
                     GKYDDILENLKQ"
     gene            complement(<1097104..>1097625)
                     /locus_tag="CAGL0L10186g"
                     /db_xref="GeneID:2891061"
     mRNA            complement(<1097104..>1097625)
                     /locus_tag="CAGL0L10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449211.1"
                     /db_xref="GeneID:2891061"
     CDS             complement(1097104..1097625)
                     /locus_tag="CAGL0L10186g"
                     /note="some similarities with uniprot|Q08422 Saccharomyces
                     cerevisiae YOR052c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449211.1"
                     /db_xref="GeneID:2891061"
                     /db_xref="GOA:Q6FKN3"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN3"
                     /translation="MNTKEEEVRVEEAKKGTPERVESILNGDQEENSSITSGASHGKV
                     TPMLLKQLSSSSFRSSISESSNTSITSLVSTTEAKSPGSSGSSTSTKVGKKSSGLKKK
                     KKKNQCYFDKCTSVASKFVGDCNFCKGHYCSRHRLMENHACEGLTSCKEQMHQRNADK
                     LASEQTHTRKIQI"
     gene            complement(<1098507..>1100222)
                     /locus_tag="CAGL0L10208g"
                     /db_xref="GeneID:2891062"
     mRNA            complement(<1098507..>1100222)
                     /locus_tag="CAGL0L10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449212.1"
                     /db_xref="GeneID:2891062"
     CDS             complement(1098507..1100222)
                     /locus_tag="CAGL0L10208g"
                     /inference="similar to AA sequence:UniProtKB:P36024"
                     /note="similar to uniprot|P36024 Saccharomyces cerevisiae
                     YKR072c SIS2 involved in cell cycle-specific gene
                     expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449212.1"
                     /db_xref="GeneID:2891062"
                     /db_xref="GOA:Q6FKN2"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN2"
                     /translation="MRGKMDADKESVAAASMSPTLSVGAGTTKSIMNVGGKSGAVVSN
                     TPEPGLKRIPTVTFSDSKIVGSNKFGASDERKPGALGGAESALDSKELESQGMVNLPQ
                     ILHDKLVDRRTPSNGLPDIQVPLPEKEEHPHFLVEDPLHSPKVRSRANSLSPSTPQVD
                     LNGVPLSTAIVNGNDVKPGIKPITSNPLERDGSVSVSKGSEQPLLESVIEEASSTPGM
                     ANIPKRENAKNLDMRLPQDDGKIHILFGATGSMAVFKIKPMVKKLVDIYGKDRISIQV
                     VLTKSAEKFLNKKVVKKVKPHPESNEDPLDVVTNIPGGTINECAKLKNGGADAQGSQQ
                     SNGSTNSTPDKTAIGNNPFQLEGGPVIQIWRDQDEWDVWKQRSDPVLHIELRRWADIL
                     VVAPLTANTLSKIALGLCDNLLTCVIRAWNPNFPIFLAPSMVSSTFNSVMTKKQLAII
                     KEEMPWITVFKPSEKVMGINGDIGLGGMMDPNEIVDKVVMKLGGYPKEEDEDEDDEDE
                     DEDEDEENETCQEGENKKDEDEDEDEDDDDDEDDDDDEDEDEDEEDENNGGAEETLQP
                     VENSQ"
     gene            <1100910..>1102043
                     /locus_tag="CAGL0L10230g"
                     /db_xref="GeneID:2891063"
     mRNA            <1100910..>1102043
                     /locus_tag="CAGL0L10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449213.1"
                     /db_xref="GeneID:2891063"
     CDS             1100910..1102043
                     /locus_tag="CAGL0L10230g"
                     /inference="similar to AA sequence:UniProtKB:Q08446"
                     /note="similar to uniprot|Q08446 Saccharomyces cerevisiae
                     YOR057w SGT1 suppressor of G2 allele of SKP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449213.1"
                     /db_xref="GeneID:2891063"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR007699"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN1"
                     /translation="MPIEKDLKVAYDVLYEEGDPKRALELYNRILKESPKALNALIYK
                     AACYEKLYFGDKQYRTVETLDEAKSCLAEAEDVAMERGDRAKIGLVYFRFFVHHFNLK
                     YYKMAETYLKRAKSYGYADPTLALWEDKLKNKLAKMNSEHGDDTDKKGKSDLDVPTEA
                     VKTINIDDTKPTPPDMKVRTDWYQSTDKLTVSFFTTILPANKDSMDIKIEGLHLSISY
                     PIPDKGSEFQYNIDLAHNVDPQEYSVIVMSKKFEITFKKLENIKWKSLEYEANTNDLH
                     IPPTATTNATGNNRDSLSYPNSSKKKIDWSKIDIDDDETDQNQSTDAFFQQLYADADP
                     DTRRAMMKSFIESNGTTLNTNWEEVKKAPVETSLPEGQELKEW"
     gene            complement(<1102310..>1104847)
                     /locus_tag="CAGL0L10252g"
                     /db_xref="GeneID:2891064"
     mRNA            complement(<1102310..>1104847)
                     /locus_tag="CAGL0L10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449214.1"
                     /db_xref="GeneID:2891064"
     CDS             complement(1102310..1104847)
                     /locus_tag="CAGL0L10252g"
                     /inference="similar to AA sequence:UniProtKB:P50275"
                     /note="similar to uniprot|P50275 Saccharomyces cerevisiae
                     YOR058c ASE1 microtubule-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449214.1"
                     /db_xref="GeneID:2891064"
                     /db_xref="GOA:Q6FKN0"
                     /db_xref="InterPro:IPR007145"
                     /db_xref="UniProtKB/TrEMBL:Q6FKN0"
                     /translation="MSAFPVSSPTRRVDQGMRNIDIMRSPGTPRLNSTGSTLCSSGEF
                     LKLTPVKILEFDSPIAKGLSRSTSELQASKLSTVDGIYKENFTVITKQLEKLLEDLNV
                     IYRDIGYSNTEILTKEKQIFNTISDSIKEFFNQAESEMSKLTINIEIEQDILNKILEI
                     IGDPSGIKTIPDLYIRNAILQQTRKTVPQSPKKPLSLLNKKNILESAREYIYNVYLPE
                     LTKFLEKCLDLQHLTNAIGMDLKDISEEEKNILNNLNESDNLEQIYEYLTNGSPKNKI
                     SLISEVIKKNKAELLNNPCLRDLSTSKYELISNLLENLKVEYLSRIDKVCTEGQRLEI
                     LLKDLRLDARKVIPKKMRQILDHYRNIDSFSIASIETYFEVSKSSLAELHLTYDKYNK
                     IHEEKSNTKHLWMLKCKQLWNLLNTSNDQIKIFVESNSDLSDSTMENIHNELERLEEM
                     KKNLIKELIDNTYKKVEKYWDILQYSEEEKKIFSSRIEEMRHTSNSLQDDEDTLEICE
                     TEVKKLEEQYSLYKPVLDLYEEFNSLLSDQAFLEASSKDSSRLLARNSHKILLKEEKT
                     RKRITRHFPRVILELKDRLIEMESKFNKPFLVDGVKVLDIVSVQEKELQSKYPRSRID
                     TGNRQSLGRVSSAGNGLRVAKPVITNSGRKVISGQRTTHSNRGVINQGKTSIARSSSD
                     LSDMEKAMHRRRTDVNVSTALNRNISNLSQKSRRHNFGYSSTTILSSNNATIKTQPRL
                     SQTRDLKPRQLFPLSVSKQNVQPTKIPILEKKVSFEAMTPGNKENVDYNQEIDRTRKT
                     NNNYASPYQESAKSVYKLSMSPEGKPKLDVEQNAYNISFDENSFFEN"
     gene            1105731..1105817
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0L10274r"
                     /db_xref="GeneID:2891065"
     tRNA            join(1105731..1105768,1105781..1105817)
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0L10274r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2891065"
     gene            complement(<1105986..>1107359)
                     /locus_tag="CAGL0L10318g"
                     /db_xref="GeneID:2891066"
     mRNA            complement(<1105986..>1107359)
                     /locus_tag="CAGL0L10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449215.1"
                     /db_xref="GeneID:2891066"
     CDS             complement(1105986..1107359)
                     /locus_tag="CAGL0L10318g"
                     /inference="similar to AA sequence:UniProtKB:Q08448"
                     /note="similar to uniprot|Q08448 Saccharomyces cerevisiae
                     YOR059c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449215.1"
                     /db_xref="GeneID:2891066"
                     /db_xref="GOA:Q6FKM9"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM9"
                     /translation="MGQDKHLFVLIHGLWGNYKHMKSLEKVLDATLNGKKSGKDKDYV
                     FFLPKQNATFKTFDGIEIIGYRTLLELCEFMKEFKDGNITKISFVGYSLGGLVARFVV
                     GKMYSECNDIFGNIERCIFMTMATPHLGIQFYNPLGYLHRKLLFSTFTGLGSTILGKS
                     GRELFIANSSNDILVRLSEGKYIEALEEFNHRILFANVKNDRTVAFFTGFIADVDPFL
                     ESDNRIKFDFESKIPGKSYSRAKPRIVDLNKLDSNVKKEKTQHNPVKYWSRTLLLLVL
                     VVFLIVPFAFFFNIGGTIYSYVATWRYRKMLKSNEFPKLIKEKAGFSDQLKGYMSDAY
                     SNVMSTVIDDDSQIENEDTPKFVDEDSNSWTNLLSKYTHHGGTEEKWKNKFKKMPLTK
                     ERQLIMRNLNQLTWIKIPIYVKFLNSHGGIVARNGISESTAATSVGSVEFAGQLVSYL
                     IHNANNK"
     gene            complement(<1107675..>1108514)
                     /locus_tag="CAGL0L10340g"
                     /db_xref="GeneID:2891067"
     mRNA            complement(<1107675..>1108514)
                     /locus_tag="CAGL0L10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449216.1"
                     /db_xref="GeneID:2891067"
     CDS             complement(1107675..1108514)
                     /locus_tag="CAGL0L10340g"
                     /inference="similar to AA sequence:UniProtKB:Q08457"
                     /note="similar to uniprot|Q08457 Saccharomyces cerevisiae
                     YOR060c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449216.1"
                     /db_xref="GeneID:2891067"
                     /db_xref="GOA:Q6FKM8"
                     /db_xref="InterPro:IPR016808"
                     /translation="MSLVANLKLSIGSKNNEFVLRDVQLWETSDTSILDAGQLKRVQS
                     YKGRFVAYVDIKKLPLWIKNQQSRELQCFTRSSTTLRYFSTKLGVKQRGIVFECIPLT
                     EKADNQGCCSYYIFYRNENVVKVVQVDLSIKANIDLQIKQIKSTLSNPQQADVKKLDS
                     TVSATIDSRLNSDITKIVSENIERHEHRTSKVLKSMLSNDKKIQVRDTLSKLILAGLR
                     LRGLSSTKSETQKLFRITLSASEFAHRKDLIQLQRGHTKAIPFEEMQETVETLLNLFT
                     RNG"
     gene            complement(<1109027..>1109785)
                     /locus_tag="CAGL0L10362g"
                     /db_xref="GeneID:2891068"
     mRNA            complement(<1109027..>1109785)
                     /locus_tag="CAGL0L10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449217.1"
                     /db_xref="GeneID:2891068"
     CDS             complement(1109027..1109785)
                     /locus_tag="CAGL0L10362g"
                     /inference="similar to AA sequence:UniProtKB:P36155"
                     /note="similar to uniprot|P36155 Saccharomyces cerevisiae
                     YKR075c or uniprot|P36025 Saccharomyces cerevisiae
                     YOR062c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449217.1"
                     /db_xref="GeneID:2891068"
                     /db_xref="GOA:Q6FKM7"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM7"
                     /translation="MTSLDDTIISRQNLMLLDNVTNYNKPALDYFHQDFDYSTMDISL
                     SWSLLLKMRKHKVLRLPSCSNEDDLDYNIYLERLHHCLWRRWSMKLFKLEDIRLDPLA
                     INWNKDTDVTVLYGPDLSVPEANNRTEPKKKSKPTLKSCLAHSADDDEEAEYYNDFSS
                     KYDYSSSVNSSTSSIFEKTYSKDEDELPQKKSLRFDDAVFKRVIDHSGNYHEIYTIIN
                     DKREQWRREQKRMYSRHKNSHSIDFGNAPPMYIS"
     gene            complement(<1111686..>1112351)
                     /locus_tag="CAGL0L10384g"
                     /db_xref="GeneID:2891069"
     mRNA            complement(<1111686..>1112351)
                     /locus_tag="CAGL0L10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449218.1"
                     /db_xref="GeneID:2891069"
     CDS             complement(1111686..1112351)
                     /locus_tag="CAGL0L10384g"
                     /inference="similar to AA sequence:UniProtKB:Q08465"
                     /note="similar to uniprot|Q08465 Saccharomyces cerevisiae
                     YOR064c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449218.1"
                     /db_xref="GeneID:2891069"
                     /db_xref="GOA:Q6FKM6"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM6"
                     /translation="MESRIVSSAEQATDIRYSFLNTLDHFSCEYVRTLWLIQYLDNKC
                     LDGARDEEALELQICGKAEYLNKLVEERVSFLQQYKQDLEMQKGINKRYSQLLSRKKG
                     TSTVVRQSSKTTTKKQNGKKLLLKINLKKAYRRDMELEKKRKDYLQKSSNESKKREVK
                     DANGDEERYCFCNDVSYGAMIACDNSKCEREWFHYPCIGMTKPPSGKWYCSEKCRLQG
                     GKK"
     gene            <1113678..>1114577
                     /locus_tag="CAGL0L10406g"
                     /db_xref="GeneID:2891070"
     mRNA            <1113678..>1114577
                     /locus_tag="CAGL0L10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449219.1"
                     /db_xref="GeneID:2891070"
     CDS             1113678..1114577
                     /locus_tag="CAGL0L10406g"
                     /note="highly similar to uniprot|P07143 Saccharomyces
                     cerevisiae YOR065w CYT1 cytochrome-c1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449219.1"
                     /db_xref="GeneID:2891070"
                     /db_xref="GOA:Q6FKM5"
                     /db_xref="InterPro:IPR002326"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="InterPro:IPR021157"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM5"
                     /translation="MFSTINRRFATRSFSMARELPKTSKLLVGGATLTAITTSALLYA
                     DSLTAEAMTAAEHGLHAPSYAWSHNGPLQTFDHASIRRGYQVYREVCAACHSLDRVAW
                     RTMVGVSHTNEEVREMAAEFEYDDEPDEQGNPKKRIGKLSDYIPGPYPNEQAARAANQ
                     GALPPDLSLIVKARHGAADYIFALLTGYPDDPPAGVQLPPGTNYNPYFPGGAISMARV
                     LFDDLVEYEDGTPATTSQMAKDVTTFLNWCAEPEHDERKKAGLKALLLLSSLYLLSVW
                     VKKFKWAAIKNRKFVFNPPKPRK"
     gene            <1115895..>1117763
                     /locus_tag="CAGL0L10428g"
                     /db_xref="GeneID:2891071"
     mRNA            <1115895..>1117763
                     /locus_tag="CAGL0L10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449220.1"
                     /db_xref="GeneID:2891071"
     CDS             1115895..1117763
                     /locus_tag="CAGL0L10428g"
                     /inference="similar to AA sequence:UniProtKB:Q08471"
                     /note="similar to uniprot|Q08471 Saccharomyces cerevisiae
                     YOR066w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449220.1"
                     /db_xref="GeneID:2891071"
                     /db_xref="GOA:Q6FKM4"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM4"
                     /translation="METIKRRRGRPQLTKDYADPSQSPLAQSSKQVQKQGKRAFAKPL
                     MKVISTPSPKKRRMSTDLNSPPVSITKKGRHRGIIISSPMKKTAAKSYKENRYEDGFS
                     SGSSTPTSTPTSHSSFFSVSRNTLQSSPPMMFSSSPTVSSHNMKQPQPRMYYSHSTQD
                     ETKSRMGLKLALTVNEKGEAVICEGGETLRPAVGDMSTDKDMASTSMDSSQTDRSDKA
                     SATELETTASNTAVPDTSPMFNKREVLSMLKKMNFNSNNDKPNTDTLPRLIIDDEITG
                     PSANVICEDLDGQDTASSAHQHQKSSSNGQVPKSPCTPGTTFQFKTGFTPKFGIDSML
                     ADEFSSPKFAKRLASHENHLSINISSPEHNLTLTPRTRKSLRSVDGVPFTQFMVSNSQ
                     TSQDKSLGRTPITSADPNEQQFVFKFSSGDPLLLTEDGDGNWPDILYHQFSTSPRKTK
                     AFNTPPSWINFGSPGPLSPLRRNSNTLLTTNLMKTLASPNVSNERGASSSLNPSIEVH
                     SPIVHENLSSVRTRKDNADFSASKMNIPSSPRNLTISNEPATPKNLTETISNTIECTP
                     LIQHTMEGSLSTKYLAANFAFGQIDHVVAIDTAKQTSVIPKQDDARLALQKLINDH"
     gene            complement(<1117959..>1119611)
                     /locus_tag="CAGL0L10450g"
                     /db_xref="GeneID:2891072"
     mRNA            complement(<1117959..>1119611)
                     /locus_tag="CAGL0L10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449221.1"
                     /db_xref="GeneID:2891072"
     CDS             complement(1117959..1119611)
                     /locus_tag="CAGL0L10450g"
                     /inference="similar to AA sequence:UniProtKB:P40351"
                     /note="similar to uniprot|P40351 Saccharomyces cerevisiae
                     YOR067c ALG8 Glucosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449221.1"
                     /db_xref="GeneID:2891072"
                     /db_xref="GOA:Q6FKM3"
                     /db_xref="InterPro:IPR004856"
                     /translation="MAEVKEEQPKRFSLWNFWISSLLLKLLLIPDYYSTDFDVHRNWL
                     AITNKLPLRQWYYEHTSQWTLDYPPFFAYFEWFLSQFVPSYVKSDGCLDIVEVGQFGM
                     PTVVFQRLTVIASEILLFVVLQVYINTSKVSERTQSFVVASSIAISPGFLIIDHIHFQ
                     YNGFLFAILIASIVAAKNKKYLWCGFFYSVALCFKHIYLYLAPCYFVFLLRAYVLNLK
                     DFKFKSYRDLIFIVKWRHLVKLGSVVIATFAVAFGPFIFDLPQLLTRLFPFSRGLTHA
                     YWAPNFWAIYSTIDKILTMVFLKMPYTYKLASQFISPPLIPASLNEIKAKMAANNNGS
                     KGLVEDVYFVILPQIVPKLTFLLTLLYQVLAVVPVLFDPSFKRFMGSMTLCGLASFLF
                     GWHVHEKAIMLVIIPFSFLVISDRRLLSSFMLLTSAGYVSLFPLLYESQDFLIKTFYT
                     YVWCVIYFFAFRKTTRLSTSVERRVFFLDRLTLVYMFLLIPMVFLIQIRDILGWKYLV
                     LQRFEFLSLMVYSFYCSVGIISAWFGLSWLYNFDEPLWVSNE"
     gene            <1120163..>1122079
                     /locus_tag="CAGL0L10472g"
                     /db_xref="GeneID:2891033"
     mRNA            <1120163..>1122079
                     /locus_tag="CAGL0L10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449222.1"
                     /db_xref="GeneID:2891033"
     CDS             1120163..1122079
                     /locus_tag="CAGL0L10472g"
                     /inference="similar to AA sequence:UniProtKB:Q92331"
                     /note="similar to uniprot|Q92331 Saccharomyces cerevisiae
                     YOR069w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449222.1"
                     /db_xref="GeneID:2891033"
                     /db_xref="GOA:Q6FKM2"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="InterPro:IPR028648"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM2"
                     /translation="MDYEDDLSAPVWDDLNPLAEADTVEETALSEEEIEEQSEDSDGE
                     EEVQVDSTSGGWGDNNETKKELLNDLAPMEDPLSGLLNESPSKRGTTPGALFESQTAP
                     LISINEDDLSASSYTAAKGHSTPRKLFDSSRIRRNIKVPLNSDGNSAKSESSHSVIDP
                     LGQAEKDREFVDEPLDDRVTNSQHANRSIFEQVESPLYHISPKKKAMDTNTDITPTES
                     VHNKTEEASQQDIEDEPVISHFQIEVTDPIKVGELTSSHIKYTVNAESELLSPNQNQV
                     SRRYRDFRWLYRQLQNNHWGKVIPPPPEKQTVGTFQPEFVETRRLQLQTMLRRIANDS
                     DLQRDEHFHMFLTSDNFAEDSKRVSYETGSNANNDNNDISEVHISEIQLLGPEEGAFV
                     IKNGGLDSEYKKGFMNISFSSIPKYNEPDKFFVDELDRITDLENQLKKMLKAVESIEE
                     QRRELSSYTYDLASLIESLGALDVTKGSTKLCYELAETQKRVKESLERDALQEAITMG
                     ATLDEYVRSLASLRSIFYQRAKLGYYLVIVENDFQKKKQDVEKMCHNNKQPANKERFL
                     AARDSVKNIERRAITVKKAWHDIGEKIKKEVSSFDRSKMEEFRNCMEITLESAIESQK
                     ESIELWETMYHENL"
     gene            complement(<1122271..>1124199)
                     /locus_tag="CAGL0L10494g"
                     /db_xref="GeneID:2891034"
     mRNA            complement(<1122271..>1124199)
                     /locus_tag="CAGL0L10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449223.1"
                     /db_xref="GeneID:2891034"
     CDS             complement(1122271..1124199)
                     /locus_tag="CAGL0L10494g"
                     /inference="similar to AA sequence:UniProtKB:Q08484"
                     /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
                     YOR070c GYP1 GTPase activating protein for YPT1P and SEC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449223.1"
                     /db_xref="GeneID:2891034"
                     /db_xref="GOA:Q6FKM1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM1"
                     /translation="MVVRTGSKHMYEKERSSSNHESSSSLVTSLMKSWKISSSPSSSK
                     RTSSLPSSPSTPVLSSSPTTNTAASAKAYGSRTSSDSLSNMGFYKVADGNIEAYSKKQ
                     ISSRRTSSSYSPLRYVNPLSMSSSSVLESPRANSGLGLHKYNSHGNGGSTSRRASGHD
                     VKKPAKYFRDLDEDWSAVIDDYNSPIPTMVNGGYGAKISRKASESNTLSRVSTSSSVA
                     TNTTTKVGSNSLSYPQLPQLKRSETDHLRTQKELEDTKEVQHLNAIIKRIAKFDSILK
                     DKSIINLQELRQVSWNGIPKCHRPVVWKLLIGYLPANIKRQENLLNNKRKEYKDSLAH
                     TFSDKHARDEPTWHQIEIDIPRTNPHIPLYQFKTVQQSLQRILYLWAIRHPASGYVQG
                     INDLATPFYQTFLTEYLSPSKIEDVESTDPLDYMTPEQIEDVEADTFWCLTKLLEQIT
                     DNYIQGQPGILNQVKNLSQLVKRIDGDLYSHFQDEHVEFIQFSFRWMNCLLMREFQMS
                     AVIRMWDTYLAETSSESSATYSHKAEYGPPRTPTEPRVSTFTTPVKEFNSPSASMKSA
                     ESTKLSQSSLNEFHVFVCAAFLVKWSDQLLAMDFQEIITFLQNPPTKDWDENEIEMLL
                     SEAYIWQSLYKDATSHWL"
     gene            complement(<1124945..>1125994)
                     /locus_tag="CAGL0L10516g"
                     /db_xref="GeneID:2891035"
     mRNA            complement(<1124945..>1125994)
                     /locus_tag="CAGL0L10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449224.1"
                     /db_xref="GeneID:2891035"
     CDS             complement(1124945..1125994)
                     /locus_tag="CAGL0L10516g"
                     /note="highly similar to uniprot|P36160 Saccharomyces
                     cerevisiae YKR081c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449224.1"
                     /db_xref="GeneID:2891035"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q6FKM0"
                     /translation="MIRTVKPKNARAKRALEKRESKLVENTKQALFVPGQTSNKLLHD
                     VMVDLSALKKPDIKRFNKKNDIHPFEDPEPLEFFSEKNDASLLVLSTSSKKRKNNLTF
                     VRTFGYKIYDMIELLIAENYKLLNDFRKRTFTVGLKPMFSFQGSAFETHPVYKQIKSL
                     FLDFFRGQTTDLQDVAGLQHVISISIQGDFQEGEPLPNVLFRVYKLRTYKSEQGGKTL
                     PRVELDEVGPRLDFKIGRVRTPSPEMEKEAHKRAKQLDVKTKKNVEIDTMGDKLGRIH
                     MGKQDLNKLQTRKMKGLKSKFDQVDDDEEDYLNDSEEDLQGSMSEHEDTFGEDFVTAD
                     EIDENQPASKKQRRA"
     gene            complement(<1126417..>1127550)
                     /locus_tag="CAGL0L10538g"
                     /db_xref="GeneID:2891036"
     mRNA            complement(<1126417..>1127550)
                     /locus_tag="CAGL0L10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449225.1"
                     /db_xref="GeneID:2891036"
     CDS             complement(1126417..1127550)
                     /locus_tag="CAGL0L10538g"
                     /inference="similar to AA sequence:UniProtKB:P38787"
                     /note="similar to uniprot|P38787 Saccharomyces cerevisiae
                     YHR063c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449225.1"
                     /db_xref="GeneID:2891036"
                     /db_xref="GOA:Q6FKL9"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL9"
                     /translation="MTAAVRPVVHIVGLGAVGTVLAVDLLRFTNVSLVPLFRSQAKLD
                     YFRNDCKSTFGIRKLYEENTPVYKYKIENSECPTTFPGGKISNLIVTTKTYQTKEAIS
                     PYLPYIDSNTNIILIQNGLGVLEVLRDDIFKNSSQRPHLFQGVISHGIFQDEGFIYNH
                     AGWVGMKIARLPWTDNEMIQTSQSVQNDEQNELIGLLTQKILAKEFGIEHMSYQELLL
                     GQLHKFLVNACMNPVTAIVDCVNGEMIDDCPPVFKSIVDECLDVLRVAYKPLFDYEET
                     YKGKTEYPSLSVNDTLEPKQLVKDIIRVGCDLNAKNSTSMRQDTLYLRETEINYINGY
                     IVQLAQTHNLGPNACKVNKTITELVNLRSGLNKTRAEKGDWRK"
     gene            complement(<1128132..>1129742)
                     /locus_tag="CAGL0L10560g"
                     /db_xref="GeneID:2891037"
     mRNA            complement(<1128132..>1129742)
                     /locus_tag="CAGL0L10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449226.1"
                     /db_xref="GeneID:2891037"
     CDS             complement(1128132..1129742)
                     /locus_tag="CAGL0L10560g"
                     /note="highly similar to uniprot|P38788 Saccharomyces
                     cerevisiae YHR064c PDR13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449226.1"
                     /db_xref="GeneID:2891037"
                     /db_xref="GOA:Q6FKL8"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL8"
                     /translation="MSSPVIGISFGNTSSSIAYINPKNDVDVIANPDGERAIPSVLSY
                     VGEDEYHGGQALQQLVRNPKNTIINFRDFIGLPFSQCDASRCAAGAPVVEIDGKAGFV
                     VSRGDVEEKLTVDEVVSRHLNRLKLAAEDYIGSSVKQAVLTVSSDFTDEQKAALKASA
                     AQVGLEIVQFINEPSAALLAHVEKYPFKEDVNVVVADFGGVRSDAAVIAIRNGIFTIL
                     ATAHDQHLGGDNLDAELIEYFAKDFEKTNKCNPTKNARSLAKLRANAMVTKKTLSNAT
                     TATISIDSLADGFDYHTSINRMRYELVANKVFSQFTSFIENVIAKAELDPLDIQAVLL
                     SGGVSFTPKLTTNLEFIFPESVEILGPQNENASNNPNELASSGAALQAGLVSNYDNEE
                     LAEALQPIVVNTPHLPKAIGLIGAHGEFHPVLLPETSYPVQKKITLKNAKGDLLVGVY
                     EGEHHIQEKTVEPEAKEEDEEDSEEWSDDEPEVIREKLYTLSTKLMELGLKDVKNGAE
                     ITFNVNKDGVLRVSARDLKSTTVVKGEL"
     gene            <1131528..>1134824
                     /locus_tag="CAGL0L10582g"
                     /db_xref="GeneID:2891038"
     mRNA            <1131528..>1134824
                     /locus_tag="CAGL0L10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449227.1"
                     /db_xref="GeneID:2891038"
     CDS             1131528..1134824
                     /locus_tag="CAGL0L10582g"
                     /note="highly similar to uniprot|Q04336 Saccharomyces
                     cerevisiae YMR196w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449227.1"
                     /db_xref="GeneID:2891038"
                     /db_xref="GOA:Q6FKL7"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL7"
                     /translation="MNRLRDEFVDSTMEEKRLHENKNREKYWYRWGPYLSERAWATVR
                     EDYSFNGDAWSNFPFEHANARVFRWGEDGLFGVSDNKQLVCMNLALWNGKDERLKERL
                     FGLTGPQGNHGEDCKELYYYLDNTPSHSYMKALYKYPFKKEFPYKELVEKNAERGYKD
                     KEFEIYEIDGLFQDKETGDSPYYDVFFEMAKDADNENELNFRITVHNRSKTDSGELYI
                     APQVFFRNTWAWDAKSEKPNLYKDEKSENLLHVNHKKYGSRQVVFQPSPGGFGEDDSE
                     DIDDIDPVLLFTDNESNLVKLFNEKENPSKYTKDAFEEYIVNGKKDSVNPANEGTKAC
                     AVYHFKNIPAGEYVTVRYTFTDKPENKIFETEGISVVDEDQFDNVFDEREEEAENFYW
                     RINPAPVSDELRKIQRQAFAGLLWTKQFYNLTWDAWYNGDKNIKPRPPPDRANGRNKN
                     WKHMYIEDILSMPDKWEYPFFASWDTAFHCIPLAMIDPDFAKKQLDLLTREWYMHPNG
                     QIPAYEWNFNDVNPPVHAWAVYRVFKIERNVYNREDRVFLERVFQKLLLNFTWWVNRK
                     DVDGKNVFEGGFLGLDNIGVFNRSEPLPTGGTLEQADSTGWMAFYSLQMLNIALELAK
                     SNPVYEDIASKFFEHFILISDSMSFDYACDVHNGVEQVSQNLWNEQDKFYYDAISWGN
                     HKEQLPIRSLVGLIPLYATMTLEPNLLKQFPSFKRRVDWFVENRPEIFDRNVASMSKR
                     GVGERLLLSLVTKERLEAILTRMLDESEFLSAYGIRSLSKYHEKHPFEMEVNGNKYCV
                     SYLPGESDSGMFGGNSNWRGPIWFSTSFLIIESLQRFYLYYGSGLKVECPVGSGDYLN
                     LAEVAEELGYRMIHLFVPDENGERAINYGEYSEFLSKDEHFKDYLQFFEYFDGDTGRG
                     LGASHQCGWTALVAKWISDVGASCVRLPRTPRSSVSTTASISSTETEETVHKLKRMAR
                     RKSAKSLVNFTGTVLDLTEEEKHLHRIGGTSTGLTPRSSVSSVKAAEIMNEEILDKIK
                     DEEIEAQQALESSVKKEVTDDKDDVPENAHKYESTIMNKLKEKMKKLTILPKDASAPC
                     SDEEDELVCH"
     gene            complement(<1135086..>1135763)
                     /locus_tag="CAGL0L10604g"
                     /db_xref="GeneID:2891039"
     mRNA            complement(<1135086..>1135763)
                     /locus_tag="CAGL0L10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449228.1"
                     /db_xref="GeneID:2891039"
     CDS             complement(1135086..1135763)
                     /locus_tag="CAGL0L10604g"
                     /note="highly similar to uniprot|Q04338 Saccharomyces
                     cerevisiae YMR197c VTI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449228.1"
                     /db_xref="GeneID:2891039"
                     /db_xref="GOA:Q6FKL6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL6"
                     /translation="MSLLVSYESDFKATLDQGKAALVKASAQSLPERNATLKQIEEQK
                     DELYDLLDQMALEVNNSVSDMQQRANYKAKIRDWKTQVNQELKEPLQKLLDTRDKDEL
                     FGAAARSGANGNIDVEGMSEEQRQQLLSNHAILQKSGDKLRDASRLANETEGIGSQIM
                     MDLRSQRETLENARDTLFQADSYVDKSIKTLKVMSRRLIANKAISYAIIAVLILLIIL
                     VIFSKFR"
     gene            <1136212..>1137753
                     /locus_tag="CAGL0L10626g"
                     /db_xref="GeneID:2891040"
     mRNA            <1136212..>1137753
                     /locus_tag="CAGL0L10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449229.1"
                     /db_xref="GeneID:2891040"
     CDS             1136212..1137753
                     /locus_tag="CAGL0L10626g"
                     /note="some similarities with uniprot|Q01649 Saccharomyces
                     cerevisiae YMR198w CIK1 spindle pole body associated
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449229.1"
                     /db_xref="GeneID:2891040"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL5"
                     /translation="MLRDVTNTPVISGRSATVDGGKLAYGDDKLMEEIKRRERKVLQD
                     INRLKSAVEEIDKETEKIRSRLPELAGSYRQLLDNIDNEDKQILCLEEQLESLESQCN
                     TERENQRRMVENLELQHSIDVTNHNTSLDQKNSESRHSWEVQLIELQNEPETKDNVDI
                     IKAIKTELAELQVEWYAIEKENDKKCSEYKQELREQFETFKREKKLNLQETENTANSS
                     LKDENEHRSKLESHKATICANDSEIANLRDTIADRTSTISQIDKSMLPLEQELREASL
                     QFREIENDCNHVNKVCEHLKSTNSLVFERYLQEKRAKKKLQYAIEEIRGKIRNFAILN
                     SDRVKNIFDVDITKATIRNINNRRVYQFNRLIERASILEQRKLWEEFETYIEIQLRKQ
                     CDFSIFICNPAATEFPFVDKLDTCISESTITDAYTYTRTKDGSTNVFNFKSKIDGSEV
                     IGYFIELREDIRDKLENKYSQTLSSTIPCIMHLLDISTISISLQIFQTFKEINNPKPS
                     ALRKK"
     gene            <1139528..>1140958
                     /locus_tag="CAGL0L10648g"
                     /db_xref="GeneID:2891041"
     mRNA            <1139528..>1140958
                     /locus_tag="CAGL0L10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449230.1"
                     /db_xref="GeneID:2891041"
     CDS             1139528..1140958
                     /locus_tag="CAGL0L10648g"
                     /inference="similar to AA sequence:UniProtKB:P20437"
                     /note="similar to uniprot|P20437 Saccharomyces cerevisiae
                     YMR199w CLN1 or uniprot|P20438 Saccharomyces cerevisiae
                     YPL256c CLN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449230.1"
                     /db_xref="GeneID:2891041"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL4"
                     /translation="MSNSNCGLKVTAKQTYYPIELSNAELLTHYETIQEYHNDISENV
                     LRTAAKFKPDTKMIDMQPQMNPNETRSTMVNFLFELSVLTRVTNGIFFHSVRLYDRYC
                     SKRVILRDQANLVAGTCLWLAAKTWGGCSHVINNVTVPTGGRFYGPNPRARVPRLSEL
                     VHYCGGSEVFDESMFMQMERHILDTLNWDVYEMSINDYVLNVDENCLIQYELYEAQLK
                     YSREMKMKHNSGASKSTIDMTEDDEEYNELRMKIELINLKKFLIDLSCWNYKFLKAEM
                     HELCQSIFDTINRFTSQDQGPLLSIPSLNPETSEELINVFVETIVNLPDSIFRVYKDQ
                     TGVFEFVVKVREYNDEMQRKYQAPSIMDLSKRLAINTQYVDIESGVPSPAYSTDTLTP
                     MRHSSAQSDNSVFSVNHLGNSSPLTPHMHSFTNFKNDSAHCSSTSLSSIPNDNRANAG
                     MNNYSIASTNKPTHMDYDNKENQLPV"
     gene            <1141710..>1142501
                     /locus_tag="CAGL0L10670g"
                     /db_xref="GeneID:2891042"
     mRNA            <1141710..>1142501
                     /locus_tag="CAGL0L10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449231.1"
                     /db_xref="GeneID:2891042"
     CDS             1141710..1142501
                     /locus_tag="CAGL0L10670g"
                     /inference="similar to AA sequence:UniProtKB:Q03691"
                     /note="similar to uniprot|Q03691 Saccharomyces cerevisiae
                     YMR200w ROT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449231.1"
                     /db_xref="GeneID:2891042"
                     /db_xref="GOA:Q6FKL3"
                     /db_xref="InterPro:IPR019623"
                     /translation="MVRSLLFALLSVAGLVAGDAADLVGTWSSKSNQVFTGPGFYDPI
                     DELLIEPALPGISYSFTEDGWFEEASYQVSGNPKNPACPKASLIYQHGKFELLDNGTL
                     ILHPIEVDGRQLFSDPCSDNGISTYTRYNQTEVFKSFETFIDPYHGVYTLQLYQFNGA
                     PLPPLYLAYRPPMMLPTETLNPTDGSTGSHPTGSSESESQESDDTSKRSLLKKRSLRE
                     HVKRSLENRYKTNAVKKSDSIFNAAFVWYTSFFLVGAGSLIFISS"
     gene            complement(<1143044..>1144084)
                     /locus_tag="CAGL0L10692g"
                     /db_xref="GeneID:2891043"
     mRNA            complement(<1143044..>1144084)
                     /locus_tag="CAGL0L10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449232.1"
                     /db_xref="GeneID:2891043"
     CDS             complement(1143044..1144084)
                     /locus_tag="CAGL0L10692g"
                     /note="highly similar to uniprot|P28519 Saccharomyces
                     cerevisiae YMR201c RAD14 nucleotide excision repair
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449232.1"
                     /db_xref="GeneID:2891043"
                     /db_xref="GOA:Q6FKL2"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR022652"
                     /db_xref="InterPro:IPR022656"
                     /db_xref="InterPro:IPR022658"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL2"
                     /translation="MVTAEQKARIEANRKLALQRLKARGIISSNGTSSGTEGGGKPAT
                     GGAAPAPSKQDDMAKLQAAAPPDSVRDSTALLEDRSHKRPLDSIRPSIRKQDYIEYDF
                     ATMKNLNGGYINPEDRVGGSDDFDDEFGSKKQKTLDDWKREQQERRMLYENAPPPEHI
                     SQAPKCIECNVNIEMDPVLHDVFKLQVCKQCSKDHPEKYSLLTKTECKEDYFLTDPEL
                     NDPDLFYKLEKPNPHSGTFARMQLYVRCQIEEFAFKKWGGEEGLDQEWQRREEGKSSR
                     REKKYQKKIAEMRLKTRAQEYTTKLREKKYGMKHVHDFSVVVTTGKDEDGHSYTRKKC
                     IDCGLEMEESDL"
     gene            <1144556..>1145230
                     /locus_tag="CAGL0L10714g"
                     /db_xref="GeneID:2891044"
     mRNA            <1144556..>1145230
                     /locus_tag="CAGL0L10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449233.1"
                     /db_xref="GeneID:2891044"
     CDS             1144556..1145230
                     /locus_tag="CAGL0L10714g"
                     /note="highly similar to uniprot|P32352 Saccharomyces
                     cerevisiae YMR202w ERG2 C-8 sterol isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449233.1"
                     /db_xref="GeneID:2891044"
                     /db_xref="GOA:Q6FKL1"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:Q6FKL1"
                     /translation="MKFFINLLLLVAGVGYLLNSLYDSWLPRNYIFDPKTLNEICNGV
                     LAKHNGSDASASTESLLIDVRDALAKHYGDEYINEYTRDAWVFNNAGGAMGQMIILHA
                     SISEYVILFGTAVGTEGHTGVHFADDYFTILKGVQRAALPWEADPEEYFPGMTHHLQK
                     GYAKQYAMDQNSFALELAQGWIPCMLPFGFLDTFSSTLDLYTLGKTIYLTAKDMIKNL
                     VQNQKF"
     gene            complement(<1145541..>1146569)
                     /locus_tag="CAGL0L10736g"
                     /db_xref="GeneID:2891045"
     mRNA            complement(<1145541..>1146569)
                     /locus_tag="CAGL0L10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449234.1"
                     /db_xref="GeneID:2891045"
     CDS             complement(1145541..1146569)
                     /locus_tag="CAGL0L10736g"
                     /note="some similarities with uniprot|Q03694 Saccharomyces
                     cerevisiae YMR204c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449234.1"
                     /db_xref="GeneID:2891045"
                     /db_xref="GOA:Q6FKL0"
                     /db_xref="InterPro:IPR024758"
                     /translation="MSTVKQRTRTEGKPQYPLMQSIKDTLKLKTTKRTNSEKKVSTLN
                     DKSGSPIKSNSERRNGITRKVNGSKRLSAQRVALFKYNNVQVFNYVRNGNNSRKSSMS
                     SLNSSGTVVMCNEYDSEVTNLKPQMLIGKGVLELYQIKTPAALDRKEQTMNYISLGRG
                     GQIVHPILPKLKITKLRNENFKYLITFSNPERYWQIEFLQINGQLHDELLKITDEFES
                     IISSVCIFIDENITKLASLKSNKTPPNNVNTLDQIKEKVQTATENDDDEAEELDYLLE
                     DPIEQEPTSSFEYDVPTDLTEVFQRTMGRINSNGSRRYSSVPQFSHRRSMIRRSMSLF
                     PEHEGRFS"
     gene            complement(<1147396..>1150311)
                     /locus_tag="CAGL0L10758g"
                     /db_xref="GeneID:2891046"
     mRNA            complement(<1147396..>1150311)
                     /locus_tag="CAGL0L10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449235.1"
                     /db_xref="GeneID:2891046"
     CDS             complement(1147396..1150311)
                     /locus_tag="CAGL0L10758g"
                     /note="highly similar to uniprot|P16862 Saccharomyces
                     cerevisiae YMR205c PFK2 or uniprot|P16861 Saccharomyces
                     cerevisiae YGR240c PFK1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449235.1"
                     /db_xref="GeneID:2891046"
                     /db_xref="GOA:Q6FKK9"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK9"
                     /translation="MTAEALVNGTSYTTLVAHSQESFKNAVEFYKNFLSLMKLNDKNA
                     NEATLYNSSVCLKIVLEEDSSKNQAAMHRVTKLSEMSKKQDWRAQVKDSLVFNIVDIQ
                     SIQKSLIANNFPIQAYPTTLQPMQLFTIDPLGNVVGVTCTKNAASTRPTKPQADVTTV
                     PPSALASNVPSALPSKVQSFTDLSYCMKTTDHYPSLPTKATRVTPESKKAIAVMTSGG
                     DAPGMNSNVRAIVRSALFKGCRAFVVMEGYEGLVRGGPEYIKEFSWEDVRGWSTQGGT
                     NIGTARCMEFRERKGRLLGAQHLIEAGVDALIVCGGDGSLTGADLFRSEWPSLIDELL
                     KENRIDNDQYERYKHLNICGTVGSIDNDMSTTDATIGAYSALDRICTAIDYVEATANS
                     HSRAFVVEVMGRNCGWLALLAGIATSADYIFIPEKPATSSEWQDQMCDIVAKHRSRGK
                     RTTIVIVAEGAIANDLTPISPSDVHKVLCDRLGLDTRITTLGHVQRGGTAVAYDRILA
                     TLQGIEAVNAVLESKPDTQSPLIAINENKITRKPLVESVKLTKSVADAIQAKDFKKAM
                     SLRDTEFIEHMKNFMAINSADHNEPKLSEDKRLKIAIVNVGAPAGGINSAVYSMATYC
                     MSQGHKPYAIYNGFSGLARHESVRSLKWQDMLGWQSRGGSEIGTNRVTPEEADLGMVA
                     YYFQKYQFDGLILVGGFEAFESLHQLERARETYPAFRIPMVLIPATLSNNVPGTEYSL
                     GSDTALNALMEYCDIVKQSASSTRGRAFVVDVQGGNSGYLATYAALAVGAQVSYVPEE
                     GISLEQLSQDIEYLAEAFEVAQGREGFGKLILKSTNASKALTAEKLAEVITAEANGRF
                     DAKAAYPGHVQQGGLPSPIDRTRATRFAIRAVDFIEEQQSVIANARAANDVFVADDKD
                     VESTATVLGVKGSQIVFSSIRQLYDFETEVGKRMPKVIHWQNARAIADHLVGRKRVD"
     gene            complement(<1151884..>1158585)
                     /locus_tag="CAGL0L10780g"
                     /db_xref="GeneID:2891047"
     mRNA            complement(<1151884..>1158585)
                     /locus_tag="CAGL0L10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449236.1"
                     /db_xref="GeneID:2891047"
     CDS             complement(1151884..1158585)
                     /locus_tag="CAGL0L10780g"
                     /note="highly similar to uniprot|Q00955 Saccharomyces
                     cerevisiae YNR016c ACC1 or uniprot|P32874 Saccharomyces
                     cerevisiae YMR207c HFA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449236.1"
                     /db_xref="GeneID:2891047"
                     /db_xref="GOA:Q6FKK8"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK8"
                     /translation="MSDESLYEDSAQKEQYEVTDYSSRHQVLPSHFVGLNTVEKVEDS
                     PLKEFVKAHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGDEKIVQFVAMATPED
                     LEANAEYIRMADQYVEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLP
                     EKLARSKRKILFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDTVHIDEKNG
                     LVSVDDDIYQKGCCSSPEDGLEKAKKIGFPVMIKASEGGGGKGIRQVTREEDFINLYH
                     QAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPV
                     TIAGPETFGEMEKAAVRLGKLVGYVSAGTVEYLYSHDDNKFYFLELNPRLQVEHPTTE
                     MVTGVNLPAAQLQIAMGIPMHRISDIRIFYGLNPRGSSEIDFEFKSEDSLKTQRKPIP
                     KGHCTACRITSEDPNDGFKPSGGTLNELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGH
                     IFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEENTITTGWLDDLI
                     STKMTAKKPDPILAVICGAATKAFIASEAARQDYINSLTRGQVLSKSQLKTMFPVEFI
                     HEGKRYKFTVAKSADDRYTLFINGSKCEVRVRKLSDGGLLIALGGKSHTIYWKEEVAA
                     TRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGDHIAAGQAYAEIEVMKMQMPL
                     LSQENGIVQLLKQPGSTIAAGDIIAILTLDDPSKVKHALPFEGLLPDLGSPVVEGTKP
                     AYKFKSLVTTLENILKGYDNQVIMNASLQQLIEVLRDPKLPYSEWKLHISALHSRLPI
                     KLDEQLEQLVERSEKRGAGFPAKQLGRLIETHVNQSSDALIGTVVEPLVDICNRYGNG
                     LEAHEHSVFVNFLEKYYEVEKLFNGATDREENVILKLRDENADNLDKVALIVLSHSKV
                     SAKNNLILAILKHYQPLCKIYSNVASIFAGPLQRIVELESKATAKVALQAREILIQGA
                     LPSVKERTEQVEHILKSAVVKTTYGETNTKRNEPDQLILRDLIDSNYVVFDVLLQFLN
                     HSDLSVATAAGQVYVRRAYRAYTIGEVKSHELSGRPVIEWKFQLPSAAFSSIPLVKTK
                     MGMNRAMSVSDLSYVADNESAPLRTGIMVSANHLDDVDEALSEGLEIVPQHGNNPHSS
                     SGPVPDRSGSSASLSNVANVIVGSTDGFSTEEEILKRLNEILDMNKQLLIDSAIRRIT
                     FMFGFKDGSYPKYYTFNGPNYSENETIRHIEPALAFQLELGRMSNFNIKPIFTENRNI
                     HVYEAVSKTSPLDKRFFTRGIIRTGHIRDDISIQEYLTSEANRLMSDILDNLEITDTS
                     NSDLNHIFINFSAIFDVSPADVEAAFGGFLERFGKRLLRLRVTSAEIRIIIKDTETGA
                     PIPLRALINNVSGYVVRTELYTEIKNSKGEWVFKSLGKPGSMHLRPIATPYPVKEWLQ
                     PKRYKAHLMGTTYVYDFPELFRQAAVSSWAKFSSKTKFTDDFFIANELIEDENGELTE
                     VEREAGANSIGMVAFKITVKTPEYPRGRQFVIVANDITFKIGSFGPQEDEFFDKVTNY
                     ARKRGIPRIYLAANSGARIGIAEELVPLFQVSWNDKSDPTKGFEYMYLDNEGLETLKK
                     YKKEHSVITERIVEHGEERHVIKTIIGADEGLGVECLKGSGLIAGSTSRAYQDIFTIT
                     LVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKVLGREVYTSNLQLGGTQIMY
                     NNGVSHLTAADDLAGVEQIMQWLSYIPAKRDMPVPILETEDKWDRDVEYYPPKDSQFD
                     VRWMLSGKQTPEGFEHGLFDKNSFFETLSGWSQGVVIGRARLGGIPLGVIAVETRTVE
                     TLIPADPANPQSTETLIQQAGQVWYPNSAFKTAQAINDFNHGEQLPLMILANWRGFSG
                     GQRDMYNEVLKYGSFIVDALVDYKQPIIVYIPPLGELRGGSWVVVDPMINAEQMEMYA
                     DVDSRAGVLEPAGMVGIKYRREKLLNTMARLDEKYKTLKEKLSEKGLSAEEHQKASVE
                     LAQREKELLPIYHQITLQFADLHDRSGRMLEKGTIRKEIEWINSRKFFFWRLRRRLNE
                     EYLIKRLNQELPNASRLEKFARIRSWYPVSMDVDNDRDVATWIEENYQSIDENLKKLK
                     SERFALDVAKSIRNDHDNAITGLCEILKMMTAEDKEKVLKSLK"
     gene            complement(<1159230..>1160783)
                     /locus_tag="CAGL0L10802g"
                     /db_xref="GeneID:2891048"
     mRNA            complement(<1159230..>1160783)
                     /locus_tag="CAGL0L10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449237.1"
                     /db_xref="GeneID:2891048"
     CDS             complement(1159230..1160783)
                     /locus_tag="CAGL0L10802g"
                     /inference="similar to AA sequence:UniProtKB:P25381"
                     /note="similar to uniprot|P25381 Saccharomyces cerevisiae
                     YCR045c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449237.1"
                     /db_xref="GeneID:2891048"
                     /db_xref="GOA:Q6FKK7"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK7"
                     /translation="MKLITIIIYLFAFVSAEEYIVSLKGPKAFQRFMDSQLVQEILES
                     KPIRKRIIKTYSFGNFRGFVIDLPNEWLIKIRRSPFVSQVVPNFSFKAFDEETALSEV
                     YRGRTIVARGENGGSPELQGFKKEECRGDSVYFDKFEASGKDMPQVNGKLLSRYIKTQ
                     SEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD
                     FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTL
                     DTVMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRST
                     IINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGAFDDRIDSIAKFSNWG
                     NCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLDSGIKPTQIKKRLN
                     ELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHYSYPNITIEHILKELDSYTTP
                     AITKGVLLV"
     gene            complement(<1161221..>1161754)
                     /locus_tag="CAGL0L10824g"
                     /db_xref="GeneID:2891049"
     mRNA            complement(<1161221..>1161754)
                     /locus_tag="CAGL0L10824g"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="XM_449238.1"
                     /db_xref="GeneID:2891049"
     CDS             complement(1161221..1161754)
                     /locus_tag="CAGL0L10824g"
                     /inference="similar to AA sequence:UniProtKB:P25626"
                     /note="similar to uniprot|P25626 Saccharomyces cerevisiae
                     YCR046c PETCR46"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="XP_449238.1"
                     /db_xref="GeneID:2891049"
                     /db_xref="GOA:Q6FKK6"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK6"
                     /translation="MYNRSTSLVSRLAPSLMRFSRAYQLPSSSRKVISIYPVLEQKEK
                     RANILKKLSQEQLDSKLDANNERRKLLAKGHKDCLKAGDIIRVVYDQSKCNYDTFVGY
                     VLSVDRKELIEDASVLLRNQVAKTMVEMRIPIFSPLIERIDVLRKSDGKRKRNKHYYI
                     RNTRLDVGDLEAGLKKR"
     gene            complement(<1162266..>1163087)
                     /locus_tag="CAGL0L10846g"
                     /db_xref="GeneID:2891050"
     mRNA            complement(<1162266..>1163087)
                     /locus_tag="CAGL0L10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449239.1"
                     /db_xref="GeneID:2891050"
     CDS             complement(1162266..1163087)
                     /locus_tag="CAGL0L10846g"
                     /note="highly similar to uniprot|P25627 Saccharomyces
                     cerevisiae YCR047c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449239.1"
                     /db_xref="GeneID:2891050"
                     /db_xref="GOA:Q6FKK5"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK5"
                     /translation="MSRPEELAPPEIFYNDSESKKYTASTRVQHIQAKMTLRSLELLN
                     IEPNSFILDIGCGSGLSGEILTEEGHVWCGLDISPSMLATGLTRELEGDLMLQDMGQG
                     IPFRPGTFDAAISISAIQWLCNADTSYNDPKRRLMRFFNGLFAALKKGGKFVAQFYPK
                     NDDQVDQILQAAKVAGFSGGLVIDDPESKKNKKYYLVLSSGSPSNEEKQVNLEGVTMD
                     ATDVDSKEPRHKQSKTLLGESKKNFIMRKKELMRRRGRQVAHDSKFTGRKRRTKF"
     gene            complement(<1163497..>1164480)
                     /locus_tag="CAGL0L10868g"
                     /db_xref="GeneID:2891015"
     mRNA            complement(<1163497..>1164480)
                     /locus_tag="CAGL0L10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449240.1"
                     /db_xref="GeneID:2891015"
     CDS             complement(1163497..1164480)
                     /locus_tag="CAGL0L10868g"
                     /note="highly similar to uniprot|Q12029 Saccharomyces
                     cerevisiae YOR271c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449240.1"
                     /db_xref="GeneID:2891015"
                     /db_xref="GOA:Q6FKK4"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK4"
                     /translation="MASSITGPIPLPESRFDLNTYWGRVRHCAEISDPTMLLTTSSDL
                     NRAKDIISKYRHGELKHTTPEFWRAKKQLDSTVHPDTGETVLLPFRMSSCVLSNLVVT
                     VGMLTPGLGTAGTVFWQWANQSLNVAVNSANANKSHPMSTTQLVTNYAAAVTASCGVA
                     LGLNNLVPKLKNIQPHTRLILGRLVPFAAVVSAGIVNVFLMRGNEIQKGISVFDEHGE
                     EVGKSKKAAFFAVGETALSRVINATPTMVIPPLILVRLQRGFLKNKSMGFQTMVNLGL
                     IATTMFSALPFALAIFPQKQAIQLKSLEDDLHGKKDKNGKEIETVYFNRGI"
     gene            <1165380..>1166753
                     /locus_tag="CAGL0L10890g"
                     /db_xref="GeneID:2891016"
     mRNA            <1165380..>1166753
                     /locus_tag="CAGL0L10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449241.1"
                     /db_xref="GeneID:2891016"
     CDS             1165380..1166753
                     /locus_tag="CAGL0L10890g"
                     /note="highly similar to uniprot|Q12024 Saccharomyces
                     cerevisiae YOR272w YTM1 microtubule-interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449241.1"
                     /db_xref="GeneID:2891016"
                     /db_xref="GOA:Q6FKK3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /translation="MSTDTSQVKVKFFTREKDESLHVDDVPMYAPISLKRYGLSEIVN
                     HLLESETPIPFDFLIDGELLRTSLQEYLTKKGLSSETTLTVEYTRAVLPPSFLANFNN
                     DDWVSALDVSDDFRHIYSGSYDGVVRTWNMSGKVEKQYSGHTGAVKAVKYISNTRIVS
                     AGNDRSLRLWKTKNDDGSVSNNTGDENDEENIEDGKTLAILEGHKAPVVSLDVASNSR
                     ILSASYDNTVALWSTIYKEMTAIDHLEEIQNPNNKISTAAKKRRKLTLKDGTIRRRAP
                     LSLLESHTGPVEQVIFDHGDNTVGYSVSQDHTIKTWDLVTARCIDTKTTSYPLLSIAQ
                     MPTLNLLACGSSVRHITLHDPRVSSSAKITQKQLVGHKNFVVGLDTCSENEYLLCSAS
                     HDGTVKVWDVRSTSPMYTITRQDPTVEKGVNDKVFAVKWAKSIGIISGGQDKKIQINK
                     GDNIFKN"
     gene            complement(<1167086..>1169041)
                     /locus_tag="CAGL0L10912g"
                     /db_xref="GeneID:2891017"
     mRNA            complement(<1167086..>1169041)
                     /locus_tag="CAGL0L10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449242.1"
                     /db_xref="GeneID:2891017"
     CDS             complement(1167086..1169041)
                     /locus_tag="CAGL0L10912g"
                     /inference="similar to AA sequence:UniProtKB:Q12256"
                     /note="similar to uniprot|Q12256 Saccharomyces cerevisiae
                     YOR273c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449242.1"
                     /db_xref="GeneID:2891017"
                     /db_xref="GOA:Q6FKK2"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK2"
                     /translation="MAGTNQVGDTNSSTLNSSNDISDKMSLNNVDVRDPSPNDSEECK
                     KASAEHEELEEDEDVGVDPKTLDWDGPGDLDNPHNWPSWKKWYATMVAAFLCLAVTMN
                     SSLYVSGVPELVAKYHVNQTLALAGLTFYLLGLANVIGAPLSEVFGRKPIYLFSLPIS
                     MLFTMGVGLSGGHMRTILPLRFFAGFFASPCLSVGSGTILDVFDVDEVSVAMTFFSLA
                     PFLGPVISPIIAGFAVEERSWRYTQWIQLWASGLILPLIAIMPETHKGLILRKRAQKR
                     NIKLKAFTNAEKKEFLKLTFTITIMRPIKMLMVEPIVLVFSIYVAFIFAVLFAFFEAY
                     PVIYRGVYHMKLGVSGLPFIGIGLGLWMGAFTYILIDRKFLFPKAPKGTPPIENPTSL
                     RTTPFRGHRDPETGQLKPIHPEKFLLACKIGSVALPIALFWQAWTSRPDVHWMAPIAA
                     GVPFGFGLILIFFSVLMYFSTCYPPLVVASTLAANNLLRYITSSVFPLFTIQMYTNMK
                     IKWASTLFALICVVMIPIPWIFERWGPKLRDISQFGYSAMAREQAEKIKAEHPDEEIE
                     DNDDHDLDLTRITTLRTIETAYSHQNSNTLEHTISNTSGNHNVRKVATNNLSQTASHQ
                     KPTDEMYNMADSGSAFDESSENSSRMV"
     gene            <1170327..>1171610
                     /locus_tag="CAGL0L10934g"
                     /db_xref="GeneID:2891018"
     mRNA            <1170327..>1171610
                     /locus_tag="CAGL0L10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449243.1"
                     /db_xref="GeneID:2891018"
     CDS             1170327..1171610
                     /locus_tag="CAGL0L10934g"
                     /inference="similar to AA sequence:UniProtKB:P07884"
                     /note="similar to uniprot|P07884 Saccharomyces cerevisiae
                     YOR274w MOD5 tRNA isopentenyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449243.1"
                     /db_xref="GeneID:2891018"
                     /db_xref="GOA:Q6FKK1"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKK1"
                     /translation="MSAMKKVIVVAGTTGVGKSQLSIQLAQRYNGEVINSDSMQVYRD
                     IPIITNKHPVEERFGVPHHVMNHVGWEEEYYLHRFESECLSAIADIHSRDKTPIIVGG
                     THYYLQVLFNKHIDTATMDSVPETIELSEQQRSLLESGDSDRIYETLTSVDPQIAKKF
                     HPNDTRRVRRMLEIFYQTKKKPSDLFSKQEVSPKFDTLFYWIYSNPTELDERLDSRVD
                     AMLKSGGMDEINELYRYYKEHNLNPEQCENGVWQVIGFKEFLPWLCDPKTATLENCVE
                     RMKIRTRQYAKRQVKWIRKMLIPDINGDIYLLNATNLLNWDQTVSKRAFAIGDQFMKN
                     ENITAAHAPEELRHLISKEQTVERKLDNWDHFTCDVCKDNKDQPLLCIGEKNWNIHLN
                     SRRHRSNLKRKHKKSGFEKWQMAKKANLENKENEV"
     gene            complement(<1171649..>1173724)
                     /locus_tag="CAGL0L10956g"
                     /db_xref="GeneID:2891019"
     mRNA            complement(<1171649..>1173724)
                     /locus_tag="CAGL0L10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449244.1"
                     /db_xref="GeneID:2891019"
     CDS             complement(1171649..1173724)
                     /locus_tag="CAGL0L10956g"
                     /note="weakly similar to uniprot|Q12033 Saccharomyces
                     cerevisiae YOR275c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449244.1"
                     /db_xref="GeneID:2891019"
                     /db_xref="GOA:Q6FKK0"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /translation="MTELIDIPFLLTKDCSADLEDRLRFCIETGSLYQTHESFKKDIG
                     EIVNTRQALVNLKFGDSKLLTKYYGYLECLLKKIDPEALAFSWSYTNYTIFEGNVFRD
                     ENLLGERRNILFNLGIAYYQSAKHIDDYKNNLPLVCDYLKRSAGCFEILSQRTKERNS
                     EKAIISETMLKALKSMCMGLAQETVWFKSLAAKKDLLTSKLAYKCFEYFQESLNSFQL
                     VGQSTEYIKLILVFVESKMLYFKAVCVYRLAQSIESIADNVGVVIRCLSIAVAALTNS
                     KLESTVVFKNKCLEMLRQLEKDNDFIYLKHVPSHLQFSDFVKLYKLDSMKDLIVLPDL
                     TEIAPSMLDQILFRNLLPIEIMDYGTSYNEKQDIYVLQHFVEPINLLNIQLDEELASF
                     FEIDPQHIVNAHNKTKSFVTRKELDVIGQSFGDLESNAINIETQLANITSYLDLEIKT
                     YEEDKQQYGDVWTIVDARDVTKEFYEKVEKLRQYLEIGRNINLETQELFASIDKSLVT
                     SRTSKAHLTAQYNDPFLNKIEALKKRRERFISEIEKKSYENRIISKLIMYYKETDDIP
                     GTISEREEIFDNIYSKHMKVFAVDMKYIEDCKNENYGLIKEIEEYKSRTNFNNEDRSS
                     DPRTQYIQDVRQSLASLDDVKTQLKKGTAYYQQLIEKVNELVQVIVGFLEARRNDRER
                     LLNEISTAA"
     gene            <1174217..>1174681
                     /locus_tag="CAGL0L10978g"
                     /db_xref="GeneID:2891020"
     mRNA            <1174217..>1174681
                     /locus_tag="CAGL0L10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449245.1"
                     /db_xref="GeneID:2891020"
     CDS             1174217..1174681
                     /locus_tag="CAGL0L10978g"
                     /inference="similar to AA sequence:UniProtKB:P12962"
                     /note="similar to uniprot|P12962 Saccharomyces cerevisiae
                     YOR276w CAF20 mRNA CAP-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449245.1"
                     /db_xref="GeneID:2891020"
                     /db_xref="GOA:Q6FKJ9"
                     /translation="MIKYSIDELIQLKPSETLKVSFDHVEFRNIIEKVVELQKLKEEE
                     FHSHHGNRRRSSHHHMKPKIKHNKPKVKTDADGWSTLEPATAGHEEESSSSATPAAAA
                     TTKTGAPQETIRVKPNNKNISSSRPADNSDIIADKQTHGFNAFAALEDEEDE"
     gene            <1176224..>1177060
                     /locus_tag="CAGL0L11000g"
                     /db_xref="GeneID:2891021"
     mRNA            <1176224..>1177060
                     /locus_tag="CAGL0L11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449246.1"
                     /db_xref="GeneID:2891021"
     CDS             1176224..1177060
                     /locus_tag="CAGL0L11000g"
                     /inference="similar to AA sequence:UniProtKB:P06174"
                     /note="similar to uniprot|P06174 Saccharomyces cerevisiae
                     YOR278w HEM4 uroporphyrinogen III synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449246.1"
                     /db_xref="GeneID:2891021"
                     /db_xref="GOA:Q6FKJ8"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ8"
                     /translation="MIFTKPMGHDSRLHRVLLLKNMVDGGNDPYTKKIQEHQDSFEEP
                     IFLPLITHTNVPQNIISRFADRADNLQDDYDFLIITSQRSIECLNLPELKHIRNKLID
                     KPTYTVGPATSNFLSSLGFTDIRGGIHAGNGMKLASIIDNDYPAGGKALFLVGEIRKD
                     IIPKYLRPRNFTVDEIIMYKTAELSDSIVWFKSYLDKCDWIVVFSPQGMSDILQYMKQ
                     YSKGARPFKIACIGPTTCEFLNSNGIEPDLVSPKPDANSLIAAIKEYEVISRLSHSNG
                     DY"
     gene            complement(<1177299..>1178225)
                     /locus_tag="CAGL0L11022g"
                     /db_xref="GeneID:2891022"
     mRNA            complement(<1177299..>1178225)
                     /locus_tag="CAGL0L11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449247.1"
                     /db_xref="GeneID:2891022"
     CDS             complement(1177299..1178225)
                     /locus_tag="CAGL0L11022g"
                     /inference="similar to AA sequence:UniProtKB:Q12192"
                     /note="similar to uniprot|Q12192 Saccharomyces cerevisiae
                     YOR279c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449247.1"
                     /db_xref="GeneID:2891022"
                     /db_xref="InterPro:IPR020318"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ7"
                     /translation="MITGNNYVEAPLEFRKQDIHETLQELLDDLKPIEFESYQDYFLI
                     NTFKKGISESGKVDIERLRSGGHTVYYQRVKRKRKSKGSSKEDEEISNPSRSSSKARS
                     ASDNNGSSSEEEDDYDSDYGNDNNRNKKKSGSNIDPNTNISESGSADSNFFNGNISKS
                     SIIPAPVKGNVRRSSRLSLQQQQQLEKQKQIRKHQKQGSEEDLKKDETGDTNDFEEEK
                     SDICDDSNSKEHIKDLFETLVEKVIEPKRRSDWVLPPRLRYQPEKQMRTKPAFDSVKI
                     NEVMANKSIRHILSRFEGGVAGVRKREWPEEK"
     gene            complement(<1178883..>1179725)
                     /locus_tag="CAGL0L11044g"
                     /db_xref="GeneID:2891023"
     mRNA            complement(<1178883..>1179725)
                     /locus_tag="CAGL0L11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449248.1"
                     /db_xref="GeneID:2891023"
     CDS             complement(1178883..1179725)
                     /locus_tag="CAGL0L11044g"
                     /inference="similar to AA sequence:UniProtKB:Q99369"
                     /note="similar to uniprot|Q99369 Saccharomyces cerevisiae
                     YOR280c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449248.1"
                     /db_xref="GeneID:2891023"
                     /db_xref="GOA:Q6FKJ6"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ6"
                     /translation="MSKKILMLHGFVQSDRIFSAKTGGLRKALKKMGYELDYPCAPIL
                     VDKSSLMSSSSQKEVEASVAKQFNTDLGVGKDGSENQLYGWWQRKAGGDFYSYEIPQN
                     TLDFLRQYIVENGPYDGVIGFSQGGGMGAYLVSDLNNLLNLSKEQQPDLKFFVAFSAF
                     RLEPEQYAQHFKTHPISVPTLVIQGELDTVVSETRVMSLYDAILPQYRALLKHHGGHF
                     IPNQKPFLNQVCGWIQSVTTNPSNDEDMDIDMNSIKSSAKSSSTQLQMDDDLLDMIDS
                     MGKL"
     gene            complement(<1180076..>1180912)
                     /locus_tag="CAGL0L11066g"
                     /db_xref="GeneID:2891024"
     mRNA            complement(<1180076..>1180912)
                     /locus_tag="CAGL0L11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449249.1"
                     /db_xref="GeneID:2891024"
     CDS             complement(1180076..1180912)
                     /locus_tag="CAGL0L11066g"
                     /note="highly similar to uniprot|Q12017 Saccharomyces
                     cerevisiae YOR281c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449249.1"
                     /db_xref="GeneID:2891024"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ5"
                     /translation="MQNEPMFQVQVDESEDTEWNDILRSKGIIPERPPSPTQQIEEAL
                     DEAIAKQHANRLEGKDLSDLEDLEDEEDEEFLEIYKKKRMAEMAKLRERSKFGDVYHI
                     NKPEYNKEVTLASKGLTHELADDEEHKREGDKDNSKAVYVFVHLSLHTKIQSRILDHL
                     FQASAKKFPEVKFVEIPANRAIENYPENNCPTLIVYHNGDVIKNIVTLLELGGNNTTI
                     KDFEKLIVDCGAVSPEDKRLVLYDEGYEDKKSLHFADKKSIRTGYASNTYADDEDDDF
                     FD"
     gene            <1181336..>1182037
                     /locus_tag="CAGL0L11088g"
                     /db_xref="GeneID:2891025"
     mRNA            <1181336..>1182037
                     /locus_tag="CAGL0L11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449250.1"
                     /db_xref="GeneID:2891025"
     CDS             1181336..1182037
                     /locus_tag="CAGL0L11088g"
                     /note="highly similar to uniprot|Q12040 Saccharomyces
                     cerevisiae YOR283w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449250.1"
                     /db_xref="GeneID:2891025"
                     /db_xref="GOA:Q6FKJ4"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ4"
                     /translation="MTRDIPYYSENDDLNVVRIFIIRHGQTDHNVKKILQGHRDTSLN
                     VTGVDQGHKLGKYLKNDRNIKFERVVSSDLIRCRQTTEAFLSEMDCDLSEKDVFFLGG
                     LRERFMGPIEGMHITEAEKYADKHGKPSFRDFGEDADLFMNRLTGTIQGCVETASDDG
                     IRNMAMVSHGGSIRAIIRWLEYDAQNAQKIIVYNTSVTIVDYIKDKKQYIVRRVGNTQ
                     HLGDGEFIVSDLRLR"
     gene            complement(<1182455..>1184182)
                     /locus_tag="CAGL0L11110g"
                     /db_xref="GeneID:2891026"
     mRNA            complement(<1182455..>1184182)
                     /locus_tag="CAGL0L11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449251.1"
                     /db_xref="GeneID:2891026"
     CDS             complement(1182455..1184182)
                     /locus_tag="CAGL0L11110g"
                     /note="highly similar to uniprot|P14747 Saccharomyces
                     cerevisiae YML057w CMP2 calcineurin B or uniprot|P23287
                     Saccharomyces cerevisiae YLR433c CNA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449251.1"
                     /db_xref="GeneID:2891026"
                     /db_xref="GOA:Q6FKJ3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ3"
                     /translation="MPDKTDAELNTEKINAALKVIESKKHEGDTAQSAVPDLTVYTME
                     DGTQVNTKERVMKSVTPINGHIPSDEEVFDRKTGLPNHQFLRDHFKGEGRITEDQALK
                     ILSMATECMKKEPNLLTVPAPVTVCGDIHGQYFDLLKLFEIGGDPETTPYLFLGDYVD
                     RGSFSFECLIYLYALKLNYNAHFWMLRGNHECMHLTSYFTFKNECLHKYSLKIYEACC
                     ESFNALPLAALMNEQYFCVHGGISPDLKTPEDVNKINRFREIPSRGLMCDLVWADPIE
                     KYDEVADDLTQGKFVINQVRGCSFAFTYQASCEFLQRSGLLSIIRAHEAQDAGYRMYK
                     NTKTLGFPSLLTLFSAPNYLDTYNNKAAILKYENNVMNIRQFNMSPHPYWLPDFMDVF
                     TWSLPFVGEKVTEMLVAILNICTEDELEEDTPYIAGEVGKIDSTHSATTSTTSPQASA
                     TVSADAIASATSEGHQHTSSILDDEHRRKTLRNKILAIAKVSRMYSVLREESDKVQYL
                     KSMNSGILPRGALAHGSQGLNETLSTFERARKQDLINEKLPPSLDEVKKKKQEYYHSI
                     LRQAQSDHR"
     gene            complement(<1184854..>1185144)
                     /locus_tag="CAGL0L11132g"
                     /db_xref="GeneID:2891027"
     mRNA            complement(<1184854..>1185144)
                     /locus_tag="CAGL0L11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449252.1"
                     /db_xref="GeneID:2891027"
     CDS             complement(1184854..1185144)
                     /locus_tag="CAGL0L11132g"
                     /note="some similarities with uniprot|Q04964 Saccharomyces
                     cerevisiae YML058w SML1 protein inhibitor of
                     ribonucleotide reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449252.1"
                     /db_xref="GeneID:2891027"
                     /db_xref="GOA:Q6FKJ2"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ2"
                     /translation="MQHQDMNGVSQRIRERVSQGYQLPPQQFQRVPLPPMAQAPMLVN
                     ERSVSSTSSLEMWEKDLDERLQMIDQNISRNKNGAAELTTMFASGKLEEMDF"
     gene            <1187054..>1192240
                     /locus_tag="CAGL0L11154g"
                     /db_xref="GeneID:2891028"
     mRNA            <1187054..>1192240
                     /locus_tag="CAGL0L11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449253.1"
                     /db_xref="GeneID:2891028"
     CDS             1187054..1192240
                     /locus_tag="CAGL0L11154g"
                     /inference="similar to AA sequence:UniProtKB:Q04958"
                     /note="similar to uniprot|Q04958 Saccharomyces cerevisiae
                     YML059c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449253.1"
                     /db_xref="GeneID:2891028"
                     /db_xref="GOA:Q6FKJ1"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001423"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR018490"
                     /translation="MDSSSIAHESDIVSTERNILPERFISNKQQGNYLEDGSGDGNGK
                     AAEHWLLAAIFNFFWVISYFISGSTHIAFRSSWYIVSLLLLKFPKWIIVEANHIHLTI
                     PFSVLVVTLAIIFYVSYEFLKGRLLSEYKNLTSDLNTDSLNSKNSKSSRLLHHDSKDS
                     NTTRRRRYSSGKLLSSALHESHSGINGGDDGDDTFLSSYLDQFLSAIRIFGYLEKPVF
                     HDLTKNMKTQKLDEGEILLLDNSVGFAIVVEGTLDIYHEVEEKGNMNDIDGDFMVDDN
                     QSIYSILKRKKKKYSTSRHGQYNNNSDPGHYNGHNVNGDDEDDDDGILQMRSSSRNQN
                     IPSFDAIESSSSDEESDINDGDSESQSESDDESTGFIRLKDGLGKFQLLNTVKAGNPV
                     SSLVNILNLFTSANDNVTSPSRTGRMDSNYTNPVERPTSKLSTSIEESAMRLELGKYS
                     LSPTEASYRSTSNPSNNFSKDNDPLSKSISGPDAVTTPSLPPLNNRAFVIPKVVARAA
                     TDCTIAIIPPQAFAKLKAKYPRSASHIIQMILTKLYHVTFQTAHKYLGLTQEIAYTEL
                     LLNRTVSYDLPNYLKEIVIDRFKDKGKDMNLQKGFQSPTSSRLTSNFNGNSNNQRTNS
                     RNSQALMSTRDLRKTRPELSQQSSMIHSPTPITGSRHVVLESRDKYNPGDLLSNVPLS
                     RINLASPSSRGFDYSSMKKESSPQSSVNSRKRSTTGERPRLLKRPSIYNNQSSSRSDA
                     LKGNNSNNKDINFTSFSAQEETEDSVVRMALVEAMLTYLGVNKTNMSILPGIYDGAPS
                     EPHSHRASEISLVSSYTSSAAPQTTIRILPKEYAIVSTRKQKQSSKKRRKYKEEISPT
                     LDYEYAKNEFAQAIELQYFKQGTVIVEQDTRGKGLYYVVSGKIDVTTSTVSDHEIFNS
                     TRDKKKKKSKTLFTIESGGIAGYLSSLVSYKSFVTLIAKTDVYVGFLPYQTLEKLCDK
                     YFLIYLRIAESLTSLLTPRMLKLDHALEWLHLNASDTLFNQGDPANGIYVILNGRLRQ
                     LRNPELEENSTDYPNDGEEKDSSRDSTIVMGELGQGESFGEVEVLTAMDRISSMVAVR
                     DTELARIPRSLFELLAIEHPSIMIRVSRLVAKKILGQGQANMALPKIGSGSNLRHDLN
                     LTIPPSSSSSIHTHSYGNDNSNQMNNANFRTITILPITSGLPVESFAMKLVHAFKQVG
                     RTTIGLNQRTTLSHLGRHAFDKLAKLKESGYFAELEELYQTVVYIADTPVKSSWTKTC
                     IAQADCVILLARADDSPEIGEYERLLLKSKTTSRTELVLLHNERSVEPGMTQRWLRSR
                     SWVHNHYHIQFAMDSLVNSSNVKDTGGNIGALNLVDKFIQTELGRKTQYNISKLLPES
                     IKMTVENFSSRFMKRKRQYYTPVHRHKDDFLRLARILSGQAIGLVLGGGGARGLSHLG
                     ILQALEERGIPIDMIGGTSIGSFVGGLYAKDYDLVPIFGRIKKFAGRISSIWRMLSDF
                     TWPVTSYTTGHEFNRGIWKSFGDTRIEDFWVQYFCNSTNITESVQEIHSYGYAWRYVR
                     ASMSLAGLLPPIEDNGSMLLDGGYVDNLPVLEMKARGCNTIFAVDVGSVDDRTPMKYG
                     DSLNGFWIILNRWNPFSKHPNIPTMAEIQVRLGYVSSVNALEKAKRTPGVIYVRPPIE
                     NYATLDFGKFEEIYKVGADFGKVFLQALAEEGKMPYIPGSNADLVGDVETGFFLHRRN
                     SI"
     gene            complement(<1192381..>1193481)
                     /locus_tag="CAGL0L11176g"
                     /db_xref="GeneID:2891029"
     mRNA            complement(<1192381..>1193481)
                     /locus_tag="CAGL0L11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449254.1"
                     /db_xref="GeneID:2891029"
     CDS             complement(1192381..1193481)
                     /locus_tag="CAGL0L11176g"
                     /inference="similar to AA sequence:UniProtKB:P53397"
                     /note="similar to uniprot|P53397 Saccharomyces cerevisiae
                     YML060w OGG1 8-oxoguanine DNA glycosylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449254.1"
                     /db_xref="GeneID:2891029"
                     /db_xref="GOA:Q6FKJ0"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR012904"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:Q6FKJ0"
                     /translation="MSINGLLNVSAGELCLKNVLQTGQSFRWLLDEATGIYSTTLKIS
                     DTLGYSIITLRQDVDFGQVFYEVLNAKVDTETIENHLKNYFRLDVDLQNLHKNHWLAN
                     DEKFKMLDHKGIRILGQEPWETLVSFICSTNNNIGRISKMCHALSENFGEYIDEYKGT
                     KYYTFPSSEDIATKATEIQLRGLGFGYRAKYIIETAKKFVEDKKKYGLSDDAQFLNEV
                     VAKKGYLEAREFLMGYCGVGPKVADCVCLMGLHMDEVVPVDVHVGRIAKRDYNIQAPK
                     KFLQELRGQFDHLPITKKKINPELDYIRLKFTEIWGEYAGWAQGLLFFRETDKSDASA
                     AKKRKTTSSPAASKKPKLDTNELVSAISVKAE"
     gene            <1194051..>1196576
                     /locus_tag="CAGL0L11198g"
                     /db_xref="GeneID:2891030"
     mRNA            <1194051..>1196576
                     /locus_tag="CAGL0L11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449255.1"
                     /db_xref="GeneID:2891030"
     CDS             1194051..1196576
                     /locus_tag="CAGL0L11198g"
                     /inference="similar to AA sequence:UniProtKB:P07271"
                     /note="similar to uniprot|P07271 Saccharomyces cerevisiae
                     YML061c PIF1 DNA helicase involved in mitochondrial DNA
                     repair and telomere"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449255.1"
                     /db_xref="GeneID:2891030"
                     /db_xref="GOA:Q6FKI9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI9"
                     /translation="MSNKRNSSILRQDDYEINYDELSALLSDSSDWDDLSMDSPQHKR
                     NCQARPIAGANNVEIPRPILRTPKAQLKAPPDCGRSISGLSEIDDSSIIELLQDKKPL
                     EKNQILQNTHVLPRETKPPMLVPLKEIVPKPELNVLENISLMAESTQRAKPQSMNPSS
                     LDISNVDEKVIEKHIEILSPKQVNKELNDLTNSDSSLQINEVLKKDISELSTEEIQFA
                     KAQLGEKFRFLTQRTVFTDVNKKQSRIAAPDTRKVKIPIILSKEQEAVIDLAEKGHNI
                     FYTGSAGTGKSVLLREMIKVLKKKYGPERVAVTASTGLAACNIGGITVHSFAGIGLGN
                     GDVTKLYRKVRRSKKNVKRWSEISVLVIDEISMLDGELFDKLDFIAQKIRKNSDPFGG
                     IQIVLCGDFFQLPPVSKDLSTPMKFAFQSLAWQKAIHVTIMLEKVFRQQGDTKFIDML
                     NQMRLGKIDMETEMEFKKLNRPLPNDDIIPAELYSTRAEVDRANRSRLNKLPGQAFCY
                     NAIDGGTLEDQEMKDRLLQNFLAPKQLQLKIGAQVMMIKNIDAQLVNGSLGKVIAFMD
                     PETYLFYSTILADSSVTPDVMEEMKDKPEELRERYAGDDEDEKMRVNKKRERFYEGNP
                     NVVPQDDLDDSIFDFMTQATNVSDDARNDIERKKRIIKDLYKNADSRKRLPLVTFKTA
                     DMSTRTVLVEPEDWAIEDENEKPLVSRVQLPLMLAWSLSIHKSQGQTLPKVKVDLQRV
                     FEKGQAYVALSRAVSREGLQVLNFDRSRIKAHDTVVDFYMTLVTADQAIEDLKRRNGG
                     SLDKKKAYAPRPAARLDRSQTAPSSGITEMLRRRSRKVETESI"
     gene            <1197228..>1198547
                     /locus_tag="CAGL0L11220g"
                     /db_xref="GeneID:2891031"
     mRNA            <1197228..>1198547
                     /locus_tag="CAGL0L11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449256.1"
                     /db_xref="GeneID:2891031"
     CDS             1197228..1198547
                     /locus_tag="CAGL0L11220g"
                     /inference="similar to AA sequence:UniProtKB:P33441"
                     /note="similar to uniprot|P33441 Saccharomyces cerevisiae
                     YML062c MFT1 mitochondrial fusion target protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449256.1"
                     /db_xref="GeneID:2891031"
                     /db_xref="GOA:Q6FKI8"
                     /db_xref="InterPro:IPR008501"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI8"
                     /translation="MTLNNEEVKEVKDKVNYGDVDLSFNRYLDVLGKAVSMSDDLLGG
                     NVDEEGQVDTFTKANIEKLKQTAELRFIDAQANIDVKKIGYENWQKYNEKVFKALQDN
                     EDNSSDELERLKLFQENLRDRIKRVSEMYDSVKNINQDLESLSEGKSNLAVSRLDWEN
                     ELGKDLTEKLINRRYLQDRFGKASKTGNFKKHPRNTGSNNDHNGEALPETTSTSSTDK
                     GNTDDSSRNDSITDIDREQTLTAFDDFSKGPAELKHIQSMLKSDISRLKEEVESYKEK
                     WMNDAELFSKISSLLKDELKDREGTRYPSNDSKSQPANDEDEAESEDEDTNSGRFKRQ
                     TVGRAEEVGGEGEEALLADGDDDEEDEEDSSSTSESSYDEEIDNEEKQDIVEEEEDAD
                     ENDDNFSKSRTPERVDNSNESNEKSDDLLEEGFPQPDADEKEQKQDN"
     gene            <1199371..>1200135
                     /locus_tag="CAGL0L11242g"
                     /db_xref="GeneID:2891032"
     mRNA            <1199371..>1200135
                     /locus_tag="CAGL0L11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449257.1"
                     /db_xref="GeneID:2891032"
     CDS             1199371..1200135
                     /locus_tag="CAGL0L11242g"
                     /note="highly similar to uniprot|P38987 Saccharomyces
                     cerevisiae YML064c TEM1 GTP-binding protein of the RAS
                     superfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449257.1"
                     /db_xref="GeneID:2891032"
                     /db_xref="GOA:Q6FKI7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR017231"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI7"
                     /translation="MSASEMRAASERVGEERNSLPSVRNQVDIQVGLIGDAQVGKTSL
                     MVKYVQNIFDEEYTQTLGVNFLKRKVSIRSTDIVFSLMDLGGQREFINMLPIATLGSS
                     VIILLFDLTRPETLNSIKEWYRQALGLNDSAIPILVGTKYDLFIDLEEEYQEKVSKTS
                     MKYAQVMDAPLIFCSTAKSINIQKIFKVALAKIFDLTLTIPEINEIGDPLLIYKELGS
                     KKNKSKNSSKPRRRSPVDNENKELVSQPHNYGHTSE"
     gene            complement(<1200406..>1203459)
                     /locus_tag="CAGL0L11264g"
                     /db_xref="GeneID:2890957"
     mRNA            complement(<1200406..>1203459)
                     /locus_tag="CAGL0L11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449258.1"
                     /db_xref="GeneID:2890957"
     CDS             complement(1200406..1203459)
                     /locus_tag="CAGL0L11264g"
                     /note="some similarities with uniprot|P54784 Saccharomyces
                     cerevisiae YML065w ORC1 or uniprot|P06701 Saccharomyces
                     cerevisiae YLR442c SIR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449258.1"
                     /db_xref="GeneID:2890957"
                     /db_xref="GOA:Q6FKI6"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI6"
                     /translation="MARNQKELNGWQILVLDEKDELIDYFEQKRPRRRRGAVERLGKD
                     QIFLKQGDEGMLLSVGDTIVVKEDIKSNGIYLIQDLRLNTPGNLIEIWAFVLLGRDEI
                     DARSYLQEILPEFVKDNGDEDSITEKYKNLVHDKELFFTATLIEIKLEQIIDKAKVLN
                     QTEWNLLSTTDKGYETTYFLRYACEPSSSNFVAIDIDKESKNIHEWMPKKSLEYYKRL
                     TEPLEVRNKKSPQKREVVNLSESNGIDTVEEKSIKMSGNVVDNSDNKPQSPIKRRPGR
                     PRKNEVNQKQPEKIVETSTANVQNHDTKVDNIDIVSSTIPQKRKRGRPKKSTTLIINS
                     NVVESTAPTKRSTRTKKARKIYTEDSFDEDPLDSDDNSGTDYFTDADDGEYKEEEKIS
                     EKIEQDEEELEVEEDEAQISDEAELLEDDYLSDNDTAKIALNKLKKTENRPSKMVQKS
                     YQLEDSSRRKAQSKGYSSQPYTTGSIRKFTKKNVVRAKKGYTPFSKRYKSIDDIPDLM
                     KMADFNQESTLNYFAKLGNRLSTGNDSLEVETIFSKIKKQLTSSQNKDAIVKSGNISD
                     HLPARENEFASIYLSVYSAIESGSATTVYIAGTPGVGKTLTVREVISDLQAASLQGEL
                     PKFQYVEINGLKMVKPTDSYEFFWNKISGEELTWAAAMESLEFYFNKVPKNKKRPIVV
                     LLDELDALVTKSQDVMYNFFNWSTYENAKLVVISVANTMDLPEKQLGNKVSSRIGFTR
                     IMFTGYSHEELKTIIKFRLRGLNNSSFYVDPKTGNAKLAEATSNENVPEGMLKVRLKM
                     TDDAIEIASRKVASVSGDARRALKVCKRAAEIAEKHYMAKHGYNYDGKAIIEDEEVRE
                     ELEAGNIPQIEEDNDGEVQIVNINHIMKALNETINSHAITYVSRLAFAAKLFIYAILN
                     LMKKTNTLDQTLGNVIDEVKLLMDKNSGNKNLHDIQKALYSSDHDGNMELRIRAWDFN
                     INQLIEAGILSRQSMRNERTTTVRVNLAVEELREAIEKDDVIKAL"
     gene            <1204120..>1205220
                     /locus_tag="CAGL0L11286g"
                     /db_xref="GeneID:2890958"
     mRNA            <1204120..>1205220
                     /locus_tag="CAGL0L11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449259.1"
                     /db_xref="GeneID:2890958"
     CDS             1204120..1205220
                     /locus_tag="CAGL0L11286g"
                     /inference="similar to AA sequence:UniProtKB:Q04658"
                     /note="similar to uniprot|Q04658 Saccharomyces cerevisiae
                     YML066c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449259.1"
                     /db_xref="GeneID:2890958"
                     /db_xref="GOA:Q6FKI5"
                     /translation="MLIVKRFILWVLLFFMAITQLLLYLPDFSCSISTGLPLCTPQFN
                     VNIVTGSRTTKDFVSSVRQFLRLISYLAIDMGWSKYLADPHIYNEENLVDTFDTDNLF
                     KINYFGFCKKTSGKTKYCVANGDCGMDVLGILVRDVGLQLGRLTQRYENNTRILGDSL
                     VFTYHLGLSSMRKFLRNDNYRNNAFSKLLLATDDQPYSNTRIKNYAKGVTVAYTLVVV
                     NKIMFYMHLAEITISAAFVVAVLGFGFVLIFGKHHTIMPLLLKGWGSVLMVSSTSSYL
                     ATIVYLGTLKLLEPTEMLDTQSQVAGHVLNNDTHSNNWDLLQTTVGSGFVISCFRYIV
                     QCLMLPLVFIAANRYTKAKDFLPAGTEELIKV"
     gene            <1205606..>1206664
                     /locus_tag="CAGL0L11308g"
                     /db_xref="GeneID:2890959"
     mRNA            <1205606..>1206664
                     /locus_tag="CAGL0L11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449260.1"
                     /db_xref="GeneID:2890959"
     CDS             1205606..1206664
                     /locus_tag="CAGL0L11308g"
                     /note="highly similar to uniprot|Q04651 Saccharomyces
                     cerevisiae YML067c ERV41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449260.1"
                     /db_xref="GeneID:2890959"
                     /db_xref="GOA:Q6FKI4"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI4"
                     /translation="MAGLRTFDAFPKTDETYKKKSTKGGVTSILTYIFLLFIAWTEFG
                     KFFGGYIDQQYTVDKVVRETAQINMDLYVNIKCENIHINVRDQTQDRKLVIQDLKLED
                     MPFFIPYDSKVNGVNSIVTPDIDEILGEAIPAEFREKLDTRQFYDENDPESEKYLPKF
                     NGCHIFGSVPVNRVKGELQITASGYGYPGKRAPKEEIDFAHAINELSFGDFYPYIDNP
                     LDKTARFDKEHPLSAYMYYISAVPTMYKKLGVEIETFQYSVNDYKYSMTDADPATVRK
                     IPGIFFRYGFEPLSIEITDVRISFLQFIVRLVAILSFFMFVVSWIFTIIDLLLVNILG
                     PKWSLRYQSDSHSHGILT"
     gene            complement(<1206892..>1208280)
                     /locus_tag="CAGL0L11330g"
                     /db_xref="GeneID:2890960"
     mRNA            complement(<1206892..>1208280)
                     /locus_tag="CAGL0L11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449261.1"
                     /db_xref="GeneID:2890960"
     CDS             complement(1206892..1208280)
                     /locus_tag="CAGL0L11330g"
                     /inference="similar to AA sequence:UniProtKB:Q04638"
                     /note="similar to uniprot|Q04638 Saccharomyces cerevisiae
                     YML068w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449261.1"
                     /db_xref="GeneID:2890960"
                     /db_xref="GOA:Q6FKI3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR002867"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI3"
                     /translation="MNDGLNLTDDLQVLCDMYPELTLNEHTDLNNGKTAELVSGALDF
                     NINFQESLKVIFEDYQLTLEGLTSNKLLFTVDPQGYPSLRTGVTLEISSQWMTEDDIM
                     KIMDALDKEFGDMTDPTTDKFDAYTPILMLVFTFLQEDTASILFPDNVKNCLSKDEYS
                     IYESMKEDFERIQHNSNNFDCCICMETKKGRHMVELPCKNTDSRHYLCKDCLKSYYST
                     LIEEGSIENIRCPECPYKPINLEKYTDYKKMKQSLFMPQIPFEFFQNILSDELCQRYK
                     DLFYTQAATKLSSHCPFACKICPRCDYWCIKEDLDDSLIQCSKCSFAFCFICSHSWHG
                     YTNPCGKAEKIANEIIEEYMEDSTTRTRKKELETKYGKKRLQSECEEYLADKMLDLAI
                     EEKGSNLQRCPSCRLVIERSEGCNKMRCAVCHTLFCFICGSILDPDDPYSHFREIIYP
                     CYGRLFEGMPGT"
     gene            complement(<1208700..>1210331)
                     /locus_tag="CAGL0L11352g"
                     /db_xref="GeneID:2890961"
     mRNA            complement(<1208700..>1210331)
                     /locus_tag="CAGL0L11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449262.1"
                     /db_xref="GeneID:2890961"
     CDS             complement(1208700..1210331)
                     /locus_tag="CAGL0L11352g"
                     /note="highly similar to uniprot|Q04636 Saccharomyces
                     cerevisiae YML069w POB3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449262.1"
                     /db_xref="GeneID:2890961"
                     /db_xref="GOA:Q6FKI2"
                     /db_xref="InterPro:IPR000969"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR024954"
                     /translation="MSTDFDRIFMNQSKFGGRFRIADSGLGWKVSTSGGSASAQNKAP
                     FLLPATELSTVQWSRGCRGFELKINTKNQGVIQLEGFSEDDFNIIKGDFHRRFSIQVE
                     HKEHSLRGWNWGQTDLARNEMVFALNGKPVFEIPYARINNTNLTAKNEVAVEFNIQDD
                     TYQPAGDEMVEMRFYLPGSVVVDEDQPAPKKEGEEEGEEAAETETKSLAEAFYEELKN
                     KADIGEIAGDAIVSFQDVFFTTPRGRYDIDIYENSIRLRGKTYEYKLQHNQIQRIVSL
                     PKADDINHLVVLAMDPPLRQGQTTYPFLVLQFQKDEETEVQLNLSDQEYEEKYKDKLK
                     KQYDSKTHIVISHVLKGLTGRRVVVPGEYKSKYEQCAVSCSYKANEGYLYPLDNAFFF
                     LTKPTLYIPFNDVSSVVISRAGQTSTSSRTFDLEVILRSNRGSTIFGNISKEEQQLLE
                     NFLKSKNLRVKNEEKDAQVRLQSALGSDSDDEDVNMGSAGEDDESVDEDFHVSSGDDD
                     DEVAEEFDSEAASEGEDEDEDMDGSDRPTKKPKTE"
     gene            complement(<1210795..>1212543)
                     /locus_tag="CAGL0L11374g"
                     /db_xref="GeneID:2890962"
     mRNA            complement(<1210795..>1212543)
                     /locus_tag="CAGL0L11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449263.1"
                     /db_xref="GeneID:2890962"
     CDS             complement(1210795..1212543)
                     /locus_tag="CAGL0L11374g"
                     /inference="similar to AA sequence:UniProtKB:P54838"
                     /note="similar to uniprot|P54838 Saccharomyces cerevisiae
                     YML070w DAK1 dihydroxyacetone kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449263.1"
                     /db_xref="GeneID:2890962"
                     /db_xref="GOA:Q6FKI1"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI1"
                     /translation="MKSFEVQEPLQKSIEGFAQSNPSLAVVPEDRVFYRAGDKSQVAL
                     ISGGGAGHEPAHAGFIGKGMLTGAVVGDIFASPSTRQILHGIKLIAKDSNGILLILMN
                     YTGDVLHFGLSAERARALGIDCRVIAVGDDVAVGREKGGKVGRRGLAGTILVEKLTGA
                     FVTRFAGQHNLADAYKVADISRNALVTIGSSIDHCKVPGRKFESELGENSMELGMGIH
                     NEPGAHVLTPIPATEDLIENQMLPKLLDPSDKDRYFVPFEKDDEVVLLVNNLGGVSNL
                     IMSSIAAITTDLLKKKYGIVPKQTITGCLMTSFNMDGFSITLMNVSKISKEMKAAFPD
                     KEIDVMQLLRDPTDAPGWPISSYELPPTVDHELLKDEEIPHGVGHYDFDSFAKWMKGA
                     AANVEKEEPRITQLDTLVGDGDCGYTLLAGCKGITDNLDKISKTHLSSAMDKISEYVE
                     ASMGGTSGGLYSILISGFVHGLQATCKDSSEKVTPEVLAKSFQIALDTLYHYTNARPG
                     ASTMIDALVPFIDEFAKTHDFKKAVEAADKGAQSTADIVAEFGRASYVENSQGIPDPG
                     AVGLVAFLKGVEGTMQ"
     gene            1213107..1213178
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0L11396r"
                     /db_xref="GeneID:2890963"
     tRNA            1213107..1213178
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0L11396r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2890963"
     gene            <1213420..>1215114
                     /locus_tag="CAGL0L11418g"
                     /db_xref="GeneID:2890964"
     mRNA            <1213420..>1215114
                     /locus_tag="CAGL0L11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449264.1"
                     /db_xref="GeneID:2890964"
     CDS             1213420..1215114
                     /locus_tag="CAGL0L11418g"
                     /inference="similar to AA sequence:UniProtKB:Q04632"
                     /note="similar to uniprot|Q04632 Saccharomyces cerevisiae
                     YML071c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449264.1"
                     /db_xref="GeneID:2890964"
                     /db_xref="GOA:Q6FKI0"
                     /db_xref="InterPro:IPR007255"
                     /db_xref="UniProtKB/TrEMBL:Q6FKI0"
                     /translation="MDGILADLVGEGFDGEYGVEVLRGVLQSETRDYERYFSPKALDG
                     SITEDIAEVDAEISAAEKRLRELMLENDKEIVTKLLRGDTREKLKSMADLLDQLWEVG
                     TGEEDGSGTARGGTGTTLSGTGIATFDEVLIENGLVDSDATAANSTEANKDNFHQALS
                     KLKARMENKDTNGLNSSDSSNLVPVLEQLDSLNELMELPLLARASINTGHYQEAVMLY
                     TYTSSLRSKFTDSSIVDEICKSVLSEIEQTMLIGLVNLLSTNVTINSLKKILTYLSAI
                     PPFNEKSRDSLLIVFLSMRYKFIQKEVTSYTIANTEINDSVVEMMIKRRIEVLREHMY
                     MSLNIFANLFSCERIPLSIPLLDDLIDKEVGDSAVETEQSTEEEITEKTNQNSQHSNE
                     QSTEAEEESKETSEQSKESSEQSKESSEQSKESSEQSKESSEQSKEGKQDKNSSEQSN
                     EDKESIEGKESKEAVENMSMSAQQKNTIPTNVPMLEFISNVIQYTLQDMVDEKLHNKI
                     SDSVCLQIVYCSFRLLDLNRNFHHLFLNKVCESELFSADQIKRAIRKRSELASKYS"
     gene            <1215533..>1220125
                     /locus_tag="CAGL0L11440g"
                     /db_xref="GeneID:2890965"
     mRNA            <1215533..>1220125
                     /locus_tag="CAGL0L11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449265.1"
                     /db_xref="GeneID:2890965"
     CDS             1215533..1220125
                     /locus_tag="CAGL0L11440g"
                     /inference="similar to AA sequence:UniProtKB:Q03640"
                     /note="similar to uniprot|Q03640 Saccharomyces cerevisiae
                     YML072c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449265.1"
                     /db_xref="GeneID:2890965"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR017147"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH9"
                     /translation="MQSDPTQDPLGGKDTKKGNLTSQMQDTYKGGSTQPSAMDDAAPR
                     GGVPESKIGEMYKPPEDVLVASAVANANQLPTANEEGAIGSVPLEQVHPRALRSAPSR
                     DQNKFDTSIDGPGLIDKYGIAGGKKFDEVLDDNTPDNMYPWSHIGEFHSSGVGKPSNV
                     SSKAVRAYLLEVFFNDLYFNTSTIMGTCFFSWLFAYIGFSWWSMIFIFFATGTVYNME
                     YNRFNRNIRDDLKRTTVHETISDRVEETLWLNSFLSKFWVIYMPVLSQQVKENVNPIL
                     AEVAPGYGIDALSIDEFTLGTKAPAIKGIRSYSKTSKDSFEIDISFAFTPNDESDMTP
                     VEAREKINPRIALGVNLGKSIVSKKVTVLTEDINCSGNVRLMLKFGNIFPNIKTVSVQ
                     LLEPPMIDFVLKPIGGDTLGLDIMSFLPGLKSFVKNMINSIAGPMLFAPNHLDIDMEE
                     IIAAQSNDASGVLAVTVISAKDLQTAADITSDVNPYVTFELDNPVSGTDEELVTNVKA
                     DTKSPTWNETKYLLVNNLQQKLHLKCYDHNGVLKDSMIGEAEIELDDLMQTSLLEHKT
                     ANLQVSNSYRGKITYSLHWFPSVNKAEEEDDDDDNNVTTSANAPNTNVDEDELEQEDN
                     DSCVGIAKLVLHSAKNLDLSSSISGTLNPQAELLMDGQLIKTFRKVKRNNEPNWEESV
                     EFLVPSQTDSKLTLKIWDDHKSHREFLCEYSGTASEIMDSLSMGASSLEASPQGYINV
                     DLQWKSVPMSGLIKVTSNSLSDPIGVLKIFVRNAEINSSLSGIGDIDPYFSVSLNNVQ
                     RYRSKYQSENRSPTFNYMVYVPVTSDGQTITISLSDYQSVGSDRFIGSARVPVSKFAK
                     RDKKTGRYQPYDKLDKSVKLDILDKRGGETDDFINASFAFIPAVPVYSPEEIANIEPL
                     ELELKEEKSKFEKEQEDLKQRMEKNPDDYEVVEVNDPFEDKQKKLGKKEKVPLQELLD
                     NYAGVLTFQISEARLSDAPAYLEVAFDDISFPCFISKRSNSGNLDAQSANAFIRDLEY
                     SKLYLRITTRRIVKSIDDIIAEAAFDTKELLHRGYGKPIELQVNDSKVTMTFLYNPIT
                     EELPCNERVQDTGYLNLNIISGSHLMAADRNGKSDPFVGIYINGKRVYKTHTEKKTLD
                     PVWNEHCKIPIPSRSRSNVVMRVWDWDRAGSNDDLGYADINLSEMEINRTYDWELPLN
                     TQGSVKLSATFNPGYVKPTLDEKDGGGLSDAPLKAIGGVSGNVADAAGNVAGIAGAGL
                     GAAAGGLSKGGKLLKSLGQGRKSFDSHRSHKKSGIDDRTNEEIAKEAKERTERDMENK
                     ESGGPHLGIPKMKKPSMNGLSLGASHITSPFHHDHNTQDTPPQQMSETFGDHNTSSNQ
                     STPGIERISTASTFARTLGPDAATTGTLKILSGDNLGRNIQIKVSLTQAGRIKYIYKT
                     KKCKADNNGDIEFHEDVQFKASPEANIILGAVSVHTLGKDKEVGFGQVSLKDPSVHMG
                     QPITVNVGEGHVTVLIDYYADQAPPVPEVPMEYRTE"
     gene            <1221234..>1222364
                     /locus_tag="CAGL0L11462g"
                     /db_xref="GeneID:2890966"
     mRNA            join(<1221234..1221248,1221849..>1222364)
                     /locus_tag="CAGL0L11462g"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_449266.2"
                     /db_xref="GeneID:2890966"
     CDS             join(1221234..1221248,1221849..1222364)
                     /locus_tag="CAGL0L11462g"
                     /note="highly similar to uniprot|P05739 Saccharomyces
                     cerevisiae YLR448w YL16B or uniprot|Q02326 Saccharomyces
                     cerevisiae YML073c YL16A"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_449266.2"
                     /db_xref="GeneID:2890966"
                     /db_xref="GOA:Q6FKH8"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH8"
                     /translation="MTALKPQKWYPAEDVAVPKKTRKTARPQKLRASLVPGTVLILLA
                     GRFRGKRVVYLKHMEDNTLLVSGPFKVNGVPLRRVNARYVIATSTKVDLSGVDVAKFN
                     VEYFAREKLNKKEKKEAQMFPENSSKQVKAERVEDQKNVDKALLANIKKTPLLKQYLA
                     ASFSLKNGDKPHLLNF"
     gene            <1222937..>1224250
                     /locus_tag="CAGL0L11484g"
                     /db_xref="GeneID:2890967"
     mRNA            <1222937..>1224250
                     /locus_tag="CAGL0L11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449267.1"
                     /db_xref="GeneID:2890967"
     CDS             1222937..1224250
                     /locus_tag="CAGL0L11484g"
                     /inference="similar to AA sequence:UniProtKB:P38911"
                     /note="similar to uniprot|P38911 Saccharomyces cerevisiae
                     YML074c FKB3 or uniprot|Q06205 Saccharomyces cerevisiae
                     YLR449w FPR4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449267.1"
                     /db_xref="GeneID:2890967"
                     /db_xref="GOA:Q6FKH7"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="InterPro:IPR026257"
                     /translation="MSDMLPLATYSLNVLPYIPTPAIDIEMPVTVRITMAALDPEALD
                     DQKQPSTLRIVKRNPNFDDEEYDDLLNGDYDEDEMASDDEEEEEEEEEEEKPAKKSKK
                     SKGKKKDESEDEEEEEESDSDLDEEDDDDEFEEYVLATLSPKTQYQQTLDLTIAPEEE
                     IQFIVTGSYAISLVGNYIKHPFDTPMGDMDDSEDEDGSDYDDELSDSYYNDQYSDDDA
                     EDSDEHDLTPDEDELAPAGSVEEIEASEEEESEEEEKKSKHKKHDHHHHHDHDHDHDH
                     EHKSKNKKRKQEEEEPKKEHKDKKVKFKKDLEEGPTKKEKAESKKADKTPKRRTLEGG
                     VVIEDRTVGDGPAAKKGDRVGMRYIGKLKNGKVFDKNTSGKPFVFKLGRGEVIKGWDV
                     GVAGMSVGSERRIIIPAPYAYGKQALPGIPANSELTFDVKLVSIK"
     gene            <1226920..>1230090
                     /locus_tag="CAGL0L11506g"
                     /db_xref="GeneID:2890968"
     mRNA            <1226920..>1230090
                     /locus_tag="CAGL0L11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449268.1"
                     /db_xref="GeneID:2890968"
     CDS             1226920..1230090
                     /locus_tag="CAGL0L11506g"
                     /note="highly similar to uniprot|P12683 Saccharomyces
                     cerevisiae YML075c HMG1 or uniprot|P12684 Saccharomyces
                     cerevisiae YLR450w HMG2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449268.1"
                     /db_xref="GeneID:2890968"
                     /db_xref="GOA:Q6FKH6"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR002202"
                     /db_xref="InterPro:IPR004554"
                     /db_xref="InterPro:IPR009023"
                     /db_xref="InterPro:IPR009029"
                     /db_xref="InterPro:IPR023074"
                     /db_xref="InterPro:IPR023076"
                     /db_xref="InterPro:IPR023282"
                     /db_xref="InterPro:IPR025583"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH6"
                     /translation="MPLLFEGFNRISRPIAYASKLSAKQPIHVILVTLVISAFAYLSV
                     IQYYFNGWQLDSKTIFAKASNQDQDKLFNDCTHYYRNPESNGWSMISSTEANDLPLTQ
                     HYYLLDMRFEANENMTISKPFIDDTIYESKSEKYVIQKDLQISSELSAPDGTQWRLTT
                     SINDIFEIKQKLFDLYEICIKNINESDPFDISIIVIAYSMMMYTIFSLFNDMRKTGSS
                     FWLSLATLVNSACALFLALFTSQCLLHKEVTALSLIQGLPFLMVVIGFNHKVRLASNA
                     LHLFESYNISKKVATYRIIYEAMLEEGGRLLQDHLLCIIAFVGCSIYASSVQPLTNFC
                     ILSAFILAYELLLTATFYSAVLSLKLEINIIHRSTLIKQTLEEDGIVSTTADIISKSE
                     NKSRNLLFNSNYAVVFVKLAFIAFFVMINFYNLGSDWATDAFSAFYTSNKPPRLPEFI
                     KTSNSSQFHDAVLISIISVTYKPYKRYHQVEDSILSLLRYISVAIRDRFVSKLVFFAL
                     VISSLINIYLLNASRIHTKYTVEEVQSKHKPKAEQKIVKQKKVTVEKSRPKLTTGKDI
                     STSESSTSTSTSSFYSSSDEDTNIDEIMKRPIEELEAIMKAGNVSKLKNKEVVSLVIH
                     GKLPLYALEKQLGDTTRAVCVRRKAISILADAPVLATDRLPYKNYDYDRVFGACCENV
                     IGYMPLPVGVIGPLVIDGVSYHIPMATTEGCLVASAMRGCKAINAGGGVTTVLTKDGM
                     TRGPCVRFPSLTRAGACKIWLDSEEGQNQIKKAFDSTSRFARLQHAQTALAGDLLFIR
                     FRTTTGDAMGMNMISKGVEFVLKQMVEEFGWHDMEIVSVSGNYCTDKKPAAINWIEGR
                     GKSIVAEAIIPGDVVRKVLKSDVSALVELNISKNLIGSAMAGSVGGFNAHAANLVTAV
                     YLALGQDPAQNVESSNCMTLMNDVNGDLKISVSMPSIEVGTIGGGTVLDPQGAMLDLL
                     GVRGPHPTNPGANARQLAKIVACAVLAGELSLCAALAAGHLVQSHMTHNRKPAAAGAV
                     ESKPTQSVNNADIKRLEEGSKICIKS"
     gene            complement(<1230393..>1231352)
                     /locus_tag="CAGL0L11528g"
                     /db_xref="GeneID:2890969"
     mRNA            complement(<1230393..>1231352)
                     /locus_tag="CAGL0L11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449269.1"
                     /db_xref="GeneID:2890969"
     CDS             complement(1230393..1231352)
                     /locus_tag="CAGL0L11528g"
                     /note="weakly similar to uniprot|P38813 Saccharomyces
                     cerevisiae YHR101c BIG1 big cells phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449269.1"
                     /db_xref="GeneID:2890969"
                     /db_xref="GOA:Q6FKH5"
                     /db_xref="InterPro:IPR024722"
                     /translation="MCGLIGIIIGLLTRVALASSLDVGTSPAILFSTRLSEGILEYYD
                     MFDSGAVVPREDFNTVCKTLISHCNSDAVVFVNQPGLSLGDLSEYADQFQYLSSYVRH
                     SSSAMNIERVSVSQDDQESQFESLVRYAMDTCNIYEKVVIEPYEADTYKAYIDAEKKV
                     ILIELPEFLNTQNETDRMALISSNDNRLRNILGQLPSPDISVIYTSFQPSNLAADEFA
                     EILPAAFDVFDKNAAVERNIRLKDATRPGFINYRPKFGDFNSISQIKLDKQFLEENLG
                     LLSAILVSTILYLFGQRLSSHSKSQNTTSNSAKNTTKKAERGN"
     gene            <1232015..>1235233
                     /locus_tag="CAGL0L11550g"
                     /db_xref="GeneID:2890970"
     mRNA            <1232015..>1235233
                     /locus_tag="CAGL0L11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449270.1"
                     /db_xref="GeneID:2890970"
     CDS             1232015..1235233
                     /locus_tag="CAGL0L11550g"
                     /inference="similar to AA sequence:UniProtKB:P38692"
                     /note="similar to uniprot|P38692 Saccharomyces cerevisiae
                     YHR102w NRK1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449270.1"
                     /db_xref="GeneID:2890970"
                     /db_xref="GOA:Q6FKH4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH4"
                     /translation="MKSSNEDKEKDISSTFKRTEVIGRGKFGIVYKGYHVKTKQVYAI
                     KVLNLDSSEDEVEDVQREIQFLASLKQIPNITRYYGSYLRGTSLWIIMEYCAGGSLRS
                     LLRPGKIDEKYIGVIMRELLVALKVIHKDNVIHRDIKAANVLITNEGQVKLCDFGVAA
                     QLNQTSLRRQTMAGTPYWMAPEVIMEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEA
                     LRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELLKTKFIKTHKATP
                     TTILKELISRYLLFRDKNKSYKDSAYLADDIPNAKAELTNEEKRRLSSDSSDGKEELS
                     EIDVKWDFDSLSSNDYIIDNNIQMDAIPQDSGPDWPINQVDHFNFAYPEEDQYYMYHT
                     NNNIQKTYQGTTIGKGNVGTIVHNSTLNAPISHTTTQFGNKATGTASNITGSHSNPSN
                     ASKRLETKALKQLLQLFEDNEVISEETDISTELPVLAKNSSSLHIKTNFNGGVSEDTM
                     GSASSEARKYPGVLTGSSYYSQSSPMVPVTSHKYQQGNGPMSSTLTAAPTSIEIEIPE
                     ELPTSTSTLQSQETSSGPTKPRSSTVSNPQLSFKQQNGVSRRLTVGAGANRNDNQVQS
                     SLSTLKQNITEDNQKENPKQSSTVNNQSNGQLSSATKSHHRTPSPSRLFANGSSPNKP
                     LNISPTMSTASHLGGSSAPPMMKPMSNTVDRKDDTPSFSSPMGIVGKPSMNNSPSDGK
                     SGVVLDKNGAAIPFTPLGNSSSRVNGEFRRMNPNLKLQMPLPTNAGARNKLLENSVTT
                     STPSNLGVNTAAAATAPASTNDSINQFGFNTSVTSALPVSMTPINEKSMDFNAKIKRS
                     HSTSKRKNSLTLDQGVSSANLSASSINIGGGGSSNSSLQVNQENQPQLTPNSVLSDGA
                     SMNSGNTGTTITASMNSNSTAVNLNSSNVSASALSVKTVTTQPNSNTVTAAGTPVTGG
                     NPIAITAPNVSAPTATAATANNGSNESVLADLPVMQAPPKQLQMDIFLDRNVYSTTNK
                     MMDKKPQVLYELEKMLKMYEQGFPALEHALKSQLEKITAEDK"
     gene            <1236335..>1238776
                     /locus_tag="CAGL0L11572g"
                     /db_xref="GeneID:2890971"
     mRNA            <1236335..>1238776
                     /locus_tag="CAGL0L11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449271.1"
                     /db_xref="GeneID:2890971"
     CDS             1236335..1238776
                     /locus_tag="CAGL0L11572g"
                     /inference="similar to AA sequence:UniProtKB:P38814"
                     /note="similar to uniprot|P38814 Saccharomyces cerevisiae
                     YHR103w SBE22 or uniprot|P42223 Saccharomyces cerevisiae
                     YDR351w SBE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449271.1"
                     /db_xref="GeneID:2890971"
                     /db_xref="GOA:Q6FKH3"
                     /translation="MIRPRSNLGTLPEEPSVESKSGRTLAGITSSRKESGMRSRTSSG
                     SAQAVGLGLGRRPSDNLFHGHADPLDTMQMLSEALPQPPKIEHGMRRERPISNDSIMT
                     TKSSEIFSTSSSDTQSNISVATNDSEDHSFGMDKSVDNSSTNATLTNRSIENRSNGDS
                     YSIGEKSDVSVNRSTKSGNNPLQRTQSETISVNMSHNRSMNGAMKQPTPPFMGKNSSI
                     PNLRYNSQPQQDNRSVPNGEFGSKLYNLSNSTSAIIPNAGTGSKLALTPSQRYRLRKE
                     QSEHALRDVIKRKEKLYDEQDGIIELQEGDIDGSFIFNVPMSSYSTTSFLNTTRQKDS
                     ATNSSSTITERITPGENQSQNNRESNMSFASTISSTSMLDFFEMPTSPIPGVNKVSDF
                     QYLQDTTKHLSSVYLHSSTKLSKSKLSERTASADCLPLEFKEASEKGMEDLLLVSENK
                     LDAVSHTRPSWLPPKDPEEKKLHEREISKTLSMASLDQLEKNKDRDSKIIKDETNKQK
                     YVLLVDRNITRKSSLQSLKKIIWETPINAELRNHIYDMVLQSEARLVTERFTESFDDI
                     IKLSNRIELTKTKEIEIRNLITANIENKAGGKYDVSDDLVLMLKLKSISQQGILPGDE
                     LLFHHLLIDDSFENLNQVWEMVNLIQMTCFNEITKDKFDSKILEKSGVVASYMLQDDS
                     FKHEFNANCLNSNTWWNILERVNHDLFMWIIDIIVTMNSQPFKNSPINKEKYSEVNWD
                     VYRDNKVLINYQILISFALNVLLNYHFGFNDLKSLADVKDKNFCIPISEENYLDIDEI
                     NSLFVGKWKHYFKKF"
     gene            <1239169..>1240692
                     /locus_tag="CAGL0L11594g"
                     /db_xref="GeneID:2890972"
     mRNA            <1239169..>1240692
                     /locus_tag="CAGL0L11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449272.1"
                     /db_xref="GeneID:2890972"
     CDS             1239169..1240692
                     /locus_tag="CAGL0L11594g"
                     /note="highly similar to uniprot|Q12196 Saccharomyces
                     cerevisiae YOR119c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449272.1"
                     /db_xref="GeneID:2890972"
                     /db_xref="GOA:Q6FKH2"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH2"
                     /translation="MDDLSDKFRNVKVSTDHINNQIMDKYGHKIKTDELSINKAKTNK
                     DKANRATVENVLDPRTMRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSKMATEQQ
                     SDEPKEDIDANAIPSKGNIDISENRAKTAEDLIREGRKEYAIKIYKTSILIFKDRERY
                     VDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFL
                     NRGDGFASPKLRDYPYKDREEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEK
                     LYMIDVSQSVEPEHPMSLDFLRMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFD
                     GDMNSYEDLRKYVATNIPIKRTQEDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFD
                     LLKSLLAQDNKKNYIAAQASKINVDSSDENISDSEDEGSDDGSDDDTDGSDEEEQYSE
                     AESYEEVPKELKGKKYEDKDLKKQRKQEAKEAKREKRKTKVKKHIKKKLVNKTKSKK"
     gene            complement(<1240790..>1242457)
                     /locus_tag="CAGL0L11616g"
                     /db_xref="GeneID:2890973"
     mRNA            complement(<1240790..>1242457)
                     /locus_tag="CAGL0L11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449273.1"
                     /db_xref="GeneID:2890973"
     CDS             complement(1240790..1242457)
                     /locus_tag="CAGL0L11616g"
                     /inference="similar to AA sequence:UniProtKB:Q12108"
                     /note="similar to uniprot|Q12108 Saccharomyces cerevisiae
                     YOR118w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449273.1"
                     /db_xref="GeneID:2890973"
                     /db_xref="GOA:Q6FKH1"
                     /db_xref="InterPro:IPR006571"
                     /translation="MGQTASSPQDNKESKSHPQFKTRDEILQYFNTRVVKLFTVTEIA
                     AFKKRFNAIDLNEPIDDTLIKEALYLDAQPNVWSAVSETIRLLQNFPLFHQPIADSIT
                     GFGLLKVIAIINVKRFEKLVNTTITRYDITVTLGLCGQAKESENKIKSTNLGDILKTY
                     DHIEIESIHIPYDKLILLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIANT
                     ISTSALGNANDIGIPATDILNAFNTIMISLVPYMSNLFEHLLFGVDDLIDHVNDLANL
                     SHQDVLTPSLYAQVIIGLPNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLMIV
                     SGTRISDDESYADSKNPRYRSFLYSFPKLRENDQNLDAIHLTKKKVTYAVYIDEPWKV
                     SNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNTIGGGIGVGSEQPIVKQNDIKFIP
                     GNISLTMDSSLEFGVFRHVGAGGGFKTSLLDNDDSKSFEIRFIIQNVEVWGCGGEKEL
                     AEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVGLVGQHQSGGSV"
     gene            <1243194..>1245020
                     /locus_tag="CAGL0L11638g"
                     /db_xref="GeneID:2890974"
     mRNA            <1243194..>1245020
                     /locus_tag="CAGL0L11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449274.1"
                     /db_xref="GeneID:2890974"
     CDS             1243194..1245020
                     /locus_tag="CAGL0L11638g"
                     /inference="similar to AA sequence:UniProtKB:Q06344"
                     /note="similar to uniprot|Q06344 Saccharomyces cerevisiae
                     YDR365c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449274.1"
                     /db_xref="GeneID:2890974"
                     /db_xref="GOA:Q6FKH0"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="UniProtKB/TrEMBL:Q6FKH0"
                     /translation="MSEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVA
                     RRAKVDKYGRKIKEGSSKDIEDFDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEV
                     PSDYVSSEDEFTSSDSDTSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWD
                     HVRSVDMMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKK
                     NSSEDEEESDVDIKDLYEEGNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIY
                     ENCDGTEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKL
                     TWDETPVDRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEEVNEEAKNKLKSLVGESL
                     KIDGKDGSDEDEGMDMEITFTPGLDEANAEGEDKDGEDNEETTIEKVRRKEKERRKAR
                     KQKLKELKQKSEEEKKQKLKSKHDEPLSDKKKAELELLMMDENESNSGINSKAHFNMN
                     EILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKA
                     MKEILKERRKRSRDSKHGKEEHTDKNDINKIVSKLKSKKHKK"
     gene            <1245685..>1250064
                     /locus_tag="CAGL0L11660g"
                     /db_xref="GeneID:2890975"
     mRNA            <1245685..>1250064
                     /locus_tag="CAGL0L11660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449275.1"
                     /db_xref="GeneID:2890975"
     CDS             1245685..1250064
                     /locus_tag="CAGL0L11660g"
                     /note="highly similar to uniprot|P04051 Saccharomyces
                     cerevisiae YOR116c RPO31 DNA-directed RNA polymerase III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449275.1"
                     /db_xref="GeneID:2890975"
                     /db_xref="GOA:Q6FKG9"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:Q6FKG9"
                     /translation="MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLEN
                     NRSPKEGGALDPRMGVSASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQI
                     LQGICKTCSAILLSEQDKRHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGAL
                     NGVVKKAAAGAGTASLKIIHDTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRA
                     TDDLNPLKTLNLFKQIASEDCELLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQD
                     SPASNEDDLTVKLTEIVWTSSLIKAGIEKGISINNMMEHWDYLQMTVAMYINSDSINP
                     AMLPGSSTGGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEV
                     AVPQLVAKVLTFPEKVTRYNIKKLRQLVQNGPNVHPGANYLLKKNEEARRNLRYGDRQ
                     KLANNLQYGDVVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPY
                     NADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISH
                     KDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKPCYLWTGKQVFSLLIKPNKNSPVKI
                     NLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQILSGVMDKSVLGDGKKHSVFYTIL
                     RDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPADDLKQKKEDLVEIAYAKCDE
                     LIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVCINELDNLNAPLIMATCG
                     SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL
                     SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQF
                     TYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIKKTVDNILKPLEK
                     RLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLAKLRKSRGLPK
                     LIKKSELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHRAKVEPGTAV
                     GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN
                     NNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLELTIEDI
                     AIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRMQTL
                     RRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVLE
                     IFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM
                     RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIA
                     EDELKPKRTLFESLTSNVANKQV"
     gene            complement(1250290..1250362)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L11682r"
                     /db_xref="GeneID:2890976"
     tRNA            complement(1250290..1250362)
                     /gene="tRNA-Lys (CTT)"
                     /locus_tag="CAGL0L11682r"
                     /product="tRNA-Lys"