GenomeNet

Database: RefSeq
Entry: NC_006036
LinkDB: NC_006036
Original site: NC_006036 
LOCUS       NC_006036            1402899 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  [Candida] glabrata strain CBS138 chromosome M complete sequence.
ACCESSION   NC_006036
VERSION     NC_006036.2
DBLINK      BioProject: PRJNA12376
            BioSample: SAMEA3138172
            Assembly: GCF_000002545.3
KEYWORDS    RefSeq; complete genome.
SOURCE      [Candida] glabrata
  ORGANISM  [Candida] glabrata
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Nakaseomyces; Nakaseomyces/Candida clade.
REFERENCE   1
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  CONSRTM   Genolevures
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
  REMARK    revised by [3]
REFERENCE   2  (bases 1 to 1402899)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1402899)
  AUTHORS   Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) INRIA uipe Magnome, CR INRIA Bordeaux
            Sud-Ouest Laboratoire Bordelais de Recherche en Informatique,
            FRANCE
REFERENCE   4
  AUTHORS   Frangeul,L. and Sherman,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2004) B. Dujon, Institut Pasteur, Unite de
            Genetique Moleculaire des Levures, 25 rue du Docteur Roux, 75724
            Paris Cedex 15, FRANCE. E-mail: lfrangeu@pasteur.fr E-mail:
            david@labri.fr
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR380959.
            On Aug 5, 2010 this sequence version replaced NC_006036.1.
            This is an updated version of the complete genome sequence. The
            Candida glabrata sequence is made of 13 chromosomes (A to M). The
            sequence was annotated by the Genolevures Consortium.  For more
            information go to http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1402899
                     /organism="[Candida] glabrata"
                     /mol_type="genomic DNA"
                     /strain="CBS 138"
                     /type_material="type material of Candida glabrata"
                     /db_xref="taxon:5478"
                     /chromosome="M"
     gene            complement(<11636..>14404)
                     /locus_tag="CAGL0M00132g"
                     /db_xref="GeneID:2891153"
     mRNA            complement(<11636..>14404)
                     /locus_tag="CAGL0M00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449350.1"
                     /db_xref="GeneID:2891153"
     CDS             complement(11636..14404)
                     /locus_tag="CAGL0M00132g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019c STA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449350.1"
                     /db_xref="GeneID:2891153"
                     /db_xref="GOA:Q6FK94"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6FK94"
                     /translation="MYSKTTFTANILFCLLLLLRCCAAILEPDNSLQIFDSFLSNPSK
                     YPLGCSPKITNPKKGLSMELYSYPYRKKGSHPCWDPAYLDPNFPRVGYKKNKLIARVD
                     GVSGDINFNFHPKRQCTPIADYLPPNFNYNEPITTTNFTMLLYGYFKPKVTGLHTFDI
                     SADDLLFMNFGAGNAFDCCRRDSTADTFGNYVAWAIWGRRIVRNKLTVRLDKGIYYPL
                     RLFFNNRDYYGQMRLTFKTEHGSERITDFSDYFFSVDDTSEGCPGLITYESECADVKS
                     STVLETDYITIQAEKEVLPIIKTIYYVGIPCSSSQSIYGSSSSSSSSKRLDCPSGLFF
                     DPLAEKCVSISTPPLPPIPSSSSLPTSSQEYSSSSHRVPSSSHALIHSSSVVISTISS
                     SIPSSMPSSIPSSMPSSMPSSIPSSMPSSIPSSMPSSIPSSMPSSVIKPSTVSNHSSS
                     IPSSIPSSMPSSIPSSIPSSMPSSMPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSM
                     PSSMPSSVIKPSTVSNHSSSMPSSIPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSI
                     PSSMPSSMPSSIPSSMPSSVIKPSTVSNHSSSIPKSSTPTGDIPEPRILNITTTTTNH
                     SSETPPFSSSDSSSYIESSIISSSSSFELRSVSTPKLISSTMVPIFSKTKSSTRSHIY
                     WNSSTIETSSSLSPSPSPSPSPSPSPSPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDP
                     QPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQP
                     SPRPDPQPSPRPDPQPSPRPDPQPSPRPNPQPSPTPKLLSDFSSLHHSRSLNAIFRSA
                     TSRHDTYTTISAFFTPRLSLQITTLVQQPTASDALNSLYLGGTYRLNVSYFLFPALLI
                     FTIANILV"
     gene            <22039..>23691
                     /locus_tag="CAGL0M00154g"
                     /db_xref="GeneID:2891151"
     mRNA            <22039..>23691
                     /locus_tag="CAGL0M00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449351.1"
                     /db_xref="GeneID:2891151"
     CDS             22039..23691
                     /locus_tag="CAGL0M00154g"
                     /inference="similar to AA sequence:UniProtKB:P32487"
                     /note="similar to uniprot|P32487 Saccharomyces cerevisiae
                     YNL268w LYP1 or uniprot|P04817 Saccharomyces cerevisiae
                     YEL063c CAN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449351.1"
                     /db_xref="GeneID:2891151"
                     /db_xref="GOA:Q6FK93"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FK93"
                     /translation="MSSSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIRE
                     DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCL
                     GEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTA
                     DHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKN
                     PQHEYIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPK
                     IVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTSPFTLVFQMAGTRGAGSFMN
                     AVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGL
                     CLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKTDLLQFKNWTY
                     PFGPYFLVIFTVFIILIQGWQAFDPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVK
                     YEDMDFVTDRYIPTKEIVELNERLDNLKGWKKVRQIFSDYIA"
     gene            complement(<24106..>25221)
                     /locus_tag="CAGL0M00176g"
                     /db_xref="GeneID:2891150"
     mRNA            complement(<24106..>25221)
                     /locus_tag="CAGL0M00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449352.1"
                     /db_xref="GeneID:2891150"
     CDS             complement(24106..25221)
                     /locus_tag="CAGL0M00176g"
                     /note="highly similar to uniprot|P47176 Saccharomyces
                     cerevisiae YJR148w TWT2 or uniprot|P38891 Saccharomyces
                     cerevisiae YHR208w TWT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449352.1"
                     /db_xref="GeneID:2891150"
                     /db_xref="GOA:Q6FK92"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:Q6FK92"
                     /translation="MDASRLKITKVSTPSERKPNDQLVFGKTFTDHMLTIEWTSENGW
                     DAPEIKPYGKLCLDPSSIVFHYAFELFEGMKAYRTKDGKIAMFRPEKNMERMNKSAAR
                     ICLPTFDGEELIKLIGKLIELDKHLIPEGEGYSLYIRPTLIGTSEGLGVKEPDRALLF
                     VICSPVGPYYKTGFKAVRLDATDYATRAWPGGVGDKKLGANYAPCVLPQTQAAAKGFQ
                     QNLWLFGPEHYVTEVGTMNAFFAFNCKETGKKELVTAPLDGTILEGVTRDSILTLARK
                     YLDPNEWEINERYFTIHEVQEKAHKGELLEAFGSGTAAIVSPIKEIGWKDTIINVPLI
                     PGEQSGPLTKQIASWMMDIQYGKVELDNWLRIVADIN"
     gene            complement(<26473..>27207)
                     /locus_tag="CAGL0M00198g"
                     /db_xref="GeneID:2891149"
     mRNA            complement(<26473..>27207)
                     /locus_tag="CAGL0M00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449353.1"
                     /db_xref="GeneID:2891149"
     CDS             complement(26473..27207)
                     /locus_tag="CAGL0M00198g"
                     /inference="similar to AA sequence:UniProtKB:P32787"
                     /note="similar to uniprot|P32787 Saccharomyces cerevisiae
                     YJR144w MGM101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449353.1"
                     /db_xref="GeneID:2891149"
                     /db_xref="GOA:Q6FK91"
                     /db_xref="InterPro:IPR009446"
                     /translation="MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVK
                     PTEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPT
                     DIEIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLV
                     SVSRGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKF
                     VTHIATSKKKKIWIRKDRSVEYPYKA"
     gene            <28137..>30434
                     /locus_tag="CAGL0M00220g"
                     /db_xref="GeneID:2891148"
     mRNA            <28137..>30434
                     /locus_tag="CAGL0M00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449354.1"
                     /db_xref="GeneID:2891148"
     CDS             28137..30434
                     /locus_tag="CAGL0M00220g"
                     /inference="similar to AA sequence:UniProtKB:P46971"
                     /note="similar to uniprot|P46971 Saccharomyces cerevisiae
                     YJR143c PMT4 dolichyl-phosphate-mannose--protein
                     O-mannosyl transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449354.1"
                     /db_xref="GeneID:2891148"
                     /db_xref="GOA:Q6FK90"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:Q6FK90"
                     /translation="MAVTKRSPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQ
                     NWLLNPKPDSDNSYRLGFYLVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTF
                     FFDVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVS
                     IMFESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILLISVAATVYSYIRFYK
                     LQLKEPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLS
                     IRMLIKHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEAT
                     KLSKEVQFFDIVTFENQDTGAFLHSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQW
                     EILPVADKAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGA
                     RANSTIFRFQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVN
                     GNKKMTDSGNAWTIDSIMNLDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSE
                     HPFASQPESWPGSMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQIT
                     RQRGYFALNKVTREKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAA
                     GLWETVFSRCKSDDPYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPL
                     IYATPLSAREVIKRKWLDISLSFAK"
     gene            complement(<30628..>31665)
                     /locus_tag="CAGL0M00242g"
                     /db_xref="GeneID:2891146"
     mRNA            complement(<30628..>31665)
                     /locus_tag="CAGL0M00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449355.1"
                     /db_xref="GeneID:2891146"
     CDS             complement(30628..31665)
                     /locus_tag="CAGL0M00242g"
                     /inference="similar to AA sequence:UniProtKB:P47173"
                     /note="similar to uniprot|P47173 Saccharomyces cerevisiae
                     YJR142w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449355.1"
                     /db_xref="GeneID:2891146"
                     /db_xref="GOA:Q6FK89"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:Q6FK89"
                     /translation="MVKVETDSATGRQILVRTTEDNREGFSFVEVIDRVDSLPSDFEL
                     NEQFRKNVFYMTTHDGVKVGFVNRGILEEIQRVANEELLELFEIKEAENILQFKYNLD
                     FDSRNTRLDELGLKLRDKSKLQGVKGWRNEKYAVWVGKKPYVLVERALSGVLGIITYG
                     VHVNGYMFDEHTQEIKFWIPRRSKDKPTWPYLLDNVIAGGLGYPYGIEETLYKESIEE
                     ANLDKESIQKNIRAGGVVSYFYFPKGNIRDNFYNESSAIVGEVEYIYDLRFDSNMKPS
                     PNDGEVDSFNLLDLQQTIDALVNNEFKPNCGLIMLEFLIRYGYINAENEPNYLKIINR
                     MHRSFPFPTLN"
     gene            complement(<32100..>33173)
                     /locus_tag="CAGL0M00264g"
                     /db_xref="GeneID:2891147"
     mRNA            complement(<32100..>33173)
                     /locus_tag="CAGL0M00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449356.1"
                     /db_xref="GeneID:2891147"
     CDS             complement(32100..33173)
                     /locus_tag="CAGL0M00264g"
                     /note="weakly similar to uniprot|P47172 Saccharomyces
                     cerevisiae YJR141w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449356.1"
                     /db_xref="GeneID:2891147"
                     /db_xref="GOA:Q6FK88"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="UniProtKB/TrEMBL:Q6FK88"
                     /translation="MKYLVEELENVGVTLIAVEALNNVSYSISTNRSTLELRVINDSY
                     KTSIRLKGLNLDNLYDEKNGHIHLSETSCGYVRLKRKTQALTNRISLVDLPDDKWNIE
                     RFKKMQGFQIACNNCKLVVLDSEVNIKKISEMPSEFWAEFMDYWHCHKPTIGESKTDA
                     KPYDYYKELKPRLNEVLVGNTYFQTIGSTIDRKVVVQTDGSVDCSNCRSTLGYKEGSE
                     ILVLEKQNLQLQDTFKELSEDYPGYLVVLARILSLLKFNSTRYFALKTGGQKPIFIWV
                     LAYDCSVAYTGNELVQRAYKLLYKDSWDRPPSSMEDIQLSDDLLDSFLQQLTKIHELI
                     PENLKMFNGWKVSYMSIEDTNPI"
     gene            <33549..>38396
                     /locus_tag="CAGL0M00286g"
                     /db_xref="GeneID:2891145"
     mRNA            <33549..>38396
                     /locus_tag="CAGL0M00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449357.1"
                     /db_xref="GeneID:2891145"
     CDS             33549..38396
                     /locus_tag="CAGL0M00286g"
                     /inference="similar to AA sequence:UniProtKB:P47171"
                     /note="similar to uniprot|P47171 Saccharomyces cerevisiae
                     YJR140c HIR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449357.1"
                     /db_xref="GeneID:2891145"
                     /db_xref="GOA:Q6FK87"
                     /translation="MSSFSFLNQSPDIEQLEAEEHTRETQIELCFQLFQDALERLKDD
                     KFGDANDLFEKLMSQEVIKPDKWGLYAYSSSIVDNLRYLAYRNRGFFYYKFLMNQYSE
                     SMSSEDVVDNILKIVENLLESLRHSEADYNVIEVLVQIFESFKSKRLQKLLLENEFMN
                     NDSHLLFSGRKRTNILPQLKVLISQYINLLKDLHASSVLEKKIICNGQAKNTSHLPRT
                     NVKFKNILEQLNKLRTEDDELIKSLDIHDIELDNYDWTSLLRSLRETLPTVKSLALFG
                     RNSDPYAETETPIEAVKVIVKEEVVIDKIHDNSNNENEVTEEKEITDNKVVTTNGNNR
                     KRSITEIETKHAQRSSKRFRDRDSSAADSETPMTFEPMFYSYTKILSLLGCKAPYDYE
                     AIYPDLMEVKANDIIYADFLACLKEWSHWHTDCLSSQNEKEIKTKKVESSTDVSLSHF
                     KTLLNSKNFQKSDDHIPEISQTSLRRFLDKVNRQQCHFHELRFKLIWFLFDNQNGDRL
                     LTSTRWTKQMYRDVEWITLSIEKNIFSFIQSDIAKYRHVALSIFETLINSLVELCEEI
                     NSKLSLGQKANDQKTQKVKIEKKITKWNSIIAQVETTDRDWTVRYLWAYYTLIQCTSD
                     IQNCLLSNILEKVHQILMKDNSSTVYLYPNADFISSFDLSFVDTQLKKLKMIKKLVNV
                     DKHSESDKSEDNNSQFIMLENVLLSTISENHAVGGDDDDMIDFFMSAPFMLKFKLWEL
                     IYMKYVKKNDIEKTTLIYGIMLKLLVDTLECKTYRTLGPKKRQERLLIMMSCLKDITH
                     NCIEVLKNNAWLQKKLSWYDDTTSQLVFIFFILFPMLPVNTPNKLSGTQTFFQKATKS
                     SKTIKSIFVDILTLLLFHLNIGLKSKISSEPELENSIIDLVSTTHISISFYNFCDYAS
                     GNFLQIAENLICQFTNEEAFTQLKQIMWCKYHYQLSGDSSIVSQHKTKAMEMSKMVSL
                     PLGIYLVKLQYQDKHPYINSAKIASKQILDNIVETFGDLSSQDNYIIMRNLHAFNGYL
                     RSNITSKLFQSCFEGKDKVDLKNPNDEFQKAMDAGVFYVSGIQALNLYKIRKRSVQAR
                     PSELDAIITMFKNDILYNTKRFESWYLLGKCYSYIVEDDLLWTADKISSSEKKAVIAT
                     TQKRAILCYAMSLTLFFENETTRTVDEQIVIVECLESLANELMIAVYKPMEALCFDTN
                     LSSLVVSSSNPATSSEIEKSSVAPIYSITDSSIEDTMIKCLTLANRYQESLLEAGKLD
                     RLNWFNFYSIAIVYSTEKLDRKGDMIDNMSKACELANKYTSVKDSVVEPHVALIHMLY
                     KLYIEGKVTMEDTLSTLKRDKFFEGFDDDFWILDVSLTQDYQKREFFSKLIELLKYVI
                     SKDKKKWQHEPYFYIAEILFMEMKDVEKSREWMDNIISIRSVNKNLVNIWKPDYERPG
                     KHFVFTHNYVMFYLELLKYDKDAQSIGLLTKKLRRFSSGMAYIGKANDVATSYFIECV
                     TKKYLLHDKVYTESYMGNINYNDFVKYSQEIVDNSKAADIAEDILEVLKIAYQLKKGT
                     NSVVYDTVCLSLFFQYIYEPYRKEHPETEPQLVSDSENKSNIRKKVSKKDAFDKIRAL
                     VDKLP"
     gene            complement(<38758..>39072)
                     /locus_tag="CAGL0M00308g"
                     /db_xref="GeneID:2891144"
     mRNA            complement(<38758..>39072)
                     /locus_tag="CAGL0M00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449358.1"
                     /db_xref="GeneID:2891144"
     CDS             complement(38758..39072)
                     /locus_tag="CAGL0M00308g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449358.1"
                     /db_xref="GeneID:2891144"
                     /db_xref="GOA:Q6FK86"
                     /db_xref="UniProtKB/TrEMBL:Q6FK86"
                     /translation="MSTKPIVNEFERTEVRDEITLERDERPGEKSFVIGLTPRSLFSH
                     CVKFHALLATFSSMCDIPITFSAANLEIQLSSSPQQTVNYKPNALKSKNQLPKTHLWL
                     EP"
     gene            <39196..>40284
                     /locus_tag="CAGL0M00330g"
                     /db_xref="GeneID:2891142"
     mRNA            <39196..>40284
                     /locus_tag="CAGL0M00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449359.1"
                     /db_xref="GeneID:2891142"
     CDS             39196..40284
                     /locus_tag="CAGL0M00330g"
                     /note="highly similar to uniprot|P31116 Saccharomyces
                     cerevisiae YJR139c HOM6 homoserine dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449359.1"
                     /db_xref="GeneID:2891142"
                     /db_xref="GOA:Q6FK85"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:Q6FK85"
                     /translation="MSNKSVNVAIIGTGVVGSSFLDQIVAMKSNITYNIIYVAELSKA
                     LISEDYSPLALGSDWAKAVNGANQGPLALEKLVDFLKKSPIPVILVDNTSSAAIASFY
                     PTFVENGISIATPNKKAFSSDLATWDSLFSGKPTNGLVYHEATVGAGLPILGFLREII
                     QTGDEIEKIEGIFSGTLSYIFNEFSTTTTNDVKFSDVVKVAKQLGYTEPDPRDDLNGL
                     DVARKVTIVARISGVKVESPTSFPVQSLIPKPLESVESVDEFLQKLPEYDDELTQLKK
                     EAAEENKVLRFIGKVDVATGKPSVGIEKYDHSHPFASLKGSDNVISIKTKRYTNPVVI
                     QGAGAGAAVTAAGILGDVIKAAQRLVGA"
     gene            complement(<40767..>46181)
                     /locus_tag="CAGL0M00352g"
                     /db_xref="GeneID:2891143"
     mRNA            complement(<40767..>46181)
                     /locus_tag="CAGL0M00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449360.1"
                     /db_xref="GeneID:2891143"
     CDS             complement(40767..46181)
                     /locus_tag="CAGL0M00352g"
                     /inference="similar to AA sequence:UniProtKB:P47170"
                     /note="similar to uniprot|P47170 Saccharomyces cerevisiae
                     YJR138w IML1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449360.1"
                     /db_xref="GeneID:2891143"
                     /db_xref="GOA:Q6FK84"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /translation="MFSALRSKNQSNKRSNDDSINSRKDVNELSLGAGGTSTSTNTNH
                     NDSPSIKNKNKNKNKNKTENENIYKLTISSGRSRGTASNTTNANTLVLNAGVAIVGKA
                     PIASSQNEIQTISGQSLQSGIDTNLMTAGFGRSAGIDSTTTVSHDANSVKSRLQRLPT
                     ITTSYKEINNGNKPVQVEPQDDSHYTSSLLVDTDPRSNNQPQSISSNAVANVEINRTL
                     QLDLVYHESRVSEKLVMLDLKKLPHIKEGQLCELRTYRKRKSTSARSNKNSRDKKLYF
                     IAHDFDEETRKRCHKFGNISVALGQLQLLLDLPPRSRVWIKPKRKEDTAADLIELHIK
                     DILVNRGDMWCMSSELVDTCVFTGQRIMFLDSIRTTVNGIYKNGKKVLSGYINDNTKI
                     VFRSESSRLLFIIQITNEMWSFDESGEQMFQKMINSFFPKIFNKWKDIETHHSITIAF
                     AISMDMSTSSYKDLKPGQRIKNTTDYYRIVVDQVSVIYWVEIMESLRKEFMEITRELL
                     SRKSDDKKDNELSVIKGRFAPVIKSNILELINFAATTIVDPFRQLDLRHTSTHVMIIS
                     PGKGLYDVDYDLLQLSCKKLLSLELTMDLICLSNPPLHVVPLFRYIDYENKLHHCIPP
                     WLNIFFWNDKTKDTNKWTPRCQIYDLQMMGLTDTELVQELELDYLNPSDDINDLQTFL
                     KDYDRDIFLPISTANFKAENISSDPDEEDLKELKKINDKTTTIHKSSTSRNTLTKSQR
                     TNSEENNSIRSRKGDTIIKDPQFVGKISNSSRNNPPYDLSDKSTFEKQFKPKTTFHPS
                     AMIKKTPENMKKLTNPVFQQQYFDIQTDNGLTGNSKNLLIKNTKYLTPIIDEPQTPLV
                     TGNLYRTRFESQSNDNELNENSKLPERGGGTDERRNVSAADTLKDVTKKSSIKDFTQR
                     IFTKFLATTKQSNFNSDGINSSAITEDAVLISDDTDGKTNNNNDFAVYPSSVADGDVS
                     GDNQHRLNNKDSFTSILKPIPRPQLGVKIFKSDINNLSSNENVNSETKQNLLGTRNTI
                     NRKQFTASPHFTSSTKNSVSNHSRFIKFDSMDDWIEILEDSIPSYSFLGDDLLPTRWR
                     DVWPKNVFRKYSKWKSFTSPAELPITLKRFPSKYELENNFMLRNHSVTQNWEQEQYKL
                     TTKDLLRNMIYLRLLVGFQICTSSTIEEVESARKGDRDVFAIHKYLRGDLTGTFKIYM
                     LMGSEIHRLHYDNSGTINVERYIEKSERNVFDQVPSYTSFVKTRYDSNYRKTDVDPIH
                     TKRSEFNWNLLDQLLAGYSDPYLYDEWHGFRSKYVILPAEIPSNTFSMVVNGKNETLT
                     TEEIRVEGLRKLIASITRLKLLSVEESKIQKDRKTEIQPEVIFYTGSLFDFLNEQQAQ
                     LDSSTLNFKDSIFGDVTKKLNKNIDLKNLAQELQMGENKLNLVTRKWHWKRHANCFVG
                     SEMVNWLIRNFSDIDTRSTAISYGQKLMNDGLFIHVLDKHSFLDGNYFYQISPEFIIN
                     MNTVERTNSKNSNTSDNNTLKKTTSRNSTESNLTPLSMRNKVSTMDDDSTQLANTTSA
                     NSYKEKKTVVLSNSMLINVDPSSKSYKEELCTVHFDRVHNPEHCFHIRLEWLTTTPKL
                     IDNMLGNWARICEKYGLKLIEIPWNELCTIPSVDPFHTFVQLHLVINPWEDPEFNDPE
                     LFAVSKFYYHIHLLKMSGFLLDNRASRFFQRDDADFEIMYSWGKPQFKYAQYIHTTGA
                     YIAEMRENGNIFLAPNNVYMSRVNRANVISKTRSSPTFTVDSRKVVIEFSRTCYSYAK
                     LRAVFLDAKEKWLSNKTVED"
     gene            <49330..>53538
                     /locus_tag="CAGL0M00374g"
                     /db_xref="GeneID:2891141"
     mRNA            <49330..>53538
                     /locus_tag="CAGL0M00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449361.1"
                     /db_xref="GeneID:2891141"
     CDS             49330..53538
                     /locus_tag="CAGL0M00374g"
                     /inference="similar to AA sequence:UniProtKB:P47169"
                     /note="similar to uniprot|P47169 Saccharomyces cerevisiae
                     YJR137c ECM17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449361.1"
                     /db_xref="GeneID:2891141"
                     /db_xref="GOA:Q6FK83"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FK83"
                     /translation="MTAGTAGLDTGRPLYYVGAQKDNTPRDESLVSYVFKGETDYIKL
                     LASTDPLSRVIDNNKGGVVLLDQVTLLESLPHLYSIGKKDSTSNITEGSVITIIVDLN
                     LEDYSIIPAVSDLHLPIHIGLESINLEQNGIHFINFNRINGTQTANNIFTSGAASPKN
                     LIINLSQYYNELVKSVPEDVAIFNITEYKKNLLPEILANVPSSITRINLLQGSSTASE
                     NQEYEDGFEPFLLDFFADFEVLVQNNIQQLLLTKIGNKVDDFNSVSAKIISNLESAKP
                     VKNLFVGEVVDISKDVTEDYSNSIKNILKLEDAYIKVLKQLLGNNLSIINEYSNSTIN
                     TLSPEFGYGRYLQEKEIQNKLVELARKSLDPQLFHSQESDEFVKKLSKWVSFKSSSLD
                     QNLLEEANKIGSDIFEYLKTDAHSQTAIKLLEVAENDEKYFQFKSSWLIGSDAWSYDL
                     GNSGVHQVLTSSDNINMLIIDSEPYEQRKASTQRKKDVGLYAMNFHNVYVASVAVYSS
                     YTQLLTAFIEANKFNGPSIVLAYLPYKSEKDTPLDVLKETKSGVESGYWPLYRYDPSK
                     EEADEQSAFQLDSSVIRKQLEAFLERENKLTLLTKRNPALARTLAQSASDVVTQKQNK
                     RAEAALESLLNGLSGPPLHIYFASDGGNASNLAKRLHGRASARGLKSTVLSMDDLILD
                     ELPGEENVVFITSTGGQGEFPQDGKSFWDALKGSTDLDLSNLNVSVFGLGDSQYWPRK
                     EDKKYYNKPAQDLYRRLEFLGAKILAPLGLGDDQGDDGYQTGYSEWEPKLWEALGVAN
                     VEVEDEPKPITNEDIKLNSDFLRGTIASDLKDESTGTVQYSNEQLMKFHGIYTQDDRD
                     IREVRKSEGLEPYYYFMARARLPGGKCTPHQWLGLDKLSEDSGNGTLKLTTRATFQIH
                     GVLKKNLKHTLRGMNAVLIDTLAAAGDVNRNVMVTALPAQAKIHKQISTMAAEISEHF
                     LPKTTAYHEIWLDGPEEQDYEDDWNERFNNRKEGPRKKKTLVSGNALVDIEPIYGPTY
                     MPRKFKFNLTVPPYNDVDVFSSDIGLIAIVDKEKNSIEGYNIYVGGGMGTTHGNKKTY
                     PRVASSFGYVKNEDVLPALEALLIIQRDYGNREDRKQARVKYTVDRLGVQGYKEKAEE
                     IWGKKFEPERSYEITSNIDYFGWVKDENGLNHFTAYIENGRVIDTPDLPQKTGLRVLA
                     QYMEKNNTGHFRLTGNQHLVVSDITDEHLDAVKEILAKYTLDNADFSGLRLSSSACVG
                     LPTCGLAFAESERYLPDVITQLEDTLEEYGLRHDSIIMRMTGCPNGCSRPWLAELALV
                     GKAPHTYNLYLGGGYYGQRVNKLYRANLNDEEIVDVIKPLFKRYAAERNEGEYFGDFV
                     IRAGIVKPTLEGRLFHEDISEDAF"
     gene            <53938..>55200
                     /locus_tag="CAGL0M00396g"
                     /db_xref="GeneID:2891280"
     mRNA            <53938..>55200
                     /locus_tag="CAGL0M00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449362.1"
                     /db_xref="GeneID:2891280"
     CDS             53938..55200
                     /locus_tag="CAGL0M00396g"
                     /inference="similar to AA sequence:UniProtKB:P47168"
                     /note="similar to uniprot|P47168 Saccharomyces cerevisiae
                     YJR136c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449362.1"
                     /db_xref="GeneID:2891280"
                     /db_xref="GOA:Q6FK82"
                     /db_xref="InterPro:IPR018870"
                     /db_xref="UniProtKB/TrEMBL:Q6FK82"
                     /translation="MKCGNLIIVADGVIDDKDIINLACDEVLDTDDDLIHNDALDWRN
                     IILNLSFRCYSVNDEDYLLAEKSNLVISRYFSRASRDKILEITSFLITKIQPLLINKK
                     NAVIDKQSKGLNPKLGFSFGDDEVYEIWKKNGGIRSIPLCLTILSHLPIDKISTNLWW
                     ISPFILNLLDATSDLQNLRLPGVKLLHVMLEKVFIDQYSNKWLKFKDTGLFQEYERIL
                     INFCFYLPPSYDSQNTLLIWRQVFPAIYSLYKAQYIEDEYQLRLHILKFISEVILQNC
                     LPRCGCKYDQLTSFLIHFMIEMIRTLGEKSTIYIQRVIYDIGQYLIKDPFFTAFDKLI
                     FETIELVEAIIGYCNTTRVLEHKYDILGIILLIYGKLKNEESMSDKIRKQLQHTIKML
                     KDRGCNFSYEIKHLKSVKGIDYTELFAV"
     gene            complement(<55412..>55675)
                     /locus_tag="CAGL0M00418g"
                     /db_xref="GeneID:2891154"
     mRNA            complement(<55412..>55675)
                     /locus_tag="CAGL0M00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449363.1"
                     /db_xref="GeneID:2891154"
     CDS             complement(55412..55675)
                     /locus_tag="CAGL0M00418g"
                     /note="highly similar to uniprot|P57744 Saccharomyces
                     cerevisiae YJR135wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449363.1"
                     /db_xref="GeneID:2891154"
                     /db_xref="GOA:Q6FK81"
                     /db_xref="InterPro:IPR004217"
                     /translation="MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDIC
                     FKKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ"
     gene            <56009..>56707
                     /locus_tag="CAGL0M00440g"
                     /db_xref="GeneID:2891587"
     mRNA            <56009..>56707
                     /locus_tag="CAGL0M00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449364.1"
                     /db_xref="GeneID:2891587"
     CDS             56009..56707
                     /locus_tag="CAGL0M00440g"
                     /inference="similar to AA sequence:UniProtKB:P47167"
                     /note="similar to uniprot|P47167 Saccharomyces cerevisiae
                     YJR135c MCM22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449364.1"
                     /db_xref="GeneID:2891587"
                     /db_xref="GOA:Q6FK80"
                     /db_xref="UniProtKB/TrEMBL:Q6FK80"
                     /translation="MTNKSEIIDEYTAVLEREIENKRYFLKESHDALRDLIESKAERL
                     NGAGSVQGRRSAINKDVWQKFMEKPMYLPERQDPIGLNLVSARLREKTESMGPWLEVE
                     KEIVHVEETYLNSLRQLNAAMQDTIAEFRKNPPKPREELVSKDYSLSSLKTQHESLHK
                     ELKEFVTRYLEPNAPENTSAEEMLQLISTLVQGKTLDKDQFKNSQSLFRLLMKGMLLE
                     NTDTNSYKLIDLVS"
     gene            <57126..>58961
                     /locus_tag="CAGL0M00462g"
                     /db_xref="GeneID:2891588"
     mRNA            <57126..>58961
                     /locus_tag="CAGL0M00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449365.1"
                     /db_xref="GeneID:2891588"
     CDS             57126..58961
                     /locus_tag="CAGL0M00462g"
                     /inference="similar to AA sequence:UniProtKB:P47166"
                     /note="similar to uniprot|P47166 Saccharomyces cerevisiae
                     YJR134c SGM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449365.1"
                     /db_xref="GeneID:2891588"
                     /db_xref="GOA:Q6FK79"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="InterPro:IPR022092"
                     /db_xref="UniProtKB/TrEMBL:Q6FK79"
                     /translation="MNESKRLTLEERLNLAAQKRRKPKKIVPGGNAEDSGLHTNPSSK
                     ESLVEDHEIELNTWIPEDISSISRDDLIKALEPHFIEYKTKQKNASTTTTGDSSVFKL
                     IKGKDEEIAQLTKKLEDRRKQDTANEKLLSKLTADNEKLNKNNDNLSKKLNESNQEIS
                     NLQQKYSLSEKMLEESTKNSHDVQVLESSNKQLRQSIIDKEKTIQDLYAKIEKLEDEI
                     LKGKDTFKIEKENINKANRENITALESQIEQLRIELENCNVITNENEDSQSKYQLIKE
                     QFESSKANWSSIESVLNSKISTLEDTIEKEKDHRANLLTQLETKTQRLLTLEKQQDQE
                     SSENITLKKTCITLESKVATLERDLQNLKDDYNLLESKYNTQRSQYRKSSESRLNNSS
                     RSINEEVSESWNDFGSGLNSLKITESNGALDTLMGQSSNIGDLTASDFTNNHELDPID
                     RDISFEKNLDAIEETSFPEDADELDQRNSRGVSMRRHSTRNSTQMQSNAQLVTKLGHE
                     IGRLETEIQSHREKIERLQKEKQLANDEILKLIDKNNGLSSIKLEKEELEKQVRDLQE
                     KLDTSLQILGEKTERVEELQNDVLDLKDMLHEQVKQMVDLQERLR"
     gene            complement(<59097..>59723)
                     /locus_tag="CAGL0M00484g"
                     /db_xref="GeneID:2891589"
     mRNA            complement(<59097..>59723)
                     /locus_tag="CAGL0M00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449366.1"
                     /db_xref="GeneID:2891589"
     CDS             complement(59097..59723)
                     /locus_tag="CAGL0M00484g"
                     /note="highly similar to uniprot|P47165 Saccharomyces
                     cerevisiae YJR133w XPT1 xanthine phosphoribosyl
                     transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449366.1"
                     /db_xref="GeneID:2891589"
                     /db_xref="GOA:Q6FK78"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6FK78"
                     /translation="MSEEKIYISYNNIHKLCQKIAKQILEREERPDVIIAITGGGMIP
                     ARIIRSFLKVQGQKNIPIQAIGLSLYEDLGLGNTADVIGKEVIRTQWLDFGALDQHFD
                     SLIGKKVLIVDEVDDTRTTLHYAVTELQKEVEEQQKRLNRLNEDTIFSIFVLHNKDKK
                     KRAQLPAEMMDSGRYLAALTVPDKWLCYPWEAQDIEEHTILAKQQGND"
     gene            complement(<60245..>63385)
                     /locus_tag="CAGL0M00506g"
                     /db_xref="GeneID:2891590"
     mRNA            complement(<60245..>63385)
                     /locus_tag="CAGL0M00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449367.1"
                     /db_xref="GeneID:2891590"
     CDS             complement(60245..63385)
                     /locus_tag="CAGL0M00506g"
                     /inference="similar to AA sequence:UniProtKB:P46970"
                     /note="similar to uniprot|P46970 Saccharomyces cerevisiae
                     YJR132w NMD5 NAM7P interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449367.1"
                     /db_xref="GeneID:2891590"
                     /db_xref="GOA:Q6FK77"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FK77"
                     /translation="MDPNTLLQCFAGTLNQDAGIRHAAEEQLKEASKVQGFLGASLEI
                     IASSEVPDNIKLSASLYFKNKITYGWSSNNYSGKNELLMFEVDNDEKPVIMDMLIQTL
                     IACAKQSSNCVRILKPALTVIISAEYPAKKWESLLPKSLELLSSDDINVTHIGLICLS
                     ELFRTYRWKENDSRQDLEMLILQYFPELLKYGKDVLFNEGKNMENPKIGEMLKLILKT
                     YKFVIYHDLPFVLQRPESFIPWAEFLVQIVQQPLPESIKNMDPDLRRTNSWVKCKKWA
                     YANLYRLFQRYASTSLTKKFEYNDFKKIYQEDFLPHFLQLLFQQIEQWNNRQTWLSDE
                     ALYYILNFIEQCVIQKSTWDLVGGYYENILQHIIYPLLRPNEETLEIFETDPQEYIHR
                     NMELWDENYTPDLAALSLLTSAVHKRGKSTRGITLEFVTGNLNRNVGDFNNITLENAV
                     EVESSLRIISSIIDILTSKNSPYAGQLEPFLKNMVLPFFKSPYGFLRSRVCEICSKLG
                     YIDLQDPELNAIIFEGVMTCFNEERDCVPVNLMAALALQAFIQNPFFQEHLSQSVVPT
                     MQKLLMLSNEFEMDTLSGVMQEFVEQFAEQLQPFGVELMKSLVQQFLKLAIDLHEVSN
                     IDPNSFLKADDVPDETDKQMAAIGVLSTTISILLSFENSVDIVKNLEQSFYPAAEFIL
                     NNDMEDFYHEICEFFENSTFLMRTISPIAWKVLELIGECNRREESTVSVYLEDFMLVL
                     NNFLIYGKDELRKNEFYCKILFEVYEKAANREDADLDELQIIFELSQKLTLSLEQKLP
                     DPIRVKFLNDAISAIISEKDSLKKSIVFGVTSFNVIISNMIVTPVIVLNALASQNCIE
                     LFFEVWVSHYIPNYIRTYDIKLSVLALMSILCSVSEEEILKFNLGNLLFQVYPLVLKM
                     MARYPAALKLLEEKRKEFSSLDFNDNEAWDDHFDFNEGGDEDNNEANIEDVIEMLRGD
                     HNDLKFVDGLADGEDFDDLEEDPLAGSILDDINIYELVKSSTSGLEQSNPAKFSTIMN
                     SLSDEDKSMHTQIMNI"
     gene            complement(<63827..>65470)
                     /locus_tag="CAGL0M00528g"
                     /db_xref="GeneID:2891591"
     mRNA            complement(<63827..>65470)
                     /locus_tag="CAGL0M00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449368.1"
                     /db_xref="GeneID:2891591"
     CDS             complement(63827..65470)
                     /locus_tag="CAGL0M00528g"
                     /inference="similar to AA sequence:UniProtKB:P32906"
                     /note="similar to uniprot|P32906 Saccharomyces cerevisiae
                     YJR131w MNS1 alpha1 2-mannosidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449368.1"
                     /db_xref="GeneID:2891591"
                     /db_xref="GOA:Q6FK76"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:Q6FK76"
                     /translation="MAYILSAVVLCVSLALWFYNLQTSGFDGDAAAMRNKVEEVFLES
                     WRDYSQYGWGYDVYSPTSHHRHNMLGEERPMGWIIVDSLDTLMVMYNSSANYKDEFRE
                     HINAATEWIDRELNFDYDNSVSLFETTIRLLGGLLSAYHLSTELDLPQRYSNIYLDKA
                     QDLGRRLAVALEVNKDGVPFQTVNLKHGITAMDGGGYTTTPTAEFTTLQMEFKYLAYL
                     TDNSTLWQLSEKLYAPLYLNNNLMNQFNGLVPILTNSQNGRFSTATIRLGSMGDSFYE
                     YLLKQYQLTGEEIYRQLYLVSLDGIAKHLLGRTTPSNLLFIGEREQGLNGPFSTKMDH
                     LVCFIGGVLGMGATNGLHLEQARKASFWNSERESEWLLAKELTKTCYEMYHQVPTGLA
                     PEIVVFNDGKARPGHDWWKSKKGDFWIKPNDAHNRQRPEAVESIMFLYQLSGNEMYRE
                     WGYEIFQNFIQNTCVDCDDPKSRKYVNLGDVTKPGSLGDNMETFWLSETLKYMYYLFN
                     DNVDLTSMVFTTEAHIFPRLSHATLLKKGFETNWHKSKK"
     gene            <66078..>67787
                     /locus_tag="CAGL0M00550g"
                     /db_xref="GeneID:2891592"
     mRNA            <66078..>67787
                     /locus_tag="CAGL0M00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449369.1"
                     /db_xref="GeneID:2891592"
     CDS             66078..67787
                     /locus_tag="CAGL0M00550g"
                     /inference="similar to AA sequence:UniProtKB:P47164"
                     /note="similar to uniprot|P47164 Saccharomyces cerevisiae
                     YJR130c STR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449369.1"
                     /db_xref="GeneID:2891592"
                     /db_xref="GOA:Q6FK75"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FK75"
                     /translation="MISEILGESIPKNTEHAVSVCLPLWADVVGYEEGDARVLDSLTT
                     GYPRFFIHASVKRLCNLISEQYARAGESCLCFPSYLVAKRCREYITVKSKQLDKDADI
                     GKIRILQLAMPQDDTDHTGIFDCKIAALFFKSELFPLAKQYWQHSGEIVSSRLADYVT
                     ERLYPNAIHIDEATKDNKTFIETRFGRNLDSSFINRAKDILRNRIAHKVVETDHNQDV
                     ATNVFLFPSGMASIFTAHRLLLNYDHIRVSNIKHNGVDKSDDIIGYGEPYLKTVMFGF
                     PYTDTLSILKKFNHTYFLGLGDESAMKDLIGILESGEQILAVFLEAPSNPLLKMCDMS
                     KLKQLSQQYGFFIVVDETVSGFVNIDILSYCDIVCSSLTKIFSGDSNVIAGSLVVNPA
                     SKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKINKIAEDLVSTVLLEE
                     EGQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKREDQAKVFYDNLSLNKG
                     PSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLETLQTIFRKAFDAA
                     KDV"
     gene            <68018..>69001
                     /locus_tag="CAGL0M00572g"
                     /db_xref="GeneID:2891593"
     mRNA            <68018..>69001
                     /locus_tag="CAGL0M00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449370.1"
                     /db_xref="GeneID:2891593"
     CDS             68018..69001
                     /locus_tag="CAGL0M00572g"
                     /inference="similar to AA sequence:UniProtKB:P47163"
                     /note="similar to uniprot|P47163 Saccharomyces cerevisiae
                     YJR129c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449370.1"
                     /db_xref="GeneID:2891593"
                     /db_xref="GOA:Q6FK74"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FK74"
                     /translation="MDKSGELLLRRCPVERLVDELQEGKLLRLCDEENGFRKVLMEEV
                     KPVNNNYCKKVLREIVDRLDRTAGQLPEDVYESWEWAYEVYFDMLNDVQDELAMDEAD
                     NDVIMYKFSEQYKVNIAETPRTIANGSTGNRTWEAAVYLGLYLIDQCASNVVAAPSRI
                     LELGSGTGLVSLLYQQLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWG
                     PRDANSGDNQWDYDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEAT
                     TALFEKYMREYKLQYEVITETTDEDFERLEEITFTRPIAPIRIYRINNAKI"
     gene            <70659..>73721
                     /locus_tag="CAGL0M00594g"
                     /db_xref="GeneID:2891594"
     mRNA            <70659..>73721
                     /locus_tag="CAGL0M00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449371.1"
                     /db_xref="GeneID:2891594"
     CDS             70659..73721
                     /locus_tag="CAGL0M00594g"
                     /inference="similar to AA sequence:UniProtKB:P46974"
                     /note="similar to uniprot|P46974 Saccharomyces cerevisiae
                     YJR127c ZMS1 or uniprot|Q04545 Saccharomyces cerevisiae
                     YML081w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449371.1"
                     /db_xref="GeneID:2891594"
                     /db_xref="GOA:Q6FK73"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FK73"
                     /translation="MMTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKR
                     HQNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDKTIGRGKWDEKILNT
                     PDVWNNDIVKVKGNKASILPTVDYTMHRQDLVLKSNDGNDSQTGISSQNSITFNNMSV
                     SVGSSGVLEYESTSKRSTPGNHSSDSTPTDSSISRLRTEGSYTNTNNADGTLNPVPYH
                     DLDLSSSSSLSFATPSYQNTRTSNNPVPIGGGTPLDVNWLNSVLESDNKINELASKSL
                     SPSATLGQKSDKHNNIADFKLSLPESKKNRRYSYPNNLNDTTAKQSNDKNYTGSPLNP
                     NGRMHSNGHNNPPSASNATITLNTSAGIENHTINDKDLFRPDLNHNPSLSSLFKTEDP
                     TSSEQPVIDIISQLSSEYTSPNDLSFVNLNQPNLGFFTQEWRDLILQKYSLLDNNFPT
                     IKELNEYIEQYQKEFHPYFAFLHLHSVQPSLSRISLFLSVAAIGAFYSYNSTHSNLLA
                     NLAYGEINQLIKSVKLDSSPLWLVQTMLVLGFYAIFNNDISLVQSASDQFVMIVKIVK
                     SAKINQPLETMVVPPTNLFPNPVTKTLTSDQIDAAYRYFITAQSRIHICHSMLFLSNI
                     FPAMSGLEACFLSSDVLCGVPCPYEDLYTSKSPGEWYNNVLKNSIEIANSSQLVNLSN
                     GMVSFQTCLEYLTTGNHVLYENIKLSLYTLLSLLVSIHEKILLERHKAKTEKDVQYND
                     TQWKLKQGPLIDSVIRKWEILYMKNGGILLPTENNVAKITGSHVMRNNVSFYLFAKLK
                     RCIDLNHVIQKIWMRDWTTMNTALEEVIYDKESLQEATDYAISLLRSWASTFTILDDE
                     SMQAMKTPMFSMACIFSSILIIAEYLRSVERWAKTFNAGDPNAKTMNPTDKILWLKAG
                     RLLKMFQKKLMSSDAKKYSEFAGVQKHEMLDITEVDESVLQRAIGLEAKVDETIQMIL
                     AASLASKALYIGVRVIGDTPIWPISVLFAQGLQSRAVYCVMKDEGVFT"
     gene            <74369..>76687
                     /locus_tag="CAGL0M00616g"
                     /db_xref="GeneID:2891595"
     mRNA            <74369..>76687
                     /locus_tag="CAGL0M00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449372.1"
                     /db_xref="GeneID:2891595"
     CDS             74369..76687
                     /locus_tag="CAGL0M00616g"
                     /inference="similar to AA sequence:UniProtKB:P47161"
                     /note="similar to uniprot|P47161 Saccharomyces cerevisiae
                     YJR126c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449372.1"
                     /db_xref="GeneID:2891595"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6FK72"
                     /translation="MSAIDDSQSDLRPFPVDSNDGSSQPDGYGSIEQDERAFRRPRSD
                     TMSTIRSGIEIVRENMDRWKFLYLILASLFIYLSFIAAFAPRTSLARDLRRFHSARMT
                     QSEVYRIFLDTLLYENKAEQHHDAISKTNGTSYIKNYLIDLGFEIKNDSYYAWVNTPV
                     KQQVRVIQDDEVIYQAKLKEDLTGVSHNAFHGYSKDGKLTARFVYCNYCTIEDYTKLV
                     NDKIDIEGKVHICKYGINAPGNKLKNAELYGSTGVLIFTDINEIPNMPVNYGTINSSE
                     TNSYDDAIQRDTVRFGSDIFGDPTTPGYAALYPDTERMNPNDYMPSIPSLPISYRDAS
                     KLLDMLHAKGSFWVSNDGVNSAKLFSGPSDPNTEVQLVNRQEYGVQQIDNIIVEIPGI
                     LSENDILIGAHRDGFPIGNGTSSMSSHSGIAVLLEFARGISKLRKKGWKPLRTIKFVL
                     WDGLHNSQLGSSSFGTRYATSLKRDSLLYVNLDNAIAGQYFNVKANPMLISAITEASK
                     NIDYKKNEDWSLFQEWYNTSNAKVDSLEGVNDYSVFQFYLGIPVVNFSFNSRTSNQPQ
                     FPINTGYDNKEWLIRYVDPEFLLHNTLSRFLGMFVLMVSETELSYYNPHPFFKHLNIQ
                     FDKVKRFAEKTFSRNEKLLYKLDSLGKLIKDIADYDSKYYERRNKEVADGVSSELPIW
                     AFVRKYRVFLSLIRANKKLREIGKVFLTNNGIEGRPLMKSSLFAPNLENSTEIMMFPG
                     LLEATKQKDVQKAMKSLIVLEAQFLNVRYLLL"
     gene            complement(<76881..>78077)
                     /locus_tag="CAGL0M00638g"
                     /db_xref="GeneID:2891596"
     mRNA            complement(<76881..>78077)
                     /locus_tag="CAGL0M00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449373.1"
                     /db_xref="GeneID:2891596"
     CDS             complement(76881..78077)
                     /locus_tag="CAGL0M00638g"
                     /inference="similar to AA sequence:UniProtKB:Q06205"
                     /note="similar to uniprot|Q06205 Saccharomyces cerevisiae
                     YLR449w FPR4 or uniprot|P38911 Saccharomyces cerevisiae
                     YML074c NPI46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449373.1"
                     /db_xref="GeneID:2891596"
                     /db_xref="GOA:Q6FK71"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="InterPro:IPR026257"
                     /translation="MSDMLPLAMYALNVEPYTHTPAVLLDTPVTVRITMAAIDPEPFD
                     EDKKPSTLRIIRRNPVYLDAGEVDEEKLIEELEGDEAAEDGDEASDDDKEEEDEDEDV
                     DEDDEDDDEDDDGEDEYEECVVVTLSPETRCQQAIDITIAPEEDVQFLVTGSYTISLT
                     GNYVKHPFDEPLEDLYSDEDSEEYSDDELDQEIEEDDELDHDEASSEESDEDQEFYDA
                     ISEGDEDIDEQLAKLEETSDVEAHLEDLIAKDNKKKRKQEQLDEQPETKKSKKTKDEK
                     NTKATENEKKNKAQVLEGGVIIEDRKIGEGPKAKKGSKVGMRYIGKLKNGKVFDKNTS
                     GKPFYFKLHRGEVIKGWDIGVTGMAIGGERRIVIPAPYAYGKQTLPGIPANSELTFDV
                     KLVSLK"
     gene            <78392..>79429
                     /locus_tag="CAGL0M00660g"
                     /db_xref="GeneID:2891597"
     mRNA            <78392..>79429
                     /locus_tag="CAGL0M00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449374.1"
                     /db_xref="GeneID:2891597"
     CDS             78392..79429
                     /locus_tag="CAGL0M00660g"
                     /note="highly similar to uniprot|P32366 Saccharomyces
                     cerevisiae YLR447c VMA6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449374.1"
                     /db_xref="GeneID:2891597"
                     /db_xref="GOA:Q6FK70"
                     /db_xref="InterPro:IPR002843"
                     /db_xref="InterPro:IPR016727"
                     /db_xref="UniProtKB/TrEMBL:Q6FK70"
                     /translation="MEGLYFNVDNGFLEGLIRGYRNGLLTNNQYINLTQCDNLDDLKL
                     QLSSTDYGNFLSQVSNDALTTSVMQEKASEKLYKEFGYIRDQSSGLTRKFIDYITYSY
                     MIDNVALMITGTIHERDKSEILSRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAP
                     FFRDCFDAADELDDLNIEIIRNKLYKAYLEDFYKFVSEEIDEPSREIMQTLLGFEADR
                     RSINIALNSLQSPDLDPALKKQLLPEIGKLYPVATEQLANAKDFESIRAVLGQVPDYR
                     NALESGSLEDHFYKLEMDLCRDAFTQQFTISTIWAWMKSREQEVRNITWIAECIAQNQ
                     RERINNYISVY"
     gene            complement(<79782..>81101)
                     /locus_tag="CAGL0M00682g"
                     /db_xref="GeneID:2891598"
     mRNA            complement(<79782..>81101)
                     /locus_tag="CAGL0M00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449375.1"
                     /db_xref="GeneID:2891598"
     CDS             complement(79782..81101)
                     /locus_tag="CAGL0M00682g"
                     /inference="similar to AA sequence:UniProtKB:Q06204"
                     /note="similar to uniprot|Q06204 Saccharomyces cerevisiae
                     YLR446w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449375.1"
                     /db_xref="GeneID:2891598"
                     /db_xref="GOA:Q6FK69"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="UniProtKB/TrEMBL:Q6FK69"
                     /translation="MRPIGTMTIANPEKILEEVKSQLGVRQSLATITEKFQEELDFML
                     KNCKKSMLPFPQVCCRGWSEYNEPMDMLAIDFGGSVLKFAVINMPQCQMELKYELEIK
                     SKVVDFKFFDNIVEWICNRIPINNERSLPRKFIVAITFSFPVNANNEIVAMGKGFRMS
                     PELKGISILDILKQSFDRLEKEYSSSFTFEISNVINDSLAVHMTSKYLQSDNNDKISL
                     ILGTGVNSCFEVQYEDLPQFKKDILTQFSDDYREKVLINSEMGFLGRYSKSIEFGNFD
                     TNIDDKMPLESITSGKWIPQILHNIIRYYNLLPMVGDEEIKYDGRLICEILSDGECPS
                     EYLLSLWDYEVYQIIRQITKLLINRAAIYLVAAIIAIRKFVSPEIYFTKGGIDIDYVG
                     SFLNYCQYYQERIHLHSKGMVKLQFLNDSNLYGCAITAYSNIFENRI"
     gene            <81930..>82796
                     /locus_tag="CAGL0M00704g"
                     /db_xref="GeneID:2891599"
     mRNA            <81930..>82796
                     /locus_tag="CAGL0M00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449376.1"
                     /db_xref="GeneID:2891599"
     CDS             81930..82796
                     /locus_tag="CAGL0M00704g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449376.1"
                     /db_xref="GeneID:2891599"
                     /db_xref="GOA:Q6FK68"
                     /db_xref="UniProtKB/TrEMBL:Q6FK68"
                     /translation="MQTEVIIRNKVAVYKLIGLCQKYRDDVQNLHKCMLRLNSLFYKM
                     TTEEIESQSKKNNDSSTTLIASATSDKCSNLNYNRCDEGLSACQVSPVENNLDEASPQ
                     DNDLLLRPKTYSAVMLDTAAISDDVRPLMESIRKDTPKKFHFYKNYGFHLGTLQDESR
                     IIAQKLHYELKHISLKIIIPMKLFDKQCTHYLKHCPCGNKIVTPYEVKQVDKFIEYIP
                     KFWHYWFLSYYSIFYRIHFLLYLQSCQLLLQKSRNTVINKSELSSISLLNDYREKAES
                     IVRQMESFNFTS"
     gene            complement(<82968..>83656)
                     /locus_tag="CAGL0M00726g"
                     /db_xref="GeneID:2891600"
     mRNA            complement(join(<82968..83162,83279..>83656))
                     /locus_tag="CAGL0M00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449377.2"
                     /db_xref="GeneID:2891600"
     CDS             complement(join(82968..83162,83279..83656))
                     /locus_tag="CAGL0M00726g"
                     /note="weakly similar to uniprot|Q06201 Saccharomyces
                     cerevisiae YLR445w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449377.2"
                     /db_xref="GeneID:2891600"
                     /db_xref="GOA:Q6FK67"
                     /db_xref="UniProtKB/TrEMBL:Q6FK67"
                     /translation="MGTKQSDTEVEGETIVKQDALTTKHPDVEFHPMLKQTIEMWCKS
                     GIRDTYDNKCFKRDVLSRISEITSIMSQIAEESNGGNSDKCRINDGVYRLDWESVYEV
                     GASIMDQYSATVDELLADLDKLYRKQYLWQDSAVLLDSFKGATIIGRLEKWTKLKEAQ
                     LEYKQNELVRSAGEIKRALKRLSTENVYGS"
     gene            complement(<84109..>85422)
                     /locus_tag="CAGL0M00748g"
                     /db_xref="GeneID:2891601"
     mRNA            complement(<84109..>85422)
                     /locus_tag="CAGL0M00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449378.1"
                     /db_xref="GeneID:2891601"
     CDS             complement(84109..85422)
                     /locus_tag="CAGL0M00748g"
                     /inference="similar to AA sequence:UniProtKB:Q06200"
                     /note="similar to uniprot|Q06200 Saccharomyces cerevisiae
                     YLR443w ECM7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449378.1"
                     /db_xref="GeneID:2891601"
                     /db_xref="GOA:Q6FK66"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6FK66"
                     /translation="MLHVARLLMRPFTNLNSLEILVQWLRLISSGMVILLSGLVCLAP
                     FTFPKSMYMSKLDAFSADITQGLFDVLRLNMETASLTSINNGVGLTTSELVILTEYTA
                     QQVRSSPQYIVVSLYGRCDCTFTTEQMMDSKGRLYQVQNSTTMCDCIDTGSDYIFDYR
                     EVLSNLGLGIILDYAYSKDGSRMGLSTSYSKYINSLRSRKVTVTNLLYAIFVIELVKF
                     CVTFWYYYIKGRFLNIFLEQFLVHTLSIFSLTVFICGLTSVISLAWLNYTVQARIKSE
                     LQSFGFSYHLGASWFTCLWMLAFFVSLSCFVWSGLEWCIAENYDPRTSDLKDGFLDRA
                     EESQYENPFDDENVITGEDSNSASSRSGGKLSSSHTEDTGIHGSTSYNNMTRLDSSRI
                     IKNFKNKQFDDTEEQFELQSITLRSSTDSDSSIQRVIQPSSTMHF"
     gene            <86290..>89556
                     /locus_tag="CAGL0M00770g"
                     /db_xref="GeneID:2891602"
     mRNA            <86290..>89556
                     /locus_tag="CAGL0M00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449379.1"
                     /db_xref="GeneID:2891602"
     CDS             86290..89556
                     /locus_tag="CAGL0M00770g"
                     /note="weakly similar to uniprot|P06701 Saccharomyces
                     cerevisiae YLR442c SIR3 silencing regulatory and
                     DNA-repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449379.1"
                     /db_xref="GeneID:2891602"
                     /db_xref="GOA:Q6FK65"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="UniProtKB/TrEMBL:Q6FK65"
                     /translation="MAELIKDLEGWQIIIKDQDGNVMDERDRKVRRKRNVSTDLFIFR
                     EKDALTFGRGQNVVVHDEVSDSYAVYLIHEIRQNTLNHALEILCFTYLRWFELEPRDY
                     YKEFKPEYLSMTNQQITEKFLEEIDRDEIYLTAEITPIWLKDFIDIAEVYNAKKWAQV
                     RQSVNKERNFLVRYVCEPVAENFVPVDIDNIMDQMRKRSARDFETMLKNLTVNGFVHS
                     SSKKRQKIKAEDTDNTVTKKNLLHNQKQKEPESHELKYQKVQLEDSPQPHHKKPQSRI
                     DDHYSVVSDMPHGRIVNTGVKPTTKKSSTSSQTQTDHTQKRKLQSDGGKSGPSNMKST
                     VGNGSSNDNIQKKRKTEDSSKTPSNLHTTMTGVSRSTGVTSDAGKVVDKEIIKNPTSV
                     PSQGGNRTKGNDMSKKEPYSKAIAAANQLKAGRTNQKSNQTAKKPSTTSSNEREEKIP
                     AYLSGRFQPSEVIDSVQSGTLNDLMTQVRKRGGVSEALKYKAKNHVDGTGQDLYATAK
                     SFTSNLRRTLLGSENSAQSQQQNASDIEKRKPYNVIDDFKNNSSAKILEHVKRGNTVS
                     ELLCHQPIDKTPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKNSGSIFEK
                     LRKCTTSESLIQCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRNKSLYLTGDDEY
                     TIKYVFNKVAHELLLSATFEEIPQFKLASVPSSYDNFYQGLWQNISGDILSDTEAAIA
                     LDSYFSVMQPVQRFPILIYIENMDEFFNNSETIYKDLINWFLNPLSKITLICNGTVVN
                     NEIGNPLKDIFLHVNFPSVSEEQDCSVANISKVINQINSSYFYFNADLQAATFCEFYK
                     HYTKNWQKINFRINEPEVGISVKNIQNALTLKGFDSIINVHKHIYQCLRNVVNRYIDS
                     TAKKTTVDIQANQLSVSAGSANTHYDLMEPLYGRIMSSLAELTFVDKLVLFCTVLCRL
                     RKSSVEKIDLNEVYNVIVDVLHHNCDNSPMISNLLLTYSTIKNRNDKGSAIKLFLSSL
                     MWLDVFTRLYRTGFVTLHVDQEDRNQIKVALAGFEVDSILAELKRDSSMSWIQSCLTE
                     "
     gene            complement(<90755..>91057)
                     /locus_tag="CAGL0M00792g"
                     /db_xref="GeneID:2891603"
     mRNA            complement(<90755..>91057)
                     /locus_tag="CAGL0M00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449380.1"
                     /db_xref="GeneID:2891603"
     CDS             complement(90755..91057)
                     /locus_tag="CAGL0M00792g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449380.1"
                     /db_xref="GeneID:2891603"
                     /db_xref="GOA:Q6FK64"
                     /db_xref="UniProtKB/TrEMBL:Q6FK64"
                     /translation="MSSQAFALCRKRFFHCLSQLRCTIFQNLTACGSVGPRRSSGNPG
                     SLPSWDGHCSQWLPQDHRWGPLPSEPKTMPRFEPNLSLTSAWPQPKLSPGSKVRLQ"
     gene            <91268..>92035
                     /locus_tag="CAGL0M00814g"
                     /db_xref="GeneID:2891604"
     mRNA            <91268..>92035
                     /locus_tag="CAGL0M00814g"
                     /product="40S ribosomal protein S1"
                     /transcript_id="XM_449381.1"
                     /db_xref="GeneID:2891604"
     CDS             91268..92035
                     /locus_tag="CAGL0M00814g"
                     /note="highly similar to uniprot|P33442 Saccharomyces
                     cerevisiae YLR441c RP10A or uniprot|P23248 Saccharomyces
                     cerevisiae YML063w RP10B"
                     /codon_start=1
                     /product="40S ribosomal protein S1"
                     /protein_id="XP_449381.1"
                     /db_xref="GeneID:2891604"
                     /db_xref="GOA:Q6FK63"
                     /db_xref="InterPro:IPR001593"
                     /db_xref="InterPro:IPR018281"
                     /db_xref="InterPro:IPR027500"
                     /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVG
                     KTLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDDVQGKNLLTNFHG
                     MDFTADKLRSMVRKWQTLIEANVTVKTSDEYIIRVFAIAFTRKQSNQVKRTAYAQSSH
                     IRAIRKVISDILTREVSNSTLAQFTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLL
                     KQPKFDLGSLMALHGEGSAEEKGKKVSGFKDEVLETV"
     gene            <93206..>95191
                     /locus_tag="CAGL0M00836g"
                     /db_xref="GeneID:2891605"
     mRNA            <93206..>95191
                     /locus_tag="CAGL0M00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449382.1"
                     /db_xref="GeneID:2891605"
     CDS             93206..95191
                     /locus_tag="CAGL0M00836g"
                     /inference="similar to AA sequence:UniProtKB:Q12745"
                     /note="similar to uniprot|Q12745 Saccharomyces cerevisiae
                     YLR440c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449382.1"
                     /db_xref="GeneID:2891605"
                     /db_xref="GOA:Q6FK62"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="UniProtKB/TrEMBL:Q6FK62"
                     /translation="MIEKKLAILASVYCSKADIKQLKRIIPYFKNQKALIFQFVQALW
                     PELQDPLDLKFLFDVDTFNGDEDHAANSLNDILVQCLEQDSSLIPLVETNPDVVLERY
                     DQLIKYVTRDSQIDFNIPPSHSSWIKNRIIHCNNYDKNLILYYQPLWSQLELTSEFNE
                     WVNGVLLPLNNIPANNRIHIEELIKMDSAKRITFLLGCMPSSTSDLGFFSNIFLPMLR
                     YYKETDLDYYTSHYVNPQTYKLENNNEITILSKIYEISGSVEVGAKVLGILYENGQNY
                     FKSHPNKFTDSELRVLLTKIGTEDSSLHLKLLDLIRDIDDLEHFNSFKTLFDIQEGTE
                     AQQYDLFTIYSRSFRIDNISELEKDFLFNKLSLRQKLEIIIESLIEKNNLSEVKKLLD
                     EDPTPENNELLIKNFWKFFYRSENIHDEAFKIAETILSMIPSNFNGSAKRHQLEYLLK
                     NSRDLSQHSINLHPHGFKPNYLLNYKDEPMAIISNLLELNPKLYKMTDKTQDILSNLN
                     SCFDKKTTEVAKSKLLALHIDHALVNRDFMFAYQLCKEWFAICKDAGNDEGIGKQWLT
                     IFQVGKFIDPEWPDNEAPTEILILQMEILSELLQYSPIDQIEIIATQWSALEVELSIR
                     DLSTDTSISNDSNSLQFIQNSLNEVSHTMAAFLGRNR"
     gene            complement(<95426..>96373)
                     /locus_tag="CAGL0M00858g"
                     /db_xref="GeneID:2891606"
     mRNA            complement(<95426..>96373)
                     /locus_tag="CAGL0M00858g"
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /transcript_id="XM_449383.1"
                     /db_xref="GeneID:2891606"
     CDS             complement(95426..96373)
                     /locus_tag="CAGL0M00858g"
                     /inference="similar to AA sequence:UniProtKB:P36517"
                     /note="similar to uniprot|P36517 Saccharomyces cerevisiae
                     YLR439w MRPL4"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL4"
                     /protein_id="XP_449383.1"
                     /db_xref="GeneID:2891606"
                     /db_xref="GOA:Q6FK61"
                     /db_xref="InterPro:IPR010729"
                     /translation="MLRRQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHS
                     NELRIQPPIPPSTKNIVVPDDHPLWQFFSDKKFMRRPEDLDTTSRAWSIPELRRKSFE
                     DLHSLWYTCLKERNILARENHLLKNAAKNNRNDYEDISEKIRTTMWRIRHVLSERDWA
                     FKRARETFAQNKELQDNLVDDFKKEFLELDSSEDEQAFEMLTRFQEALFGIHEVIEDN
                     VVDRKFVDGLKLVATLKLQRFQSRNDSINAILEESDGQINDVGEAFVVFTADNNLKAV
                     EEACDAIKELRQGENGVSRFDELPTVRGYLKRLVSATTV"
     gene            <96799..>97056
                     /locus_tag="CAGL0M00874g"
                     /db_xref="GeneID:9488055"
     mRNA            <96799..>97056
                     /locus_tag="CAGL0M00874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999553.1"
                     /db_xref="GeneID:9488055"
     CDS             96799..97056
                     /locus_tag="CAGL0M00874g"
                     /note="highly similar to uniprot|P57743 Saccharomyces
                     cerevisiae YLR438ca LSM3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999599.1"
                     /db_xref="GeneID:9488055"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:B4UN56"
                     /translation="MSLSTPLDLLKLNLDERVYVKLRGARAMEGVLQAFDSHCNIVLS
                     DAVETIYELVDGELKSQERASEMIFVRGDSVTLITAVSEEE"
     gene            complement(<97304..>98599)
                     /locus_tag="CAGL0M00880g"
                     /db_xref="GeneID:2891607"
     mRNA            complement(<97304..>98599)
                     /locus_tag="CAGL0M00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449384.1"
                     /db_xref="GeneID:2891607"
     CDS             complement(97304..98599)
                     /locus_tag="CAGL0M00880g"
                     /note="highly similar to uniprot|P07991 Saccharomyces
                     cerevisiae YLR438w CAR2 ornithine aminotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449384.1"
                     /db_xref="GeneID:2891607"
                     /db_xref="GOA:Q6FK60"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6FK60"
                     /translation="MNFNISSKETVELEQKYSAHNYHPLPVVFHKASGAHVWDPEGKE
                     YLDFLSAYSAVNQGHCHPKIVKALVDQASTLTLSSRAFSNDVFAVFAKYVTEYFGYEM
                     VLPMNTGAEAVETALKLARRWGYEVKKIPDNEAIVLGAQGNFHGRTFGAISLSTDEED
                     SRKHFGPFLTNTTAKNPSKGQAIRYGHIEDLEQAFESHGDKIAAVILEPIQGEAGIVV
                     PPKGYLLDVQNLCKKYNSLFICDEIQTGIGRTGKLLCFEHTEGVKPDVVLLGKAISGG
                     VLPVSCVLSSREIMSCFTPGSHGSTFGGNPMASRVAIAALDVIKEEKLVERAQKLGDL
                     LQDELRKLQAQSDGMISEVRGVGLLTAIVIDSQKAQGRTAWDLCLLMKDKGVLAKPTH
                     DHIIRLAPPLVISEEDLLKGVQAMKEALVELPSAPISGH"
     gene            <99946..>100296
                     /locus_tag="CAGL0M00902g"
                     /db_xref="GeneID:2891608"
     mRNA            <99946..>100296
                     /locus_tag="CAGL0M00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449385.1"
                     /db_xref="GeneID:2891608"
     CDS             99946..100296
                     /locus_tag="CAGL0M00902g"
                     /note="weakly similar to uniprot|O13577 Saccharomyces
                     cerevisiae YLR437c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449385.1"
                     /db_xref="GeneID:2891608"
                     /db_xref="GOA:Q6FK59"
                     /db_xref="InterPro:IPR013900"
                     /translation="MDNKRHQTSIGSELSEAQNRLSTVGMRIRQRIDRGYAYSGKNVS
                     GMDDQVPIRDVASTIVPQFRTQVLYEQQQQPQQMHRPAMNGPAPMLVNQRTESSNLDC
                     MQEEMLSNGKRRVF"
     gene            <102735..>106646
                     /locus_tag="CAGL0M00924g"
                     /db_xref="GeneID:2891155"
     mRNA            <102735..>106646
                     /locus_tag="CAGL0M00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449386.1"
                     /db_xref="GeneID:2891155"
     CDS             102735..106646
                     /locus_tag="CAGL0M00924g"
                     /inference="similar to AA sequence:UniProtKB:Q06673"
                     /note="similar to uniprot|Q06673 Saccharomyces cerevisiae
                     YLR436c ECM30 involved in cell wall biogenesis and
                     architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449386.1"
                     /db_xref="GeneID:2891155"
                     /db_xref="GOA:Q6FK58"
                     /db_xref="UniProtKB/TrEMBL:Q6FK58"
                     /translation="MGNTDSKLNSLYKEHLLKLARPEITSIDNSQNGVICLFNPEYSL
                     REIIDLYNNRGNITPDKSLKHTSDNHSTSIEDNLFTDYYKNFLKFDFQKIDNFNDLIS
                     KDELRTIYKNNKENYLNLIRFVILKIILIPSIFGNTQNKSSFNKLFKQLLTCIKILTK
                     LVPVYLENIVNGEKDILWDTSPDALFGEHIPDTDLIPVSMTSALKTSLDMPTADLASP
                     HMERPLGAALLDSCLNLLFIEDFTVSSSSDTSQKTGDLTMILWENGINTYDTSYYTQF
                     VHLDANRLQIIELLLALVSIDIYLPVNSDGFKAKDKIKNKYLDYMKYEAREHSVICLT
                     ASIINLFCRHSAYYKQEGTNPYKIIPKENSRENPKYSNRNSFDTNPGSSNNINSQWLP
                     ELRSKLVISSLQFLNVMICPEESNTKVTKKRMVNTAVSYLATLQREFDLKLILTSVIR
                     IFKLPIDAAIDEDSNLFTFPTASSRKKHQNLSNHSRTSSSSNIKRSTSNSSATSRYDS
                     NPNTVTGSPKLANMRENNTSSYSSLPPLPPILCQSLVFLINVIKINKLVKNQFADKFA
                     SKFVVFAVYYLKYYNDNPEYSLTVIPVINMLALYLTSKPLVLLKMLDPFNSNYYTNKI
                     PNAFKLTSGNINNLTYRDFTVIQLCNIADYEVKNNIQPNPIIYETLYNLIPIDPKWLA
                     SDTSGADDEELTLLSRKKSINSSGNGLKSCERLSYNASLAVLHLISKMSSRNYLTTYS
                     TPRIASMVTSIPAYVLSPGFKLDLLAILLRAVSLYVVSNTDEAMNLIFAFARHKSVIL
                     QLSEVMNSIAKNFSPTNTQISTTDKNIRLRDFYRLHDLSYNNINFRKAFNNDEGFHRS
                     SSPNLIKSNNGKNNDNNDSDNDSMDMNSSAYLVLTKPIAREYSSDDLRNNNLTTREHA
                     GSNNNNNINSSNDKTLQVLEYVDFINDPIISLANESDYFKMRPKWPVGISMKSKVKSS
                     MKKDFVRSWQGNDSMVLLVKIVKVLLYDFPEIATINNSEYYVLLKKMEESKDHFLSMI
                     KDNIPIYMRTGSSIQHQKLSIDDESKFSTIWFYTLCWSDIFNTHSSPYNKSLINELEE
                     VEETNDIIPTISNNGSNIFADPGSPVLERWNSNSSNLSRTNSNSSSLMGYFFQQPQSA
                     SSNRSSVDHTSRFIESKNASAPTKKASAPQNSSFSLFKFSWTGFNKNGNSDDCDVIKE
                     EEETTVSQTSTRNGVNQQIFVSALDMSLLKSNIWVDTKVRMFIVEREEKEEFSLLDMT
                     STFFKKLKFNNSAAMSNWESNNIPGSTPLASVPFAARNPMF"
     gene            complement(<106985..>107617)
                     /locus_tag="CAGL0M00946g"
                     /db_xref="GeneID:2891156"
     mRNA            complement(<106985..>107617)
                     /locus_tag="CAGL0M00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449387.1"
                     /db_xref="GeneID:2891156"
     CDS             complement(106985..107617)
                     /locus_tag="CAGL0M00946g"
                     /inference="similar to AA sequence:UniProtKB:Q06672"
                     /note="similar to uniprot|Q06672 Saccharomyces cerevisiae
                     YLR435w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449387.1"
                     /db_xref="GeneID:2891156"
                     /db_xref="GOA:Q6FK57"
                     /db_xref="InterPro:IPR019398"
                     /db_xref="UniProtKB/TrEMBL:Q6FK57"
                     /translation="MEFDETVYVEAPQGQGNLMFSDEKQQARFELGCSMMVYKWDALD
                     IAVDNQWGGPESAEKRDWITGIIVDLFKNEKIVDAALLEETLLYAMVDEFDTNVEDDS
                     ALPIATGIIQVYKDCAAQNYQIVEQLYLEWQSKEKNKPQRVIKVTGDDESSSDEDDED
                     EEYMNGATGEDTHMHYEEIDVDMENDKSRSEPIVDDDGFELVQKKGKRRN"
     gene            <107989..>109311
                     /locus_tag="CAGL0M00968g"
                     /db_xref="GeneID:2891157"
     mRNA            <107989..>109311
                     /locus_tag="CAGL0M00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449388.1"
                     /db_xref="GeneID:2891157"
     CDS             107989..109311
                     /locus_tag="CAGL0M00968g"
                     /inference="similar to AA sequence:UniProtKB:Q06671"
                     /note="similar to uniprot|Q06671 Saccharomyces cerevisiae
                     YLR431c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449388.1"
                     /db_xref="GeneID:2891157"
                     /db_xref="GOA:Q6FK56"
                     /translation="MLNDILVEVAEKTQLLESLIIPHERALTESDYSDQLENIRAEIS
                     ATLNSLSNLNDLLISHDGPLRTEISSLMASKSKLKKINMKELTLLNEQETLETLRNDS
                     SNLESSRPGFTTQQQQSITIASSYRHELQKYLDLVDVEKTSLNTNKLADNSKISKEDV
                     ENSDFNFNLKRYEKQQSILHSALTVNEIEIKKLETLLKEFRKDNNFIRDELKLINSNL
                     KSHEDLISDELKQIDESRYAIMQSIGYSGRNEQQSSILDSIVKLSIKKPDIRTLIQER
                     IEEYSNLLNFIDMKLNGLDQMLQEYKSRKSEWAEKSILWSQCLALISELEVTVRDQLS
                     SAHTVGSEISPDQIKAQIKKFLTKLNKLLDESDLEDVVYSLVRNEVNSLNVALDEMNQ
                     MPQIKNDISDRESIHNPSFKLISKSPPKTGFSSENVSYKLNNTNIKKD"
     gene            complement(<109609..>115548)
                     /locus_tag="CAGL0M00990g"
                     /db_xref="GeneID:2891158"
     mRNA            complement(<109609..>115548)
                     /locus_tag="CAGL0M00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449389.1"
                     /db_xref="GeneID:2891158"
     CDS             complement(109609..115548)
                     /locus_tag="CAGL0M00990g"
                     /inference="similar to AA sequence:UniProtKB:Q00416"
                     /note="similar to uniprot|Q00416 Saccharomyces cerevisiae
                     YLR430w SEN1 positive effector of tRNA-splicing
                     endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449389.1"
                     /db_xref="GeneID:2891158"
                     /db_xref="InterPro:IPR024481"
                     /db_xref="InterPro:IPR026852"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FK55"
                     /translation="MSLPIAQLYEKAGQFVPLIEKVYNGSNVGISESKLLGDVLHFIA
                     ELKDQHIFCDPQFEPIAVFCLTIFSFNDQSTIDWLKSRFNSILASCNKCVLAFARGKS
                     RMLRHFAIQRNVPHEHVAKFNNLICSWRLDTIRVPIEKLSNLPIGSQVENDFSCAFYE
                     CMTDPNLMRMDRAFRALFDKSFSVLLSSQDSLLNGKTPNDGDILLAGTIFCWCEGNKD
                     ENDWARKVLRNLIQSKTTFNMKTIGDDVLDEIQTHFLFLQNPGNWNEVIVSQFWTRFI
                     PIFTMLDREIIEEYFGIPKNQESLKRSFKYPIESLVKLWCNHMTKLYSDKPVDFLLRA
                     LHMFLDKLGQDFWQLIEPYTFHSILDSLFEQPVFLARLMRLQKEPIIENREELIFSFS
                     GSLTDLLAWTLPFYNALSPSKRIQMVKKVSISFLKIVAHQPNLESISKACLVTSSCTL
                     LSSVLFITDDERAKLYSVNDFENVLLTKVDSRLLLDNSLIQNVLLKSITEPASFYPGL
                     GNSATSVAASTMGVLTTCIDFDLLTLCQRTYKLYFGTAVNEFPLPLSLLENMVGSIQL
                     GSFHNGPLLTKLLLTSLKNVYGIVIITKSNLNTTQHNKTVENVWNLVINLVENFNDLL
                     PNQLMEILGDKDAMVGFWSCIFSSNEKLYQAATNILYNTFDVDGRLEGVQALFKQNVS
                     SHLNSINFILSKLIKCEYFELCPRTVKVLMDIISAFIDPTNGVLSNPEISNSSETKDE
                     MFSFWNLVWSFLDSIYRCTLKWATKYNYSLLENFTKDTLDLSNALVGSFREFKDVLGE
                     NVNLFHVVLKAFKNMLYWLRLSDEILLESCVKLITSTSDLAQERKMKFDDELVELMAK
                     YGSKYRKFSNKLSLQQSNEIISRAQTLNPTLTSKIMDEASAYNKMKEQAKQTIVISDS
                     EETGTGKSPAELKSEYLQRKALGLAAHTKSKVTQSKITSFGTVQAGAALSLKTKPQPK
                     PLSKMEMARRQLLQNRVIHPPSQPAFHTKAPSKSQTAEDDTSSDESDIDMETARELFA
                     VAKSKSKGIETLDISGKPIKINSAAERAKMEEEYMRKRLNVDLNPLYEQLLQWDYTKI
                     SEYPDDKGADAYRDIKDEFKSANDYKNVMKPLLLLESWQGMCSARDRDENTPFSIVIG
                     NRTSISDFYEIYASISKKMLQDSNITESDLIVLAYFPNIAPGQKVRYEEFKKAQFTCL
                     AKVKTLKKTKGGNVDMSLRVHRNHSFAKYLTHRAEINAVKVMQMTTIEREYSTLEALQ
                     YYDLVNQILSAKLSPPSNTFEQQIMKVQQEYFLNESQARAIVNTVISSGFSLIQGPPG
                     TGKTKTILGIVGYFLSLRNATPTGTIQAPTDKKSTTLDQMLKKPKILICAPSNAAVDE
                     ICLRLKSGIKTKGQTVRPAIIRLGRTDVVNAELKDVTLEEIVDKKLGDKSYEFTNNPD
                     IEKKFQSLLSERRQLRDKLNAENGSPDSSMSTNDIANLQMKIRELTKSINELGREKDE
                     MREKNAINYRNRDLDRRNAQAQVLASCDIICSTLSGSAHDVLATLGMKFETVVIDEAC
                     QCTELSAIIPLRYGSKRCIMVGDPNQLPPTVLSGAASNFKYNQSLFVRMEKNSKPFLL
                     DVQYRMHPAISKFPSAEFYDGRLMDGPDMESLNKRIWHEQEPFKPYKFFDITSGQQVQ
                     NVKTMSYTNKEEIEVAIEMVDKLFRLYDNKIDFSNKIGVISPYKEQIQRMRREFMRYF
                     GGSITKFVDFNTIDGFQGQEKEIIIISCVRADDSQSGVGFLKDFRRMNVALTRARTSI
                     WILGHQKSLRKSKLWSHLIDDAEGRGCLQQAYSGFLNSSNSRAQDTLNKYKESKSKEK
                     KKHPIPAAADKKDADISNRNISEATDISDGEDDYDPVTAFKPIEKIAIKRRADNQDKS
                     PFIEKKRIKKPKIQANDENPSGTKKKSSIFGSKENNQVPSKPAVPYIKDKASKKDKKE
                     DKKKSKKSRHISFSDSIETIP"
     gene            116503..116605
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0M01012r"
                     /db_xref="GeneID:2891159"
     tRNA            join(116503..116540,116560..116605)
                     /gene="tRNA-Ser (GCT)"
                     /locus_tag="CAGL0M01012r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2891159"
     gene            <117010..>117579
                     /locus_tag="CAGL0M01056g"
                     /db_xref="GeneID:2891160"
     mRNA            <117010..>117579
                     /locus_tag="CAGL0M01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449390.1"
                     /db_xref="GeneID:2891160"
     CDS             117010..117579
                     /locus_tag="CAGL0M01056g"
                     /note="highly similar to uniprot|Q05498 Saccharomyces
                     cerevisiae YDR339c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449390.1"
                     /db_xref="GeneID:2891160"
                     /db_xref="GOA:F2Z5Y9"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:F2Z5Y9"
                     /translation="MGKAKKTRKFALVKRTLNAKKDQRLKGNQEKQKSQEDPELTRNI
                     PQVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCV
                     IAELEKLGPKYRIALKLARDPRIKRLTCTHKGTYADDCIVNRVLQHKCYIVATNDAGL
                     KQRVRKIPGIPLMSVGGHAYVIEKLPDVF"
     gene            <118018..>120105
                     /locus_tag="CAGL0M01078g"
                     /db_xref="GeneID:2891161"
     mRNA            <118018..>120105
                     /locus_tag="CAGL0M01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449391.1"
                     /db_xref="GeneID:2891161"
     CDS             118018..120105
                     /locus_tag="CAGL0M01078g"
                     /note="highly similar to uniprot|Q05497 Saccharomyces
                     cerevisiae YDR338c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449391.1"
                     /db_xref="GeneID:2891161"
                     /db_xref="GOA:Q6FK53"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6FK53"
                     /translation="MVGILSKTLSEVHPTLLTNGMGITNTHRRISLGFFPPNRKNPLV
                     RKYRRKRANLNTNDQRSFQSLVDDFGSSVHEPSQFLNYINEDEEDLYYNDIEEGGELS
                     RTVSLPSLVSETPDLSPPDTDWIIQEHERRYSSVYNSDNENDLADEPVSIGGSMTNRE
                     LEYDEFMNRIKAQKQVYDSIASHKYRRRPSLISVSSRGTVPTIYQEINGTDGADVCLP
                     EKITFREEAKVLSSFSFPLIFTFLLEQIFPMVCSLTVGHLGKNQLAAVSLASMTSNIT
                     LAVFEGIATSLDTLCPQAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFL
                     VVPEKELIALTSQFLRVLIFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFV
                     SYTLVWNKYIGIGFIGSAVAVVINFWLMFILLLLYTIYIDGKKCWGGFSKKAFTHWKD
                     LGHLAFSGIIMLEAEELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISA
                     STRIANFIGAKRVDLAHNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDL
                     MTGLLRLVAVVQIFDSLNAVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGWVFN
                     MKLYGLWIGIGCAMLLIGLIEAYNVLYPNWDYILNYAEILKETEEDDDDDSYFTDSDD
                     NDEEPTERSPLLD"
     gene            complement(<120294..>121178)
                     /locus_tag="CAGL0M01100g"
                     /db_xref="GeneID:2891162"
     mRNA            complement(<120294..>121178)
                     /locus_tag="CAGL0M01100g"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="XM_449392.1"
                     /db_xref="GeneID:2891162"
     CDS             complement(120294..121178)
                     /locus_tag="CAGL0M01100g"
                     /inference="similar to AA sequence:UniProtKB:P21771"
                     /note="similar to uniprot|P21771 Saccharomyces cerevisiae
                     YDR337w MRPS28"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="XP_449392.1"
                     /db_xref="GeneID:2891162"
                     /db_xref="GOA:Q6FK52"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:Q6FK52"
                     /translation="MVFARTLIRNIEGVGLKVNPLRYYHATPVTQGAKAVKFLKAQKR
                     RQKNEARQASIKSQSEMVDPVLGRKDTPFINRINAEIKEPTVLSSDYNYDEVEKFLVS
                     VEATKQEHRDLSPLNPEFATTETTESLSLRHEALFRILNIRNANRKDTMQIAIRLARE
                     EFQRFPGDTGSSEVQAACLTVRIQNLANHIKNHKKDYANTRMLRMLVQQRQSLLRYLK
                     RDNPERYYWTIEKLGLNDAAITQEFNLDRRYMQDFKFFGDKILVKESKKVAQQIRKDE
                     RKQKKASSSSTVEQQPVL"
     gene            complement(<121796..>122782)
                     /locus_tag="CAGL0M01122g"
                     /db_xref="GeneID:2891163"
     mRNA            complement(<121796..>122782)
                     /locus_tag="CAGL0M01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449393.1"
                     /db_xref="GeneID:2891163"
     CDS             complement(121796..122782)
                     /locus_tag="CAGL0M01122g"
                     /inference="similar to AA sequence:UniProtKB:Q05473"
                     /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
                     YDR336w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449393.1"
                     /db_xref="GeneID:2891163"
                     /db_xref="GOA:Q6FK51"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FK51"
                     /translation="MSSGKISGRNAINIVKNVKVKPTSDSLISGSNKVNVKRSGLLSK
                     PHKKHASSDKSHSWINLNKYMNNSYAYPSASQLNAINHFFNRAECKYEWSVADFGNIP
                     SEQMKSVYGHNSGMNHEGGKLYNGKTRYPFQLLNPLPEIAFLGKTNVGKSTILNNLIT
                     SFKQKDLDVHARMSNRAGFTKTLNCYNVGNKFRIIDTPGYGFHSAIEQGNVTLDYLSN
                     RKELKRCFLLISAKKEISEHDRYLMDLMTESGIPFELIFSKMDKVTDVDEFVQWIDSS
                     GLRNLPTLPKLIFTNSMVSKFIKKRYGVDLLRYSIFEACNLDSSVKPERIKY"
     gene            complement(<123429..>127094)
                     /locus_tag="CAGL0M01144g"
                     /db_xref="GeneID:2891164"
     mRNA            complement(<123429..>127094)
                     /locus_tag="CAGL0M01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449394.1"
                     /db_xref="GeneID:2891164"
     CDS             complement(123429..127094)
                     /locus_tag="CAGL0M01144g"
                     /note="highly similar to uniprot|P52918 Saccharomyces
                     cerevisiae YDR335w MSN5 multicopy supressor of SNF1
                     mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449394.1"
                     /db_xref="GeneID:2891164"
                     /db_xref="GOA:Q6FK50"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FK50"
                     /translation="MNVGANQVVEALNVIYSPKSNNGQRLEAQKFLDSVRTLEESPLW
                     GFEIALNNSDNNILKYFGLNLLEYNIKKNWNSYNNEKRQQLKKWIIELNYNVSTVDTR
                     YIKEKLASLWVEIAKRIWGEALKETNPSNDQLLDSWVDLDRDLHQLWNINESSREVTL
                     IIFRILFEDVFLLDDMTVLKRMTIIQPLCVMIVCPMDIFITKYKFSEKWTLFKADSDG
                     WFSIWIPELRTALLNKNSEYIIRLLETLKTCLNWPLSEVIIKNDILTTLLDCLATDIR
                     KAQSMALDSIHILLTRPYGNDEHYQTIIDKVFDSMDLLARVYEDLLFNPEEEVDETRY
                     PIVKKFVDMTSCLYVSIPKIKDTNNQIEKYFKLVMQTTYNPSLIVSGLTLDLWCSCLR
                     NDDYIPLIQKYAIKDLLNFAADALVYYEQIDGHISRNYVDIDFQSNSEFQSYCSTYRK
                     RIRDIIRLISCVEIDMTYEWLNNRLNVYFSSPAGQQVLTSSFLDHKSEPYLGALSQYM
                     IVECFINGCIRWKIWYPSGPDYNQKLDSILQKLEILSNQLIALNMKEPLLLKKQIQNF
                     ALFLTMLRDNVLFTLLEKIITSATMDYPEVNLDDRSEQSDAVRDLRYACGIELNRMAL
                     LMPESLKSIYPDLEAVIAKIMPNLSYHEKISFKSFLLIIVLKSSLDNKEQRFSELVDV
                     ELMAWSEKTTEVGLSDLHWFMERLGIVQIAEYFQKRGINENSDLLTIPIDDEGRALKA
                     ELTKRWQTLFPVRATRMFIHYSMQSIKGDEEFKRLQDLWRPRIIPVLPYILRLLFQLQ
                     SYHDAENWKNLPVIVQTFVKCTTVERFWEAGASSKSKDEFIDEHMKAMQTLRDFADSV
                     GHIIRYTREYTLLVLSAISSLGSIFFELDDVPDMLINSIAIFKPGNNEISPGVSTHGW
                     KHILNIAIRPMLKNCPDDCAPKFMSAFLPKLFEMLDHLLYQRWSVRMDVMDVNPAPVD
                     NDQMTEDILEENLLRQLTTVVVRIVIDCVGQASVSSQSARSNLTSHQLRMRKIIFNDI
                     NILAPFLKLVNHLMAYKDNKCSFNSILVMKGCINEVAAKDETVDVFFTTELMKNLLIN
                     VLCNSAFKDFFNEALYVFTTLFLTLCKESTSARQFFYELSGGYDIDSLHSNLKKVDDY
                     KSQRALMVEFIDWTKMTLGKDDFDEEQAMQENRKQEKREAILQKANERLIKKNKESGD
                     MLDDPNTEDGAVGNLFS"
     gene            <131016..>131990
                     /locus_tag="CAGL0M01166g"
                     /db_xref="GeneID:2891165"
     mRNA            <131016..>131990
                     /locus_tag="CAGL0M01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449395.1"
                     /db_xref="GeneID:2891165"
     CDS             131016..131990
                     /locus_tag="CAGL0M01166g"
                     /note="highly similar to uniprot|P32318 Saccharomyces
                     cerevisiae YGR144w THI4 involved in thiamine biosynthesis
                     and DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449395.1"
                     /db_xref="GeneID:2891165"
                     /db_xref="GOA:Q6FK49"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="InterPro:IPR027495"
                     /db_xref="UniProtKB/TrEMBL:Q6FK49"
                     /translation="MSATATTTTTSQLQLNSTSIEHALSDVVKTDDWSDFQFRPIRES
                     TVSRAMTSRYFKDLDKFAVSDVVIIGCGSSGLSAAYVIAKNRPDLKIAILEANVAPGG
                     GAWLGGQLFSAMIMRKPADLFLKELEIPYEDEGDYVVVKHAALFTSTVLSKVLQFPNV
                     KLFNATAVEDLVTRPAGPNGEVSVAGVVTNWTLVTMAHDLQSCMDPNVIELSGYKEDG
                     TRDPSKKHGVVLSTTGHDGPFGAFSAKRIVSIDKNKKLAGMKGLDMNNAEAGVVKNSG
                     SYNGVGSMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAGEEILKHFAE"
     gene            complement(<132330..>136682)
                     /locus_tag="CAGL0M01188g"
                     /db_xref="GeneID:2891166"
     mRNA            complement(<132330..>136682)
                     /locus_tag="CAGL0M01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449396.1"
                     /db_xref="GeneID:2891166"
     CDS             complement(132330..136682)
                     /locus_tag="CAGL0M01188g"
                     /inference="similar to AA sequence:UniProtKB:Q05471"
                     /note="similar to uniprot|Q05471 Saccharomyces cerevisiae
                     YDR334w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449396.1"
                     /db_xref="GeneID:2891166"
                     /db_xref="GOA:Q6FK48"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSKNNKLNGKDNRQSKIEKLSELKLRHDQLTNELYHLHEYISLV
                     EYDPFYIPNSENYERLLEEKDVTWGSIFQEKKQLHNESSGKKVRRSVRHLRDSGSSTI
                     NELDTMSENDINLLKEVDILAKQKLQDLKLQFSNSHIKKKGNTKRAKIVKQVPNHQDK
                     SESPQISERDVKTVVKDLKPNHRGSEIKPEIMESSDVKNEIENCDFNEKQLKLYKDDD
                     IASESDFYFTTSSEDELPNKRRGTIKRRKRINLYVNPPKAVITNPDNIANSHYPTLHE
                     YLDSFKILEDDMTNEEYNTFIKEQQRFAKMIKKGIETGALKYDPVTETVQPSARKVPN
                     MFSHAKVDPIQYMYKEQNLHIHQEHLINQGLFSSKLVQNRKKQRIAGAKKIAQMIEQH
                     FKHIAGAEDRRLKENEKQRKAIARNIIQSVKKRWNLAEKAYRILKKDEEEQLKRIQGK
                     EHLSKMLEKSSKLLGAQLKQHPNEDDIENSTSDDFSSTGDSDNLSSSSDEESDDEIND
                     LSEDQKNNINELKTSSTSAFSSPEISSPSKNPDLGLNSLLTNDFENESNSSDTNEEFI
                     MGDSDTSHSDDENLTDDSEDSNDGEHDTTSDNEKSDLFPADTTNDPLAVQDVPTPSLL
                     RGTLRTYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWGPHLI
                     VVPTSVLLNWEMEFKRFAPGFKVLTYYGNPQQRKEKRKGWNKPDAFHVCIVSYQLIVQ
                     DQHSFKRKKWQYMVLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSL
                     LYFLMPQTVIDGQKVSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQV
                     LRPYLLRRLKADVEKQIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSI
                     VNCLMQLRKVCNHPDLFEVRPIKTSFLFGESVIARYSERANSITRRIHFHDKDTLVDL
                     QNINLQFTNNDLEKTSYHTNTINKLACINEFVEEVQKLRKQNAEEERQKSRHLKINTQ
                     NISNFYEEFMQQKLDEQENKINFIGYLNSQRCSRKTVYGMNLIRLLEMPHVSNNCIDD
                     PNYDDLIKPLQTRLLDGRTTIEKFAVLTPGAVTSNIGELTLGMDEFVTPNSKSGIIPY
                     EELVQLDNPFHQVQTKLTIAFPDKSLLQYDCGKLQKLAILLQQLKDGGHRALIFTQMT
                     KVLDILEQFLNYHGYLYMRLDGATKIEDRQILTERFNSDPKITVFILSSRSGGLGINL
                     TGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQ
                     LDDVIIQKGEFTTDYFSKLSVKDLFGSDVVGDLPVIDTKPLLGSDSEAIKDPKKLEKL
                     LAQAEDEDDVKAANSALREVNVDDEDFDESSTNKTGGNILNGDDIDEDVDEYEGTNHV
                     EEYMLRFIANGFYF"
     gene            complement(<137725..>138729)
                     /locus_tag="CAGL0M01210g"
                     /db_xref="GeneID:2891167"
     mRNA            complement(<137725..>138729)
                     /locus_tag="CAGL0M01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449397.1"
                     /db_xref="GeneID:2891167"
     CDS             complement(137725..138729)
                     /locus_tag="CAGL0M01210g"
                     /inference="similar to AA sequence:UniProtKB:P38803"
                     /note="similar to uniprot|P38803 Saccharomyces cerevisiae
                     YHR085w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449397.1"
                     /db_xref="GeneID:2891167"
                     /db_xref="GOA:Q6FK47"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /translation="MTKSKKQKQKKKDFLKKKLKVGKPTGKPSNSTDTSFTARTLSVR
                     SQLVNNAGDDLRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLIC
                     DDSKDVREQLLELFDEVGKHDEQVLKLHCRSLVLYINMGMTHILPRVQADSTKFLGCL
                     LKYCGQEFCDQAWNKLMAGIFRVLSWETQHSKNSNQAAGAMQTSKRDNKFQAAHLSTL
                     YALLECGCKEPTVETTDEDTTSNIQNFEEVQYMTPSFPQAYGYLKLFDKQLKSSSSNK
                     DNSSVSSSDALDVESRIRNVENVYLPTMKKQIEQIIQEGGEAGKNANNIKKLISEIFS
                     "
     gene            <139130..>141289
                     /locus_tag="CAGL0M01232g"
                     /db_xref="GeneID:2891168"
     mRNA            <139130..>141289
                     /locus_tag="CAGL0M01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449398.1"
                     /db_xref="GeneID:2891168"
     CDS             139130..141289
                     /locus_tag="CAGL0M01232g"
                     /inference="similar to AA sequence:UniProtKB:Q05468"
                     /note="similar to uniprot|Q05468 Saccharomyces cerevisiae
                     YDR333c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449398.1"
                     /db_xref="GeneID:2891168"
                     /db_xref="GOA:Q6FK46"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:Q6FK46"
                     /translation="MSSRALRKQQNDAELLESILNSNATTKRTTQQQKPKANMATTNI
                     FSLMDDYNSDDSEDVKDDAEEFELHKDVADEENEAIAAPKIQLASKKSRKKANKGRKN
                     KKKDNKPVNEPQSDTKDDIGNDEELDKIIREFQKSYINTTNLHHDDDIDGDEFVTASE
                     SESYDEGTRSSTKKTSNHNLFTDPGFSNFNIRGLKACERFFNTDIRKLDPHTEYKLLF
                     DDISAKSLEDIDSVSSVSISPQQLKQIQRLKRMVKNWGGRDRRTVPNGPGNSPHRLRL
                     TKVRDDWIPTQRGEFKMALMTKSEVMDWQLWMSPLDWKDVVEERVGSLHKFISFYKFE
                     SVTPDITRKSLSEFYVSVILHPDHEALISLISSRYPYLVPGLLQVALIAIRQGDRSNT
                     NGLLQRALFVFDRALKTTVQFDGVKCQLPYIYFMNRQFYLTIFRYIQALGQRGAVGTA
                     SEWTKVLWSLSPLEDPLGCRYFIDHYLLLNEEYQYIIDVAKSPLFTTYKQWYTLGFSL
                     AVTLSLIRLGKLKEARQEIEKNAKINTACLMTLFLEHLKGDVSQVQTTIEPTERDILE
                     FKSYVTRFQHHWKSTEEVNFLHDELSRIFTNSIDLDSDLDNAATNDDVESPFYIDGIP
                     VNLLRFAILSEESSLMAAIPKRIWSNYEIYEFDVLPPIPTTKESRDVIENIKSLINES
                     ELISSQAEALQNEEILRRIQQLSLQEYMEGNPQELDI"
     gene            complement(<141519..>143315)
                     /locus_tag="CAGL0M01254g"
                     /db_xref="GeneID:2891169"
     mRNA            complement(<141519..>143315)
                     /locus_tag="CAGL0M01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449399.1"
                     /db_xref="GeneID:2891169"
     CDS             complement(141519..143315)
                     /locus_tag="CAGL0M01254g"
                     /inference="similar to AA sequence:UniProtKB:P13574"
                     /note="similar to uniprot|P13574 Saccharomyces cerevisiae
                     YHR084w STE12 transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449399.1"
                     /db_xref="GeneID:2891169"
                     /db_xref="GOA:Q6FK45"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:Q6FK45"
                     /translation="MSPFIKGRQRRTEEILKGDLKHHNDDGLVKSVIDDLEDAISAIE
                     DLKFFLATAPLNWHENQVIRRYYLNNSQGFISCVFWNSLYYMTGTDIVKACMYRMEKF
                     GRKVIERKKFEEGLFSDLRNLKCGLDATLEQPKSKFLKFLFRNLCLKTQKKQKVFFWF
                     SIPHDKLFADALERDLKREFNGQNPTTIAIQEPALSFNYDQDSKLSLQEQLSRHISTK
                     KCNTITKSGDKDISKNKITNAVVDNQNEEQKEANDISSLEEVSNSVNIGDPLSRSNHS
                     SSYAYSKFQSCNTSHAQSAISSPLSPTNNLPASMDTDYSSDLKELTSDSPNFDNDDNF
                     MNIKIEYPDENISNGFLATSLNPDQSFLYYDDRNMEIDKNSSIDTNKIVTAQFSPFLV
                     SASLDPQYLLPHVQRTPFQDIKSAAKDGAFTTQKINPSVGNNLHFPYPEVTSPGLVDS
                     ITLSELLDENCNNASFELNNERVKISSQELSIWNMLPHNSTSHMTPVFHSLLSAGIKG
                     THLPAYSPFLTTTPWGSLSSPFSSAKSNKSSQRRQSQFDTRTLGKRRKTKTCSKYSSP
                     NGIARNTKPNKVLKNSINKMIDTLRSNTKNVS"
     gene            complement(<144593..>146641)
                     /locus_tag="CAGL0M01276g"
                     /db_xref="GeneID:2891140"
     mRNA            complement(<144593..>146641)
                     /locus_tag="CAGL0M01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449400.1"
                     /db_xref="GeneID:2891140"
     CDS             complement(144593..146641)
                     /locus_tag="CAGL0M01276g"
                     /inference="similar to AA sequence:UniProtKB:Q06683"
                     /note="similar to uniprot|Q06683 Saccharomyces cerevisiae
                     YDR332w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449400.1"
                     /db_xref="GeneID:2891140"
                     /db_xref="GOA:Q6FK44"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FK44"
                     /translation="MLRILKQSFRNNAPSLKWYSTTATPILRDYQNDAIKSCLDAIAL
                     GKKRIGVSLATGGGKTVIFSSLINLLRQRNRGNACRFRTLILVHRRELAEQAVRTTSR
                     INEDLNIQLEMGNQNCDVSNSDVIVASVQSIIRRLHKYREGDIDLIIIDEAHHAAADS
                     YKKVLKHFRCDTANTRIPVIGFSATFERYDKKSLKESFDELVYHRGIIEMIDDNWLCE
                     SKFTTVRLEVDLSKIPTSTLTSDFQTGALSRLLNTQTVNSIIYNSYLEKRKENNIKSS
                     LLFGVDINHIECLERYFNERGIKAKAVSSKTSVEDRQKAIRDIKSGELEVLLNCGIFT
                     EGTDIPNIDCILLCRPTKSRTLLVQMIGRGLRLHHSKEYCHIIDFVGSTKAGVVSVPS
                     LLGIESCEDTFDNATLEELRKIKLEEETRMAEYQQMQTQAELQKRAHEEMLRNQLNKM
                     EQTLLEVSHGDALDLNLISYANFKEYHEKLQAGIAVDLNKINQIEEELSFIHKSKYAW
                     VRITKNCWAFDLSNGHHIRLYRSSDKPGGTRYTLKLYREIPKLYRDEVNSSIRYVPTI
                     LEKDQDLSQITLKLEQVIKKYEDLGNSNSLGRIIKYARWRSQEASPKQKILVEKIIQK
                     QLTKLKNSNDSMNIDPFSISSYIKNLTKGSASKLLFATSIAPTFPVQGLLKNLKNTSK
                     "
     gene            complement(<147015..>148187)
                     /locus_tag="CAGL0M01298g"
                     /db_xref="GeneID:2891170"
     mRNA            complement(<147015..>148187)
                     /locus_tag="CAGL0M01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449401.1"
                     /db_xref="GeneID:2891170"
     CDS             complement(147015..148187)
                     /locus_tag="CAGL0M01298g"
                     /inference="similar to AA sequence:UniProtKB:P49018"
                     /note="similar to uniprot|P49018 Saccharomyces cerevisiae
                     YDR331w GPI8 essential for GPI anchor attachment"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449401.1"
                     /db_xref="GeneID:2891170"
                     /db_xref="GOA:Q6FK43"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="InterPro:IPR028361"
                     /db_xref="UniProtKB/TrEMBL:Q6FK43"
                     /translation="MRIVLPCLLWLVTLACGVVNAEHTNNWAVLVSTSRFWFNYRHMA
                     NVLSMYRTVRRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGESVEVDY
                     RGYEVTVENFIRLLTDRWTEDQPKSKRLQTDENSNIFIYLTGHGGDDFLKFQDAEEIA
                     SEDIADAFAQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHS
                     DVEIGVAVIDRFTYYSLEFLEQIDKTSNLTLKDLFDSYTFEKVHSHVGVRSDLFKRNV
                     SDVLITDFFANVQNVIPDDNSGKTSGNNEDIIDLAIQKSQLASKKDKSSQTPKPKEPA
                     SSIYFRTASSLNKNITDAKNNSNEGLMTVLLIILVMLGLYTTFKRTSKKETAKFSL"
     gene            complement(<148547..>150079)
                     /locus_tag="CAGL0M01320g"
                     /db_xref="GeneID:2891171"
     mRNA            complement(<148547..>150079)
                     /locus_tag="CAGL0M01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449402.1"
                     /db_xref="GeneID:2891171"
     CDS             complement(148547..150079)
                     /locus_tag="CAGL0M01320g"
                     /inference="similar to AA sequence:UniProtKB:Q06682"
                     /note="similar to uniprot|Q06682 Saccharomyces cerevisiae
                     YDR330w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449402.1"
                     /db_xref="GeneID:2891171"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FK42"
                     /translation="MEEDKINNFLVITAVEDADVARQFLDMAGGDVDTAISLYFEHGV
                     SGLPSGGADAGAGTSGASSSVAHAESDSALAERLQQEAYQEPQTDVRPPDEARHETLA
                     ETHVFPTTYGGIGGSFGSLRHHSGNVAQDMFDNSTPQGIFNQRMDFDYSDDSSSEGSS
                     SSSLSEFNSNSDDDDEYEYVEEDVVEVDDDGNITERKELVRRLKNPITKEARLAMLFR
                     PPFDIMSKVNLDRAKLKARKKKRWIMINIQDSGVFQCQALNRDIWSNKRVKRLIKKNF
                     IFLQYQFESRNAEPYVHFYGLKSKEELPHIAILDPLTGERLKQWDSTVPRLESFLDEV
                     EKFLKDFSLEPGSKNPLIKQPTPDLDPTTLSEEQQMELAIRQSLGAGEQEVSPSNNER
                     NTDEVSETEIADAKEEEKPSTGSLFDQIEPINHEEPQNEPGKTTRIQIRTGDGRRMVR
                     RFNLTDTVRNIYEVIKAKLDGFADCQFILSNHQRENLIEKLSLTIAEAELGNSSLLVE
                     KE"
     gene            <150584..>152002
                     /locus_tag="CAGL0M01342g"
                     /db_xref="GeneID:2891172"
     mRNA            <150584..>152002
                     /locus_tag="CAGL0M01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449403.1"
                     /db_xref="GeneID:2891172"
     CDS             150584..152002
                     /locus_tag="CAGL0M01342g"
                     /inference="similar to AA sequence:UniProtKB:P28795"
                     /note="similar to uniprot|P28795 Saccharomyces cerevisiae
                     YDR329c PAS3 peroxisomal assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449403.1"
                     /db_xref="GeneID:2891172"
                     /db_xref="GOA:Q6FK41"
                     /db_xref="InterPro:IPR006966"
                     /db_xref="UniProtKB/TrEMBL:Q6FK41"
                     /translation="MVQGRAPVSRRVQRYRGGLFIAAASVGTLVAVGSLAVYIVKQWL
                     YRQQLRIAEEHFVKEQIKRRFDQTQSDSLATLYELVQVSSMVYDQKDLNLDEIMLALR
                     DKKLQKQSQTGSAARAADTTSNSSVTGVTSALNDKVSEKASSIRSSKTDDIRNMTKGE
                     LWNQLKIRSISKLVTVTYTTSCLLLMTRLQLNILTRKEYLETVVKTTMQKNNDAGNSS
                     GFFSWVASKIWGSPSNGEEKRKSAQDMYGELVQAEKAGKHMSKGKVEYINEQAFLSIF
                     WWLINRGWSKIHEIVEREVRSEFGHLDPKDALTIDDFSERLTKVYYRVNKTLFLVNEE
                     KEKPLLDIMIPRTPQELKNVLEQAMDLESLQLLEQDDSILRQLCKEMEKYMKSEATSI
                     VMEQAINESFDYAITEIDASIKKRNQEETQMALFALSCKECCDKMLKTNMMTMDNDYL
                     TVLDGIAVLDDLSAMVYSNFGL"
     gene            <153430..>153969
                     /locus_tag="CAGL0M01364g"
                     /db_xref="GeneID:2891173"
     mRNA            <153430..>153969
                     /locus_tag="CAGL0M01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449404.1"
                     /db_xref="GeneID:2891173"
     CDS             153430..153969
                     /locus_tag="CAGL0M01364g"
                     /note="highly similar to uniprot|P52286 Saccharomyces
                     cerevisiae YDR328c SKP1 kinetochore protein complex CBF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449404.1"
                     /db_xref="GeneID:2891173"
                     /db_xref="GOA:F2Z631"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="InterPro:IPR016897"
                     /db_xref="UniProtKB/TrEMBL:F2Z631"
                     /translation="MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLD
                     DEDEEQDEDEDEDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVD
                     AWDREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVND
                     FTPEEEAAIRRENEWAEDR"
     gene            <155052..>159335
                     /locus_tag="CAGL0M01386g"
                     /db_xref="GeneID:2891174"
     mRNA            <155052..>159335
                     /locus_tag="CAGL0M01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449405.1"
                     /db_xref="GeneID:2891174"
     CDS             155052..159335
                     /locus_tag="CAGL0M01386g"
                     /inference="similar to AA sequence:UniProtKB:Q06681"
                     /note="similar to uniprot|Q06681 Saccharomyces cerevisiae
                     YDR326c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449405.1"
                     /db_xref="GeneID:2891174"
                     /db_xref="GOA:Q6FK39"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:Q6FK39"
                     /translation="MVDKKKKRSFSETGIFKLFKSKSRSKSSKSKSNLKGKNGHSSQR
                     NSRSKHKERTLSRPSVSDRKRLETESGDRTVSESHLLSSKLRKLGNHNHNHIHNNGNI
                     EYPEIRSIRSGGSRSFNDRYNDYNDYDDDDDDDDNNDNGNRDGLDNGHTDTMSDATED
                     GIDISFKPRRSLQNSTAGLNRINTLQGYFNIPVTIDSHHTNSHNNNSGTRTNPISRKT
                     SEFFNSKNPSKTGTQSNLQETNHTQGILDTIVSFAQNAVGRVPKIVVNDPSAEEIVDS
                     GDKDKTTATNTLKANIPGITSNISSLSSVTTNRNGTSTSGRIPLKTEDDLLNGGEQHN
                     DTVLHSPLNEENRSSSFLKHLDYLLSPRTSDPLKEKSTPLADLAVDNKSENSVPKHDA
                     KLPVANKEQQRYSYNTVEEENKTMNSQGTNYTDKGLDPTKIKFQSHVGNHEPAIATFG
                     RGNLTLDVLIDHSNSDETIDNSESRVSFKNNNPNHPGMPIFNENYRNSSYIDVQRHLG
                     LNKGNEIGRGRSRTLPTNDASAVLDQKIEGDSKRNSRITTLSNDEIVGDNDRKPRSLS
                     RKFLNRRSFSPSIGSKVLPSMAFRNSMNKTRNSNDKMDTSKPRSSGVFSATVNSTQDT
                     EYTKPFSLVGIEYSSEKKNIEFHNIFKDAGVTPQERLILDHSCALSRDILLQGRMYIS
                     DQHIGFNSNILGFVSTVFIPFKEIVQIEKKTTAGIFPNGIVIDTLHSKYIFASFISRD
                     ATFNLITDVWNQIILGRRYSDDTDQSDYSSRLNDLSDSNSLYNQLKDIDDDGGDDAAL
                     SDIDSTDMTSSEEVEDIIGSGIGIKKTKGQIKSLSLGPSQHEPTSSGYKPTNNEKLVT
                     EFLVEAPLGTVVNLLYGENTKYITDILASMKSTDISPIPKLLGTSSRKFNYVKPLPGN
                     IGPSKTKCFITETLDHYDLEKYVKVSQVSDTPDVPSGNVFSARSVFLFTWDKDNNTKV
                     VVYGCVDWKGKSWLKSFIEKGTMDGILEVAKTTHHEIKTILNNQSSSEQSVEDNGDSA
                     EEVIEESNLPKMGPLSHQPTEPPFSKESEDTVIEENVNFQAPLGTIFQILFGDDTSYI
                     KKMIEKQNNFNLSEIPPFNNKMREFTYTKRLANSFGPKQTRCFITEKIEHMDLNSYIL
                     VRQIVKSPDVPSGNNFAVHTRTYLTWGNDNSTNMLVVTNVEWSGKSLLKGTIEKGSIE
                     GQRVTTKQVIEELRDIIANAGSSRKKLKKRSKTITSLKKVTSQPLEKKPDTVAQNMDS
                     SANLLDQFVSFVMELDFTSLKGIGFIIITVFLFFLLLRGLFFSNAKSATKIIRPGVII
                     IDGEEYSYVPNSKTIYNAYEKKIGKFDYSFKSDDNNPVMESEFLIWDWLDDRTNGNSN
                     NLSFRKQYKRGFKPVKTHKLQQLKESIKIAENELNEMKRLLNEEEELLL"
     gene            complement(<159500..>162646)
                     /locus_tag="CAGL0M01408g"
                     /db_xref="GeneID:2891175"
     mRNA            complement(<159500..>162646)
                     /locus_tag="CAGL0M01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449406.1"
                     /db_xref="GeneID:2891175"
     CDS             complement(159500..162646)
                     /locus_tag="CAGL0M01408g"
                     /inference="similar to AA sequence:UniProtKB:Q06680"
                     /note="similar to uniprot|Q06680 Saccharomyces cerevisiae
                     YDR325w YCG1 Yeast Condensin G"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449406.1"
                     /db_xref="GeneID:2891175"
                     /db_xref="GOA:Q6FK38"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025977"
                     /db_xref="InterPro:IPR027165"
                     /db_xref="UniProtKB/TrEMBL:Q6FK38"
                     /translation="MTEVTTDGSDINSKIFGSIANVFQAAQLSYAGHRKHVAVLKKIQ
                     TKAIAQGYEDAFNYWFNRLILAILPLKKTEVVGDRIIKLVASFIASLDKEIELAKAQG
                     KPLPNNAESAFTKFVDHFIRNILRGIESKDKNVRFRVVQLLAVIMDNIGEIDESLYEL
                     LTWSLNKRIYDKDPNVRIQAVFCLTKFQAEDVGRENEPSNDLIAIEINESTKTLMSLI
                     QNDPSAEVRRAAMLNLISLPATLPYILERARDVNQINRRLVYSRILKAAGKECFTKID
                     TKILDQLIKWGLEDREESVRAACKKLIHHDWLGLVDGDLIRLLEHLNVKDSTTCDKVL
                     VCIFEKHPEIIQKIKFSHDIWSNFTIEVAFLFRCFYLYCIQYNINEVLYDNFPEASRL
                     AEYLQSYINKAFKDNQSQSITDNDKKHLEFIIEQILMAADKYDYSDEIGRRSMLTVVR
                     NFLGIKSLSVTSIKIGIDVLKTLSINEKDFITMVIEMINDIRDEDIDMQEKEEKAAKR
                     KSKKSKKLQKKKDKQSSTEVLVNKKNDDLGDAQSAKKDTTLETSTFDYADDDESSNEE
                     ESDNEDENENDGDDDDLDSFHSAVEGLVNGDSNTMNEADIMRKMLYEKEARPDTLILC
                     LTRSGYMLELVSSSIQENILIASLIDTLITPAVRNSEPTVRELGIKNLGLCCLLDAQL
                     ATENIYILGMCVSKGNESLKMIALQVLFDIFALHGNVVVDGEGKVDSISLHKIFYKVL
                     KNTELPSCQKIAAEGLCKLFLADIFTDDDLFETLVLSYYTPANSANEELIQAFAFCLP
                     VYCYSHINHQNRMARIGADILLRLCVLWDEFRYSDEYNDEKMTMLKPNIIFQQLIDWT
                     DPRKIINRDEKDANADSSQIRFLLDVLKIVPQIEKSEIKRLLLNNINLVHLHHTQEYS
                     TLKQLEDNIIDILENDAIDQNQRNSLTRFKLSLQDVIEKTESKLDEHSDADTSTEQYS
                     MILESSQVYSKPPTRNDEENCSDEDNAAALPSELNTKKRKRSESVENRDDTTNRTNRT
                     DTSREGLTGENSDIMMSD"
     gene            <164428..>166683
                     /locus_tag="CAGL0M01430g"
                     /db_xref="GeneID:2891176"
     mRNA            <164428..>166683
                     /locus_tag="CAGL0M01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449407.1"
                     /db_xref="GeneID:2891176"
     CDS             164428..166683
                     /locus_tag="CAGL0M01430g"
                     /note="highly similar to uniprot|Q06679 Saccharomyces
                     cerevisiae YDR324c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449407.1"
                     /db_xref="GeneID:2891176"
                     /db_xref="GOA:Q6FK37"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FK37"
                     /translation="MTMLVHRSRFVDFTPSNITALAFSHKSSAELTPSDLRLAVGRAD
                     GNIEVWNPRHDWFQEMIIEGGQDRTIEGLCWCNVAGEPLRLFSIGGSTIITEWDLNTG
                     LPMKNYDCNAGVIWSIAINAAGDKLAVGCDNGTVVIVNIAGGPGIIEHDSILMRQEAR
                     VLSLAWNGNDYVIGGCSDGRIRIWAAHEKDESRGRIINTMRVDKSKKESTLVWSVLYL
                     PSKNTIVSGDSTGSIKFWNFQYATLSQSFKSHSADILCLTTDAKESTIFSAGVDRKIF
                     QYSLDHSKKWLISSNRLLHGNDIRAMCAYQSKGADFLVSGGVDKTLFINPISSFADGR
                     YRKMPFVVPYNKNVLINNTQRLIVMWDGSVVKIWTMGTEVENEKNYKLVCKLVLKDEQ
                     KIHTCAMSPDGQVLLVGRATTTKIFHLQPMENKLKVTKLSNDFLFTIGTKAAKFINNS
                     KVVICNTDDELLMLDLEEEDDEKPEYFELDEPQNTKSSLKIPYMNKINRIDANESAVV
                     VSRYCGIVTVINLKTKKSQNLLHLMNFVTSIYIHEQRKTVIVVTAENKIYELSLASIF
                     REDTEDKEGDEQADVTNEENSVFTAWSKRNTENIPKQLKDMRQKCLGVFASDEDSNKI
                     WLWGSTWICRIDMSKNLPVITRKKTKKHGRDGLTITDDSNYMNNNLEDEDEDVDMDID
                     EDLEILKGGKVKSISNQKDPLTSEVFYFNDKYRHLLMADLLSSSELVVVERPPIFLKD
                     QKAFQQPKLVF"
     gene            <167313..>168917
                     /locus_tag="CAGL0M01452g"
                     /db_xref="GeneID:2891177"
     mRNA            <167313..>168917
                     /locus_tag="CAGL0M01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449408.1"
                     /db_xref="GeneID:2891177"
     CDS             167313..168917
                     /locus_tag="CAGL0M01452g"
                     /inference="similar to AA sequence:UniProtKB:P32609"
                     /note="similar to uniprot|P32609 Saccharomyces cerevisiae
                     YDR323c PEP7 vacuolar segregation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449408.1"
                     /db_xref="GeneID:2891177"
                     /db_xref="GOA:Q6FK36"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR021565"
                     /db_xref="UniProtKB/TrEMBL:Q6FK36"
                     /translation="MQSSDVRPNDTQQEYSKLIQEENTKSSCPICFKECANLNELNKH
                     LDKDHNFGNENSNGDHVKKHQNKKKSSGIRTSHHEVYNEGMSKCAYCRKKLTKSNGVS
                     NCYHCGKLYCRSHLLWQMKLDKRARYDPQHGKFYPCCFKCTSSRPGYNDYGLTVSKTS
                     EFSRLRSSKMEDKQLRSLQLETRLLKLIDGYISISRKYGNNLFSTVVRNSELSKYERS
                     IVHWKDDSNVHTCNICTSEFGLVRLSRKHHCRLCGNIVCDTDGYEEEVINTRRRKTTM
                     KKCSYQIKLRNLKSSTDDLHYNSQLRPDEEYIAELQVRLCSTCIDNLLLKRKFKRDLT
                     KPMPPLLSRYETLHNIADVIRTILPPFQDALQKIDNERTKKVSDEKELADLSKLRVKL
                     LRSFANYNSVNKQLCSIKPSNFSEERVKNSLLVESSYFINENILPLRSLPAVLSGEDY
                     VMSKSEPEVKKLSELMSSDLSIKEIKQGREELMVLEEQIFQIESLVETAKRQRKFDEV
                     ATLATNLNELNQRATELREKLGQEGF"
     gene            <170175..>170609
                     /locus_tag="CAGL0M01474g"
                     /db_xref="GeneID:2891178"
     mRNA            <170175..>170609
                     /locus_tag="CAGL0M01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449409.1"
                     /db_xref="GeneID:2891178"
     CDS             170175..170609
                     /locus_tag="CAGL0M01474g"
                     /note="highly similar to uniprot|Q92317 Saccharomyces
                     cerevisiae YDR397c YNC2beta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449409.1"
                     /db_xref="GeneID:2891178"
                     /db_xref="GOA:Q6FK35"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FK35"
                     /translation="MIGDGDDVTLPKATVQKIISEVLDSDLMFNRDAREIIIKSGIEF
                     IMILSSMASEMAESDAKKTIAPEHVIKALKELEYNEFIPLLEQILIEFKGTQKIKEKK
                     NSKFKKSGLTEEELLQQQEELFRKSRSRLHQNSVSGSATDST"
     gene            complement(<171045..>173900)
                     /locus_tag="CAGL0M01496g"
                     /db_xref="GeneID:2891179"
     mRNA            complement(<171045..>173900)
                     /locus_tag="CAGL0M01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449410.1"
                     /db_xref="GeneID:2891179"
     CDS             complement(171045..173900)
                     /locus_tag="CAGL0M01496g"
                     /inference="similar to AA sequence:UniProtKB:Q04175"
                     /note="similar to uniprot|Q04175 Saccharomyces cerevisiae
                     YDR395w SXM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449410.1"
                     /db_xref="GeneID:2891179"
                     /db_xref="GOA:Q6FK34"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FK34"
                     /translation="MLDERAILTCIGHTLISDAKVIKQAEDQLYEYQKQPGFTSFLLN
                     VVTDNSIAMNVRLSAAIYMKNKIQRSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSES
                     SHLRPHLTESIRGILNADNSWDLTATVKELLTSGKQEYLYPGLLLVFEVAIVHRWDMS
                     DNREVIDNFIIEIFPIVENITSQLVNQTDYRSNELLYLVLKSFKYSCLNNLPKYFADL
                     DKLNAWIQLHLFICQKPLPAEVLELDPSDRSLDKRVKVNKWGFGNLTRFLYRYSRSTK
                     VITPEFVNYVFTKIVPEIIQEYFKFIESWSNKSLWLGEASLYYMVQFLEKCMITNELF
                     PLLEPHLNVVLQHLIFPCLCATEESVELLYEDPEEYTRRYFDLNKDGSMADFASSDFV
                     YMLGTVRPDKLNEVLVFINEVFTNFSQHKGDKEWSFKQEGAMRMISTLFSLFQNPQDL
                     EGMFSNYIVNFLADDSHHFLVARALETVASYPYDINDMGTLSKLFEQTYGHFLNSDCL
                     PIQVEAADALKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVENF
                     ADELTPFAKDLAVNLAEQFLNLGRSIVESTNGAYSTGDQDQETQACALLATMTTMVMS
                     MNKVSLVEQFAPVVKFVIVHAQISFITEIVDLMDSLALSSKALFNQFTPEIWEMFHDV
                     MDSFQTYALDYFESYLVFFETIVLQGFPQDQTFVEPFLSLLSVKLESEIDYDVEGVMN
                     LLTCFALSMKETPFLEKALSRAMDEEFGLDDKQVIKMVLAYLFVKPIETLQVMESSGV
                     TLNILKRWFDLKFKSVFAIKLQILAIMSILKLPELPSCVSGYLKEFSNKLVTLVEQLP
                     VAIRNREALNKGEELSGGADGTDLLDPQEEDEYLEEYDDDLKESILDQVNAFQEVSVF
                     LTSLQSENPQRYQDIISGMSDDKKESLQVILEFVSNN"
     gene            complement(<174378..>175595)
                     /locus_tag="CAGL0M01518g"
                     /db_xref="GeneID:2891180"
     mRNA            complement(<174378..>175595)
                     /locus_tag="CAGL0M01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449411.1"
                     /db_xref="GeneID:2891180"
     CDS             complement(174378..175595)
                     /locus_tag="CAGL0M01518g"
                     /inference="similar to AA sequence:UniProtKB:Q04172"
                     /note="similar to uniprot|Q04172 Saccharomyces cerevisiae
                     YDR393w SHE9P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449411.1"
                     /db_xref="GeneID:2891180"
                     /db_xref="GOA:Q6FK33"
                     /db_xref="InterPro:IPR008839"
                     /translation="MYSYRYLRPVSRSGRAILIQRQAYLRNITFTHFRCEENKSSASK
                     RPTGNALNTKLNELNGSLNNLWNKFLEGRGVFQHHAKNIRKSIQEANKKIAEQEKESK
                     DAKINYKKDELTNEEIKDLPSERELHRKKWSRKLEFYLDSLQETLFTATKALNDVTGY
                     SSIQKLKNSINLINEKLDATRKARTDLKLQYTKAIESRTLSQKQLNELLQRKSSWSPS
                     DLENFTKLYKDDAINQQTEKELKEKVRDIEKKEEQLTDDLYRAILTRYHEEQIWSDKI
                     RRTSTWGTFILMGFNLVLFIIFQLLLEPWKRRRLTGSFEGKVRHALELHSQEQETKIR
                     DFLEEIKTKESNNIANEQKTITKLSFWDKLRNTFQNSTGLSLTQFNMLELTVTAINSF
                     LVGILFTLLLHAL"
     gene            complement(<175916..>176896)
                     /locus_tag="CAGL0M01540g"
                     /db_xref="GeneID:2891181"
     mRNA            complement(<175916..>176896)
                     /locus_tag="CAGL0M01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449412.1"
                     /db_xref="GeneID:2891181"
     CDS             complement(175916..176896)
                     /locus_tag="CAGL0M01540g"
                     /note="highly similar to uniprot|P06844 Saccharomyces
                     cerevisiae YDR392w SPT3 general transcriptional adaptor or
                     co-activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449412.1"
                     /db_xref="GeneID:2891181"
                     /db_xref="GOA:Q6FK32"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FK32"
                     /translation="MDKHKYRVEIQQMMFVSGETTEPPLETTSLIEDIVRGQVVEILM
                     QANKTAQSRGVKSILPEDVIFLIRHDKAKVNRLRSYLSWKDLRKNAKDQDSNAPAGGG
                     AEEEDLGKKAGDKDEKDSSANMKVKKSQIKLPWELQFMFNEQPLENNEDADDIDEDER
                     EANIATLKRLKMNDDRTRNMTREEYVHWSDCRQASFTFRKSKRFKDWSGITQLTDGKP
                     HDDVIDILGFLTFEIVCSLTETALKIKKREQILQNQKQQSQNIHQDVSLDKSAITRKK
                     RLFDNLDDEVNPLKPNHVEEAWRVLQMIDKKHRALTNFRGGRLSSRPIIL"
     gene            <177667..>178320
                     /locus_tag="CAGL0M01562g"
                     /db_xref="GeneID:2891182"
     mRNA            <177667..>178320
                     /locus_tag="CAGL0M01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449413.1"
                     /db_xref="GeneID:2891182"
     CDS             177667..178320
                     /locus_tag="CAGL0M01562g"
                     /inference="similar to AA sequence:UniProtKB:Q04170"
                     /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
                     YDR391c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449413.1"
                     /db_xref="GeneID:2891182"
                     /db_xref="GOA:Q6FK31"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:Q6FK31"
                     /translation="MSEVKLNITRDVVRASETLYKAFDDSHAFDYITKKFFNLPVDEY
                     VSKDRINAITHYYVACYHDSNGEVVEANDYDAVAVFSLPNQHLPKSLTNDPHFNQVFF
                     HDLKSRLAEVIPEDIHYYYLFMIGKDLTRKDTKGSVRKIFEEYKKRADAENCAIVLEA
                     IAEHARSVYEYFGFKNYKTFHYGVGEVNEQGQPDPNGKGFTGYLMIYHKDGDKVLRE"
     gene            178619..178690
                     /gene="tRNA-Gly (CCC)"
                     /locus_tag="CAGL0M01584r"
                     /db_xref="GeneID:2891183"
     tRNA            178619..178690
                     /gene="tRNA-Gly (CCC)"
                     /locus_tag="CAGL0M01584r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2891183"
     gene            <178971..>180869
                     /locus_tag="CAGL0M01606g"
                     /db_xref="GeneID:2891184"
     mRNA            <178971..>180869
                     /locus_tag="CAGL0M01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449414.1"
                     /db_xref="GeneID:2891184"
     CDS             178971..180869
                     /locus_tag="CAGL0M01606g"
                     /note="highly similar to uniprot|P52488 Saccharomyces
                     cerevisiae YDR390c UBA2 E1-like (ubiquitin-activating)
                     enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449414.1"
                     /db_xref="GeneID:2891184"
                     /db_xref="GOA:Q6FK30"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:Q6FK30"
                     /translation="MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLM
                     EVGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAIAVNAVQSFSNSKLVPYQDNIMD
                     TNVFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGK
                     TECFDCTKKETPKTFPVCTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQ
                     DWGTDDVEEINRIKNETNELKELQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWK
                     TRAKPVALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQITSKLMDRYNTESAID
                     FDKDDQDTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLM
                     SLRVLNLLKYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGV
                     FKVTKNQMEKHSFMDFINALTSTSKLSDDISILDATTQRLLYDYDFEDLAEKKLVDLS
                     LKNGSVLLITDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIPSETADE
                     NGGGDMLQNDSLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIED
                     DDELVILD"
     gene            complement(<181274..>183079)
                     /locus_tag="CAGL0M01628g"
                     /db_xref="GeneID:2891185"
     mRNA            complement(<181274..>183079)
                     /locus_tag="CAGL0M01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449415.1"
                     /db_xref="GeneID:2891185"
     CDS             complement(181274..183079)
                     /locus_tag="CAGL0M01628g"
                     /note="highly similar to uniprot|Q04163 Saccharomyces
                     cerevisiae YDR389w SAC7 suppressor of actin mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449415.1"
                     /db_xref="GeneID:2891185"
                     /db_xref="GOA:Q6FK29"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:Q6FK29"
                     /translation="MPNKHSISPSRHMPFWKNFVNNPKSVSSENLSTPSRPVYQRGHS
                     YNHTAPKTGSPIKNEVGAAERQDFRDYRDQFLSGRNGFSGRVFGVSLEESLSVASAEV
                     IVQSELVSFGRIPIVVAKCGAYLKSNGLSTSGVFRIAGNSKRIKELQYIFSTPPDYGA
                     KFSNWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRILKYMLNNEVSH
                     PNANKENTLTMKLTESTKQDTDDRANDGDNENEDEQHITEEEAKRKQLRRKKKLSRCI
                     RAAIKEYEELFTDLLSDSKQLTIYLLDLLSLFARQSQLNLMSGSNLAAIFQPSILSHP
                     QHDLDPKEYELSRLVVEFLIEYTYKLLPHLLKSTKDDQQKKISESVHQKSTTESTTNR
                     DKTSSPLPNIQIQTETTTIKGTPDNSKTTSTATSQQNNIHSKPEAKSPALQVPKYQRP
                     HSRSIGSAPMVPDVIASNKRRSRLFPWLHKPGILSDTGDTATDGEGDDLLNDDENVDP
                     HLSSPVHSSNHRQHLLSIPKVQRSVSGRSITSNSSGRPLSLILNRSEDNLPKNGSSST
                     EKFERPRSPIAYSQESIESKAKKRESWFARLTSRN"
     gene            complement(<184085..>185485)
                     /locus_tag="CAGL0M01650g"
                     /db_xref="GeneID:2891186"
     mRNA            complement(<184085..>185485)
                     /locus_tag="CAGL0M01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449416.1"
                     /db_xref="GeneID:2891186"
     CDS             complement(184085..185485)
                     /locus_tag="CAGL0M01650g"
                     /note="highly similar to uniprot|P39743 Saccharomyces
                     cerevisiae YDR388w RVS167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449416.1"
                     /db_xref="GeneID:2891186"
                     /db_xref="GOA:Q6FK28"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:Q6FK28"
                     /translation="MSFKGFTKVVTRAPQSFRQKFKMGEQTEDPVYEDAERRFKELEQ
                     ETKKLSEESKRYSSAVNGMLNHQIGFAKAMEEIFLPISGKMSDPNATIPEDNPEGIEA
                     SEQYRALVAELQQTLKPDLALVEEKVVKPCQELLKIITYIRKMATKRNHKKLDLDRHL
                     NTYTKYEKKSEKPDAKPKVEEKMYKAQVDMETAQQEYDYYNDMLKEQLPILFSLEAQF
                     VQPLFVSFYYMQLNIFYTLYNKFQDMKIPYFDLNSDIIEAFIAKRGNIEEQTDSLTIT
                     HFKIGYSKTKLEMTRRRYGKDTDSASPTPGAYGAVGSTTPGYGQMQSPNATGYGGMQS
                     PPATGYGVQQPAMGPGAVGAVGAVGAVGAGAVGAGAMGYQQQAAPPAYTAMGAGAAVP
                     QPPQQPMAAPAPAGAPVETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGR
                     YNGQQGVFPGNYVQLN"
     gene            <186088..>187731
                     /locus_tag="CAGL0M01672g"
                     /db_xref="GeneID:2891187"
     mRNA            <186088..>187731
                     /locus_tag="CAGL0M01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449417.1"
                     /db_xref="GeneID:2891187"
     CDS             186088..187731
                     /locus_tag="CAGL0M01672g"
                     /inference="similar to AA sequence:UniProtKB:Q04162"
                     /note="similar to uniprot|Q04162 Saccharomyces cerevisiae
                     YDR387c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449417.1"
                     /db_xref="GeneID:2891187"
                     /db_xref="GOA:Q6FK27"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FK27"
                     /translation="MVDENSNNENGLDQEEEIDVYSDLYSTYTQVTSLTTNDVDNTTY
                     PMTWKTVALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCL
                     GCFVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGT
                     AAQCTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILFGLSA
                     VPAIIFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSK
                     LKHYQDEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHR
                     MEPRTKRALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFT
                     FLAVYLVDLVGRRSMLLNTIWIMTVGLLLSTIGFQHENVVVLLFAVSIFVAAYASAMG
                     TIPWSSVEFLPLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSV
                     MAWFFVYFWYPEVKGLSLEEIGKVFENGIDVHYVYRNYY"
     gene            complement(<187841..>190675)
                     /locus_tag="CAGL0M01694g"
                     /db_xref="GeneID:2891188"
     mRNA            complement(<187841..>190675)
                     /locus_tag="CAGL0M01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449418.1"
                     /db_xref="GeneID:2891188"
     CDS             complement(187841..190675)
                     /locus_tag="CAGL0M01694g"
                     /note="highly similar to uniprot|P09440 Saccharomyces
                     cerevisiae YBR084w MIS1 C1-tetrahydrofolate synthase
                     precursor or uniprot|P07245 Saccharomyces cerevisiae
                     YGR204w ADE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449418.1"
                     /db_xref="GeneID:2891188"
                     /db_xref="GOA:Q6FK26"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FK26"
                     /translation="MLKFLRTNRYYHLLSGTKLSQKIIEQCRNEIDTIRKNHKFLPTL
                     KILQVGNRLDSSAYVNMKLKKSEQSGVKCIVEKLPESITEFELLSKIEAINNDTSIHG
                     LLIQLPLPKHLDETTITSSVSVDKDVDGFHIYNAGELTKKNGHPKFIPCTPNGCIELL
                     KEHNITIAGKNAVVIGRSSIVGTPITSLLKNLDATVTQCHSKTVNLPEIVKTADIVIA
                     ACGQANMIKGEWLKEGAVVIDVGINHVPDNTKKSGHRLVGDVDFDSASKKASYITPVP
                     GGVGQMTVAMLVSNVVLAAKRSLANFEKVPEIKPLPLKLEKPVPSDFEISKSQEPKHI
                     DNLAKELGIFQDELELHGHYKGKISTSILDRLESKKNGRYVLVAGITPTPLGEGKSTT
                     TMGLVQALTGHLGKPSIANVRQPSMGPTFGVKGGAAGGGYAQVIPMDQFNLHLTGDIH
                     AVGVANNLLAAAIDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRRLERLGINK
                     TNPDELTAEEINKFVRLNINPDTINIKRVVDVNDRMLRKITIGQAATEKGRTRETGFD
                     ITVASELMAILALSTSLQDMKRRVSKLVVASDINGKPVTVDDIGCSGAIVALMTDTIK
                     PNLMQTLEGSPVLVHAGPFANISIGASSVMADKIALKLMGTCLDSQEPGYVVTEAGFD
                     FSMGGERFFNIKCRSSGLVPDTVVLVATVRAIKSHGGAPDVKPGQALPQEYIEENIEF
                     VKKGVANLVKQIENVKKFGVPVVVAINKFSTDTENETKAIEESCKAAGANNVVVSNHW
                     EEGGKGAIDLANAVVQSCEEPKSFQFLYDTDLPIKEKLETIVKEMYGGAGIELSEKAQ
                     KQIALYTEQGFDKLPICIAKTQYSLSHDPKLKGVPQDFIVPIRDIRASIGAGYLYALA
                     AEIQTIPGLSVHAGYLNVEVDDKGNINGLF"
     gene            complement(<192389..>193696)
                     /locus_tag="CAGL0M01716g"
                     /db_xref="GeneID:2891189"
     mRNA            complement(<192389..>193696)
                     /locus_tag="CAGL0M01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449419.1"
                     /db_xref="GeneID:2891189"
     CDS             complement(192389..193696)
                     /locus_tag="CAGL0M01716g"
                     /inference="similar to AA sequence:UniProtKB:P18412"
                     /note="similar to uniprot|P18412 Saccharomyces cerevisiae
                     YBR083w TEC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449419.1"
                     /db_xref="GeneID:2891189"
                     /db_xref="GOA:Q6FK25"
                     /db_xref="InterPro:IPR000818"
                     /db_xref="UniProtKB/TrEMBL:Q6FK25"
                     /translation="MTVSNDSSVSDRYNMNNSTSTSNVSSSNSTGSSNSSGHTQTTGS
                     DNKWPMDIESAFVEALGLIIKNGTSKIKIRDRNYGRNELISMYIWYRIGKYRTKKQIS
                     SHIQVWKKSLLTKKKTGTLTNSNEIYVLDLIENGPQQTDESTRYFYTFFESIISTIMG
                     NYPAFAITHRPVLCPPNSTLPLPLPTGQQWFYAPQEGYYYQNQNSNSINYAGHQMTPN
                     NGGNQNQMDYMANDRNNIEINNMKLKSGSGMPMNTFNQRQQNVQQLPYPMISTQQGQN
                     SHQFLYHNGSNVDHKVPMSNTGNSANFNGNISSPQFNNSSNTPGVNNMHSNGSGFGML
                     YQYQQYPNQSYYMQQSSLPIPPSIVQNSYTNNNTTNITTTPMSLPNVMSQFGQNGQSK
                     TTNNLPPPIRQPDILNKENKPLVKNEEINPYNEKKEVQGIQSN"
     gene            <197743..>201900
                     /locus_tag="CAGL0M01738g"
                     /db_xref="GeneID:2891190"
     mRNA            <197743..>201900
                     /locus_tag="CAGL0M01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449420.1"
                     /db_xref="GeneID:2891190"
     CDS             197743..201900
                     /locus_tag="CAGL0M01738g"
                     /inference="similar to AA sequence:UniProtKB:P35177"
                     /note="similar to uniprot|P35177 Saccharomyces cerevisiae
                     YBR081c SPT7 Transcriptional activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449420.1"
                     /db_xref="GeneID:2891190"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:Q6FK24"
                     /translation="MTIGNIYDLNFLLKLTNKLFENHTFDSYLTNQQLIVLNHILKHN
                     ELNSEIWPDFMSGNLRLKVKIDQTVEDKANQEQLQTTDGVAGSPKSTHIKKEDDFETN
                     TINDDDEFTRSYDDEDLSKLDLDALKEQIDGAYFVGNLSLKVRYVLSQFGIENNLTDY
                     LEEGIDNTDKVESYGGESPTNANTEDNLFTSTDANEDGEDDDYDFDEDDEPNKEAESN
                     DNATEEVVESDRTFKDSTTQCLTLEITISKNTLATYLNPNDIEEKILENSDKFFHSLE
                     NDRETMLKKLKLQRSDQKITTDSDTIDLNGNNSDDNKGSIDDDDDDATIRVPKRQRNR
                     DVTGDDDDEEDDDDESKKDKEGNSPKKLKTLPTGLGIENLSLKHLLSRIQSNKNKLNI
                     SDYELKHLLTEVRKNRSKWTSDERIGQEELYEACERVVMELRNYTEHSTPFLNKVSKK
                     DAPNYHLVIKKSMDLNTVLKKLKALQYNSKQEFVDDIMLIWKNCLTYNSDPSHFLRAH
                     AIAMQKKSLQLIPLIPNITIRNRADVERELEELEKDKDYKDNDDKEDAEEEVAGSGRK
                     GLTMGAHKLAKDSSATNNATNTDTNEETTKVINKMDIEVQKGEGEEKEGEVMPESDQS
                     LSQDKGNDKIIETETNFSKDDDKHLTPQSHNNTEEETKDQSEKMASESKTEIEEDSKI
                     NESSEENAGDKIYSNASKTEQPQVTTVIEGETEDKGETEDKGEAEVPADEEEDDEEDD
                     EDEEAQTFVVEKDDDKDDVELSVWKSITANIRADICLKRSEYFKTGQLNSELDALLKD
                     PERMKPFFQLYKEFKDQKELEMFRLKMEQNSIMKNGFGTALVKQEDYSSIGGATNPSE
                     NQEGNDAYGKTYEGMDLDSSTLLKEYDTMNYLPEFAYGGQDQQMLDQNEEDAVNRILE
                     LGMTKKSALLDNVGKGLTPKVNSNISLIQEIRHICHKISLIRMLQNPYSTQFNKANPG
                     QILNAHQYRYEKVNDDIDIDPISQLHNHDYKHDKNVMWKVMHKNVSKIAMSNGFETTQ
                     PTAIDILTEIAGNYLSNLTRSLKIHKETNSVNRMKPEEMLEAVLLENGINKPDDLYSY
                     MESEFEKKTKKLKDVKAKLENFLKDLLRPTLQDLSERNFEDESQSFVTGDFASNLNGE
                     DFFGFRELGLEQEFGILSNSVPISLLSFQFQATDSETKEQVMKLQAEEIKDIVYEKVS
                     KKDLQSDRFSPIVLSLLTQSYEKTKSAIPKINKVVTAEAEKDNDDVTEEEPKTKPLED
                     NDDLLVMEDDELPVKTKMGSRLRLPPTGKISTTYKKRPLADAFILPEEDPIDEINVNN
                     DSDQVKVEDVPENNGTPMDNDRELDLQISENPLFDSPDIDNNSFGLNLEDNDIAVSNS
                     SLNLKLG"
     gene            <203616..>208115
                     /locus_tag="CAGL0M01760g"
                     /db_xref="GeneID:2891191"
     mRNA            <203616..>208115
                     /locus_tag="CAGL0M01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449421.1"
                     /db_xref="GeneID:2891191"
     CDS             203616..208115
                     /locus_tag="CAGL0M01760g"
                     /note="highly similar to uniprot|P33302 Saccharomyces
                     cerevisiae YOR153w PDR5 or uniprot|Q04182 Saccharomyces
                     cerevisiae YDR406w PDR15 or uniprot|P51533 Saccharomyces
                     cerevisiae YOR328w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449421.1"
                     /db_xref="GeneID:2891191"
                     /db_xref="GOA:Q6FK23"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005285"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6FK23"
                     /translation="MSLASDKKDADVASTTTTAQDDDNLSTYHGFDHHVQDQVRQLAR
                     TLTQQSSLHQKKEHTLPEEGINPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISN
                     SDPDYYKPYSLGCYWKDLVATGESADIEYQANFLNGPYKGLKTVYNTVVPSTASSKDK
                     NFKILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPN
                     DIRKHFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVA
                     MATFGLSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATAL
                     EFIRALKVQASISNAAATVAIYQCSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQK
                     MGYVSPERQTTADFLTAVTSPSERIINQDYINRGIFVPQTPKEMWEYWRASEDHADLI
                     KEIDSKLSDNYDANLAEIKDAHVARQSKRARPSSPYTVSYGMQIKYLLIRNFWRIKQS
                     SGVTLFMVIGNSSMAFILGSMFYKVMKHNTTSTFYFRGAAMFFAVLFNAFSSLLEIFS
                     LFEARPITEKHRTYSLYHPSADAFASILSEVPAKLITAVCFNIIYYFLVNFRRNGGVF
                     FFYFLINIVAVFAMSHLFRCVGSVSKTLSAAMVPASMLLLGLSMYSGFAIPRTKILGW
                     SKWIWYINPLAYLFESLMINEFHDRKFPCSQYIPSGSVYNNVPADSRICSSVGAIRGN
                     DYVLGDDFLRESYSYLHKHKWRGFGIGLAYVIFFLVLYLILCEYNEGAKQKGEILVFP
                     QNIVRRMKKERKLKNVSSDNDVEIGDVSDISDKKILADSSDESEESGANIGLSQSEAI
                     FHWRNLCYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGV
                     ITGEVSVDGKQRDDSFARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQ
                     YVEDVIKILEMEQYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLD
                     SQTAWSICQLMKKLANHGQAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGC
                     KTMIDYFESHGSHKCPPDANPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEEL
                     EWMSNELPKKNTNNSETVHKEFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFN
                     NIFIGFTFFKADRSLQGLQNQMLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSR
                     TFSWKAFIVSQILVEIPWNILAGTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSC
                     AFYVYIGSLALFCISFNQVAEAAANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVS
                     PLTYLIDGMLSTGVANVAIKCSNYELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSA
                     TDTCELCPYSHTNDFLSSVSSKYSRRWRNWGIFICYIAFNYIAGIFLYWLARVPKKSG
                     KLAKK"
     gene            <208704..>210980
                     /locus_tag="CAGL0M01782g"
                     /db_xref="GeneID:2891192"
     mRNA            <208704..>210980
                     /locus_tag="CAGL0M01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449422.1"
                     /db_xref="GeneID:2891192"
     CDS             208704..210980
                     /locus_tag="CAGL0M01782g"
                     /note="highly similar to uniprot|P18759 Saccharomyces
                     cerevisiae YBR080c SEC18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449422.1"
                     /db_xref="GeneID:2891192"
                     /db_xref="GOA:Q6FK22"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:Q6FK22"
                     /translation="MFKLPGFGKASISHSPPDMSNVNIRPVTLCVTNCPNNTYALANV
                     AAVNPADLPDNIYIIVDNLFVFTTRHSNDVPAGTIGFNGNQRTWGGWSLNQDAQVKSF
                     DLFKYAGKASYLGTIDMEITFRSRNKAVATPFDQDELAAQFVANFESQIFSPTQYMIM
                     EFKGHYFDLKIRNLQAIDLGDIDSSAPVSSGIEVKGILTKQTQINFFKGRDGLVNLKS
                     PNSLRPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPAVIEKLGISHVKG
                     LLLYGPPGTGKTLIARKIGMMLNAKEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEY
                     KSKGEESSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILVIG
                     MTNRKDLIDGALLRPGRFEVQVEIHLPDEAGRVQIFEIQTKKMRENNMMSPDVNLAEL
                     AALTKNFSGAEIEGLVKSASSFAINKSVNIGQGATKIDPKNIAQLKVTRADFLNALSE
                     VTPAFGISEEDLKSCVEGGMFVYSERVNALLKHGARYVRQVRESEKSRLVSLLIHGPP
                     GSGKTALSAAIALKSEFPFIRMISPNELAGMSEAAKISYIDNTFRDAYKSPMNILVID
                     SIESLVDWVPIGPRFSNNILQVLKVALKRKPPQDRRLLILTTTSAYSVLQQMDILSCF
                     DNEIAVPNLSTLDEFNNVMKEAQFLDDSGRMQVISQMQNAGTKINVGVKKVLTNIETA
                     RHDDDPVNELVELMTQSI"
     gene            <211439..>214294
                     /locus_tag="CAGL0M01804g"
                     /db_xref="GeneID:2891193"
     mRNA            <211439..>214294
                     /locus_tag="CAGL0M01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449423.1"
                     /db_xref="GeneID:2891193"
     CDS             211439..214294
                     /locus_tag="CAGL0M01804g"
                     /note="highly similar to uniprot|P38249 Saccharomyces
                     cerevisiae YBR079c RPG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449423.1"
                     /db_xref="GeneID:2891193"
                     /db_xref="GOA:Q6FK21"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR027512"
                     /translation="MAPPPLRPENALKRADELISVNEKPAALQSLYEFITARRIRYAT
                     PSQVEPIVFKFLELGVELKKGKLIKDALYQYKKLVHGSAEGLVSVGAVLRKFIDYVET
                     KLASEQAKAEEKQKEEVSDDLEGGVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWE
                     SYRTALDLLRNNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYHQS
                     KFGSNQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTTRKPKS
                     STLANYFENLVQIFLVSGDQILHTLAWKKYFELYSTNPNATEEEFKKIASTIFLSALS
                     IQLDDLPNVRYNYQSRSYRLLDVETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIME
                     VEFDGESFKGKFEAILPKLEGESYFANYSVSLRDVIIRRMFVFASQKYEDISLNDLYS
                     SVTFSSSFKLSEWDIEKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVE
                     EEEEEEEEEEEEEKEAEGAEGAEGDTEEGQEAVAEPEPVIKRNYYIRKRLSELYEKLL
                     EDTDYNTVSYLDKVRIAREALIKHTKDTIEDMKKNSEERAKMHQERRRQHMESAAMNA
                     EKDAEQRQKRIMEERASIEAKLEEEAHRRLIEKKKREFEEVKQREIRKLVDELNAKGN
                     GTKVEYDEVKDMDIPDITKYFVNRLSKNKDELEERMNFAVKRMDHLERAYRKVELPLL
                     KKQADELRATDEVNFGNMKKKIVDAAKAEYEAKMEDYNRVSSVFDDYKTLRDRMLAAH
                     NEKFAAIRAENAAKLEAAKKARIEEVRKQRYEELLARSEAEKKAAEEAERRAKLDEIA
                     RKQREMEEALERKSAARTFTQPRAPVVPNANLDEIARKQREMEEAIERKLAGKSAAPA
                     PAPAPAASTPAASTPAAPGKMSFAERMRLKRQQQQQK"
     gene            complement(<215340..>216605)
                     /locus_tag="CAGL0M01826g"
                     /db_xref="GeneID:2891194"
     mRNA            complement(<215340..>216605)
                     /locus_tag="CAGL0M01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449424.1"
                     /db_xref="GeneID:2891194"
     CDS             complement(215340..216605)
                     /locus_tag="CAGL0M01826g"
                     /note="highly similar to uniprot|P38248 Saccharomyces
                     cerevisiae YBR078w ECM33 or uniprot|Q12355 Saccharomyces
                     cerevisiae YDR055w PST1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449424.1"
                     /db_xref="GeneID:2891194"
                     /db_xref="GOA:Q6FK20"
                     /db_xref="InterPro:IPR000494"
                     /db_xref="UniProtKB/TrEMBL:Q6FK20"
                     /translation="MKVTSLVYAAMATSVLGQNSTSDDVPSGCSLGSSATATAQSDLD
                     KYSGCETIVGNLTITGALGSAALAGVKKIDGSLRIYNATSLGSFAADSVKEITGALNM
                     QDLTILTTASFGALEEVDTINLITLPAISTFNTNLQSANNIVVSDTSLESVEGFGSLK
                     EVNVLNINNNRYLNSFKSSLESVSGALQFASNADETAVSFDNLIWANNITLRDVQNAS
                     FAKLESVNASLGFINNTISTLNLTHLSKVGQSLSVVSNDDLTQLSFLNLTSVGGGLVV
                     ANNTNLKTIDGLKNVQTVGGAIDITGNFTTLDLSSLKSVRGGATFNTVSGNFSCSPLK
                     SLQSKGAIQGDSFVCKNGATSTSISMSSRSRSSSASSSASATVTARSNDTASTSSTKT
                     KKSKGAAAQEVFPAGSFFGAVAAVAVALL"
     gene            <217235..>217690
                     /locus_tag="CAGL0M01848g"
                     /db_xref="GeneID:2891751"
     mRNA            <217235..>217690
                     /locus_tag="CAGL0M01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449425.1"
                     /db_xref="GeneID:2891751"
     CDS             217235..217690
                     /locus_tag="CAGL0M01848g"
                     /inference="similar to AA sequence:UniProtKB:P38247"
                     /note="similar to uniprot|P38247 Saccharomyces cerevisiae
                     YBR077c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449425.1"
                     /db_xref="GeneID:2891751"
                     /db_xref="GOA:Q6FK19"
                     /db_xref="InterPro:IPR020233"
                     /db_xref="UniProtKB/TrEMBL:Q6FK19"
                     /translation="MIHSRNVQALLDGMLGGCDVLEGTVPVPALHSVALLSADTGSII
                     SFSKEHDLEHGPAEHDSLNNLRIMALLVKDKFSSDEKKSCEKGYDLDGGHRAYTYDVE
                     DLHASVTRIPDSDLLLMLLAHRDFPYGLLNMKLKACVKSFAQLYGYRLG"
     gene            complement(<219813..>220760)
                     /locus_tag="CAGL0M01870g"
                     /db_xref="GeneID:2891752"
     mRNA            complement(<219813..>220760)
                     /locus_tag="CAGL0M01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449426.1"
                     /db_xref="GeneID:2891752"
     CDS             complement(219813..220760)
                     /locus_tag="CAGL0M01870g"
                     /note="some similarities with uniprot|Q12145 Saccharomyces
                     cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
                     cerevisiae YPR015c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449426.1"
                     /db_xref="GeneID:2891752"
                     /db_xref="GOA:Q6FK18"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FK18"
                     /translation="MIFESNPLNSFMLDDEERFKIDDYLDCFNDMSLPAIQNTTVIQP
                     FSMYNESYEKLFNETDSIISDEPSSVFELDTNSRRDTLKSEGFISLEHPDMLQKRDSD
                     SQYHFKNELPYPRDEVVKMAEAYPPSLQKVEESVSPKSSCIQPADDETSNAFDEKFSA
                     QAEINKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNM
                     LRHYKLHFKLSNGAYILPTGEICAEKPTAKQLLQSSKRTSSRVQKKRKTSNTTTSTYV
                     SDGYPSEVDVSGSATPLNNDVLCKPYLNVLHQGGEASSI"
     gene            complement(<228017..>229039)
                     /locus_tag="CAGL0M01892g"
                     /db_xref="GeneID:2891753"
     mRNA            complement(<228017..>229039)
                     /locus_tag="CAGL0M01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449427.1"
                     /db_xref="GeneID:2891753"
     CDS             complement(228017..229039)
                     /locus_tag="CAGL0M01892g"
                     /inference="similar to AA sequence:UniProtKB:P38246"
                     /note="similar to uniprot|P38246 Saccharomyces cerevisiae
                     YBR076w ECM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449427.1"
                     /db_xref="GeneID:2891753"
                     /db_xref="GOA:Q6FK17"
                     /db_xref="UniProtKB/TrEMBL:Q6FK17"
                     /translation="MENWIENSSTLFNHNGNNLNLRQFRTYPEELLDTVEDDAHFFPS
                     PTNYTKKSSKYETLYLELDHLRPNCKHICGKNKLYLPRSFQHHKLTRMMRLSYESQSY
                     EVKKNFKCPPSACILESHLESDTSCNHYSSAGPIKRTDLINYRYLRSRDSRKEIMCRF
                     CLGVNWVDSTIYFKHLFLAHGIITRLDNTTDWYHINQKKNNITTIKLEDYMTFYVQEV
                     KSSAIQFTRNVLPHVVVRLLPIPSTYYSSIMGSGFRRTHVLCPNCNRYIRIGWCEHDE
                     IIQRQYEDFESLNIQTFKEYSRISYIQTRNRQEIQGVYENYFVHYLECNFRDYDSTCL
                     YIIFTD"
     gene            <232780..>234810
                     /locus_tag="CAGL0M01914g"
                     /db_xref="GeneID:2891754"
     mRNA            <232780..>234810
                     /locus_tag="CAGL0M01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449428.1"
                     /db_xref="GeneID:2891754"
     CDS             232780..234810
                     /locus_tag="CAGL0M01914g"
                     /note="some similarities with uniprot|P14922 Saccharomyces
                     cerevisiae YBR112c CYC8 general repressor of
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449428.1"
                     /db_xref="GeneID:2891754"
                     /db_xref="GOA:Q6FK16"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6FK16"
                     /translation="MSEEFSSWYGDVTRKCGSLAIDLGLSTLAFDQLVKLLEQEKHIS
                     TILLLVRLYLKNKDYYNVVTFLVNGRDNEILSDYRVWKAIALSYFKLNNVQDSLNAVD
                     YALKLKSDDQDTLLLKARIMSFLDDSSLKTQYEALISSYSDKSSKEYYQILVCYMQYS
                     RNIGDIPKCFEIFQAISQEFSRTQKKRSINFLQVFSYAYQLYASTIYLTEGNINEAGR
                     KRKRGYNNDSPLEVINEFLSISERNYNSSLSIQPLKILQGQISFIEGIDLRESINYLN
                     LELQILNNHAATLSEEGVYHKSILNYMIARNMLKLNPHENAQVAYEYFQNSLSLTPNL
                     PFIWISVASLYLTLGQLEDSLATYSQAISLAMSFENVLPPKELSYYKRFAAVAWHGIS
                     QVYTVTLQLTNAIEALDHAISIVYQEHDVTTEQELTSLRNEYVKLNSQSTPHPNIVYS
                     LPEVSMKLLLEYETCRDSFLFQNIDDLEIIDKNNLNDGAIKNFAGQVTTLTTQPPTDQ
                     STLRVLNTANGTNSIAYTQKPPGSEVYTRKQSVTGTPSSAHAQQYGRNPQLSSSMSQT
                     LNAPIQDVRTIQQPNGQNIVVGNQILQQQQQQQYTTKQPFVVFNHATQKQELVTPQIV
                     STENGRYQPQHVSMIQGLPQPNPNAYYQVNDGNVVLKPIQSMNNNEFITKVL"
     gene            complement(<234892..>237735)
                     /locus_tag="CAGL0M01936g"
                     /db_xref="GeneID:2891755"
     mRNA            complement(<234892..>237735)
                     /locus_tag="CAGL0M01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449429.1"
                     /db_xref="GeneID:2891755"
     CDS             complement(234892..237735)
                     /locus_tag="CAGL0M01936g"
                     /inference="similar to AA sequence:UniProtKB:P38244"
                     /note="similar to uniprot|P38244 Saccharomyces cerevisiae
                     YBR074w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449429.1"
                     /db_xref="GeneID:2891755"
                     /db_xref="GOA:Q6FK15"
                     /db_xref="InterPro:IPR007484"
                     /translation="MRFKALLRAIFRFRKTNFSILLIITYAIIIALLVFDRSRYKLDL
                     PNATSDKLRRNLLEQAWSDLQVITQSPHPYSSRNNDVVHDFLLQRVKNITRSNDNIYI
                     DDDYRNKSSILFHQPDVFNSTSKVSRVVYYESSNIIVKVVGSNNELPALLISGHFDSV
                     PTSYGATDDGKGIATMLSLLNHFSSSQPKRSVIFNFNNNEEFGLLGAYAFTYHPWIRD
                     IEYFINLEGMGAGDRAVLFRTSNVETAEIYKKAVKSRPFGNSIFQQGFNSRYIGSQTD
                     YKVYDEYGLKGWDISFYKPRDYYHTAKDSIQYTSKESLWSMLNQSLQLAIYISNEKLI
                     KKSSSNPAVFFDLLGLFFVVVDTKHLFYADIFMLIVGPILLMMKAHLDKRRRLERSRL
                     VQLRLLLSLGLSVVFLLLLTKSLNSFNPFVYSADYRTPLTGLFLLFVTVNYLIVTLAE
                     RLNPTESYKTVAINQIFIIAWLMQLYITLRMAKSDFTLTGTYPLSIFSGCLIVALSLG
                     LFGTKNKAVNDAPNSSVRYASSQNDEDNPLPSQDRGENINQVRDTGNQEVTSNTNTDL
                     HSNAEEVDERMPLLSNNHIGDSGKMDKNSDFSKHYNWIVQFLCIVPISSFIFLFSLDY
                     TLDAIHKMVQETTDDVQLICIIITIGVILLALPILPFISKLNYQSSVIIAIIGVLLFG
                     KSLVMQPFSEIAPLKVRFLQTVNQHDISKSSVSLFTAKDTPIKEMIYDLPSVKSQSTL
                     VNCTVFGGSKICDYYGLPPNLVDSEGNRQNKNLMKIEVLKNDNNDTQRSPYAPLSAEI
                     KINVSENRVCSLAFWSQSSKQSPVKKFSVIKSNNNNTNSVSNSIKYADGIDEVLIHKL
                     DFNGAHHFSIEWLPNIPFDLDYDPVIDGQGDNNIEITVACFTGEADSLSVVNGHPLKK
                     IPAFDEVVKYSPKWYTFTNRDRGLVVIKDKIQL"
     gene            complement(<238113..>240875)
                     /locus_tag="CAGL0M01958g"
                     /db_xref="GeneID:2891756"
     mRNA            complement(<238113..>240875)
                     /locus_tag="CAGL0M01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449430.1"
                     /db_xref="GeneID:2891756"
     CDS             complement(238113..240875)
                     /locus_tag="CAGL0M01958g"
                     /inference="similar to AA sequence:UniProtKB:P38086"
                     /note="similar to uniprot|P38086 Saccharomyces cerevisiae
                     YBR073w RDH54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449430.1"
                     /db_xref="GeneID:2891756"
                     /db_xref="GOA:Q6FK14"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FK14"
                     /translation="MQLPRYENKPFKPPRRIIPSGTVPRPVRSVGGSTASTFGVKRTY
                     AQTAELQPARSNDTSDRSKTDTTRRYFTIMYRKYTTKKNKTWNGDGYAILILDAAIKL
                     IIYNEQGKPLGSSTKVNIDTLFDSIYTTKGLEFQLDYEIFDTDEIRKVRILLGKEPDS
                     NLIPSQTSSSQQNAIDKGISSELPVSQLFTKSTKKFISPTLKTNPNARPISSMNKQIA
                     KTNRPENTVPTQKFRSLFDCNTIENPLIMNTFQGSEVDIIVDPLLCKMLRNHQRIGVK
                     FMYDCLLGLETNLTAESTDDKSCRLERDSDIKGCILADDMGLGKTLMTITLIWTLLKQ
                     TPFASKVQCSQLGVPLSGMISKVVIVCPVTLIGNWKREFKKWLGLNRIGILTLNPKNN
                     VDMDKISVRNFIKVNRTYQVLILGYEKVLTVQEELLKQKDKLDLLICDEGHRLKNGAS
                     KILKVLKSLDIDKKVILTGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLYINPISRA
                     RDINNKFNTKVIEQGEEKSNQLIEFTKRFILRRSNNILSKFLPPKTDIILFCRPTIEQ
                     IKAFRDIIENVRVDMNNITFNTSLGLINLMKKVCNSPSLLCNDPYYQSNVDSNIFTVS
                     NKSNSSGKLTVLLELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGA
                     TPAKQRDMLVNTFNNNPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMS
                     RIHREGQKRPCYIYRLITTGCIDEKILQRQLMKHNLTRKFLSSNTSDTGSANDDLFDK
                     SDLKDLFTIHQNTKSNTHDLICRCDGLGEEFDDDEEVLKAPALDGSFEQWSNALDAKR
                     KMDVLESQRTQLEKKLLKQCLLDYKHIDPDRSLDLYDDVATEVYKKGKKNITFAFIKV
                     GNVIIE"
     gene            <241386..>243596
                     /locus_tag="CAGL0M01980g"
                     /db_xref="GeneID:2891757"
     mRNA            <241386..>243596
                     /locus_tag="CAGL0M01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449431.1"
                     /db_xref="GeneID:2891757"
     CDS             241386..243596
                     /locus_tag="CAGL0M01980g"
                     /inference="similar to AA sequence:UniProtKB:Q12083"
                     /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
                     YPL164c MLH3 insertion and deletion mismatch repair
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449431.1"
                     /db_xref="GeneID:2891757"
                     /db_xref="GOA:Q6FK13"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028830"
                     /db_xref="UniProtKB/TrEMBL:Q6FK13"
                     /translation="MIHVLPKETWQVLRADTQITGIDSVLRELLQNAVDAGASTVDVS
                     FSIKKNMCMVADDGCGMTRKDLDLLGRPHITSKIRNFRDLERFGNGNGTMGFRGEAIF
                     AISQISELTMMTKHSDFRAHYWRDFPMTSVLTTEEDIRSSLHAQYLSTTPFYEDIWAR
                     SSGTVVIVSDLFKYIPVRKKTLENVPVATITDSIREDFYQILVRNPNLKLNIFTFDDN
                     YKNFEFLNHVKEQYLHSLGSIPIHNAFIRVYGHVVPDPSIKIVKLSFREYNITGLISN
                     CQVRSKSFQFVFVNGRRYSNSEFLGKINRIFDQSTFATNAVEKDTRLGKRSARSYPLF
                     VIKIDGPAHVQDLIQSTSKDIIHLSDGKLINILILKVIYSFLKDQGFLTEIPTQLNDD
                     NCDRIDQLGTLEEPIFMDNDFHRDFVIRNNVKMAKYNKVSHANISHPWKRQRLDYPVR
                     RTSKWWKERSVNELHQSRISTKFAPIKKWAAYEKLHVFDYKDRFLSRSDDLKEVDVVN
                     QVDQKFILLRQKSARGNFELYIIDQHACDERIRLESFLKQYICDIMANALAVQKIFQS
                     RIEIAISEKENFEQYRHEFSKWGIYYNVVHSNNNYSLDIFALPDMLADKIKANEELKD
                     MMLQHIFDLKDGSRSRIKTISSLDAQFLSGGWWSNVNKIPSFIRRFFDSKACRSAIMF
                     GDTLNLQECRDLVRRLNGCIQPNFCAHGRPSVVELIGHQHQWELKNFTADYDYD"
     gene            <243827..>244951
                     /locus_tag="CAGL0M02002g"
                     /db_xref="GeneID:2891758"
     mRNA            <243827..>244951
                     /locus_tag="CAGL0M02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449432.1"
                     /db_xref="GeneID:2891758"
     CDS             243827..244951
                     /locus_tag="CAGL0M02002g"
                     /inference="similar to AA sequence:UniProtKB:Q12529"
                     /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
                     YPL165c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449432.1"
                     /db_xref="GeneID:2891758"
                     /db_xref="GOA:Q6FK12"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:Q6FK12"
                     /translation="MTVTESYLQISEYFDINETSWGGRACFSKRDLNNGQVVLEVEDC
                     MGTSIDYDFRKEVCHYCYKYNNGKSMKVKISFNDLQDCLYEFPQLATYKAKFKGAGLW
                     FCCDTCRDKYLSIHNITELIESYEILLESFMRMIKNKSLLEEQEQDYNGITITKEYID
                     NTWEDITTRWIPMVRKTKATKRAKFLPQISEDEYNCCRFVSETLFRIKHLDPGSDTLE
                     AFHNLQSNELSKIQKFPVLLNFQVLVFKTLFVLLPDNLKNSLTVQAFRHILGSEYGNA
                     FGIWQDTEAVDSREYFGYWVFPKASYFNHSCDPNITKTRIDRKMVFTLNRDVACGEEL
                     NIDYSGVLDLPVDRRQKFLFENWFFVCGCNRCNSDLKLVH"
     gene            complement(<244928..>245581)
                     /locus_tag="CAGL0M02013g"
                     /db_xref="GeneID:2891759"
     mRNA            complement(<244928..>245581)
                     /locus_tag="CAGL0M02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449433.1"
                     /db_xref="GeneID:2891759"
     CDS             complement(244928..245581)
                     /locus_tag="CAGL0M02013g"
                     /inference="similar to AA sequence:UniProtKB:Q12092"
                     /note="similar to uniprot|Q12092 Saccharomyces cerevisiae
                     YPL166w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449433.1"
                     /db_xref="GeneID:2891759"
                     /db_xref="GOA:Q6FK11"
                     /translation="MNSKNTIVYVKVKGKRPDGFVDPPVFEWNIQKEKKLWSLLSQLN
                     DPDKEIDWALLAEGLDAPIYFLKRRCYELFTKHFELLRQQIDRKNKNALTDRSETPER
                     DSTEEITKEVNFLNQLPVRTPGTIQEEFNEDNGPKDKNKTPDTTKKAIEQLKSSRILN
                     FKGNKLDYNNREVGLTRYDSTYEKEGVHTEETESELSSSLGVSKSTLEEALMDKLQI"
     gene            <245848..>250293
                     /locus_tag="CAGL0M02035g"
                     /db_xref="GeneID:2891760"
     mRNA            <245848..>250293
                     /locus_tag="CAGL0M02035g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449434.1"
                     /db_xref="GeneID:2891760"
     CDS             245848..250293
                     /locus_tag="CAGL0M02035g"
                     /inference="similar to AA sequence:UniProtKB:P14284"
                     /note="similar to uniprot|P14284 Saccharomyces cerevisiae
                     YPL167c REV3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449434.1"
                     /db_xref="GeneID:2891760"
                     /db_xref="GOA:Q6FK10"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:Q6FK10"
                     /translation="MISGEETDSIQDGANEVEFDSFDLQLNNYDHYMAYPTSLDRTHG
                     SSLPLKKFHKVPVIRIFGCLRTGHQLLCHVHGIFPYFFVKYDGKEDDTSIIINEKCAK
                     LHQLLEQILRDKMKSKGSRNDKQDETNLNELVYIANVSVVKGVPFYGYHVGWTPFYKI
                     SLLNPSLSEQVCNIIREQNVLQNGQNEVYESQFPYLLKFTADFNLFACSWINFKKVYF
                     RAPVLNEMLNMDEIMMTKELRVLLDRFHSKDTVLKKTMFPRIGNGLLEIDVIPQFIKN
                     IDQIKIRNIHHDLSEKKESVNYLDDGPYVSSTKNMLKDVEIQRKLYSLEEYKKAADIS
                     RNENDMIWNSSHQFEMFLRKALSSVKVSDKDSNFLSGHFNANDFLKTPFEMIDELWPT
                     KFESSIDLNDENERHDKNDQLLDVGEDFDKAEERDEDILGEPNEDDYIEKEMHSQDNG
                     QFINVSTSVISTTQSLDKLLTQSIVKNQRKLKIGNVLSDLGNVATNYHNYFPSNIKKY
                     YRYKQCNISYSSMNEDLQDNGLPINDYMGPFFSDPCDLHKKDYQYAGKQFDITSTHLM
                     KRYPLDFKEDLVRLTKQRLDNDVLFASWKYLKMPPSFNDVAESVTRKERARHSISQIK
                     KPTATKSLGNTSSIKRSESIHDNLTHFSLEIHVNTRGDLLPDPRKDEVSVIFWKVDSD
                     TFPFSIDLQLEGIMYTNKLERENLIETLESISGGVPIMEYEDEFSMFDALTDLILLFD
                     PDLLSGYEIHNSSWGYIFERSLSVHKFNIANEISRVNMGAQFKLRDSWGFKKSSGISI
                     TGRYVLNIWRLLRKEIAVTQYSFENMVHLLLKIRLPKYSCSHLTSLWSNFKTGNELKT
                     FLNYYLTRVRLNIGILKKISFTLNVMEEARLIGIDFQSVYNRGSQYKVESFLIRICKS
                     ENYILLSPSKVAVQKQKPLECVPLVMEPESAFYKSPLLVLDFQSLYPSIMSGYNYCYS
                     TMMGRVRELDGTKRTLGVTNFELKSELLKKLRDDIRIAPNGVIYAKEHLRKSTLSKML
                     SEILEIRFMIKKTISDLGSDHQALKKLLESKQLALKLLANVTYGYTSASFSGRMPCSD
                     LADSIVQTGRETLEKAVKMIESTASWGAKVVYGDTDSLFVYLPGKTKEDAFRIGAEIS
                     NSITASNPKPITLKFEKVYFPCILLSKKRYVGYSYLSSSQLNPHFDAKGIETVRRDGT
                     PAQQKVVENALRILFETKDLSKVKNYVVDTFTKIRSGNISIQDFCFAKEIKLGHYKSE
                     STMPPGAVVAKRLKKQDSRAEPQYKERLSYLVVKGKSGQILRERCVSVSEYFSNDHFA
                     LDSEYYITKTLIPPLDRLFNIVGISVSDWNQEGPMFVEGSIKPYTGADNIPTSTRCKA
                     CEQNTVSGDSYLCDNCVSNEKMAASKLIIKIQASASKLKVLNDICRICSRQYTGDMGL
                     LSSNNALKCVSYDCPNYYSKLKAQRLMQSKHYYSWNELLHNMDHW"
     gene            complement(<250402..>251271)
                     /locus_tag="CAGL0M02057g"
                     /db_xref="GeneID:2891761"
     mRNA            complement(<250402..>251271)
                     /locus_tag="CAGL0M02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449435.1"
                     /db_xref="GeneID:2891761"
     CDS             complement(250402..251271)
                     /locus_tag="CAGL0M02057g"
                     /inference="similar to AA sequence:UniProtKB:Q12042"
                     /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
                     YPL162c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449435.1"
                     /db_xref="GeneID:2891761"
                     /db_xref="GOA:Q6FK09"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:Q6FK09"
                     /translation="MGPIKPGMDNCQLLGPASLLVQCLMGISALALLLFKRNHEHPRR
                     KMEIWLFDIGKQIIGALGIHFINVGISVLKRHHEKKAYLFISIIGNLIESVSSTREDD
                     GSDEQCDWYFLNLLLDTTVGIPILWLAINCITYILQYLNIKNVESGNYFAEEENDIES
                     QESEQPLITAFFKQLGIFTSSLIVMKICVYLVLNYFEDLAYWFANLILSWSDRWPDLQ
                     VTLVMFVFPIILNCFQYFCVDNVIKLHSDDVNNYNSKSFEPEEVIQEEYTNLISGAQK
                     KDKNKQSAYETIS"
     gene            complement(<251658..>253472)
                     /locus_tag="CAGL0M02079g"
                     /db_xref="GeneID:2891762"
     mRNA            complement(<251658..>253472)
                     /locus_tag="CAGL0M02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449436.1"
                     /db_xref="GeneID:2891762"
     CDS             complement(251658..253472)
                     /locus_tag="CAGL0M02079g"
                     /inference="similar to AA sequence:UniProtKB:P39011"
                     /note="similar to uniprot|P39011 Saccharomyces cerevisiae
                     YPL161c BEM4 bud emergence protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449436.1"
                     /db_xref="GeneID:2891762"
                     /db_xref="GOA:Q6FK08"
                     /db_xref="UniProtKB/TrEMBL:Q6FK08"
                     /translation="MDYETLLFELKPLLDIEQLKVANIDESNVQVYTSALEKCSQGAR
                     IESNRTIIGRSGLLDSLTESLAFLLEQEFTVDTQSNKNILLIISEIVRVLANSFADND
                     DNRNIFFDKNRFLANPIIETYFAKVLALNLQQNDPDVIITLQMRLAAMVKNLIVDNRN
                     YVTHYAAFLCPTSYLRLDSINLTSENEVQMALFIAELIDAILEFDKKGATLDEMKIVS
                     TLYYQLSTYITSASVEIDDGDDEEPLIELLATLTNIAEIVFSIDGTFNFDKQQETKDI
                     IQKNILQTIDNLEELKFHNKLIIMRRLVTTSGYIASDKSNTTHSEMNMCLNHLRNENP
                     SPYTIGAIFINITNAIRSTEESKELEQTLSIPDIICYSKKLSDPVQFQGVLDLLKKVL
                     NLSNTLLLPNDSLQGIANLLTYSNEQAQYFQGLIPLVNGLLNKLLTVIPSSKIEFIFQ
                     GNISEGFVKLICKNGSISASLALDKLLLVKNPIKKDITDRLWECLFHFDQVAKENNTS
                     ESANVYLLFQVAKTLGVYLRNTIDKPTEIQDFLLYQYEDQLVFLLSQILDLRDKNVRG
                     SESAMNNGKFVAGLIIDAKKSVRTTDDDRLLAICKQFF"
     gene            complement(<254024..>254827)
                     /locus_tag="CAGL0M02101g"
                     /db_xref="GeneID:2891763"
     mRNA            complement(<254024..>254827)
                     /locus_tag="CAGL0M02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449437.1"
                     /db_xref="GeneID:2891763"
     CDS             complement(254024..254827)
                     /locus_tag="CAGL0M02101g"
                     /note="some similarities with uniprot|Q99373 Saccharomyces
                     cerevisiae YPL159c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449437.1"
                     /db_xref="GeneID:2891763"
                     /db_xref="GOA:Q6FK07"
                     /db_xref="InterPro:IPR014804"
                     /translation="MSVSLVLCTWGGAARTARVYRVVKQAMIRTMFVRLRSAGQVRYQ
                     SSFSFPSSQSLLQKGQLGKKKRSVRKLGLGISDKKQYNSGVTSAAQEAGGAVRDLKSE
                     KAQTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEF
                     AMKLEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVVNSRKLNGATGEN
                     ANDFDEQGNFQKKAFFDKVQSILNRNGKGGRKRPGVTVLKHLKKLKEQN"
     gene            complement(<255200..>257236)
                     /locus_tag="CAGL0M02123g"
                     /db_xref="GeneID:2891764"
     mRNA            complement(<255200..>257236)
                     /locus_tag="CAGL0M02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449438.1"
                     /db_xref="GeneID:2891764"
     CDS             complement(255200..257236)
                     /locus_tag="CAGL0M02123g"
                     /inference="similar to AA sequence:UniProtKB:Q99299"
                     /note="similar to uniprot|Q99299 Saccharomyces cerevisiae
                     YPL158c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449438.1"
                     /db_xref="GeneID:2891764"
                     /db_xref="GOA:Q6FK06"
                     /translation="MSGMIIRTPTRTKTKSFNGKQMDFTFPSPVRGSVDEHSLDNHRI
                     VNETLSLKPQEDIEVSSQMLSDYTSSASNANTYSGNSSNGYYSFANISDNTTASPKLH
                     NHNNMVSPILENTESSFQLQTVESLDPQRQRIRSTYEYGHMGSNQNLRQTREKSKTAE
                     SISTTIAQQTIPTADNISFDFSDISGYEDAVSNKSENKNHKPQNSVVKNQLRATSRAA
                     ISTNDSPSLSNVYMSSLINSSLESTRKTSTASSSVRSSRSSLKRSNAVRCKGGLLQYF
                     TKLGIKIRKNCNKLRLVMRRKLFRFKKNSKSFSRSNSIRSGLEISKLPKVRHEKKLRQ
                     ESSSIAPHTLHQKRTHGFNNKLHKSMSLKSLQPALVSETVPEINNNLHDILESKEKTA
                     DVPAATKTMKTTPSLRRTPSSIRRAASILTSNVATPKASANNRNSMIEYDTVENSRIS
                     SRNSSIKSKGRLVRSSGSVGLSSIARQPSIVVKNKVIPLSMSRFSIKEEIKEEEEESE
                     ESTSDYYVETEPVEAAPRTLAGPKSYAPENFRYGANVDDIKTLYKHYLSTVISRRIKM
                     RLEMAQGEHSATNEPALTHQSTASLKDPIASVLTEYDSEGSEGTNLFDDEDDSSASEE
                     DDEVVLPPLKGHNSTMSFVVQSPFTRQNSMASSSALLYLPVKRSLTLPIGMKIT"
     gene            <257734..>258735
                     /locus_tag="CAGL0M02145g"
                     /db_xref="GeneID:2891765"
     mRNA            <257734..>258735
                     /locus_tag="CAGL0M02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449439.1"
                     /db_xref="GeneID:2891765"
     CDS             257734..258735
                     /locus_tag="CAGL0M02145g"
                     /inference="similar to AA sequence:UniProtKB:Q12052"
                     /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
                     YPL157w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449439.1"
                     /db_xref="GeneID:2891765"
                     /db_xref="GOA:Q6FK05"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FK05"
                     /translation="MGPGLAVEIRRGLTATTMAHRKWLVRGSDLRKDILRKSSKRYRK
                     YGRSKKCFKELVQLLLKDEFLVDNNKPPSSKAGTQKELVKYWRKRRTLFSKVNSMPIY
                     MTSELWFSVTPERIARFLANFISACLPNAKRILDVFSGGGGNSIQFANVFDRVYCLDS
                     NLEHLYCSIKNGQSYGVSNKLWMCKGKWGEHTAKKFRKLNIDCIFGSPPWGGPEYIKD
                     EKYDLEKSLLPFGLYKLLKTFKIVSDNIILFLPKNSNLDQLSETTKEVFGPEAKCKVL
                     YIKEQGYLKGMLCLWGSAFTNYQQDTASDSEEEEGEELNESDKSKNANIYINYDIDG"
     gene            complement(<259132..>259833)
                     /locus_tag="CAGL0M02167g"
                     /db_xref="GeneID:2891766"
     mRNA            complement(<259132..>259833)
                     /locus_tag="CAGL0M02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449440.1"
                     /db_xref="GeneID:2891766"
     CDS             complement(259132..259833)
                     /locus_tag="CAGL0M02167g"
                     /note="some similarities with uniprot|Q12498 Saccharomyces
                     cerevisiae YPL156c PRM4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449440.1"
                     /db_xref="GeneID:2891766"
                     /db_xref="GOA:Q6FK04"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FK04"
                     /translation="MSKEKADNIQWTRAKRGLGGTVFVLVLLLLTFGNVLGIFSTDIP
                     IQSIIASTDSLNSNALIGKASVNSIKKESNNLNSVAHTSMSSSSVAKDGTVIEYDPEK
                     NFKQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHIL
                     SHKIKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFA
                     GENIVFNKRDLPSNS"
     gene            complement(<261290..>263308)
                     /locus_tag="CAGL0M02189g"
                     /db_xref="GeneID:2891767"
     mRNA            complement(<261290..>263308)
                     /locus_tag="CAGL0M02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449441.1"
                     /db_xref="GeneID:2891767"
     CDS             complement(261290..263308)
                     /locus_tag="CAGL0M02189g"
                     /inference="similar to AA sequence:UniProtKB:P28743"
                     /note="similar to uniprot|P28743 Saccharomyces cerevisiae
                     YPL155c KIP2 kinesin-related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449441.1"
                     /db_xref="GeneID:2891767"
                     /db_xref="GOA:Q6FK03"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6FK03"
                     /translation="MSASRDSEKYRFETPRVMKSPSPSLDSAVSISSYARSRSSVTRG
                     FRNGSSSGSSSRSSSPLRPGSFGGDPYLQYGKIRNRSESSSYENGSGNLDKYTGTIKV
                     VIRPKPYPTEKIVSWKIHGDKVISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRL
                     IEGYNATIFAYGMTGSGKTFTMSGTEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWV
                     SYLEIYNEKINDLLDVASGSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQ
                     KRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLS
                     LCDLAGSERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLA
                     SPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRS
                     KNVALDVSRVYKRINRSAHPFSSPSKLDGGDDRSEQRIQELLIQLQTRDRELAKLREV
                     SAGVASGTMNGAQQNLHPDTQLLTKENLLLKNKLKHYESLLVEDGMGVSGASTRNTSN
                     SSSSSTLVSSSPALDNKGRYAGTNSTGVDAELEEIAQLLPSEVAVMLETKFDNLRRQL
                     QSAHRYSESLEKQLNDSHTETEQLKRSLQTKDKLIEALTSAKRLQQQQ"
     gene            complement(<264202..>265449)
                     /locus_tag="CAGL0M02211g"
                     /db_xref="GeneID:2891768"
     mRNA            complement(<264202..>265449)
                     /locus_tag="CAGL0M02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449442.1"
                     /db_xref="GeneID:2891768"
     CDS             complement(264202..265449)
                     /locus_tag="CAGL0M02211g"
                     /inference="similar to AA sequence:UniProtKB:P07267"
                     /note="similar to uniprot|P07267 Saccharomyces cerevisiae
                     YPL154c PEP4 aspartyl protease Saccharopepsin precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449442.1"
                     /db_xref="GeneID:2891768"
                     /db_xref="GOA:Q6FK02"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6FK02"
                     /translation="MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFE
                     AHVQQLGHKYVSQYEKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQ
                     KFKVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGY
                     ISEDNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAI
                     QQHLLDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYW
                     EVPLNAIKLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQYTLE
                     CSTRAKLPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFL
                     RRYYSVFDLDANVVSLAEAVHSA"
     gene            complement(<267332..>269635)
                     /locus_tag="CAGL0M02233g"
                     /db_xref="GeneID:2891769"
     mRNA            complement(<267332..>269635)
                     /locus_tag="CAGL0M02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449443.1"
                     /db_xref="GeneID:2891769"
     CDS             complement(267332..269635)
                     /locus_tag="CAGL0M02233g"
                     /note="highly similar to uniprot|P22216 Saccharomyces
                     cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449443.1"
                     /db_xref="GeneID:2891769"
                     /db_xref="GOA:Q6FK01"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016256"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FK01"
                     /translation="MMETQPTQQATQATQKYLIDNFTQEQIKKNSVYRVICTSGQIPI
                     KDMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRD
                     ISTNGTWLNNQRIEKDRNHLLSQGDEITVGLGVSSDIISLVIFINEKFRDYLEEVRQE
                     LSSQGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKI
                     INKRKVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVA
                     AHGAVGEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAK
                     VQGNGSIMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVI
                     LTGHLPFSGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDD
                     ALNHPWIKQCSSQFDANSMSSQVSLSQSMSQQKALESLDDAQYEFLKAQKKLQQDEPI
                     NDKLKDFKVPTQPPTRFTQPKVINPIENIKKYTKSVKKKGSGKFMTFKPLPESVIQES
                     FEIKQGINPFFIGRSDDCNCRIDDNRLSRVHCFILKKRHPIGKSIYESPAQGLDDIWY
                     CHSGSNDSYVNDIRMTPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGL
                     GIPNEERSVTSQTEDELKLVSRLAKIMAAQRSSTKEANETMDQNRNLLKKVHSVSLSQ
                     SITDPSRKVKRAKLDQTDHNAENMQFF"
     gene            <270614..>271690
                     /locus_tag="CAGL0M02255g"
                     /db_xref="GeneID:2891770"
     mRNA            <270614..>271690
                     /locus_tag="CAGL0M02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449444.1"
                     /db_xref="GeneID:2891770"
     CDS             270614..271690
                     /locus_tag="CAGL0M02255g"
                     /note="highly similar to uniprot|Q12461 Saccharomyces
                     cerevisiae YPL152w RRD2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449444.1"
                     /db_xref="GeneID:2891770"
                     /db_xref="GOA:Q6FK00"
                     /db_xref="InterPro:IPR004327"
                     /translation="MIPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQV
                     SEPVSDSVQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSS
                     HFPALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARN
                     LVLVLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKS
                     IHNEELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKM
                     YKAEVLGKLPIMQHFYFSEFLVCPEGISEPRTHIHNGDEDDDQCCQDGAAHNTWGDCC
                     GIKIPSLYAANAMEKQSHKPIPFD"
     gene            complement(<271836..>273119)
                     /locus_tag="CAGL0M02277g"
                     /db_xref="GeneID:2891771"
     mRNA            complement(<271836..>273119)
                     /locus_tag="CAGL0M02277g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449445.1"
                     /db_xref="GeneID:2891771"
     CDS             complement(271836..273119)
                     /locus_tag="CAGL0M02277g"
                     /note="highly similar to uniprot|Q12417 Saccharomyces
                     cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449445.1"
                     /db_xref="GeneID:2891771"
                     /db_xref="GOA:Q6FJZ9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /translation="MSIGDELVDADEVYRQARWKNQFEVLSKLPRVLQERVDAQKPVI
                     EASGNSATPSNASRALVRHQQNPGDVGLVLNKKFADEQGHESVIERHDKLLNQTPRWH
                     APWHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMT
                     VRDLAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTA
                     GRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKS
                     MKVLTHHQRTVRDISVHPSEFSFASACTNDIRSWLLPKGELLTNFVSQDLDVINTVSI
                     NQDDVLFAGSDNGSLTFFDYKSGHKYQTFKTKEAPGSPESERGILSSTFDGTGLRLLT
                     GETDRTIKIWKQDETASQDTHPNLPWNPKLDSQRL"
     gene            <273725..>276406
                     /locus_tag="CAGL0M02299g"
                     /db_xref="GeneID:2891772"
     mRNA            <273725..>276406
                     /locus_tag="CAGL0M02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449446.1"
                     /db_xref="GeneID:2891772"
     CDS             273725..276406
                     /locus_tag="CAGL0M02299g"
                     /inference="similar to AA sequence:UniProtKB:Q12152"
                     /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
                     YPL150w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449446.1"
                     /db_xref="GeneID:2891772"
                     /db_xref="GOA:Q6FJZ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ8"
                     /translation="MINAIQPPTKAEQNNIKAIIGNSYNRLYSQFSSSELTEVGNYKI
                     QKQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYITKLYEVI
                     VTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLNCVHRDLK
                     LENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGFKVDIWS
                     LGVILYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTER
                     PNTSAILLHPFLQPYGTLILEQTNKIILKQKQGGSQFSSRLERRLIKKMKRIGYDTQA
                     IRQSVIKKKCDSLSGLWFLLAEKEKKIDDKNRPRRSRSLLSVRKVFDDSTQDLLTGDD
                     GLLTTSLEVTRVGSIGKILNKQAERVTSLAPMGVKKSIDFSTRSLNLTLTNTNQSQDN
                     NTKNQESVTFSKEQVRRVQSGTNASTQNEQSPKKTNIFKKMSKFFKEKKYFSNLNNEE
                     SASSTNTMRRSLETSLGASSHNKESVSPEKGNSINEDENRNEKFDSTDKRKPIKQSEK
                     ATMVLLPEDRHKLTITEPNVTRLKSSSVTSRQTSTDNDDSESMDNSRSGSAEIKKRNL
                     VPTARPFSGLSEISNDTYNSDYSTDGNTSSYRVNDPPLSQIMKTNSGGTSQYSGNSEK
                     LTNGTGRRYIRRNQSLISNASSASEKSSRTDSFYDITTASPPAFIDNRSKNNFGLKES
                     ILPRFGAHHSWGPKRSYASNRVGSLGRRAQKRNYLKNNSSRTTQSIIKEEDSSDNDET
                     DVSYHSYRYNNNKSPLNAFRSGGTPEYGEDKLISSSPLQTFGNVEHTPPKSATDSPEA
                     FNGIYAPVVSNRIPSKNIVEDEELISAADLEDNFSDD"
     gene            complement(<276554..>277990)
                     /locus_tag="CAGL0M02321g"
                     /db_xref="GeneID:2891773"
     mRNA            complement(<276554..>277990)
                     /locus_tag="CAGL0M02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449447.1"
                     /db_xref="GeneID:2891773"
     CDS             complement(276554..277990)
                     /locus_tag="CAGL0M02321g"
                     /note="weakly similar to KLLA0F11341g Kluyveromyces
                     lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449447.1"
                     /db_xref="GeneID:2891773"
                     /db_xref="GOA:Q6FJZ7"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ7"
                     /translation="MSVRRLDNVVDSKYLWQPVDGIESNSDAKLEDTYLCFGIFWLDI
                     YADYQHQLEELQKHQVRIEQSLNDCNIHYPWSNIEGVAMEIRFLSEDKGKRPYLFGYH
                     CVEDNIEAEEGIVVSLLFEYLKESGPEVFMKICDTDGDFLIDKFEDLMPDVYAFPSAN
                     NRLWLHEGKFKAIPASFKPGRGIESSECIEFLSKQMFKCEVLTKMQDAFEKEILNSFP
                     HSYLDELKLIKLAIPDDMCHSGLKLNPGLGSYLIKQSLENTDTAGGSVATIVEQAKQS
                     PTTYDLLVPASHLRILSTVQFNVTGKEKDCYDPHICGWILCNTFSRLIKTGKILYKPN
                     SKRLTDPDSIFANFPFKEVRKIKEVEKIFADMNENLYGAQTFNNKTKSKLAAKDYEVS
                     KDDEARKYFKSENVDIDEDDFFEYFLTEALGVSKKELDEYTTSNISNGLKEDGIPQTD
                     DIGDDCDLEMSDEILQKLLESFKMGNMQ"
     gene            <278407..>279219
                     /locus_tag="CAGL0M02343g"
                     /db_xref="GeneID:2891456"
     mRNA            <278407..>279219
                     /locus_tag="CAGL0M02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449448.1"
                     /db_xref="GeneID:2891456"
     CDS             278407..279219
                     /locus_tag="CAGL0M02343g"
                     /note="weakly similar to uniprot|Q12380 Saccharomyces
                     cerevisiae YPL149w APG5 involved in autophagy and nutrient
                     starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449448.1"
                     /db_xref="GeneID:2891456"
                     /db_xref="GOA:Q6FJZ6"
                     /db_xref="InterPro:IPR007239"
                     /translation="MGDSKELVWNGSINVQIKLDSRLLVDGVPEGRRLVNIRVPRESH
                     IAIYTPLVLERLRNVLRSDIEELLPKVWYSYKDISLPWSIPFGTLFDIYNGAHKGISG
                     SRDNYINVWKLNLVTDEKFPINVIPIIEGQDQLRKFMMQSWKQCCFILNGSSKRVMSL
                     SLQDSLEVWEGVTERDYAKYSGVIKRILPRTPRRIPVAIHAANGGPIVQTTEPTLTDT
                     SFSQAVEGIVKADFVVCQGIVMYLRDFSDTSLYDVYDKLHSIDGYLHLIANL"
     gene            complement(<279263..>279721)
                     /locus_tag="CAGL0M02365g"
                     /db_xref="GeneID:2891457"
     mRNA            complement(<279263..>279721)
                     /locus_tag="CAGL0M02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449449.1"
                     /db_xref="GeneID:2891457"
     CDS             complement(279263..279721)
                     /locus_tag="CAGL0M02365g"
                     /note="weakly similar to uniprot|Q12036 Saccharomyces
                     cerevisiae YPL148c PPT2 phosphopantetheine protein
                     transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449449.1"
                     /db_xref="GeneID:2891457"
                     /db_xref="GOA:Q6FJZ5"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR016614"
                     /translation="MSVLGVGCDVVHLPRMHRLLTKYDAGSRGFQRVVSKFMHPTERI
                     ALGVDGASLSAGQIRYIAGTWALKEAALKALHCAAPLHTVLPPAMFIYTKLLYRQRRS
                     NGVPQLLLDNEALRLDQLQFLRQAKFLSTLSHDNEYLVAYTTLIDTKNLV"
     gene            <280372..>282942
                     /locus_tag="CAGL0M02387g"
                     /db_xref="GeneID:2891458"
     mRNA            <280372..>282942
                     /locus_tag="CAGL0M02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449450.1"
                     /db_xref="GeneID:2891458"
     CDS             280372..282942
                     /locus_tag="CAGL0M02387g"
                     /inference="similar to AA sequence:UniProtKB:P41909"
                     /note="similar to uniprot|P41909 Saccharomyces cerevisiae
                     YPL147w PXA1 Peroxisomal long-chain fatty acid import
                     protein 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449450.1"
                     /db_xref="GeneID:2891458"
                     /db_xref="GOA:Q6FJZ4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ4"
                     /translation="MDGIRVRNVLINVHRQCIGLDIERIAGKRYLGVLLKHLYYVART
                     GSTGYLDGHKRRARMILLVVVLMGVAGASGISWGVMRMLTRLRGWYLHSWKNRGRRPS
                     MRRTRSQTRLVDGGRIIYVPEDSIDGKPTSSKKNKKFLIPPTDNDIYEHDKFLFKNVE
                     SERTRSSQLFYSKFLNQMSVISRILIPSFLDKNAILLSSQIFFLIMRTWLSLFVARLD
                     GQIVKDIIAGRGRRFLLDIGCWFLIAIPASYTNSAIKYLQRKLSLSFRTNLTRYIHDM
                     YLDKRLGFYKLLYDSKASTSVIKNIDNSITSDVTKFSDATCSVFANIAKPVIDLVFFS
                     VYLRDNLGTMGVAGIFVNYFITGYILKKYTPPLGELASSKSSAEGDYYNYQLNMINNN
                     EEIAFYQGTEVEKTKVKELYENLMERTLLVDKRKFTYNMVEDYILKYTWSGLGYVFAS
                     IPIVVSTVASGINNEEVNMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFT
                     LLCVLHRVHSTDFNYGANIEDKLQEISDALSSSSTLPNKTKVDIIRGTIQRNFNGVRF
                     ENIDVIIPSPSGREGVKLINKLAFQIPPHIDFNMSHSNSILDITGSKDVNLPFLQGPG
                     SSLLILGPNSCGKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQKPYFTRGGTLRD
                     QLIYPMSSDEFFDRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEK
                     QRVNFARIMFHRPLFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHD
                     LLLEISGKSSGSWHLQTLGTDEAINSIEHEIEELEEKLENVKLWEIERDELIRKLSVV
                     "
     gene            complement(<283059..>284402)
                     /locus_tag="CAGL0M02409g"
                     /db_xref="GeneID:2891459"
     mRNA            complement(<283059..>284402)
                     /locus_tag="CAGL0M02409g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449451.1"
                     /db_xref="GeneID:2891459"
     CDS             complement(283059..284402)
                     /locus_tag="CAGL0M02409g"
                     /inference="similar to AA sequence:UniProtKB:Q12080"
                     /note="similar to uniprot|Q12080 Saccharomyces cerevisiae
                     YPL146c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449451.1"
                     /db_xref="GeneID:2891459"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ3"
                     /translation="MAPLKVNERPAQYKQSSRKGKKAWRKNIDLTDIEKSIETQKDLE
                     ITHGTSDLASLQDTALFQVDEEGDIDLKKALIKRKQIKKNLKSKEILDSIKTASKIKS
                     VIHPRHQEHQTKEGGKVQGVSKKELKKLLSLAGKIQGESKLKNRSDKDGLVKSAAADL
                     WNEEESNKVKLPSGIEFKKKRDEIPEELIKYSTTSWSIAEVKPKTLEHKPVKVAEYED
                     LPHAGKSYNPDSKHWNSLISKEYESEKKREDARNKIQEYQAKIQRLMEVLDDKEEESS
                     SEEDEEDEEDETEETTESTDVTLGLSINPVVKNKKKTKYQKNKAKRHEEKVKMHKEIK
                     ELKQQIKELEKIEEIEQEVEKRHEEKDKKVKKEKKNKKGKLGTKYHILNEGLEVKFKD
                     ELSDSLRKVRPEGSLLYDTVRKLQSSGKVEARIPRTKGRRYKQKITEKWTYKDFK"
     gene            complement(<285179..>286495)
                     /locus_tag="CAGL0M02431g"
                     /db_xref="GeneID:2891460"
     mRNA            complement(<285179..>286495)
                     /locus_tag="CAGL0M02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449452.1"
                     /db_xref="GeneID:2891460"
     CDS             complement(285179..286495)
                     /locus_tag="CAGL0M02431g"
                     /note="highly similar to uniprot|P35844 Saccharomyces
                     cerevisiae YPL145c KES1 or uniprot|P35843 Saccharomyces
                     cerevisiae YOR237w HES1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449452.1"
                     /db_xref="GeneID:2891460"
                     /db_xref="GOA:Q6FJZ2"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ2"
                     /translation="MSGYASSSAWTSFLKSVSTFNGDLSSLVAPPFILSPVSLSEFSQ
                     YWAEHPDLFLEPSFINEANFKTKCTEDPNVESPEMARMLSVTKWFISTLKSQYCSRDE
                     TMGSEKKPLNPFLGELFVGKWDNKDHPEFGETVLLSEQVSHHPPITAYTIFNDKNKVK
                     LQGYNQVKTGFTKTLMLSVKQYGHTLLEVNKESYLITPPPLHIEGILMAAPFVELEGR
                     SYLQSSTGLLCVVEFSGRGYFSGKKNSFKARIYKSAADSADKNKAIYTISGQWSGSSK
                     ISKLNPATGYSDEIGTFYEAERVPVSHLSVKPIDKQHPLESRKAWKEVAEAIKAGDMD
                     LITKTKSDLEQKQRDLRKEEEAKGICWERRWFKDFDYSDAPGKDYLVPEKDDIFLQLA
                     KAMDLSIKNVPSGTLNGEKEDKKEDLTSIHWRFDRKLWDEEKEVVL"
     gene            <287732..>288094
                     /locus_tag="CAGL0M02453g"
                     /db_xref="GeneID:2891461"
     mRNA            <287732..>288094
                     /locus_tag="CAGL0M02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449453.1"
                     /db_xref="GeneID:2891461"
     CDS             287732..288094
                     /locus_tag="CAGL0M02453g"
                     /note="some similarities with uniprot|Q12245 Saccharomyces
                     cerevisiae YPL144w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449453.1"
                     /db_xref="GeneID:2891461"
                     /db_xref="GOA:Q6FJZ1"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ1"
                     /translation="MSQIVVDGLSVRVDCDVEDGVKSPISLNLCLSGDEELKSSRLEC
                     YYYTIMGRKDDVLGIPLRDTSSDWIRDLARLCATMITKKYNKPCYVTISTVGENNFQA
                     STIPLLAAVKEHVATLVN"
     gene            <289221..>290322
                     /locus_tag="CAGL0M02497g"
                     /db_xref="GeneID:2891463"
     mRNA            join(<289221..289239,290018..>290322)
                     /locus_tag="CAGL0M02497g"
                     /product="60S ribosomal protein L33"
                     /transcript_id="XM_449454.1"
                     /db_xref="GeneID:2891463"
     CDS             join(289221..289239,290018..290322)
                     /locus_tag="CAGL0M02497g"
                     /note="highly similar to uniprot|P41056 Saccharomyces
                     cerevisiae YOR234c RPL37B or uniprot|P05744 Saccharomyces
                     cerevisiae YPL143w RPL37A"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="XP_449454.1"
                     /db_xref="GeneID:2891463"
                     /db_xref="GOA:Q6FJZ0"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="UniProtKB/TrEMBL:Q6FJZ0"
                     /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLLQIEGVANPQEAQFY
                     LGKRVAYVYRASKEVRGSKIRVMWGKITRTHGNSGVVRAKFRNNLPAKTFGASVRIFL
                     YPSNI"
     gene            complement(<290723..>292993)
                     /locus_tag="CAGL0M02519g"
                     /db_xref="GeneID:2891464"
     mRNA            complement(<290723..>292993)
                     /locus_tag="CAGL0M02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449456.1"
                     /db_xref="GeneID:2891464"
     CDS             complement(290723..292993)
                     /locus_tag="CAGL0M02519g"
                     /note="highly similar to uniprot|Q03002 Saccharomyces
                     cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
                     cerevisiae YOR233w KIN4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449456.1"
                     /db_xref="GeneID:2891464"
                     /db_xref="GOA:Q6FJY8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY8"
                     /translation="MTASKRHTYYGGGSISYERTNNSEHDKTQRPQDHQGPKHRKHVT
                     FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRD
                     FITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQR
                     KRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFL
                     RQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNP
                     DGHDISRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHS
                     TFLSITPDEWDRLSNTKNIYRKSKPQFYPNKRPGSTYSNYSSGSKDNKRDSLIIDSAL
                     VSLPVPPKEFQSHILARPSSLVVESRYSPLGKRNGHNRSNSAASAALQAVFDASERES
                     LKSVDSKPRSRSNDHKDIIEGIQPQKHAFVKPSRKVRPTSMQAPGSSYIHHGNFEGLH
                     ELMKRDNSTASSHQTSISSEARIFDASPTLIPDLTKSPSSSTGNSPKLLPRKSFTVSK
                     PLLDLKFASADIIKANESTDSLSKRIHDQIYEVEHPRQRRHSYRYSGIISDLIFGTLS
                     EEGEINTFENKDHKSDAEESEMTISESKLDSVSICSQQSNIHRNISKQASSVSLLRTT
                     SNHSTNNLNVGSRTYGRAELYDKRHLRQIPSNTLNQINAPGNTHRNSAIYSEDDKRKS
                     TAKRVFEFFKRRSMRV"
     gene            complement(<294348..>294479)
                     /locus_tag="CAGL0M02541g"
                     /db_xref="GeneID:2891465"
     mRNA            complement(<294348..>294479)
                     /locus_tag="CAGL0M02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449457.1"
                     /db_xref="GeneID:2891465"
     CDS             complement(294348..294479)
                     /locus_tag="CAGL0M02541g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449457.1"
                     /db_xref="GeneID:2891465"
                     /db_xref="GOA:Q6FJY7"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY7"
                     /translation="MLGAPISRDTPRKTRSKTQFFQGPIVSLITEKCTYEWGNPSIN"
     gene            complement(<295156..>296529)
                     /locus_tag="CAGL0M02563g"
                     /db_xref="GeneID:2891466"
     mRNA            complement(<295156..>296529)
                     /locus_tag="CAGL0M02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449458.1"
                     /db_xref="GeneID:2891466"
     CDS             complement(295156..296529)
                     /locus_tag="CAGL0M02563g"
                     /note="weakly similar to uniprot|Q03010 Saccharomyces
                     cerevisiae YPL139c UME1 or uniprot|Q12206 Saccharomyces
                     cerevisiae YOR229w WTM2 or uniprot|Q12363 Saccharomyces
                     cerevisiae YOR230w WTM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449458.1"
                     /db_xref="GeneID:2891466"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY6"
                     /translation="MTVDTEIASNKLRNEEFKIWKKTIPLLYQHISTMKPKYANASKG
                     TIKDVPCCLTFSDEVIPNKANGTLSTVIYYGIGNEIYSLDCDLPLGLHLQKDTLQPNE
                     KLQLPQFDQIVSRIQSEDLSPKWRAAANCNIYKIKCVGNGKVVALLDSGAIVWFQEST
                     ESPVSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDLSLNGEKIIVSQAVLNEDRTV
                     IKVFSNIDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATPI
                     WKIENEHILSFAFSPLVETLLITGGANGIINFWDVKRLTVKTATTGGDKRQESLLSLS
                     NHVEEPISSVEFSASSPSEFITVGISGSIYHWDVFNYFEKVSELFSEGGDQSAIDSLD
                     TEEIQAESLTFYHTGGSRRHLGKSTKKNSVSVHPIIEGLIGTIDTDGLITVYKPFTGV
                     LPEAEDS"
     gene            complement(<297048..>298130)
                     /locus_tag="CAGL0M02585g"
                     /db_xref="GeneID:2891467"
     mRNA            complement(<297048..>298130)
                     /locus_tag="CAGL0M02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449459.1"
                     /db_xref="GeneID:2891467"
     CDS             complement(297048..298130)
                     /locus_tag="CAGL0M02585g"
                     /inference="similar to AA sequence:UniProtKB:Q03012"
                     /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
                     YPL138c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449459.1"
                     /db_xref="GeneID:2891467"
                     /db_xref="GOA:Q6FJY5"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY5"
                     /translation="MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGC
                     DDWFHFECMKIPETYRNLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYE
                     PCESGSKYCSKEHGKEYMSRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKF
                     KTFGSSSFIDSDIDRVDRHGEIYDKIINDDKYYKDLLTEKDNITNNQIEGLKKKVEEL
                     DKYLDWISSVNKLINGEDNTIEQEENVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAK
                     IPCNPEEFYNKYSEITTSTPDCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETH
                     LKRLDLSISTRKRQLNINYFEHIMRS"
     gene            complement(<298560..>302174)
                     /locus_tag="CAGL0M02607g"
                     /db_xref="GeneID:2891468"
     mRNA            complement(<298560..>302174)
                     /locus_tag="CAGL0M02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449460.1"
                     /db_xref="GeneID:2891468"
     CDS             complement(298560..302174)
                     /locus_tag="CAGL0M02607g"
                     /inference="similar to AA sequence:UniProtKB:Q03016"
                     /note="similar to uniprot|Q03016 Saccharomyces cerevisiae
                     YPL137c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449460.1"
                     /db_xref="GeneID:2891468"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY4"
                     /translation="MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTERSR
                     SLSISNASLSHGMYADPHAKRVSGTMAIPRAMAGAIAGAGAVAIEDDDEVDIRADGGP
                     GARMPALTKTHSLNQETKDEVPVLTPPPTPTQSRNSPSLVSVKRSASTSSKPKKTSLF
                     GSLFGRSRSSSQSNDTEKKLDTAKRLAISTASEKKTYPQELLTPASPVSANSPSPDIR
                     RSTSITKSAKEHRARNSDNTTTDKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKF
                     ETDPPQQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNLGPQFTKDSIEYKRA
                     LEIHQIALKEAEKHQQEAHHAARRIAHEVSNFSNGKQASAPGFMLNLVAQSDQSKRDQ
                     NSAVHDTDINIDLSEKLNKTGIDLPIHMHEHHFDDPGSTLEGNQEITLDVVYTRCCHL
                     REILPIPSTLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLS
                     TEMFKIVISSVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPE
                     TGTELLRSSMDWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQK
                     HLTNGIRLGLANATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSS
                     LTYPNLHYFTLNSTNIQSTNDMALLLKALSKLPNLEFLDLSNLPQVFPDILPYMYKYL
                     PRFPQLKRLHIDNENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTN
                     GDSNSGTVFAKNNFSATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTM
                     DSSFQLDELDSQDELLFDGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQ
                     KLHKIHNNVQQTIDNLFEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSE
                     VLGENKIASSDSLVDHPNLRHVVETDNLNENSNERDLQVNENDNLQQRPHLMATESGR
                     TIDTLTGRPVFSRRSSTTSLASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGESSA
                     VSASTSQTTLPSIDSKEKKIFTKLPSGPELRTAIIKAKGVSSIEELIQKINDYHCCDI
                     ESLYNILKQNELEGNGIVTSESDLTDNEREHLEGAVKNIYEQLLNNASMNRDVKKVNQ
                     "
     gene            <303016..>303657
                     /locus_tag="CAGL0M02629g"
                     /db_xref="GeneID:2891469"
     mRNA            <303016..>303657
                     /locus_tag="CAGL0M02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449461.1"
                     /db_xref="GeneID:2891469"
     CDS             303016..303657
                     /locus_tag="CAGL0M02629g"
                     /note="some similarities with uniprot|Q03020 Saccharomyces
                     cerevisiae YPL135w ISU1 or uniprot|Q12056 Saccharomyces
                     cerevisiae YOR226c ISU2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449461.1"
                     /db_xref="GeneID:2891469"
                     /db_xref="GOA:Q6FJY3"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /translation="MGVCVFFPLCLPCPGALTYIREAQFISSWTPADPRHKQLKMFLQ
                     RFVTVGGAAIGARSTMGAMGAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDK
                     TLPNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHG
                     MTLDDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTSTTTLH"
     gene            complement(<304583..>305971)
                     /locus_tag="CAGL0M02651g"
                     /db_xref="GeneID:2891470"
     mRNA            complement(<304583..>305971)
                     /locus_tag="CAGL0M02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449462.1"
                     /db_xref="GeneID:2891470"
     CDS             complement(304583..305971)
                     /locus_tag="CAGL0M02651g"
                     /inference="similar to AA sequence:UniProtKB:P19541"
                     /note="similar to uniprot|P19541 Saccharomyces cerevisiae
                     YPL133c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449462.1"
                     /db_xref="GeneID:2891470"
                     /db_xref="GOA:Q6FJY2"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY2"
                     /translation="MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLC
                     VADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSS
                     NNNLLLPPQPNFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNME
                     DSIENTQEQTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQ
                     KLNKQESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLK
                     PYDYAKGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFE
                     RMLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEE
                     SAVNFWEKYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGN
                     FIPLSPTRDHSN"
     gene            <306446..>307303
                     /locus_tag="CAGL0M02673g"
                     /db_xref="GeneID:2891471"
     mRNA            <306446..>307303
                     /locus_tag="CAGL0M02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449463.1"
                     /db_xref="GeneID:2891471"
     CDS             306446..307303
                     /locus_tag="CAGL0M02673g"
                     /inference="similar to AA sequence:UniProtKB:P19516"
                     /note="similar to uniprot|P19516 Saccharomyces cerevisiae
                     YPL132w COX11 cytochrome-c oxidase assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449463.1"
                     /db_xref="GeneID:2891471"
                     /db_xref="GOA:Q6FJY1"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY1"
                     /translation="MSYTVGLRMAARRSVLRMTPLSQMRMVPRVSHRWSSNGPSSSAK
                     SSSNGNIDFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLY
                     RAICARTGFGGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVY
                     VLPGETALAFYKAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEID
                     MPVFFFIDPDFASDPSMRNIDDLILHYTFFRAHYGDGSAVSEHQPVEDVNMANAQILT
                     PQVIDATKD"
     gene            <308170..>309063
                     /locus_tag="CAGL0M02695g"
                     /db_xref="GeneID:2891472"
     mRNA            <308170..>309063
                     /locus_tag="CAGL0M02695g"
                     /product="60S ribosomal protein L5"
                     /transcript_id="XM_449464.1"
                     /db_xref="GeneID:2891472"
     CDS             308170..309063
                     /locus_tag="CAGL0M02695g"
                     /note="highly similar to uniprot|P26321 Saccharomyces
                     cerevisiae YPL131w RPL1"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="XP_449464.1"
                     /db_xref="GeneID:2891472"
                     /db_xref="GOA:Q6FJY0"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:Q6FJY0"
                     /translation="MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKY
                     NSPKYRLVVRFTNKDIICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATG
                     LLIARRALQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVF
                     GALKGASDGGLYVPHSENRFPGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEER
                     FSELFKGYLADDIDADSIEDIYASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKK
                     LTKEERDARVAAKIAALAGQQ"
     gene            <309656..>310444
                     /locus_tag="CAGL0M02717g"
                     /db_xref="GeneID:2891473"
     mRNA            <309656..>310444
                     /locus_tag="CAGL0M02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449465.1"
                     /db_xref="GeneID:2891473"
     CDS             309656..310444
                     /locus_tag="CAGL0M02717g"
                     /note="some similarities with uniprot|Q03029 Saccharomyces
                     cerevisiae YPL130w SPO19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449465.1"
                     /db_xref="GeneID:2891473"
                     /db_xref="GOA:Q6FJX9"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX9"
                     /translation="MKRPFIFSSQILASFVVAEQFRAFLSTDEIGSDSIQRGTDDNPL
                     VIRIDKQSYSPELIDTLTKSTNIIFADLPDVPEFIKADKISDVDYQVVQNTWKHKDKK
                     NDEEEKQDDNDKKEDKNKQENNDKNEETKSKTKPNSKTVEDHKTTLSTKTTTHSTIIY
                     TSSKPEKTKESEENSKDSRSGDKGKPYDDSEDNGDSDDELCDDEEEKESKNSNKLPSN
                     HTEPHLGDNEDEFFDNIGNHLNNRGHYQWLLYAILFALPFPNIL"
     gene            <310925..>311881
                     /locus_tag="CAGL0M02739g"
                     /db_xref="GeneID:2891474"
     mRNA            join(<310925..310933,311165..>311881)
                     /locus_tag="CAGL0M02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449466.1"
                     /db_xref="GeneID:2891474"
     CDS             join(310925..310933,311165..311881)
                     /locus_tag="CAGL0M02739g"
                     /note="highly similar to uniprot|P35189 Saccharomyces
                     cerevisiae YPL129w ANC1 transcription initiation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449466.1"
                     /db_xref="GeneID:2891474"
                     /db_xref="GOA:Q6FJX8"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX8"
                     /translation="MVASTKRTIRIKTEQHILPDVPPVENFPVRQWSIEIALLDEEGK
                     EMPATIFDKVVYHLHPTFANPNRTFNEPPFKIVEQGWGGFPLDISLYFLEKGGERKIS
                     HDLNFLQESYEVDHVIQVPLNKPTLTAELAKSGFTEDTSSGSKRKMTGSNTGAESKTK
                     KAKTTTASTIKGNVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFI
                     IDLYSLPEGLLKSLWEYVKKNTE"
     gene            complement(<312153..>313730)
                     /locus_tag="CAGL0M02761g"
                     /db_xref="GeneID:2891475"
     mRNA            complement(<312153..>313730)
                     /locus_tag="CAGL0M02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449467.1"
                     /db_xref="GeneID:2891475"
     CDS             complement(312153..313730)
                     /locus_tag="CAGL0M02761g"
                     /inference="similar to AA sequence:UniProtKB:Q02457"
                     /note="similar to uniprot|Q02457 Saccharomyces cerevisiae
                     YPL128c TBF1 telomere TTAGGG repeat-binding factor 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449467.1"
                     /db_xref="GeneID:2891475"
                     /db_xref="GOA:Q6FJX7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX7"
                     /translation="MTGDIQMASSDTEDVNRFANIIEDLPVKTRLTLSTLSLLNDVST
                     QLLRFLISNAHTPNVIAVISNKENYISTGESEMFHTLVRIFKNIRDVYESRTPLLNVN
                     NVAPGLWLLNMPPPTILKGHEAYIISTIRKANLVTFILTVINCLPYGFDFLQKVYLDV
                     FCPNTILTDQTNGDQVSKFLKPQAIIYLDLKTHAYISSIRDHLGANEQIPDAEKRILL
                     DTIFPDNIAMRLVNRKIVAPNEKKILTPSEKEFVGRCERRKETLIKFTNYTDLLNSYD
                     WTFFVKELLEYCGKNMNLIVWGKKGRSKTALLEFNPSDFDPQILFATGSHLTTDLAVN
                     SHDPSPIGNTFDTGNKEKLIDANELRPLTDAESESINNEIQSALQNESGQGMQKNFMD
                     DAHMSGGENVHSQLVDSNNSILSDVISKSPSVKVVKAKRTWSKEEEKTLITGLIDLGP
                     AWAKILDLYGPGGKINENLKNRTQVQLKDKARNWKLHYLKTGKPLPEYLNRVTGNLDK
                     IAKTKRRGSKEGSIPPN"
     gene            complement(<314946..>315635)
                     /locus_tag="CAGL0M02783g"
                     /db_xref="GeneID:2891476"
     mRNA            complement(<314946..>315635)
                     /locus_tag="CAGL0M02783g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449468.1"
                     /db_xref="GeneID:2891476"
     CDS             complement(314946..315635)
                     /locus_tag="CAGL0M02783g"
                     /inference="similar to AA sequence:UniProtKB:P53551"
                     /note="similar to uniprot|P53551 Saccharomyces cerevisiae
                     YPL127c HHO1 histone H1 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449468.1"
                     /db_xref="GeneID:2891476"
                     /db_xref="GOA:Q6FJX6"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="InterPro:IPR011991"
                     /translation="MAAKKVTKDTKPGYKNLIIEGLKALNNGKGASRVALKKYIKDNH
                     SDVASVSLFDSYFNNAIKKGIDSKEFHFPKGPSGVLKLVKPASTSTTTKAKTTDKKVT
                     KKSTASKASEKKTPAKKTATATTKKVTKPKKDEKKKTTQKKSSAITYREMILTGVLSM
                     NNGKGASRMALKKFIKDKYPTNVEKVVNFDYLVNNAIKKGVESGELSQPSGPSGMVKI
                     LKKGKESIKSI"
     gene            <317204..>319822
                     /locus_tag="CAGL0M02805g"
                     /db_xref="GeneID:2891477"
     mRNA            <317204..>319822
                     /locus_tag="CAGL0M02805g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449469.1"
                     /db_xref="GeneID:2891477"
     CDS             317204..319822
                     /locus_tag="CAGL0M02805g"
                     /inference="similar to AA sequence:UniProtKB:Q02931"
                     /note="similar to uniprot|Q02931 Saccharomyces cerevisiae
                     YPL126w NAN1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449469.1"
                     /db_xref="GeneID:2891477"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX5"
                     /translation="MDIDKFHLSLVSGGKPSLARNVDTPDSKKNSTLLSDDLTHYVIP
                     FNNQIKIYSTETKHCVKTIKFPNHEVLNTVFMNDDVKIVHFAFGDMTKTNDTIDNELL
                     SIVTNTGSLLVLNLKGKLVEDPKHLNISAKLNDPKESISKILFGEATQQIKLITSKVN
                     SDNTLAYYLYDCSFEDNISLTCTHELQNVQNISWSNNNLYLSYLVEQPKSEGSSKTEK
                     IFKCISIFDDSLNQEFDLSIILPSTTVSQSSNSKTVSTIAIDNNGIQLAVGFFSGVIT
                     IVDLADLQTRLLKWHIDSVLSLTFTDDGSYLLSGGWEKVLSFWQLATNMQQFLPRLNG
                     VIVDIDTIGNGKFYSLTLQLTENVTSADYQILLLNAADLTSVLSITGPLAVFSSETKN
                     SKQPLSSMNTKTSESVSSSVVSKKKLKKKLLKNKRQDFTVPACINPVSKQIYFPHMSA
                     IQVYDFYKNEPIAYQYVTSAVAGAMGKVRTELNIQEPLITEVQFTKDGKWMITQETEF
                     PPEDLPSSKDLNYILKFWNKESGEGDWQLKTKVLNPHGLAVPITKILVAPSCINNSEG
                     CLTADNNGGLKYWSFEKHEKNWCLTKVSLPNFNHFSNSVSLAWSSDGSLIFHGFDDKL
                     QVIEFDTLRKFESSFSELTFDFEIQALLLSNDKTLVVATKTTLYAFDILAGAITHSYD
                     LFPYIDGVYKNTNISRLLACNSKSGQIALVVNQQVEDESNNKTLNYKSSIIIFSADLS
                     ERVGSYSHDEYISCIEWNYESDFIFMDIQSRLGVVGATVSTEMSDEVNNEGVFDGLYH
                     ESGNSFHEELKKLSSQKVEAENVDTEDKNDVDLEFINGNFANKAINMNSFTSMMDNIQ
                     NIQMESLFDRVMKVLK"
     gene            complement(<320283..>321739)
                     /locus_tag="CAGL0M02849g"
                     /db_xref="GeneID:2891478"
     mRNA            complement(join(<320283..320948,321650..>321739))
                     /locus_tag="CAGL0M02849g"
                     /product="40S ribosomal protein S0"
                     /transcript_id="XM_449470.1"
                     /db_xref="GeneID:2891478"
     CDS             complement(join(320283..320948,321650..321739))
                     /locus_tag="CAGL0M02849g"
                     /note="highly similar to uniprot|P46654 Saccharomyces
                     cerevisiae YLR048w NAB1B or uniprot|P32905 Saccharomyces
                     cerevisiae YGR214w NAB1A"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_449470.1"
                     /db_xref="GeneID:2891478"
                     /db_xref="GOA:Q6FJX4"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDG
                     VHVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEIEQQTAEEA
                     AQEAGEEEAKEEVTEEQTEAAEWAQENADNVEW"
     gene            <324009..>325811
                     /locus_tag="CAGL0M02871g"
                     /db_xref="GeneID:2891479"
     mRNA            <324009..>325811
                     /locus_tag="CAGL0M02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449471.1"
                     /db_xref="GeneID:2891479"
     CDS             324009..325811
                     /locus_tag="CAGL0M02871g"
                     /inference="similar to AA sequence:UniProtKB:P46982"
                     /note="similar to uniprot|P46982 Saccharomyces cerevisiae
                     YJL186w MNN5 or uniprot|P38069 Saccharomyces cerevisiae
                     YBR015c TTP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449471.1"
                     /db_xref="GeneID:2891479"
                     /db_xref="GOA:Q6FJX3"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX3"
                     /translation="MVSMRLLMNSLRKRKLLVAIQVVVLFLIFSHSFGTDYLIPYNSN
                     TEYASSAARVQPMQLPDPVAKKTLIGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDV
                     SSGGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKL
                     YPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHN
                     GRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIF
                     DTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSI
                     YTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNI
                     YGPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVG
                     LMQTDFEQDYQRHKQVLKELATEKPLEPVKYQLPNHFQDKMKNPDGTSLDIMFLHASF
                     HKFDPADLAKSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKS
                     LKKHEGTEFWTSMCSYFKQRVDFLTKTKPANAFI"
     gene            <326338..>328779
                     /locus_tag="CAGL0M02893g"
                     /db_xref="GeneID:2891480"
     mRNA            <326338..>328779
                     /locus_tag="CAGL0M02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449472.1"
                     /db_xref="GeneID:2891480"
     CDS             326338..328779
                     /locus_tag="CAGL0M02893g"
                     /inference="similar to AA sequence:UniProtKB:P25623"
                     /note="similar to uniprot|P25623 Saccharomyces cerevisiae
                     YCR030c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449472.1"
                     /db_xref="GeneID:2891480"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX2"
                     /translation="MNNHRSTYINQILERKDPYEATETLRIRLSQAKLLNTNLYLFLN
                     QLADLRRNYNQQLRKIIIENEDLNSMLRKQMIENNVLTAEEMQHFTFNSLGEIEPLWN
                     TLVSELKLDLAANTKFSKVIEDEVILGIKNSVEKNSNWGTSKHLHSKLSKVAVSLKRN
                     KDPNTHAELQSEWDADKAKLFQIFETMDYERLYSVKDCLLKYQSGYTDYILKTTEKCD
                     TYMTQFLEFNPEKEIQRFANDASNYKFSQVQPGNNAKYAPSNMNTPNQERGSFNDKTS
                     PSRFASASTVIKHDMGSEQPIMLEDSTTYKNMNKTQKLKSKMGSIFGKNKLKSKKSQQ
                     RLSSSPEKPPLSKSFSSASASTNYSSRKSQMASTMQTPQVDIQNRESGITDQISSSNI
                     STPKSFQQQPKIEQAPIASMSQPALIPNQKDKPLPDINQSKKERDIVSDQNAKSTPEI
                     IQHKPLHITSPNSSKSQTPRQWSTSSAASTTNNEPPAYSPHLSNNDNMPNNTAANTLG
                     SQQMMQPQLTGELTALQAQTTGATGTSSANNSLFQHLPDDFSIFGLNASIAEVLNATF
                     KDGVLTSSQLVGEVALNYVKNTVMNTPLPIGLNLQVTNASTFNKVILNQAFMEKVADT
                     EYKVNPQFIDGRTLGAMKYSIDNTTVPVVIHPIWKFEPHQASVVLTVGLSNQIPESIN
                     ELTLSDFTVMVNIAGTESTSALSKPQGTFNREKNRITWKFKEPLTISRDGENVKLIGR
                     FMTNGQGFEPSDGVMLKFVIREQQGQQDASINIIGSKITLSVQEYDVENPFGGEWQPM
                     RTNRTLASGNYIATS"
     gene            complement(<329147..>329923)
                     /locus_tag="CAGL0M02915g"
                     /db_xref="GeneID:2891481"
     mRNA            complement(<329147..>329923)
                     /locus_tag="CAGL0M02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449473.1"
                     /db_xref="GeneID:2891481"
     CDS             complement(329147..329923)
                     /locus_tag="CAGL0M02915g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449473.1"
                     /db_xref="GeneID:2891481"
                     /db_xref="GOA:Q6FJX1"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX1"
                     /translation="MIRFGMPHNQGSLPAIQASIAYGSSNLPSPEDDFDLRLSPSISG
                     RDTQTLLNYVSSSENDAIISSSRTDDELSGIHDNAENGSSDYYNNILSTSSSTSLGTY
                     EHVIISRTRSPIQEATSLTPNVSTQIDKWCLEIQLDRQRTPSLALADDQVDIDRNDLW
                     TSHILADLDDSHLKRIKEFAAYFLPVLKESRRQQRELQKQTARRNTDTANTRKFRIPS
                     LFNKDLLSLSFENISIESDCSSYIEVLSSPYLNISYSDLT"
     gene            <331097..>332218
                     /locus_tag="CAGL0M02937g"
                     /db_xref="GeneID:2891482"
     mRNA            <331097..>332218
                     /locus_tag="CAGL0M02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449474.1"
                     /db_xref="GeneID:2891482"
     CDS             331097..332218
                     /locus_tag="CAGL0M02937g"
                     /note="highly similar to uniprot|P48510 Saccharomyces
                     cerevisiae YMR276w DSK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449474.1"
                     /db_xref="GeneID:2891482"
                     /db_xref="GOA:Q6FJX0"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6FJX0"
                     /translation="MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRL
                     IYSGKILKDDQTVESYNIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIA
                     SGQTGGFNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQM
                     NEMLSNPEMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNG
                     QGGMPGADATDASAFPAPGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALM
                     DPASNPFAAMMGNMNNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQ
                     QLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV"
     gene            <332990..>335266
                     /locus_tag="CAGL0M02959g"
                     /db_xref="GeneID:2891483"
     mRNA            <332990..>335266
                     /locus_tag="CAGL0M02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449475.1"
                     /db_xref="GeneID:2891483"
     CDS             332990..335266
                     /locus_tag="CAGL0M02959g"
                     /inference="similar to AA sequence:UniProtKB:Q03254"
                     /note="similar to uniprot|Q03254 Saccharomyces cerevisiae
                     YMR277w FCP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449475.1"
                     /db_xref="GeneID:2891483"
                     /db_xref="GOA:Q6FJW9"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW9"
                     /translation="MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVE
                     IANSPDDNDIDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVC
                     EIKRPCNHDIVYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITT
                     RLKNEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPL
                     IYMGPKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKS
                     LFGDRILSRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVG
                     VGDINSNFLPKQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEK
                     LNHQMATAEESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDE
                     LFYLKDTLAYIHKEFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTD
                     IKRADIVIWTSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFE
                     CLASWKRIDEKPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQM
                     EPTMPLFGGDTSWLNDDEDEVEFGSDDDNSDEDSLISEDTDNGLAANGNSSESSITNK
                     VPEATEDVLNNPSDTQNEEDQIPNGNGNHLPKRPIDDVSENAHEMASKKQLTSKDDDR
                     SSDVESDFEEDLLNALDD"
     gene            <335863..>337716
                     /locus_tag="CAGL0M02981g"
                     /db_xref="GeneID:2891484"
     mRNA            <335863..>337716
                     /locus_tag="CAGL0M02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449476.1"
                     /db_xref="GeneID:2891484"
     CDS             335863..337716
                     /locus_tag="CAGL0M02981g"
                     /inference="similar to AA sequence:UniProtKB:Q03262"
                     /note="similar to uniprot|Q03262 Saccharomyces cerevisiae
                     YMR278w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449476.1"
                     /db_xref="GeneID:2891484"
                     /db_xref="GOA:Q6FJW8"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW8"
                     /translation="MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHK
                     RFDSRIVFGTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRY
                     HSQEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKM
                     DNGYKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKR
                     MLTSYLNSVVNQLIQRDFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYIT
                     VPEQKDPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDS
                     KNEWKQLTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGF
                     LYKDTLTGFKWIGNEAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAY
                     ANWLQSSSNPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFP
                     ESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTGESVRFT
                     IRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF"
     gene            complement(<337942..>339618)
                     /locus_tag="CAGL0M03003g"
                     /db_xref="GeneID:2891485"
     mRNA            complement(<337942..>339618)
                     /locus_tag="CAGL0M03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449477.1"
                     /db_xref="GeneID:2891485"
     CDS             complement(337942..339618)
                     /locus_tag="CAGL0M03003g"
                     /inference="similar to AA sequence:UniProtKB:Q03263"
                     /note="similar to uniprot|Q03263 Saccharomyces cerevisiae
                     YMR279c or uniprot|P13090 Saccharomyces cerevisiae YML116w
                     ATR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449477.1"
                     /db_xref="GeneID:2891485"
                     /db_xref="GOA:Q6FJW7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW7"
                     /translation="MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDE
                     CQSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAG
                     QTQSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYI
                     IMTLWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVI
                     SCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTN
                     LNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIK
                     YATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHF
                     MFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQI
                     ILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAH
                     GADLLKGYRSALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC"
     gene            complement(<341849..>345613)
                     /locus_tag="CAGL0M03025g"
                     /db_xref="GeneID:2891486"
     mRNA            complement(<341849..>345613)
                     /locus_tag="CAGL0M03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449478.1"
                     /db_xref="GeneID:2891486"
     CDS             complement(341849..345613)
                     /locus_tag="CAGL0M03025g"
                     /inference="similar to AA sequence:UniProtKB:P39113"
                     /note="similar to uniprot|P39113 Saccharomyces cerevisiae
                     YMR280c CAT8 transcription factor involved in
                     gluconeogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449478.1"
                     /db_xref="GeneID:2891486"
                     /db_xref="GOA:Q6FJW6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW6"
                     /translation="MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSN
                     TGSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGY
                     TETLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFT
                     ENMELQLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALN
                     SMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLK
                     KNLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIP
                     NSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVY
                     KTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKI
                     HLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSA
                     VLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEED
                     SQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLP
                     EKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLE
                     QQLQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINI
                     SRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKL
                     LDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESS
                     QLSSTSNPIAKGELKSDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNT
                     LAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVNKERDSDK
                     QELNAIFNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHG
                     ATSGLNSKGNEFLSMNTLYGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNND
                     ILSTRIGFNGKDDYSNSRSFTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNF
                     GSTNSELHERLNNNHFDAATSYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDTLSLS
                     FGDYSTQRRPRRYPNYNNTLGKDSLAMKTEINGGRNQGNLHDLFQWQNSK"
     gene            <346435..>347349
                     /locus_tag="CAGL0M03047g"
                     /db_xref="GeneID:2891487"
     mRNA            <346435..>347349
                     /locus_tag="CAGL0M03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449479.1"
                     /db_xref="GeneID:2891487"
     CDS             346435..347349
                     /locus_tag="CAGL0M03047g"
                     /note="weakly similar to uniprot|P23797 Saccharomyces
                     cerevisiae YMR281w GPI12 N-acetylglucosaminyl
                     phosphatidylinositol deacetylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449479.1"
                     /db_xref="GeneID:2891487"
                     /db_xref="GOA:Q6FJW5"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="InterPro:IPR024078"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW5"
                     /translation="MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVE
                     DLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDA
                     DGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEP
                     GVKQKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKY
                     SGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAH
                     KSQMVWFRYLWWSFSRYVFVNDLSRITV"
     gene            complement(<347584..>349230)
                     /locus_tag="CAGL0M03069g"
                     /db_xref="GeneID:2891488"
     mRNA            complement(<347584..>349230)
                     /locus_tag="CAGL0M03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449480.1"
                     /db_xref="GeneID:2891488"
     CDS             complement(347584..349230)
                     /locus_tag="CAGL0M03069g"
                     /note="weakly similar to uniprot|P22136 Saccharomyces
                     cerevisiae YMR282c AEP2 required for the expression of
                     subunit-9 of atp synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449480.1"
                     /db_xref="GeneID:2891488"
                     /db_xref="GOA:Q6FJW4"
                     /db_xref="InterPro:IPR024319"
                     /translation="MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTK
                     NVEVSKYSHVELRSLNEQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEG
                     SVEDAIQLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGG
                     SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFL
                     MLRSGALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYN
                     DKDNHSQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSD
                     LLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTI
                     DLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSL
                     VTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF
                     VVLRNRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW"
     gene            complement(<349679..>352171)
                     /locus_tag="CAGL0M03091g"
                     /db_xref="GeneID:2891489"
     mRNA            complement(<349679..>352171)
                     /locus_tag="CAGL0M03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449481.1"
                     /db_xref="GeneID:2891489"
     CDS             complement(349679..352171)
                     /locus_tag="CAGL0M03091g"
                     /inference="similar to AA sequence:UniProtKB:P09880"
                     /note="similar to uniprot|P09880 Saccharomyces cerevisiae
                     YJL087c TRL1 tRNA ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449481.1"
                     /db_xref="GeneID:2891489"
                     /db_xref="GOA:Q6FJW3"
                     /db_xref="InterPro:IPR012387"
                     /db_xref="InterPro:IPR015965"
                     /db_xref="InterPro:IPR015966"
                     /db_xref="InterPro:IPR019039"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW3"
                     /translation="MNLSRNVKDLVEKLEAASQLPGRGKAIKRICKLSNSDGQVVSWK
                     FNEWDYGKNNIKLPCCARGLFITDDSKNPQIVARGYDKFFNIDETPFTRWDTLESDTK
                     GTYNVTLKANGCIIFVSGMADGTLVVCSKHSTGPRDDVDRNHADAGEQFLLSQLKSIG
                     IEPQQLALELYQNNVTAVAEYCDDTFEEHILEYTNDDVGLYLHGINYNETTFRTWDMD
                     SVSEFARKYNFKQIKYENFNDFTLLKKFLEECSNSGTYHGQEVEGFVIRCKTRENGND
                     FFFKYKFEEPYLMYRQWREVTKDYISTKSRVFKFKKHKFITNKYLDFVIPILDSSPAL
                     CEEYMKGFGIIKLRNEFLKDFGMSGLEILNHEKVLELENANKIDYDTVDEHTKFLIIP
                     VAVIGCGKTTTAMTINNIYPESWGHVQNDNITGKDNSLLMKRSLELLAKPGIKCVVVD
                     RNNHQARERKELFDWIDEYKEDYLPYDTNIKVICLSFTKRDDLENVREITTNRVFARG
                     DDHQSIKLSKYGEKKVMGIMSGFIKRFQPVNEDRMPDIMFDHVIDLTVTEKDSSLINA
                     KRILNNLHDKYPVLVPTVPTDEEIRAAFEKSLEYKPTTVKIINEKGSRRNKNKDKKHT
                     SAPTMKKLKPVYFFAELRDPTKLLRCIKAFIEENRSSIDNDSYIHIDRLFQDKKYQEK
                     LHVTLIHLMQGKKGTETQQQLWDDYLRSFDEYLTVNPETFDKNCDRIKTKYSIKVTVQ
                     SLYWDSKIATLTVKPELVEVERDGSLNTLACCNDIPHITLGILEEGIKPVYSNELLKM
                     MNQNDKESRPANSFCLELAGLEVQIADVYIHL"
     gene            <352552..>354423
                     /locus_tag="CAGL0M03113g"
                     /db_xref="GeneID:2891490"
     mRNA            <352552..>354423
                     /locus_tag="CAGL0M03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449482.1"
                     /db_xref="GeneID:2891490"
     CDS             352552..354423
                     /locus_tag="CAGL0M03113g"
                     /note="highly similar to uniprot|P19658 Saccharomyces
                     cerevisiae YJL085w EXO70 exocyst component protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449482.1"
                     /db_xref="GeneID:2891490"
                     /db_xref="GOA:Q6FJW2"
                     /db_xref="InterPro:IPR004140"
                     /db_xref="InterPro:IPR016159"
                     /translation="MNEIDVDEADILVLSQGLEKTSRLTHQVNKSLAKISKTSAQSSQ
                     LFGPILARNNVLKTLQRNIDSTLNSVASVKDLANEASKHEVLLRKGIASLGLKPFTVE
                     LHKLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELEFIQILKRIEPFDP
                     QINMEKKIPFPYYSDEDISQMLIIFNYFYVKSEDSRMQDIFIRERGDQMLKSMAFMEP
                     FAKKVTSSKNAPYEKGSSGFINYTEAVLGFIANERSLIDDVFSQFAEIKPRVLRNILD
                     PIVAAFCKVLMSDLIFVKSNIDNAGLFSFELTECISGVQKSVKGMNLKNQMQLIDADK
                     QVKDVTRSLFKDTVDRIKSKTNQMTTIPSDNGVTEATVDTMSRLRKFSEYKTGCLAAM
                     ESISRDVWLSKSFREKEYTIQSAAIADNETAASLLSCFLSDCIDTLVANLERRAQTIL
                     MPNQEPDVANPNSARNKFKQRIGFLVLMNMTLVEQIVEKSELSVMLGNLGKARIEKLK
                     KRYVNYLVADWKDLTVNLMDTVVIDSVGKKSKDKEQIKEKFRRFNEGFEDLISRTKQY
                     KLSDPALKRLLKSEIVALLMPMYDRFYGRYKDSFKNPRKHIKYTPDDITNVISQTLR"
     gene            complement(<354638..>357859)
                     /locus_tag="CAGL0M03135g"
                     /db_xref="GeneID:2891491"
     mRNA            complement(<354638..>357859)
                     /locus_tag="CAGL0M03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449483.1"
                     /db_xref="GeneID:2891491"
     CDS             complement(354638..357859)
                     /locus_tag="CAGL0M03135g"
                     /inference="similar to AA sequence:UniProtKB:P47029"
                     /note="similar to uniprot|P47029 Saccharomyces cerevisiae
                     YJL084c or uniprot|P36117 Saccharomyces cerevisiae
                     YKR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449483.1"
                     /db_xref="GeneID:2891491"
                     /db_xref="GOA:Q6FJW1"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:Q6FJW1"
                     /translation="MPIADSNSPLFPIGKDLTIPTDAKPVASTASVQIYIKLAEPVVF
                     LQDFENLNHSDKPPGILRGSLILRILKPTKVKNLTLNFKGYARTEWIEGIPPKKQEFA
                     EINDIINHTWPFYQSSEHHHSHHAHSSTASSSPAASNATSNNSGSNTRTGTPGNEDSP
                     VYKGTGAALYRPLPRSTSERALRTGATQSSTPTNFSPLKNNTVLRSKSKDNLDDFARK
                     RVLSRASSHSTLTNNSFNSSSNNNNGHTLNKTLSPMSFLRRATSSNSAHAFGVNDTPS
                     ASHRNGASTPTHPAPTGSFISDILSGNFASPGDSTTHNHAGNSSHQVNSNNQSQQATA
                     DFDPVGENGTFQPGDYIYPFEQLIPQSYPETVKAEFGFVEYYLFVSLERHGPFKSNLT
                     GRTPVNIIRTQSDNSVEESEPIIISRDWENALFYDIVIGSKDIVLDAFLPINFRLSPM
                     EKLTLHRIRIYVTETMEYFCKNQKVHRIEPTKKFLLAEHKGPRVPGLPKDANYNKAKN
                     MGNLLLDESSGDLVNKEFQYQLFVPSKFNNHQKIHPDTTYDNIKANHWIKICLRLSRV
                     VGDKRKHYEISIDSPMRVLHKLCSHANTLLPSYESHLIFNKQNFTDSSSQKNRESTND
                     NELGLYHDSNIFFPKEVLMSPLLSPDVQALDVNTESIYNAPYRVIRHDEFDDSRHKSG
                     NDPSANVFNSPTLKSNIYQPDSIQRELASPQAVPLSPMLSSLSLTDFHQSNPPDFESL
                     EDQLSAATTRSNSPMILPKDPPTYKEATHNDPSGVVASASIPKIKLSHSQESLPINNK
                     NLRIKGLTPFSDTASIDTLSNDSDIAAGFQFSSSPNLTHSLLRSHSPSMISLHTGENV
                     KNTPRLDVSHDNMPSTIRDDRHFFNDISQILGDEAEENENHLKLSRTHESSNGEASAR
                     SSFDMSAINFRKDSVTAEPLLSNRNNSQISGIGNFAMPSKESLPLLGSPTDSSVDITA
                     LYDRNSAAWHPLQLEGEIPLSPIVSNESHSNMLFKANQRPNDDATNTSHDDMLTRDVN
                     PTDDSSGGLSDTDHRRTSHIGEHEKPITNAAETHKNINAVDSI"
     gene            <358599..>361211
                     /locus_tag="CAGL0M03157g"
                     /db_xref="GeneID:2891492"
     mRNA            <358599..>361211
                     /locus_tag="CAGL0M03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449484.1"
                     /db_xref="GeneID:2891492"
     CDS             358599..361211
                     /locus_tag="CAGL0M03157g"
                     /note="some similarities with uniprot|P47030 Saccharomyces
                     cerevisiae YJL083w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449484.1"
                     /db_xref="GeneID:2891492"
                     /db_xref="GOA:Q6FJW0"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR011992"
                     /translation="MHMRLNKRRRNHVQEQMSELPQDAKNDSLAAAQVIFKRHADNAN
                     STPPSPVGLDSAGHLDKQADTAQRVHKVGTPSGTSSSHNSGNEGMHKVTKPLGENTAT
                     TAPIAIKQPVRVVRASPTAIVSPTSHTPLDAATAAANVVAEKSKIRTTQQQLQDKKRR
                     DIENAHHAASAAAVTSSNLAVGSPPSQYIPSVPTLNVTSPQMRNSSQNIDRRSKSNEE
                     AHNGHEKMMNSRSNSINSSTIKGSVSEPNTVTPLRQNSPSNMDDIIQKMEAVDIDEGR
                     KNSFVMNGSGDSVDSLKPNVVRRPMRTPSGRRVRPPSPIDKIGSIQEPHLESTGFNDQ
                     NDFSEMSSLIDGSSSEDITKIRGSGIRERSPVDGVEHGGMSVNIPMQRSLSSDVLSPS
                     QQAAMVAATKLSPSTQTLPVEELEYLASTGDVSAYKALNKINGTNMAYKGTIPDLIPS
                     RARAQKTSKLKFKIFGGGKNSDRRNNATPIGYDPVMNISTDFGGKKVVESNQNNVKFK
                     TTMRSQKYLGNDNLDDNDLRTQYIDDDDDDDDYDSAYEDLDYSRDDSEAMYKGDRESS
                     NPRSNSLLQSSSYSGKVGFNSNANSGTSINNSGNVSNLDYSLRDGVAEKKKSRRDKIK
                     KKLKSTASVVPYYPHYALTHLASGVSTVNSNLNNSNKNTKWFNEDKPWKSHKDVGFVT
                     SQERKRYEAMWVTNRYLYLNLLPWWPKEEVEKDEDDSASNLNSNASTNVGGVLSDGDN
                     EEDDVTRFLLSLPADGLMLNLVAKDIWERSNLPNDLLKQIYDLVDTRKDGTLNRESFL
                     VGMWLVDQCLYGRKLPQELDPKIWDSVDRWVLNVVNSTMMTALERKQKKKMMKKELKN
                     IKREQKQAIAEQHN"
     gene            <362253..>364484
                     /locus_tag="CAGL0M03179g"
                     /db_xref="GeneID:2891493"
     mRNA            <362253..>364484
                     /locus_tag="CAGL0M03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449485.1"
                     /db_xref="GeneID:2891493"
     CDS             362253..364484
                     /locus_tag="CAGL0M03179g"
                     /inference="similar to AA sequence:UniProtKB:P47031"
                     /note="similar to uniprot|P47031 Saccharomyces cerevisiae
                     YJL082w IML2 and similar to uniprot|P36114 Saccharomyces
                     cerevisiae YKR018c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449485.1"
                     /db_xref="GeneID:2891493"
                     /db_xref="GOA:Q6FJV9"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR019412"
                     /translation="MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIAL
                     RAMDYVLDDRTEEGLALLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASN
                     TLAKAEQLSWKSRTEAQKSGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAA
                     KALLKLRKAYSMLHEIMEVVKKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQ
                     LSETESNDPELWAFAEKIYKMRKLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANS
                     EQSVLSDEAAERQATIDEFIHSGVNLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEG
                     LRLIWKATKDRNVHGCIGLLGLMFYYDGPFQFTDVDFDIPPALSNTKTSDSDTDRDGS
                     ISIDEMDGHALLHPGPILEEALLHARALFPNSALWLLNEARMLSSRGRLPEAIELLDS
                     IDVESIHMRQVKGLLVFDKAITLVHMQEYERAATNLLSLLKISDWSHAFYTYFAGCCY
                     LENWRMAQMGFIKDDKLEFYREKAEELIFSAPKLLGKKTFKSKNLPLDRFMLRKVEQF
                     KATQKKLGVKNILDAIGTSPIREITYFYNGYNRMSKSDLEIAQKMLTSYHNPAIDQHD
                     PDQELIKNLLLSLTMRRLGDVESGVKLLDEKVLPSIYYMQNGKVKYIKKTEDPWAYPT
                     ALYERALFTWKLDGVDNLSECRHWLVTAQNYAGDYELSTRVGMKIKAALDRVEESLQH
                     GTA"
     gene            complement(<364771..>366252)
                     /locus_tag="CAGL0M03201g"
                     /db_xref="GeneID:2891494"
     mRNA            complement(<364771..>366252)
                     /locus_tag="CAGL0M03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449486.1"
                     /db_xref="GeneID:2891494"
     CDS             complement(364771..366252)
                     /locus_tag="CAGL0M03201g"
                     /inference="similar to AA sequence:UniProtKB:P80428"
                     /note="similar to uniprot|P80428 Saccharomyces cerevisiae
                     YJL081c ACT3 protein Actin-like protein ARP4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449486.1"
                     /db_xref="GeneID:2891494"
                     /db_xref="GOA:Q6FJV8"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027667"
                     /translation="MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSF
                     GEIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQW
                     SWALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSF
                     ATGRPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPL
                     FEVEQRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATS
                     TGRTIESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMK
                     RNKVGSGNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDL
                     ISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSI
                     ERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR"
     gene            complement(<366828..>370457)
                     /locus_tag="CAGL0M03223g"
                     /db_xref="GeneID:2891495"
     mRNA            complement(<366828..>370457)
                     /locus_tag="CAGL0M03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449487.1"
                     /db_xref="GeneID:2891495"
     CDS             complement(366828..370457)
                     /locus_tag="CAGL0M03223g"
                     /inference="similar to AA sequence:UniProtKB:P06105"
                     /note="similar to uniprot|P06105 Saccharomyces cerevisiae
                     YJL080c SCP160 required for maintenance of exact ploidy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449487.1"
                     /db_xref="GeneID:2891495"
                     /db_xref="GOA:Q6FJV7"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:Q6FJV7"
                     /translation="MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEESKPVEEAPK
                     PEPKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRM
                     RSNNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPK
                     VKEAKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPD
                     SYNEDLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVK
                     EVSSDDVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQF
                     LIDADEVKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISK
                     AHNKNLDHAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDK
                     TSEIKAARREIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYF
                     KGDDSVVLFATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQD
                     EFFGKDSVALKLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVEN
                     PSTTAKITVEVPVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKG
                     LQFIIEHAKKDIANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINF
                     LKENNTITIKGPSRGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTIN
                     GLSDEFGVELDFLQKSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTE
                     KLDIDRKYHKTIVGAGGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFV
                     SNVVKAINKIVEESQNSITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDE
                     EETRVSLTGLPENIEKAEKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEK
                     FVNVRYGNATKKANNLNRTPVDIPYEKVAGAEGEKVKFTVEETGPSVVENVDGEIPWR
                     LIYEPIDFDSILDEENGEKKEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWT
                     SDPSKFFKVVGMGGSNVKKIRESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAII
                     KSLKQ"
     gene            complement(<372122..>373810)
                     /locus_tag="CAGL0M03245g"
                     /db_xref="GeneID:2891496"
     mRNA            complement(<372122..>373810)
                     /locus_tag="CAGL0M03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449488.1"
                     /db_xref="GeneID:2891496"
     CDS             complement(372122..373810)
                     /locus_tag="CAGL0M03245g"
                     /inference="similar to AA sequence:UniProtKB:P39994"
                     /note="similar to uniprot|P39994 Saccharomyces cerevisiae
                     YEL020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449488.1"
                     /db_xref="GeneID:2891496"
                     /db_xref="GOA:Q6FJV6"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:Q6FJV6"
                     /translation="MGKKVIHSRNIASLLKYQYDVDVVFGIVGIPVVEFAQELQSVGI
                     RFIGFRNEQAASYAASAYGYLTGKPGVLLVVGGPGVIHALAGVYNSMNNRWPLLIIAG
                     SVPRDEKYQGGFQELDQVSLLKPYLKFAGELTGTKKDANIVFNAWNSATQGTPGVSYI
                     DFPGDLITDVVEAIEFYKHETKRITTGPDPRSIAEVTSLIKEHQDKNILVVLGKGCIN
                     SSLALRHFIEEFNFPFLPTPMAKGILPDSHRLNVSAARSQALKSADLVLVFGARLNWI
                     LHYASPPKWNSNAKFVQVDIEPLTLGVNNPNGTSYCIWGDIQLTIENLRDTLHKLDFV
                     KHKGLTKELKEKIESNKHNLRVRLNPENYYGAKMLNYYSVYSMLKNLIDDRSSFIVSE
                     GANTMDIARISFETDFPKRRLDAGTNATMGVGLGYAIAAKVHSPELNIVTIQGDSAFG
                     FSGMEIETAVRYRLGIIFIIMNNSGIYHGSDPSTITNETQLPPTMLSEKCRYDLVARG
                     LGAKGYLVKNLQELEYYYKKALVHTRERIPCLLNVIIEPGQNKKISFGWQKSKL"
     gene            complement(<374158..>374958)
                     /locus_tag="CAGL0M03267g"
                     /db_xref="GeneID:2891497"
     mRNA            complement(<374158..>374958)
                     /locus_tag="CAGL0M03267g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449489.1"
                     /db_xref="GeneID:2891497"
     CDS             complement(374158..374958)
                     /locus_tag="CAGL0M03267g"
                     /note="weakly similar to uniprot|P38632 Saccharomyces
                     cerevisiae YEL019c MMS2 DNA repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449489.1"
                     /db_xref="GeneID:2891497"
                     /db_xref="GOA:Q6FJV5"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:Q6FJV5"
                     /translation="MDSVALPEALPIHKDQRDNFHDLRECYISSELSTIEKQYEKTIN
                     QLTTYIDLLEEDQILQCVNKLTESYKDTLAQKEQADQLDNQLESLKQDYLRISDHSPA
                     TDIDSFREYTNGTVGIDSFQKYFTEGIVDQKPTIPRNNVRRKPNTYEKLLKALPYIIR
                     DPTCVIPDEDQEEDDIQIEGGKIELNCPITCKPFENPMISKACNHVFDKVGIQMYFDT
                     PDKKKCPQGACGHELTARDFIPDNIMMLRCKINNRKKNDQARNMLDVL"
     gene            <375233..>375850
                     /locus_tag="CAGL0M03289g"
                     /db_xref="GeneID:2891498"
     mRNA            <375233..>375850
                     /locus_tag="CAGL0M03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449490.1"
                     /db_xref="GeneID:2891498"
     CDS             375233..375850
                     /locus_tag="CAGL0M03289g"
                     /note="some similarities with uniprot|P39995 Saccharomyces
                     cerevisiae YEL018w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449490.1"
                     /db_xref="GeneID:2891498"
                     /db_xref="GOA:Q6FJV4"
                     /db_xref="InterPro:IPR026226"
                     /translation="MNEEIQTLLIYQICDSLRFQANMEDISVDDVMDVMQENIMVECL
                     LDGVIMDKADVQKIVIQYVTDGELGEEAIGDKMESMYSNSRKKLLKEIDDLDNTISTN
                     RKKDKLLNLYRDTVLNRLQNKKTVLDKLYHGMKEDSSVIRNRIYLERIKNETPNSIAE
                     LQLMLQRSIADCIMSEPIGSEKYNIAKEIQINLEDTIRFMKRALE"
     gene            complement(<376045..>376164)
                     /locus_tag="CAGL0M03305g"
                     /db_xref="GeneID:9488056"
     mRNA            complement(<376045..>376164)
                     /locus_tag="CAGL0M03305g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999554.1"
                     /db_xref="GeneID:9488056"
     CDS             complement(376045..376164)
                     /locus_tag="CAGL0M03305g"
                     /note="highly similar to uniprot|P40975 Saccharomyces
                     cerevisiae YEL017ca PMP2 plasma membrane ATPase
                     proteolipid 2 or uniprot|P32903 Saccharomyces cerevisiae
                     YCR024ca PMP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999600.1"
                     /db_xref="GeneID:9488056"
                     /db_xref="GOA:B4UN57"
                     /db_xref="InterPro:IPR012589"
                     /db_xref="UniProtKB/TrEMBL:B4UN57"
                     /translation="MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF"
     gene            <377932..>378930
                     /locus_tag="CAGL0M03311g"
                     /db_xref="GeneID:2891499"
     mRNA            <377932..>378930
                     /locus_tag="CAGL0M03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449491.1"
                     /db_xref="GeneID:2891499"
     CDS             377932..378930
                     /locus_tag="CAGL0M03311g"
                     /inference="similar to AA sequence:UniProtKB:P39996"
                     /note="similar to uniprot|P39996 Saccharomyces cerevisiae
                     YEL017w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449491.1"
                     /db_xref="GeneID:2891499"
                     /db_xref="GOA:Q6FJV3"
                     /db_xref="UniProtKB/TrEMBL:Q6FJV3"
                     /translation="MSTFARWRKAELFDLMNKLKITDVSNSTKKSDMIVLIEHYLENL
                     SAPLDYMHDFPELQTYYEDKQQLKIESDIEDELDKISSTSEDMEYGEDIDMKEETSET
                     SSDSSAEETETVVEKKDYNNLDFSEEPTKLQDFKFNFDQILDDIIDRAYIINENVKDY
                     LSSISAVESIFTIIELVLFSVHLFANYRTGETVLSAQHSIGYMDYYFRPEYYKREVVH
                     FLNKIGLPILTWFFLLRIVPCFVSYYINFIRYELLVDMDPMVYHLFKGIVEFLIITRF
                     NDNQNPIQGFLSSFSFSPLGHLHVDPCRDLREFNDALGYLPLCFSVVCTILTLYIL"
     gene            <379851..>381758
                     /locus_tag="CAGL0M03333g"
                     /db_xref="GeneID:2891500"
     mRNA            <379851..>381758
                     /locus_tag="CAGL0M03333g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449492.1"
                     /db_xref="GeneID:2891500"
     CDS             379851..381758
                     /locus_tag="CAGL0M03333g"
                     /inference="similar to AA sequence:UniProtKB:P39998"
                     /note="similar to uniprot|P39998 Saccharomyces cerevisiae
                     YEL015w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449492.1"
                     /db_xref="GeneID:2891500"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR019050"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:Q6FJV2"
                     /translation="MSQFIGYGVKLELKDGKILEGKITKATSKGLVLSDVKFEDGGSS
                     QLFKVRSSQLKDLKVVSVRQKNGKGNGSNGNAANKSSRNKSRNDYSMNSGSQTNGNTS
                     HGGSRHNNNNNNNSRYDSDWANDDVNQIKLQDDFDFQGNLNMFNKKDVFAQLKQQDDV
                     APELRLVAHNKKKDYEKPKNFNIDEMVIPNAKEDSWHKIDSERPQQQKSDGYLDFESG
                     TDDDDVDDHEDRQLSNTRDRKNNNQIKHNVEDDDDDDDEGLEFHDADELPITQAVNIT
                     HLLHKAAKGSNSGKSKDGSQGNEQMLAKLEQMIIQQSKGSTRRNSSISSKKPTLLKIK
                     DSSKQIATATPVQLLEIERIAQDHFGITAPILIENFAINLAQVIKQKLGGKARLRLEN
                     SNAEPLVVILTSDSVRSGARALALGRQLCRTGHIRVITMFTTSVNEIQDSLVKEQLEL
                     FKKCGGKVVNKVSSLESAVMSLNSPVEIVIDAMQGFDYNISDIFENIAEAEQADEDVN
                     ASDQNRRNNTRNSVSKAETIEQRITDIINWCNNQRGSTKIWSLNVPSSFDSGSGVQNF
                     PVAVQATGVICTGWPLSSLPNIKYTLSSLDDVVAVDMGFPRGVYTLQNSLRKFLSFDV
                     FAIEGSIALEL"
     gene            <382549..>384297
                     /locus_tag="CAGL0M03355g"
                     /db_xref="GeneID:2891501"
     mRNA            <382549..>384297
                     /locus_tag="CAGL0M03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449493.1"
                     /db_xref="GeneID:2891501"
     CDS             382549..384297
                     /locus_tag="CAGL0M03355g"
                     /note="highly similar to uniprot|P39968 Saccharomyces
                     cerevisiae YEL013w VAC8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449493.1"
                     /db_xref="GeneID:2891501"
                     /db_xref="GOA:Q6FJV1"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MGGCCSCFRDSSDDVSVLPITDNEREAVTLLLGYLEDKDRLDFY
                     SGGPLKALTTLVYSDNLNLQRSAALAFAEVTEKYVRQVSRDVLEPILILLQSQDPQIQ
                     VAACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLATRDDNK
                     HKIATSGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAVPVLVSLLS
                     SNDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALR
                     NLASDTSYQLEIVRAGGLPHLVNLIQSESVPLILASVACIRNISIHPLNEGLIVDAGF
                     LPPLVKLLDYRDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVKKCKELALDSPVSV
                     QSEISACFAILALADVSKQDLLDADILQALIPMTFSTNQEVSGNAAAALANLCSRIDN
                     YSKIISSWDQPKEGIRGFLKRFLQSNYATFEHIALWAILQLSESHNDKVIYLIKNDKE
                     IINSVRKMADVTYDRLQKSGVDVNKNGNSEERGDNEDHQSNNDRNLANSTSSDQYEDA
                     SMELYNITQQILQFLD"
     gene            complement(<385581..>387701)
                     /locus_tag="CAGL0M03377g"
                     /db_xref="GeneID:2891502"
     mRNA            complement(<385581..>387701)
                     /locus_tag="CAGL0M03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449494.1"
                     /db_xref="GeneID:2891502"
     CDS             complement(385581..387701)
                     /locus_tag="CAGL0M03377g"
                     /note="highly similar to uniprot|P32775 Saccharomyces
                     cerevisiae YEL011w GLC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449494.1"
                     /db_xref="GeneID:2891502"
                     /db_xref="GOA:Q6FJV0"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /translation="MSLTKIPENVQGAVSIDPWLEPFADVLSERRYLADKWLYDIKHA
                     TPDGSEQSLVDFARNAYKTYGLHANQQTKEIVYREWAPNAQRAFLVGEFNNWNEESHE
                     MKHKDEFGVFSITLAPLENGDFAIPHDSKIKVMFVLPDGSKVYRIPAWITRATQPSKE
                     TAQKYGPTYEGRFWNPPNSYQFKHQRPKFNLANDSIKIYEAHIGISSPEPKVASYKEF
                     TQNVLPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRYGTPEDLKELIDTAH
                     SMGILVLLDVIHSHASKNSEDGLNMFDGSDHQYFHSLTSGRGEHPLWDSRLFNYGSFE
                     VQRFLLANLAYYIDVYQFDGFRFDGVTSMLYLHHGVGAGGAFSGDYNEYLSRDRSGVD
                     HEALAYLMLANDLVHDLLPESAVTIAEDVSGYPTLCLPRTAGGGGFDYRLAMALPDMW
                     IKLLKTKQDDDWDMGHIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYT
                     DMTVLKEPTLVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPRVGNNDS
                     YHYARRQFNLVDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFE
                     RNGHLFVFNFHPTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLE
                     WNNRRNFIQVYIPSRTAIVLTRQM"
     gene            complement(<389650..>390294)
                     /locus_tag="CAGL0M03399g"
                     /db_xref="GeneID:2891503"
     mRNA            complement(<389650..>390294)
                     /locus_tag="CAGL0M03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449495.1"
                     /db_xref="GeneID:2891503"
     CDS             complement(389650..390294)
                     /locus_tag="CAGL0M03399g"
                     /note="highly similar to uniprot|P28263 Saccharomyces
                     cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449495.1"
                     /db_xref="GeneID:2891503"
                     /db_xref="GOA:Q6FJU9"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU9"
                     /translation="MSGNSKRRIETDVMKLLMSDHEVELVEDSMQEFHVKFYGPKDTP
                     YEGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLN
                     IVEWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDKYATKERYESQFGTP
                     EDDEDDGDDAEMKDEDGDDDIDEPVSDLEDISDDNADPSEELSDISDIELSDED"
     gene            complement(<390927..>391586)
                     /locus_tag="CAGL0M03421g"
                     /db_xref="GeneID:2891504"
     mRNA            complement(<390927..>391586)
                     /locus_tag="CAGL0M03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449496.1"
                     /db_xref="GeneID:2891504"
     CDS             complement(390927..391586)
                     /locus_tag="CAGL0M03421g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449496.1"
                     /db_xref="GeneID:2891504"
                     /db_xref="GOA:Q6FJU8"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU8"
                     /translation="MFFVSSTGIDISDAGKEFSFSSVESKFAQRWFIGNCKHRNPSRK
                     NAINQFFKSNAYSETINYSRKLKQKKLKQKEMAAMQRQNTTLLTAGSQNQEQPENSSR
                     EITNLLTGNDIWRHKRDDQVVVDTVTVHKKTKSFWKSFKHMRKQIRKLRLQKKNVYKP
                     QGCTTHTQRQCSKKETLERINFLKPLPYLVGDSYSPEIIKQNILAITEHSEQNLLLTD
                     Y"
     gene            392109..392182
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0M03443r"
                     /db_xref="GeneID:2891505"
     tRNA            392109..392182
                     /gene="tRNA-Asn (GTT)"
                     /locus_tag="CAGL0M03443r"
                     /product="tRNA-Asn"
                     /db_xref="GeneID:2891505"
     gene            complement(<393154..>393990)
                     /locus_tag="CAGL0M03465g"
                     /db_xref="GeneID:2891506"
     mRNA            complement(<393154..>393990)
                     /locus_tag="CAGL0M03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449497.1"
                     /db_xref="GeneID:2891506"
     CDS             complement(393154..393990)
                     /locus_tag="CAGL0M03465g"
                     /note="highly similar to uniprot|P25613 Saccharomyces
                     cerevisiae YCR010c SPG2 or uniprot|P32907 Saccharomyces
                     cerevisiae YNR002c FUN34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449497.1"
                     /db_xref="GeneID:2891506"
                     /db_xref="GOA:Q6FJU7"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU7"
                     /translation="MSDKDQGSAQLAGDHQEYQNKNYDSDVENMAGGDHEIGKIYTSG
                     ANNEYIYIGRQKFLKTDLYEAFGGTLNPGLAPPSSHKFANPAPLGLSAFALTTFVLSM
                     FNAKAQGIVVPNVVVGLAMFYGGLVQLIAGIWEIALENTFGATALCSYGGFWLSFGAI
                     YIPWFGILEAYKDKESDLGNALGFYLLGWTIFTYGLTLCTLKSTVAFFALFFLLALVL
                     LLLSIGEFSGKVGCKRAGGVVGVVVAFIAWYNAYAGVASRQNSYIVAHPFPLPTNEKT
                     LY"
     gene            complement(<396552..>397505)
                     /locus_tag="CAGL0M03487g"
                     /db_xref="GeneID:2891507"
     mRNA            complement(<396552..>397505)
                     /locus_tag="CAGL0M03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449498.1"
                     /db_xref="GeneID:2891507"
     CDS             complement(396552..397505)
                     /locus_tag="CAGL0M03487g"
                     /note="highly similar to uniprot|P32910 Saccharomyces
                     cerevisiae YNR003c RPC34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449498.1"
                     /db_xref="GeneID:2891507"
                     /db_xref="GOA:Q6FJU6"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU6"
                     /translation="MSDINNATIQLSDRAKELHNVMITKGSGALFTQQELSERSGLAS
                     LSDLMSIVQELLDKNLLKLVKQNNELKFQAVDFFEAQKKSTMSAEEALVYSYIESSGR
                     EGIWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKHPTRKIYMLYHLQPSIEVT
                     GGPWFTDSELDVEFINSLLTIVWRFVSECTYPGGFSNFQNGSQGALYAPGIKNYCSLE
                     DILQFIEQAQVANVQLNLGDIRSLCEVLVYDDKLERVLHDHYRVTLSSVMQMNQVASV
                     SQADDATDMYAESEYSIFDFHTVMAPSSMDKEAVYFDEWVL"
     gene            complement(397755..397826)
                     /locus_tag="CAGL0M03509r"
                     /db_xref="GeneID:2891508"
     tRNA            complement(397755..397826)
                     /locus_tag="CAGL0M03509r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT)"
                     /db_xref="GeneID:2891508"
     gene            complement(<398183..>400981)
                     /locus_tag="CAGL0M03531g"
                     /db_xref="GeneID:2891509"
     mRNA            complement(<398183..>400981)
                     /locus_tag="CAGL0M03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449499.1"
                     /db_xref="GeneID:2891509"
     CDS             complement(398183..400981)
                     /locus_tag="CAGL0M03531g"
                     /note="highly similar to uniprot|P32074 Saccharomyces
                     cerevisiae YNL287w SEC21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449499.1"
                     /db_xref="GeneID:2891509"
                     /db_xref="GOA:Q6FJU5"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU5"
                     /translation="MSTSTYKKFEQAGSSDLPDKMTIYQDCMNTFNETPVNPKRCRLL
                     ISRLLRLLAQGETFPRNEATALFFSISKLFQYPNDSLRQLVYLAIKEFSGISEDVLMA
                     TSSIMKDVQNGSDLVKPNAIRSLTNVLDESTAFSAERLLKSALVSKHPSISSAALCTS
                     YHLLPISEVTVKRFTNETQEAVVDLKQFPSSSMNGEYYPNSTYITQYHALGLLYQLKK
                     NDKMALLKLVRQFSEGNVLKNQLAKVELVRIVSELIQKDPQLFTQFKPLLNNWLSNKF
                     ESVQLETAKMITSFAIHNPRLVSPELYAAAISALQSLLSVPRVSTRFATLRILNRISM
                     ISPEKIAICNPELESLVNDSNRNISTYAITTLLKTGTAKNISSLIHTITRFIHDVSDD
                     FKIIIVDAVRTLSLNFPQEWKSIVTFLIDVLKNSEGGFKYKNSIVEALIDIVSFVPQS
                     KELALENLCDFIEDCEYNEILVRILHLLGKEGPSTTNPSLYVRHIYNRVVLENSIIRS
                     AAVVALSKFALTKNDSTLCESIISLLKRIVHDKDDEVRDRASIALKFIEAAKEKNDKV
                     ANDLIQSSSAYDLSSLESKLSAYLSSNTDSFQTPFDSQSIPKYAEDELKAMELKKKQE
                     KIFENKGDKTRDSSKTESTSNSAGENFNAEAEYDDGKDDLLAAKYAEEMAAIPEINAF
                     GSIVNTTKAVPLTEPEAEFVVTGIKHLFADHVVIQFNIRNTLTDVILDNVSVSCVPEE
                     SGDVTLEEQFTIPIDRLLPSAESSCYVAFKKPEAIVTETFMNSINFTTREVNPDTNEP
                     FEGDEGFEDEYEIDPITLSGGDYVKSSFVGNFTSAFDELPHEEIAVYNIQEDISIQEV
                     VDKVIQNTSCLPLGSTQYVGGDSNSHTLKLFGKSALTGSKIGMLVKFIKSSKGVALKV
                     QGKAEDATLCADLVNSVI"
     gene            complement(<401779..>402873)
                     /locus_tag="CAGL0M03553g"
                     /db_xref="GeneID:2891510"
     mRNA            complement(<401779..>402873)
                     /locus_tag="CAGL0M03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449500.1"
                     /db_xref="GeneID:2891510"
     CDS             complement(401779..402873)
                     /locus_tag="CAGL0M03553g"
                     /note="highly similar to uniprot|P53829 Saccharomyces
                     cerevisiae YNL288w CAF40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449500.1"
                     /db_xref="GeneID:2891510"
                     /db_xref="GOA:Q6FJU4"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU4"
                     /translation="MNVGVHTVGALSLDDGVIPPPGLNPNMMGMGNMPMGVPPMGAGG
                     NAGNAGNAGNQNPNASAGGNAGSSNANAASANNNASSGNAPAGTAQHALDDPNVYHWI
                     CELTYGPQKEQALLELGRKREQFDDLAIVLWSSFGVMTSLLNEIISVYPMLQPQLLTS
                     QLSNRVCNALVLLQCVASHSETKHLFLQAHFPMFLFPFLNTTSRQRTFEYLRLTSLGV
                     IGALVKNDSKDVIGFLLRTDIVPLCLRIMESSSELSKTVAIFILQKILLDDVGLQYIC
                     ATLERFYAVTNVLKDMVEHLTVHTPPGRLLKHIIRCYLRLSDDLEARRVLKVVLPNKL
                     RDNTFTEVLMDDVATKRCLAQLLLTLNEEN"
     gene            complement(<403738..>404733)
                     /locus_tag="CAGL0M03575g"
                     /db_xref="GeneID:2891511"
     mRNA            complement(<403738..>404733)
                     /locus_tag="CAGL0M03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449501.1"
                     /db_xref="GeneID:2891511"
     CDS             complement(403738..404733)
                     /locus_tag="CAGL0M03575g"
                     /note="highly similar to uniprot|P38629 Saccharomyces
                     cerevisiae YNL290w RFC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449501.1"
                     /db_xref="GeneID:2891511"
                     /db_xref="GOA:Q6FJU3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU3"
                     /translation="MMTEDRDNLPWVEKYRPQTLDDVYGQREVVGTVKKFVQEGKLPH
                     LLFYGPPGTGKTSTIVALAKDIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQI
                     FSKGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYSHKITPALLSRCTRF
                     RFQPLPNDAVEKRMANVLVHEHLRISPAAKEALLELSNGDMRRVLNVLQASKATLESP
                     EDEITDEVIYECCGAPRPQDIQTILKSILEDDWSTAYDTLTRIRSSNGLALIDLIESI
                     VKILEEYKLKKEETRISLLSQLGDIEYAISKGGNDKIQSSAVIGAIKSSFELELV"
     gene            <404993..>406768
                     /locus_tag="CAGL0M03597g"
                     /db_xref="GeneID:2891512"
     mRNA            <404993..>406768
                     /locus_tag="CAGL0M03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449502.1"
                     /db_xref="GeneID:2891512"
     CDS             404993..406768
                     /locus_tag="CAGL0M03597g"
                     /inference="similar to AA sequence:UniProtKB:P41821"
                     /note="similar to uniprot|P41821 Saccharomyces cerevisiae
                     YNL291c MID1 involved in Ca2+ influx during mating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449502.1"
                     /db_xref="GeneID:2891512"
                     /db_xref="GOA:Q6FJU2"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU2"
                     /translation="MLLWVLFLYLLASGSAFRFGGNDSWWNRRDLAAGGSEVAVDMQL
                     LDIVNKADGGSTSTSSDVGASSSAQSNADDTNGDGDDDDGDDDDDDDGEDEPQIINSN
                     LIYEWTPIISKMTPGKVDNYMFNINPESTGLGFAPSYEILIFLSGNICQQPTNSTDLQ
                     IRVYYSFDEKMLSNISLGNFETFSNGYLEALQISPVNHTSNGTTLNSKNLYVSVRLWD
                     LINDKEVDKDDPNIKNLTSTEWDYRLSISENDLVFQWDTRSWIDVLDTDSTSALISTG
                     NVTDDGQIYSNYTIYDPTLYDLYLYTYDEYQKFLNVSELSLCAIKNGPHLVSSEGASA
                     TNPPLEMLQETGLKIQKRIAESSSGIAEQFYITGLTPNTTYAAFLTKKIGKGQSLSNV
                     GGVLFDAEIFTTQTSDACSLIFGMSFCSDNAYSVPSSEFTNGNKSDLAIEYDNIASAL
                     YSNFSKALQLVPCDADLDARYSPIRTCDDCATSYRDWICAVSIPRCSTTESSSYIYRS
                     KTDNRNSYVNKFIKPTEDYYEVLPCIDMCYAIVRDCPSVFNFKCPDQESEPELLFQSY
                     NIFKQSSPFITCNFIGNASYLKIHK"
     gene            complement(<406841..>408055)
                     /locus_tag="CAGL0M03619g"
                     /db_xref="GeneID:2891513"
     mRNA            complement(<406841..>408055)
                     /locus_tag="CAGL0M03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449503.1"
                     /db_xref="GeneID:2891513"
     CDS             complement(406841..408055)
                     /locus_tag="CAGL0M03619g"
                     /note="highly similar to uniprot|P48567 Saccharomyces
                     cerevisiae YNL292w EXM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449503.1"
                     /db_xref="GeneID:2891513"
                     /db_xref="GOA:Q6FJU1"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR014780"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU1"
                     /translation="MNGIFAIEKPSGISSNQFMMQVQKIFNNSAVFSKEIERATAERR
                     KQFEQQTGKKASKRKLRKVSKVKMGHGGTLDPLASGVLVLGVGTGTKQLSQYLSGTVK
                     VYETEALFGISTTSGDSEGEILSRNSVKHLKLEDVKTVEEKFRGSLKQTPPIYSALKM
                     NGKSLHEYAREGKPLPRAIEPRQVTIYDLEILPKTLSKDHDYKLIETEDESNSQIVKD
                     LNANMLFDTLYYSKEYVEKMNLPSEVAAIEPPIPLTDEEKQEIGELKDKYRAPLLHAK
                     ASVSSGTYIRSLVSDIGKAMRTSCYMTKLIRIQQQEWSLEKNNVFKLEDFTDKDEQVW
                     AKVLEIVLEKGSSVNIVEELKNAESLYQQQIKDLKVKETEDLAGATGSTAQPVVEETE
                     HNDLKRKHEESL"
     gene            complement(<408582..>410747)
                     /locus_tag="CAGL0M03641g"
                     /db_xref="GeneID:2891514"
     mRNA            complement(<408582..>410747)
                     /locus_tag="CAGL0M03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449504.1"
                     /db_xref="GeneID:2891514"
     CDS             complement(408582..410747)
                     /locus_tag="CAGL0M03641g"
                     /inference="similar to AA sequence:UniProtKB:P48566"
                     /note="similar to uniprot|P48566 Saccharomyces cerevisiae
                     YNL293w MSB3 and similar to uniprot|Q12317 Saccharomyces
                     cerevisiae YOL112w MSB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449504.1"
                     /db_xref="GeneID:2891514"
                     /db_xref="GOA:Q6FJU0"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6FJU0"
                     /translation="MSSENLIDDAGVVSETTQPQEVHGSTDAPARTQDSDDVPKSNRA
                     VLSTAGLRLTHASRSDLKKPVLGFPKKSPSLPNFHENVQSDNENNSDPTLSKLLDESK
                     FVHNSHRLNFSLLKDDQPIDESDDTSGIETKEVKIEVKSQLHVPKTHKRTATLGGVSM
                     NEDDGNLSVIDMYGDEVESRVSKPQVPAEATQVDNDESQDEEVPPHAGSNTSENPGQH
                     NTEKATTEAAMTQEMLREQQIKADRRQSTFHYDRYGFKKQTNYVSEAKYDSWWNEYSQ
                     YCIRRKHKWKQLLEKSGLPVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARG
                     QDLLNRNKDRYDQLLERMEILLSSDKKKIQDLDIIERDLHRTFPDNLHFQHNSYHGDE
                     PPLISSLRRVLVAFSLYNPKIGYCQSMNFLAGMLLLFLDEERAFWMLVIITSRYLPGV
                     HNVNLEGVNIDQAVLMLCIKEYLPEIWPYINPELKTINKTSNSLGIKNGGSTGVKNEF
                     LYKLPPITLCTASWFMGCFVGVMPVETTLRVWDCMFYEESHFLFKISLAIFKLCENDL
                     SKVRNNGSSLLPNYMNGNHKSMSKDESDMEVFQIIQVFPKSLIDPNDIFDKIILKKRL
                     SFNRLDQEEIDRCRKYVATQRQKYKKFHDNGKNATFSGVNEDVPPAGESGTRIASDTI
                     NEALSSEIYGFKKGLTGVHWNNSIKEKVRQMRKKIDKDD"
     gene            <411533..>413152
                     /locus_tag="CAGL0M03663g"
                     /db_xref="GeneID:2891515"
     mRNA            <411533..>413152
                     /locus_tag="CAGL0M03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449505.1"
                     /db_xref="GeneID:2891515"
     CDS             411533..413152
                     /locus_tag="CAGL0M03663g"
                     /note="weakly similar to uniprot|P48565 Saccharomyces
                     cerevisiae YNL294c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449505.1"
                     /db_xref="GeneID:2891515"
                     /db_xref="GOA:Q6FJT9"
                     /db_xref="InterPro:IPR014844"
                     /translation="MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVY
                     AKNVKWSSFCDYGVPLYLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTI
                     LMVYSTIFVITVALTVLSFLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISR
                     QQEHYGVANGNVFGTLLNSNLVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFV
                     GGIMSIVSFIISAIVSYTDRVGIRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTR
                     KTWVSHLQMWYLALLTIAIVLLSPAMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEW
                     LERIHILKKAAQVKSLLGQKIYEDEQEGYNFAYYSVNNESNLDTNSDSHISLYNDMFR
                     NSEQFSNVGSNLSSKESSSLPAQMNSTGISFPTAVNQVEFQKRKSFLDHLTNFTYSRP
                     YKIYKKSKSIIQLRKRNSETVKNERSNEELSIEKVRRRLGLTNERREYVYNTKDIVFA
                     SDDDTESECESNNILNESIDSHFPENGAGSV"
     gene            complement(<413333..>414814)
                     /locus_tag="CAGL0M03685g"
                     /db_xref="GeneID:2891516"
     mRNA            complement(<413333..>414814)
                     /locus_tag="CAGL0M03685g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449506.1"
                     /db_xref="GeneID:2891516"
     CDS             complement(413333..414814)
                     /locus_tag="CAGL0M03685g"
                     /note="weakly similar to uniprot|P48564 Saccharomyces
                     cerevisiae YNL295w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449506.1"
                     /db_xref="GeneID:2891516"
                     /db_xref="GOA:Q6FJT8"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT8"
                     /translation="MSLVNSRQYRIMRFVPRICRQYRQFSQGRRKSGAVLKEKENTEV
                     KLQDNTTALNGVVNDADLLEPSGGDKTSETKWKRELKKDISSAKKPTTLVPSVSSTDH
                     LTDQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNFRVINASDDGGEKSLD
                     EFLESVKDNDWNIDNSEQKKVIPWQASISGIEYEDKSFSNIPKHVLSKLRPYKLIKLK
                     MPKIVNKQRRASMIKNLKFHNNKVNDELHLVDIFGKPHERDIAKHQLGAASAELDSNM
                     SKEQISAKREHFKELMYYYHRYGFIKSDCDQYKTYVDKQSKLAQKEFQKVTGLVIKPG
                     RSDFCLPLHLYVNKRQNSKILLERYLRKKLYRDVISVMLNFSSNISDQSMIKRFKKKL
                     YNIQEETIRDLTNILPSTEFEALEADCCIMKSPVSGFKRMHWLKYSKRHNVMWGKNYS
                     KEFNVSGNSFALTRSGVRRMKYPVYINWTTYDSTFRAWNHYNM"
     gene            <415143..>420122
                     /locus_tag="CAGL0M03707g"
                     /db_xref="GeneID:2891517"
     mRNA            <415143..>420122
                     /locus_tag="CAGL0M03707g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449507.1"
                     /db_xref="GeneID:2891517"
     CDS             415143..420122
                     /locus_tag="CAGL0M03707g"
                     /inference="similar to AA sequence:UniProtKB:P48563"
                     /note="similar to uniprot|P48563 Saccharomyces cerevisiae
                     YNL297c MON2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449507.1"
                     /db_xref="GeneID:2891517"
                     /db_xref="GOA:Q6FJT7"
                     /db_xref="InterPro:IPR026829"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT7"
                     /translation="MRRVRNCDVFCVYIDLETSGQSTNGIENMMSRAGASFAVFNKQL
                     DADLHALVAEARRRNSEVKEASHKSIEILKTIKTINDLENHPDFVVPFALACKTKNAK
                     MTTIAMQCLQNMASTRCIPEKRMDMILDAFIEATQLAMDIQLKVLQLVPIFFKTYSSY
                     LKGGLCKKLLYCCTSLLRVPNKAPIVAGTASATLQQLMDEIFDRLSDKTLESNNDEDE
                     DFEVLVNNNDFIKVNAFRYDANLVFSNLCSIVDTKSTEKTDNSLLDITDISTDLALEI
                     LESILQNGKQFLIEYEDLQFVLRIKTIPLLLRCMSNSKQFSTVLRCFRCIRLLIDKEF
                     LMIIELELEVMLSMIIHNLSLDSSILPWQRVLSLEIFNEISQNPTMLNDLYDIYDKYE
                     DKKPILHNFLTQSYHILLSDDFKDYIGYSSVIEKIEMPLISNNSFQTKNQYMQMLDKN
                     TAPNVNITYIIWLIVNCTNCWSEKLSSQAVALTEIENKSLRNTTKDQLHVTLNGLFEN
                     LFNIHTLLLQSSTIDTTIFHNIVRAFQKLTHCAGMLGEVSKVDRCLDYFRKAIITVEH
                     ASNTEKDLKVNAPSHIRKSSGSAMLSTLSESIVGPDLNKDIQKENDNIQLYPQSINSK
                     QVSLFRALTSLAISLGPNFSAKSWYFLFTAWNWVYYFIYGPSNDILNSLNIDEEFISH
                     DLSRNDLASIENTIHSFHDATKSYPLQTLIIMLTELEKLSDLTLNLNPKDQVGYQPFF
                     NNSEFSVAIYNPSFFISEIAELTSSNMSRILASTKTSSYWDKFIDYMVSQMADRKRTF
                     ALRLYCSHVIASVYKTCTNEIYEIEDTNLRKTCFTKYEQIFTSSLNRIMASIEVLEVN
                     KLNILNENLNTEGDIIFQVLNTLKEQLNEFGDMISDSWVTVFSIINSPFRWIDSNIST
                     LLQDDSDDLSLIDGIIMKQKNMIQVSFDVFKLITDDFLKNLHLNVIPDVIDTIVAFVN
                     QEKILNVSFSSISQFWLVGDYLRSNYSADIEKFRTECDDYFTHPSENNAEFIRAIKSP
                     ESTISQKYYGIWLYLLKNLLFCSLDKRNEVSVGAIQTFFRIIDSHSSTFPSWQAIFNN
                     VLYPFLNTERSDEQLQTNLDCLNVTLKGLVQLFSQKFSDFDEYNKNAAEWSALLQLFI
                     KLLQCPSTGVRYVTIKNYGTIVTELCTKENIPTNLLDLCATIWTDYNIGYSDFGNSSQ
                     LSEKTDYDCISELLLSFPSLCTMIDSVKDDNNVFYEKSMSLLLSAVKFPLLPEHSRDQ
                     AKPSTLQNAVLEGMSLIYTKLNKNNIFVYFVHLSMISTLLFDTRDKIEKKLAPKLHEN
                     AISRIPTFEALSYKSLQMLEKQLSELKSAEQPRNKYVLKIIRNLREIIVSKSLIDLST
                     DGSRPLWVLASSCYRSFLACIDNVSDCFANDSEGQQEFIEIFMSIFLTPLRRRDTKVD
                     SMTEKSDLSEFDQYSQLFKNKSLMPLFTSDHYDLLVRNIWDASLIYEFDDIQKAILQD
                     SGGPKNCEKILSHLNDLEVFGLTRTQDTLSKVSCSKRCLQELISFALLDDKDMSELKY
                     LTFPYIVSRISLLLGKYISDEFLSGSAPIPKLRGEEMNILLNGLLKLLDNLLRSKVPI
                     SKEVESLAHLYPLVLRTIPVSHKLTGLQNTVLELSLSFTKLISASSHQP"
     gene            complement(<420316..>422901)
                     /locus_tag="CAGL0M03729g"
                     /db_xref="GeneID:2891518"
     mRNA            complement(<420316..>422901)
                     /locus_tag="CAGL0M03729g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449508.1"
                     /db_xref="GeneID:2891518"
     CDS             complement(420316..422901)
                     /locus_tag="CAGL0M03729g"
                     /inference="similar to AA sequence:UniProtKB:P48562"
                     /note="similar to uniprot|P48562 Saccharomyces cerevisiae
                     YNL298w CLA4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449508.1"
                     /db_xref="GeneID:2891518"
                     /db_xref="GOA:Q6FJT6"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT6"
                     /translation="MSLSAAAAKISDSDFQSIGPAPRPPVSAGGAAFNKTQPITRYMS
                     QLDLNSGRANRSNSNVRRKSGWVSYKDDGLLSFLWQKRFMVLNDSALTLYKNEKVTED
                     PVLKIPLTVIVSVSKNQLKQYCFELTRVSERNSSNGGQSGNTDSMAKKTIYIATKTET
                     DLISWLDSIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITG
                     EDWNNDSAAVIQVLNFYQEYNNGEGSTYGAGSTTSVSSGSTNSSQINLLKDTNTSTNS
                     SDKVSPISQANSMVPQRRAPSPPKQSSTVNSVNSVNVVPSQNSSQQAINMPNRSNTPI
                     RQGSSPYQNNISSKNNMAPRMQAPSPAGGNKIQNSLPKLATHNNYNQQQGFVNKYPSP
                     GSSPGSSQPPSPINGYRPHHNMSNPYANKGPGSPLNARPNQQTTIQNQVPFNQRNGSQ
                     QQSNYPMKVYPTIPVLKQPQQGGGYPNQNVIQNQTSVNAANMAMRQQQQQQNKINQNN
                     PPAALQPVRQAPKKPAGVSKDGAEKAKKTSKPTMSNAEIMSKLKQVTLDADPSTLFKM
                     IEKAGQGASGSVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRKE
                     LIVNEIMVMNDSRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYS
                     PLSEPQIAYIVRETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQ
                     RSKRATMVGTPYWMAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYL
                     IATNGTPKLKHPQSLSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNIACEPEDLTSL
                     LENKK"
     gene            complement(<423750..>425630)
                     /locus_tag="CAGL0M03751g"
                     /db_xref="GeneID:2891519"
     mRNA            complement(<423750..>425630)
                     /locus_tag="CAGL0M03751g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449509.1"
                     /db_xref="GeneID:2891519"
     CDS             complement(423750..425630)
                     /locus_tag="CAGL0M03751g"
                     /inference="similar to AA sequence:UniProtKB:P48561"
                     /note="similar to uniprot|P48561 Saccharomyces cerevisiae
                     YNL299w TRF5 nuclear division protein or uniprot|P53632
                     Saccharomyces cerevisiae YOL115w TRF4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449509.1"
                     /db_xref="GeneID:2891519"
                     /db_xref="GOA:Q6FJT5"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT5"
                     /translation="MRGDRSKRKVAKYQKKESARVKRLRRSSFNALQRNIEVFNDNKE
                     FLNKYENLELDLSDPENRTHLLSEYNDDLTQSDGESKADNHNDSYDTIPVIDIDSGDE
                     GIVSDIKISGGKLEDNDDFIAFSSSSEDENSGAENNESEDYLSSGNTSSDDELAGRRN
                     AERELNADFPWLLNHDHSKQKEISDWLTAEIRDFVAYISPSREEIETRNKTIAKIRRS
                     VKRLWTDADLQVFGSYATDMYLPGSDIDCVVNSKSGDKENRQYLYELARHLKNDGLAT
                     RVEVIAKSRVPIIKFVEPESDIHIDVSFERSNGLEAAKLIREWIGDTPGLRELTLVVK
                     QFLHARRLNDVHTGGLGGFSIICLVFSFLRLHPRIITGDIDPLDNLGVLLIEFFELYG
                     KNFAYDDVAICVDDSRATYKPKTSCRFYPPARTSFTLAIQDPGDPTNNLSRGSFNVRD
                     IKKSFSGAFDLLVNKCFELDAATFKNRVGKSILGNVIKYRGAPRDFNDERALVENRAI
                     IENEHYHRKRARVVHADDEDTSDEDDMFINISANEEETEEMYKVEKVEKVVKKRKIAK
                     ADTNTKTKTKTKAKARNHTSIDQLMGIPEDEEPPVIQEREKKSLSMQDKRDYWLSKGQ
                     AL"
     gene            complement(<426518..>427099)
                     /locus_tag="CAGL0M03773g"
                     /db_xref="GeneID:2891520"
     mRNA            complement(<426518..>427099)
                     /locus_tag="CAGL0M03773g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449510.1"
                     /db_xref="GeneID:2891520"
     CDS             complement(426518..427099)
                     /locus_tag="CAGL0M03773g"
                     /inference="similar to AA sequence:UniProtKB:P48560"
                     /note="similar to uniprot|P48560 Saccharomyces cerevisiae
                     YNL300w TOS6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449510.1"
                     /db_xref="GeneID:2891520"
                     /db_xref="GOA:Q6FJT4"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT4"
                     /translation="MKFSTASILAIAASVASAGTVVSDGVTYVDITTTPVVTTSAVST
                     VKTTSTPYTTTTVSTKPASVSSSANSASAAKGNAAVISQIGDGQIQATTATPAKPSSA
                     APAKPSSAAPVSPASSSKASPSSVAPASPSIEQQKSSTLSTSAVKTNPAVVSQIHDGQ
                     IQASTLQQQLTNAAGKNSATFGAALLAAVAMLL"
     gene            complement(<428607..>430148)
                     /locus_tag="CAGL0M03795g"
                     /db_xref="GeneID:2891521"
     mRNA            complement(<428607..>430148)
                     /locus_tag="CAGL0M03795g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449511.1"
                     /db_xref="GeneID:2891521"
     CDS             complement(428607..430148)
                     /locus_tag="CAGL0M03795g"
                     /note="highly similar to uniprot|Q99383 Saccharomyces
                     cerevisiae YOL123w HRP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449511.1"
                     /db_xref="GeneID:2891521"
                     /db_xref="GOA:Q6FJT3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT3"
                     /translation="MSSDEEDFNDIYGDEHQDQQQTVSNESKPVDSTTAPSTESASVP
                     MDPLAALQALSSNLNNSNNTDNNNDKDTSSGSQTTADGNAVSSEQNGSNVSSEPQVSN
                     QTQNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVELK
                     IMKDPNTGRSRGFGFLSFDAPSSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGKIFV
                     GGLGTDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAAEKVCESRY
                     REFKGKQIEIKRAEPRHQQKQAGQQAVSPPVAGMGMNPMSNPMANPMAGMYQNPMMGG
                     FNPMFNPQAMQDYYQKMQEYYQQLQQQTGMDYSQMFQQQMSMMMPGFQMPPMNADGSG
                     SPLNNAGSENTPSGDDHNGSDNSSSSNVQTIGGDSNDSNSASNERNEDGSNRMKKNSL
                     PKNIPRGPRGPSERNDRGSYHRDRSGGSRHGGYHGSSNGSYRRERGGYNGGRRSNGYH
                     PYNRS"
     gene            complement(<431237..>432664)
                     /locus_tag="CAGL0M03817g"
                     /db_xref="GeneID:2891522"
     mRNA            complement(<431237..>432664)
                     /locus_tag="CAGL0M03817g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449512.1"
                     /db_xref="GeneID:2891522"
     CDS             complement(431237..432664)
                     /locus_tag="CAGL0M03817g"
                     /note="weakly similar to uniprot|P48559 Saccharomyces
                     cerevisiae YNL304w YPT11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449512.1"
                     /db_xref="GeneID:2891522"
                     /db_xref="GOA:Q6FJT2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT2"
                     /translation="MADGRRKRYSLNVVVSPSPSERRFSGMDFTEASGTSPWNSPFGG
                     GSTESFHFDKSNRNSRHSFYRTLSSSNSLSGGSVYRNSSVGLGLSSSAYMNDVMCSRE
                     SLSMSAIESNAANIKVLFIGDAGVGKTAMILNYCRELPTRAQWEHIIGLSPTPNRAGS
                     SNRSGRNQMVRRSLTARAYERKSDIMQDQRKRYSSTDYDDYKENDFMAQRDFKIVKDV
                     ESESSSLNYDPEELIVDTKTTIGVDIKTNIINIDNRIFNCILWDTAGQERYRNAIMPS
                     LYKKSNAIILSYDITDKCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQR
                     EVTHEDVIAAIEEIESRYGLVIAGNFEVTCKNFDSLNEAMNNITVDLVNNGCYEEKAE
                     QELEGTAVLEEDEEMKESTTLNEQYDDEVVSTSNDEDSGEDSDGSLEPVIRKRTTAKT
                     RIIDISKPKNQPNILDTSHKMSCCT"
     gene            <433214..>434101
                     /locus_tag="CAGL0M03839g"
                     /db_xref="GeneID:2891523"
     mRNA            <433214..>434101
                     /locus_tag="CAGL0M03839g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449513.1"
                     /db_xref="GeneID:2891523"
     CDS             433214..434101
                     /locus_tag="CAGL0M03839g"
                     /inference="similar to AA sequence:UniProtKB:P48558"
                     /note="similar to uniprot|P48558 Saccharomyces cerevisiae
                     YNL305c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449513.1"
                     /db_xref="GeneID:2891523"
                     /db_xref="GOA:Q6FJT1"
                     /db_xref="InterPro:IPR006214"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT1"
                     /translation="MSVNKNSYVPLPNESAPPPYQEEDPAPNLYNVPDDFKWSTNVSA
                     CEPLVRQQFLHRVYSILSTQLLATLSMGYLTYKWEPLREFTNSNTWLVILASIGSILT
                     CIWLAFAPSVDDYVPEDEANYTGETETNNELRPAKAPWYYLSKRGQYAVLSVFTICEA
                     YSLSTITLAYDPQIILSAVLITTVVIVGVSLVALSERFQFLTESATTIYFWLNWGLLL
                     LFGMVLTGVFFGFSSKMNIFYAWFGAALFTIYLLMDTQMIFRKVRPDEEVKCAMILYV
                     DIINLFLHILRILSSRENE"
     gene            complement(<434549..>435578)
                     /locus_tag="CAGL0M03861g"
                     /db_xref="GeneID:2891621"
     mRNA            complement(join(<434549..434964,435566..>435578))
                     /locus_tag="CAGL0M03861g"
                     /product="60S ribosomal protein L25"
                     /transcript_id="XM_449514.1"
                     /db_xref="GeneID:2891621"
     CDS             complement(join(434549..434964,435566..435578))
                     /locus_tag="CAGL0M03861g"
                     /note="highly similar to uniprot|P04456 Saccharomyces
                     cerevisiae YOL127w RPL25"
                     /codon_start=1
                     /product="60S ribosomal protein L25"
                     /protein_id="XP_449514.1"
                     /db_xref="GeneID:2891621"
                     /db_xref="GOA:Q6FJT0"
                     /db_xref="InterPro:IPR001014"
                     /db_xref="InterPro:IPR005633"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:Q6FJT0"
                     /translation="MAPSAKASAAKKAVVKGTNGKKALKTRTSATFRLPKTLKLARSP
                     KYASKSVPHYNRLDSYKVIEHPITSETAMKKVEDGNILVFQVSLKANKHQIKKAVKEL
                     YEVDVMKVNTLITAKGNKKAFVRLTADYDALDIANRIGYI"
     gene            complement(<436916..>437539)
                     /locus_tag="CAGL0M03883g"
                     /db_xref="GeneID:2891524"
     mRNA            complement(<436916..>437539)
                     /locus_tag="CAGL0M03883g"
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /transcript_id="XM_449515.1"
                     /db_xref="GeneID:2891524"
     CDS             complement(436916..437539)
                     /locus_tag="CAGL0M03883g"
                     /inference="similar to AA sequence:UniProtKB:P42847"
                     /note="similar to uniprot|P42847 Saccharomyces cerevisiae
                     YNL306w MRPS18"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS18"
                     /protein_id="XP_449515.1"
                     /db_xref="GeneID:2891524"
                     /db_xref="GOA:Q6FJS9"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS9"
                     /translation="MLRSLGSKWLLAGRRLNSSVADGGRISFAGAVKDLTRKDEVANI
                     SNPYGEKRAMKGKSLEVPLKYKLNCVFRKNNTHFTYSAVVEDKNYLVNNPELSYNEKY
                     LYYLRLPQKVKFAISTGCLGFRKALRGEYEAAFQTTTKVFQMIKEKGLMDKDIEIIMD
                     DFGKGRTAFIAALNGKEGNEIRRKVTRISDKTALKFGGVRSPRMRRL"
     gene            <437944..>439704
                     /locus_tag="CAGL0M03905g"
                     /db_xref="GeneID:2891525"
     mRNA            <437944..>439704
                     /locus_tag="CAGL0M03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449516.1"
                     /db_xref="GeneID:2891525"
     CDS             437944..439704
                     /locus_tag="CAGL0M03905g"
                     /inference="similar to AA sequence:UniProtKB:P42846"
                     /note="similar to uniprot|P42846 Saccharomyces cerevisiae
                     YNL308c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449516.1"
                     /db_xref="GeneID:2891525"
                     /db_xref="GOA:Q6FJS8"
                     /db_xref="InterPro:IPR018034"
                     /db_xref="InterPro:IPR024626"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS8"
                     /translation="MPRKKSAAKKAREAAAKTQGEVPEQKISEEVEAKPLDANDEHED
                     ASDESSSEEEDDYGELLTEEVEDGIKNVLTAIRNNEKDKLLNPEVKFFEDPEKAAEKM
                     EVSEKHKPVYLKDYHRMNILSGNALKDDDELDEDELETVDGKQSFVSQQREERQQLLN
                     EINNAFDGDDQKSEEENDDEDDDGFLKKKEKKMEVSKTDPLREIDPNKDEDKFLEEFV
                     NQHAWIPKKGDKIISLDGGMDMEEDDEEFDDAVEQFENAYNFRYEDPNAAEIVSYART
                     QATLRRSKTSSRRRKREEEKSHKEEEKKEKEEKIQKKKVKKVNKVTDILTQIKKEYGA
                     DISEEMVEKITSTLMNNDYKEDEWDNVVAELFNEEFYAQEGKPEWDEDDEIMADFYKE
                     GEEVNDGQEPPELDTNDTTETNDQDNAGRSKKKSKIEEKKSKKKEKKQLQEMVETAIE
                     KNKMAIIDEVEEERGRSREKEELKFRYREVSPESFGLSTREILAADDTDLNEFIGLKK
                     FAPYRPKELRAKDKRKVTKSRRLREWKKKVFNNESGLTEEQFIALMEKEGSSEPPMKK
                     HKKSHDKDKKNKNSHKKNKK"
     gene            complement(<440211..>441497)
                     /locus_tag="CAGL0M03927g"
                     /db_xref="GeneID:2891526"
     mRNA            complement(<440211..>441497)
                     /locus_tag="CAGL0M03927g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449517.1"
                     /db_xref="GeneID:2891526"
     CDS             complement(440211..441497)
                     /locus_tag="CAGL0M03927g"
                     /note="weakly similar to uniprot|P42845 Saccharomyces
                     cerevisiae YNL309w STB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449517.1"
                     /db_xref="GeneID:2891526"
                     /db_xref="GOA:Q6FJS7"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS7"
                     /translation="MADISREKEDELASKILERAQLAQMRRQLKIGLSKVPSETRDDE
                     QYEENHTKADITDDSTDNYTLGSAYSATPRSRASMVSPRKRQSGDPREMSAIMNASPL
                     KKVLLDGIKDGESSENVSPVSRRFVRPSTPPKTASRPASVHIPQKSSYDNRTPTTPKL
                     TNAHTAFTNSLNSAEKNAMTKADTATLTKVPSTPKRGNSSQKKQAGVNKNNTDDSTGA
                     DLLMYLATSPYSSARAHNTTYNRKNSVSSVTKVPTTPYTSLYMSHSHTQEMNDDAVRF
                     SALKASLNSPQSTFKVPHVVGSQANNGQWFPDILMDSPSLYLGSALSPSANKKKLASP
                     GPGSGSGHAVSTHLPVPSTPSRELHHQTNTNLLKTPNFNMGDYLQNIFSPSPQVSLND
                     LGNSHMTEMQAKSALAVGPVEGGSVHSSPTRIASDV"
     gene            <441978..>442553
                     /locus_tag="CAGL0M03949g"
                     /db_xref="GeneID:2891527"
     mRNA            <441978..>442553
                     /locus_tag="CAGL0M03949g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449518.1"
                     /db_xref="GeneID:2891527"
     CDS             441978..442553
                     /locus_tag="CAGL0M03949g"
                     /inference="similar to AA sequence:UniProtKB:P42844"
                     /note="similar to uniprot|P42844 Saccharomyces cerevisiae
                     YNL310c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449518.1"
                     /db_xref="GeneID:2891527"
                     /db_xref="GOA:Q6FJS6"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS6"
                     /translation="MLRLLRGTGAVRALRYTNARSLNRAMAGAVVSGRHLGGRAAPLC
                     RASQFSTTVAKLQSQDNDKTYPLGSFKVDQPQIMIAFTCKKCDTRSSHTMSKQAYTGG
                     TVLITCPGCKNRHLIADHLKIFSDDRITIEDILNAKGESVSQSTDDLVFEDIPESLKE
                     TIGHYASDAPESYKKRLDNEKVHTLPHPEEK"
     gene            <442995..>445340
                     /locus_tag="CAGL0M03971g"
                     /db_xref="GeneID:2891528"
     mRNA            <442995..>445340
                     /locus_tag="CAGL0M03971g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449519.1"
                     /db_xref="GeneID:2891528"
     CDS             442995..445340
                     /locus_tag="CAGL0M03971g"
                     /inference="similar to AA sequence:UniProtKB:P42843"
                     /note="similar to uniprot|P42843 Saccharomyces cerevisiae
                     YNL311c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449519.1"
                     /db_xref="GeneID:2891528"
                     /db_xref="GOA:Q6FJS5"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS5"
                     /translation="MRKLQLFGGSKYFSLSQKEGKPVHKNINNQEKVEDEVEDETDDQ
                     LSLLSLPPKILRRILSHLDSASLIALTHVHSKLYKIISNEFLFSNIVLDSKISLLKFS
                     AMIHSEFHTSNALVNGTRGSTSPQENKSQNVRFLVRSVEFVNPQSHDSLLKYSKFHKK
                     NDTGSLIGGSYNFNTSSEIPISKLPTSPKAEDRPKSSSLAQTSFGGKLDTHENTRSSS
                     RTRSTNHYKCYKLMEKFEHKFSGYTYIELMLDIIDYLPNVTHVKLSNVDPSFKVPLWY
                     SVFNDGSRDFFKKIIKGQQSITNDDLRTFELSKEFVREYEKKFYHLPLLKSLEISAAI
                     DKKQTKPVVFRPNLICCFGVIQELTLENITLDKESFETPMEFVPLHLRLEETNDLHVN
                     GKPTSLELYNLHSPVSSLTLRACTIIQGNGILRLIHNYFKDVKNLQLLELSSKYDLFL
                     CNCFSSLSNLTIDCNSACFTNEMTVNDDYYLKEITLSNEDETNCDDNISVTETLLESS
                     SRVVIQAPPPTSAVVVSLNLDYISKTSGSNAQENPLPSDSKKPALITKSQGDYFRQLR
                     IPTFHYFYHYYKSIWERIPHKNVNINIINIPFTNVYPMSPKGLAESMIVSSDANDQET
                     LIAYRPSGYSAHDVPTSSIIHVSEEAREFNSTQYYWENGVRRCYLDAIQELRESSSYY
                     QSMTQHEILDMIDYEAINGYQNFKFYKDIPNVNLWCFLKSLSKFKSVKINLLRTWLYC
                     TPRSRYDWELLLKPVLNVNVPVIVTDRDGYVVYSYGQHKMH"
     gene            complement(<445590..>446429)
                     /locus_tag="CAGL0M03993g"
                     /db_xref="GeneID:2891529"
     mRNA            complement(<445590..>446429)
                     /locus_tag="CAGL0M03993g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449520.1"
                     /db_xref="GeneID:2891529"
     CDS             complement(445590..446429)
                     /locus_tag="CAGL0M03993g"
                     /note="highly similar to uniprot|P26754 Saccharomyces
                     cerevisiae YNL312w RFA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449520.1"
                     /db_xref="GeneID:2891529"
                     /db_xref="GOA:Q6FJS4"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS4"
                     /translation="MATYQPYNEFSSVTGGGFENSDSRPNTMDSGTGSNTNTLTPVTI
                     KQILDSQQAIQDGPFITHNQELHHVCFVGVVRNITDHTSNIYLTLEDGTGQIEVRKWS
                     DDSSDVAQGTDGDDGFGEMKGGESQIAQQYQIGTYVKVFGALKEFGGKKNIQYAVIKN
                     VDSFNDVIAHHLEAIKCHAIANGKMQGSSLASGDNEGAGQSLFVQDDEGAGNKNPLQR
                     ILEFCKQQCVGKDANTFAVPIPLISQSLDIDETTVRNCCTTLTEQGFIYPTLDDNHFF
                     AVD"
     gene            complement(<447059..>447889)
                     /locus_tag="CAGL0M04015g"
                     /db_xref="GeneID:2891530"
     mRNA            complement(<447059..>447889)
                     /locus_tag="CAGL0M04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449521.1"
                     /db_xref="GeneID:2891530"
     CDS             complement(447059..447889)
                     /locus_tag="CAGL0M04015g"
                     /note="some similarities with uniprot|P21705 Saccharomyces
                     cerevisiae YNL314w DAL82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449521.1"
                     /db_xref="GeneID:2891530"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS3"
                     /translation="MRVESQQSAIVLLELMDKYKPHLKPYAYRLHSWERVLADYNSRL
                     HTKYRQIRTIKNKFERLKYMYLQDRGSEQFKGYSEAELVLLERLISESDGVSVKDPIV
                     RDNGMSQGALASGGRPPEPALVPRLPMLGGQLLKQSTINNIIEPTPPPLDTISIGMPK
                     NAKKPSIQDTGLAGQPTMEDSTVTAGTPLDTSIFDGDTRIPTRKNSLDVHTIQDLVRK
                     LSDQQKQEDQLMIMKEAELSKKYMTQADFLSYKKQNRAIQLQILNVITSLLETPTKES
                     "
     gene            <448125..>449054
                     /locus_tag="CAGL0M04037g"
                     /db_xref="GeneID:2891531"
     mRNA            <448125..>449054
                     /locus_tag="CAGL0M04037g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449522.1"
                     /db_xref="GeneID:2891531"
     CDS             448125..449054
                     /locus_tag="CAGL0M04037g"
                     /inference="similar to AA sequence:UniProtKB:P32453"
                     /note="similar to uniprot|P32453 Saccharomyces cerevisiae
                     YNL315c ATP11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449522.1"
                     /db_xref="GeneID:2891531"
                     /db_xref="GOA:Q6FJS2"
                     /db_xref="InterPro:IPR010591"
                     /db_xref="PDB:2P4F"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS2"
                     /translation="MLTRSLVPALRRRITVVARQYSIEDRYKEKLLQKAKAEGVESIE
                     ELKKRLADQIEEKKKELNKIDPLRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNV
                     LPKDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKY
                     AVKNPLFVLPLPRENAADGNKADKDSVPVELQYVQWQFAGPNTVHCLITSLAEYKLHQ
                     DFAKPHTTIQFHLDLANDKDMVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETS
                     IAKERIQLLEDFNKGSQNFDINKLIQLAQSMEN"
     gene            <449398..>450450
                     /locus_tag="CAGL0M04059g"
                     /db_xref="GeneID:2891532"
     mRNA            <449398..>450450
                     /locus_tag="CAGL0M04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449523.1"
                     /db_xref="GeneID:2891532"
     CDS             449398..450450
                     /locus_tag="CAGL0M04059g"
                     /inference="similar to AA sequence:UniProtKB:P32452"
                     /note="similar to uniprot|P32452 Saccharomyces cerevisiae
                     YNL316c PHA2 prephenate dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449523.1"
                     /db_xref="GeneID:2891532"
                     /db_xref="GOA:Q6FJS1"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="UniProtKB/TrEMBL:Q6FJS1"
                     /translation="MTVKVLFLGPEGTYSHQAAIQQFSHLVDYNVVYEAVDSIPSCVD
                     KLIEHDNDIEDVDLYSVVPLENSTNGQVVFTYDILRNLMQGSNGTNMRIRENQVVAPI
                     TIVGEQYVSILHCLISPDPSIGIESLQNYDTLKIYSHPQVWGQVSKYLVELQKRFPNL
                     KLERINCNSTSEAVLQAAEEQSSSQSSGILNLAIASEIAASIYQCYIIQHSINDILGN
                     TTRFLVFKKKSNHRRLLAPPSATPQRVSLLTFTIKQDDPGSLVEVLSVLKDFSLNMCS
                     ISSRPYLLRSEQISQQGENFRRRNWQYIFFIEFYIEQDKEFDKDKFCDRIDALCGDWC
                     HWGRFPRDICYYKNTA"
     gene            complement(<450572..>451939)
                     /locus_tag="CAGL0M04081g"
                     /db_xref="GeneID:2891533"
     mRNA            complement(<450572..>451939)
                     /locus_tag="CAGL0M04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449524.1"
                     /db_xref="GeneID:2891533"
     CDS             complement(450572..451939)
                     /locus_tag="CAGL0M04081g"
                     /note="highly similar to uniprot|P42841 Saccharomyces
                     cerevisiae YNL317w PFS2 polyadenylation factor I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449524.1"
                     /db_xref="GeneID:2891533"
                     /db_xref="GOA:Q6FJS0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /translation="MDQSAAVEGVPQKKYLTLRRSVDVSSSYNRLYYLKKHGLSLPPI
                     EPETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATF
                     SGEFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKE
                     LDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHP
                     ELGLIVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCR
                     VFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHII
                     PFAHEKCISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFF
                     GINNDINAVREKSEYGAAPPPASTAFPQQTQYNNNISRVPEIKEPTPTTDKEQRTSIL
                     PGLSI"
     gene            <452677..>454272
                     /locus_tag="CAGL0M04103g"
                     /db_xref="GeneID:2891534"
     mRNA            <452677..>454272
                     /locus_tag="CAGL0M04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449525.1"
                     /db_xref="GeneID:2891534"
     CDS             452677..454272
                     /locus_tag="CAGL0M04103g"
                     /inference="similar to AA sequence:UniProtKB:P42833"
                     /note="similar to uniprot|P42833 Saccharomyces cerevisiae
                     YNL318c HXT1 hexose transport protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449525.1"
                     /db_xref="GeneID:2891534"
                     /db_xref="GOA:Q6FJR9"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR9"
                     /translation="MEQVTIGVISLDSSPTENYTLNTAETRQSFQLSGKSEVNTIPGE
                     KYEELKMKYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVS
                     SAKELSNMKRGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFS
                     NGNFILLLASRFVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNI
                     LNYMTNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESA
                     KISYSIMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHKFEFLYGKPKYGKRLLIGI
                     MVMAFQQLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRR
                     STLIYGSFGMFICMIFYASFGTLSLRKDLLSFVLIIVTCLFISIFAITIGPVSFVVVA
                     ELFPTRTRSVSMSICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAF
                     FVPETKNKTEEEIDYMFQNNLKS"
     gene            complement(<454489..>455361)
                     /locus_tag="CAGL0M04125g"
                     /db_xref="GeneID:2891535"
     mRNA            complement(<454489..>455361)
                     /locus_tag="CAGL0M04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449526.1"
                     /db_xref="GeneID:2891535"
     CDS             complement(454489..455361)
                     /locus_tag="CAGL0M04125g"
                     /note="highly similar to uniprot|P42840 Saccharomyces
                     cerevisiae YNL320w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449526.1"
                     /db_xref="GeneID:2891535"
                     /db_xref="GOA:Q6FJR8"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR8"
                     /translation="MLYRTFKMIFGGVLALGTISVTAVYLVQNKLVYPSWAQGAREYV
                     DTPASKNIPYKEVTLTTKDGIELQAWDIRNEETKSKSTVLILCPNAGNIGYFIPIIDI
                     FYSQFGLNVFIYSYRGYGYSKGTPSEEGLKIDADRVMSYLATDDFHKTKKLILYGRSL
                     GGANAIYIASKFSQLCDAVILENTFLSIRKVIPYIFPWISRFAFMCHEVWNSEEDMPH
                     CNSEIPYLFLSGLEDEIVPPEHMKDLYDICPSGSKQIYEFPFGTHNTTIIQDGYWEIV
                     RKFLEDNKFIEPAQ"
     gene            complement(<455977..>458901)
                     /locus_tag="CAGL0M04147g"
                     /db_xref="GeneID:2891536"
     mRNA            complement(<455977..>458901)
                     /locus_tag="CAGL0M04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449527.1"
                     /db_xref="GeneID:2891536"
     CDS             complement(455977..458901)
                     /locus_tag="CAGL0M04147g"
                     /inference="similar to AA sequence:UniProtKB:P42839"
                     /note="similar to uniprot|P42839 Saccharomyces cerevisiae
                     YNL321w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449527.1"
                     /db_xref="GeneID:2891536"
                     /db_xref="GOA:Q6FJR7"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="InterPro:IPR005185"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR7"
                     /translation="MSLRPTVSKDKSRPVLVKRVFSVDDDANEVQNDIRYFENLADGV
                     KIVLPGSENNIQDSAALSTGGNVAVPVPQGLRDEALVPVDSLRSLSTPDLMESITNLQ
                     QKLVTPRINGVAAHGNVGSPRFIIHDHTHTHPGDKKSATHHDLYIEELPAQRSNSSQA
                     LPAGSVAGGNGTSSLTDIPPVDLEASNLGETERLDPDNASRASSIESYTLRERQDAIN
                     ETHPFGIRIWKPALYKKKRSVEKAADEDIHETKLKKITWAVKATNWIWVATCGLFLFT
                     VFASASITVLIAGLFTKSARDYSRLMLRLARYLLYPFGKVVYLIQDKQYLEEDRDEGI
                     SVQQFYNWVTSYKSRLFFHESQTRPTESDALGNNMHHTSYGSIQKVVGEQTNTESNNP
                     MLDNNGYTELPHSTSFQNPSNDHQNSAATQRRLFGRGKWSLGRIVFYAIFHIVLQPIV
                     LFLSLLTWLAVFTIPMSNILWNLMYHCRRHPLALGFKSIKNSSNQIIEHYDDKNILLC
                     TFRCAGWHYYKFTIDGTNVIVVNLIAMVFFTIFDFYALKEFFNIDLWITSESTVFILC
                     LASIIPLAFYIGQAVASISAQTSMGLGAVINAFFSTIVEIFLYCVALQQKKGLLVEGS
                     MIGSILGAVLLLPGLSMCGGALNRKTQRYNPRSAGVSSALLIFSMIVMFVPTLLYMMY
                     SGYDVICDDLDATLPLDLYSAYKVMSTSKCHFSHPPLKFDKLYTHVIEPMSIVCAFVL
                     FLAYTIGLWFTLRTHAATIWQLPIADPPREIVNTEANGIDGILSHEEDHNDEGGGHDA
                     PNWSRSKSTLILLLATLLYAIIAEILVSCVDSVLEDFPSLSPKFLGLTIFALVPNTTE
                     FLNAISFAMHGNIALSMEIGSAYALQVCLLQIPALVLFSVITAIGVDKALISIRDQMF
                     PLVFPTWDLVASMASIFVFTYLYAEGKSNYFKGSILILLYVIIIMGFYYQGLIAEWGI
                     IT"
     gene            <459618..>460739
                     /locus_tag="CAGL0M04169g"
                     /db_xref="GeneID:2891537"
     mRNA            <459618..>460739
                     /locus_tag="CAGL0M04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449528.1"
                     /db_xref="GeneID:2891537"
     CDS             459618..460739
                     /locus_tag="CAGL0M04169g"
                     /note="weakly similar to uniprot|P17260 Saccharomyces
                     cerevisiae YNL322c KRE1 cell wall protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449528.1"
                     /db_xref="GeneID:2891537"
                     /db_xref="GOA:Q6FJR6"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR6"
                     /translation="MRISRLLLIAGVAQAAIVTDFIITTLADGTLSTVTSIYDNAKPK
                     TDTDTDTDTDTDTDTNTATGTTKATTTNTNTNTNTNTGTNTGVKLITTSTVVTDAAGV
                     IKTVPTVITSGVKQTGTTTGTTTGTTTGTTTGTTGTKKSYVSTITTVDAAGRPVTLTT
                     TITGTNTNTNTNTNTGTANTPYVTTITTTNINGVTVTLTQTVTPTKAAVDPAAANGAL
                     TAFVVKSKPSDLVGTAPDGRPDPSLVSFTEVPATPVTTVPIDTYITITEGTTRTYTTL
                     RVPTSIWVTITNAAGQTVTFQTTYMQRFSSQYLEVASPSSGSIGLGSLQGEVGVVKSV
                     MVMSQSANAAHNNARAGTPVTSICMSLAMAFLTMFTWFM"
     gene            complement(<461446..>463251)
                     /locus_tag="CAGL0M04191g"
                     /db_xref="GeneID:2891538"
     mRNA            complement(<461446..>463251)
                     /locus_tag="CAGL0M04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449529.1"
                     /db_xref="GeneID:2891538"
     CDS             complement(461446..463251)
                     /locus_tag="CAGL0M04191g"
                     /inference="similar to AA sequence:UniProtKB:P32329"
                     /note="similar to uniprot|P32329 Saccharomyces cerevisiae
                     YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
                     YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
                     YLR121c YPS3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449529.1"
                     /db_xref="GeneID:2891538"
                     /db_xref="GOA:Q6FJR5"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR5"
                     /translation="MKFSSLCMLASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAK
                     RGRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGS
                     DNPYCRGSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSD
                     GLLGGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSKSSTWHSNDTAFMIQ
                     YGDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAV
                     SGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLYTIP
                     MVNTYASQGYKNPIQFEVTLNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALVT
                     RIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDSCILG
                     IMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSSVPGAVRAP
                     GFSSTWSTLATSFNTQGDIFTVQAAATVSGSATNTGTGRATATGNSNSTRSTTSRSRT
                     SATSTRSDSQKKNDASRTSFTSTLLFVAGLLVSFI"
     gene            complement(<463756..>464523)
                     /locus_tag="CAGL0M04213g"
                     /db_xref="GeneID:2891539"
     mRNA            complement(<463756..>464523)
                     /locus_tag="CAGL0M04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449530.1"
                     /db_xref="GeneID:2891539"
     CDS             complement(463756..464523)
                     /locus_tag="CAGL0M04213g"
                     /inference="similar to AA sequence:UniProtKB:Q12288"
                     /note="similar to uniprot|Q12288 Saccharomyces cerevisiae
                     YLR126c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449530.1"
                     /db_xref="GeneID:2891539"
                     /db_xref="GOA:Q6FJR4"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR4"
                     /translation="MTVAARKVAIFYTDHPNEWSRDDGTFATMAVELLEQAKEHEPYV
                     GAEGGIEYRVFDVYNGELPSVDELSSGDYLGLYITGSRYDSFDTETQWIVDLRKLLYR
                     LVNETTLPIVGICFGHQVLARSLGAQVGRNPKGLEAGVHGVQLNATGKTLFSRDRLYL
                     SELHSDHVEEVPPGYENWGHTEKSHCQGLYKPQRVLTFQGHPEFTTQLAIKSTQHKHQ
                     TGQLSDEEYAETIQRCHSNNDGVHAARNIWKLYHGKI"
     gene            complement(<464973..>467324)
                     /locus_tag="CAGL0M04235g"
                     /db_xref="GeneID:2891540"
     mRNA            complement(<464973..>467324)
                     /locus_tag="CAGL0M04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449531.1"
                     /db_xref="GeneID:2891540"
     CDS             complement(464973..467324)
                     /locus_tag="CAGL0M04235g"
                     /inference="similar to AA sequence:UniProtKB:Q12440"
                     /note="similar to uniprot|Q12440 Saccharomyces cerevisiae
                     YLR127c APC2 component of the anaphase promoting complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449531.1"
                     /db_xref="GeneID:2891540"
                     /db_xref="GOA:Q6FJR3"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR3"
                     /translation="MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKN
                     HQLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRI
                     ERHVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELA
                     TEIVDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQ
                     LSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEIST
                     VNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVK
                     PHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESD
                     DVVDPMIGSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLDLFDILLELLE
                     SKETLVIEFKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINT
                     IDIMLRDIYKSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGEL
                     EHLLELYSRFYSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKS
                     PKHDSNFPTEGLTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKG
                     DSTYAAIPDVLEESVVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQS
                     AMPKDSHYSTVNQKQLQDYLDTLVEEGVLSSASNDSYKLPQIR"
     gene            <467785..>468606
                     /locus_tag="CAGL0M04257g"
                     /db_xref="GeneID:2891541"
     mRNA            <467785..>468606
                     /locus_tag="CAGL0M04257g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449532.1"
                     /db_xref="GeneID:2891541"
     CDS             467785..468606
                     /locus_tag="CAGL0M04257g"
                     /inference="similar to AA sequence:UniProtKB:Q12395"
                     /note="similar to uniprot|Q12395 Saccharomyces cerevisiae
                     YLR128w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449532.1"
                     /db_xref="GeneID:2891541"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR014764"
                     /translation="MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYY
                     DKEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNL
                     EDLVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKY
                     FTTIYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQ
                     DEHKKLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL"
     gene            <469040..>471862
                     /locus_tag="CAGL0M04279g"
                     /db_xref="GeneID:2891542"
     mRNA            <469040..>471862
                     /locus_tag="CAGL0M04279g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449533.1"
                     /db_xref="GeneID:2891542"
     CDS             469040..471862
                     /locus_tag="CAGL0M04279g"
                     /note="highly similar to uniprot|Q12220 Saccharomyces
                     cerevisiae YLR129w DIP2 DOM34P-interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449533.1"
                     /db_xref="GeneID:2891542"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR1"
                     /translation="MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVG
                     GLENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGV
                     IKIWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLR
                     SHKDAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAV
                     TCSADSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNAD
                     KTIEIYRLRKEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYK
                     IKSAQWTVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIR
                     STSISDDNKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGE
                     LQLFDIASSTMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSD
                     ESNKTMPMLQLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSL
                     YGHKLPVLSMDISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPES
                     YNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWE
                     ETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEESEEVEGVHKQTV
                     ESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSKKGIQPIRPQENTLLVALKKTP
                     EEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVTTKAALLQKHISLVCKTLFF
                     VIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGFNIEGMKFIKQQWELNHH
                     LEFNDEYEEKNFEEKHSKKRVFGTLA"
     gene            complement(<472227..>473396)
                     /locus_tag="CAGL0M04301g"
                     /db_xref="GeneID:2891543"
     mRNA            complement(<472227..>473396)
                     /locus_tag="CAGL0M04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449534.1"
                     /db_xref="GeneID:2891543"
     CDS             complement(472227..473396)
                     /locus_tag="CAGL0M04301g"
                     /inference="similar to AA sequence:UniProtKB:Q12436"
                     /note="similar to uniprot|Q12436 Saccharomyces cerevisiae
                     YLR130c ZRT2 or uniprot|P32804 Saccharomyces cerevisiae
                     YGL255w ZRT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449534.1"
                     /db_xref="GeneID:2891543"
                     /db_xref="GOA:Q6FJR0"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:Q6FJR0"
                     /translation="MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFP
                     ILSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWA
                     FGICLMSLFMLFLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGM
                     LNCAGHQDSLQDSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNS
                     EHKFSADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGL
                     GTRIAETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDS
                     ISSGILIYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA"
     gene            complement(<474158..>476269)
                     /locus_tag="CAGL0M04323g"
                     /db_xref="GeneID:2891544"
     mRNA            complement(<474158..>476269)
                     /locus_tag="CAGL0M04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449535.1"
                     /db_xref="GeneID:2891544"
     CDS             complement(474158..476269)
                     /locus_tag="CAGL0M04323g"
                     /inference="similar to AA sequence:UniProtKB:P21192"
                     /note="similar to uniprot|P21192 Saccharomyces cerevisiae
                     YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
                     YDR146c SWI5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449535.1"
                     /db_xref="GeneID:2891544"
                     /db_xref="GOA:Q6FJQ9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /translation="MNTFQADWGEIPQMPKDQVFTPQDQLTNYNDNMMDNLLDFNYND
                     VDALLSEELKDLDIPLAPSPRDLNMNAEQSLNWMQDIQGHRSNKPSMSHKRGMSGTAI
                     FGFKNHNKTLSIASFSKNTDIINEAENENVKGNTDNQNGFVLSQVLLKQQEELRLALE
                     KQKEVNRNLERQLRENRLQQEHIQRVLHDQEAVTSQLTAQNVTESPSKQRSPTKYQGD
                     DAIIVTKNSSSGGYVFPPPPRVTLNNEAVTPPLSFSRFSNIDQMESSDPLNYLQPNAD
                     FTEAYASHKTPESSFGKEHASVLSTSEFLRPTNAARESSSKAMYSSPNSMISPHRKKD
                     SVLSTVSTILQPQDDYQNTASPPSQMLNLEEANLENEQKNNGKMLRAPVEIMPTIPGS
                     KNNTPMTANKSGFMPQKHTFQHTPVKAKNNVDMNERSLVRPELSGTPLNKSVQNGMHF
                     REEDDSNILHHISEIPQGSTSHNNTTAGDDSNVSNRLQFSNTESSPSRQRKKPTTLPP
                     GYIDRYVKELPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVR
                     NHDLARHKKTHDKHFSCPCGKKFSSEQSMMKHKNRHNCTGPARVPDSKMVSKSPRKQS
                     SPTKLSSAIMNSPIKENYLKENTNLHIDQLRMDPKMRNALEDGGLLKPVERTEAMAFP
                     SPLSGYSDLGSPFRDLGTIEE"
     gene            complement(<477731..>478693)
                     /locus_tag="CAGL0M04345g"
                     /db_xref="GeneID:2891545"
     mRNA            complement(<477731..>478693)
                     /locus_tag="CAGL0M04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449536.1"
                     /db_xref="GeneID:2891545"
     CDS             complement(477731..478693)
                     /locus_tag="CAGL0M04345g"
                     /note="weakly similar to uniprot|Q12208 Saccharomyces
                     cerevisiae YLR132c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449536.1"
                     /db_xref="GeneID:2891545"
                     /db_xref="GOA:Q6FJQ8"
                     /db_xref="InterPro:IPR027521"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ8"
                     /translation="MNILAEYSSESEFESEENLKSQNSEEVIPPIENWEKSGEVSNLE
                     EWQRTHRDDIDTVIKLPPIPSSVYDKYQIPPNTDKYIERTDNGMSLGAIKGSDVFKRN
                     IGKWSCFLYIEYRPSSTEREMISKTLSQFNQSWQKKFPGTDIFEPLHYTTLGVPVPLH
                     ISLTKNIPFDSETQRDRFYNILVPKVAQLRQHLVQFEDTLRFYGSPQTTSVFLGYNVA
                     QSVKDNIIKDITDNIESALIDSGLSESDKMVTVPSFSHMSIAKLSNAPKDILDKVGYA
                     DSNQMAKQIQDYVEISPNQQPVFYVSSIKMNKNRELLTIPFATP"
     gene            <479260..>481074
                     /locus_tag="CAGL0M04367g"
                     /db_xref="GeneID:2891546"
     mRNA            <479260..>481074
                     /locus_tag="CAGL0M04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449537.1"
                     /db_xref="GeneID:2891546"
     CDS             479260..481074
                     /locus_tag="CAGL0M04367g"
                     /inference="similar to AA sequence:UniProtKB:P20485"
                     /note="similar to uniprot|P20485 Saccharomyces cerevisiae
                     YLR133w CKI1 Choline kinase or uniprot|Q03764
                     Saccharomyces cerevisiae YDR147w EKI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449537.1"
                     /db_xref="GeneID:2891546"
                     /db_xref="GOA:Q6FJQ7"
                     /db_xref="InterPro:IPR007521"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR026712"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ7"
                     /translation="MPLSEIEPHSPSAKKASGHRRSRRHSSIGSSSRKPSLTRNRSTL
                     RLMRTISIESLNNDTFSASGGEDEDNSNSDYNDVSGTNQDLEDKIGNLSIKSGISQSS
                     SDIKTTPAKKGSGGVSASSTDNSIEVPFVKVALDITLPQDYFKKDVANMIQSLKVPRW
                     YARGLVESPLKMESLRLTKIAGAMTNAIFKVEYPALPSLLLRVYGSNNDMIIDREYEL
                     QVLARLSVQHIGPSLYGCFLNGRFEQFLENATTLTKDDIRDWKTSQRIARRMKELHTG
                     VPLLRFEKEQGSMAWNKIDQWLKEIEMNGGDWISNDDNVQQVFGAPNWKEFKESIRKY
                     REWLFENSKSPYVFCHNDAQYGNLLFSAPVINSEKNDLKKSLDESNLSTSSLFPSDSR
                     VSLKEIINPTKQEQSQDSKLVVIDFEYAGANVAAYDLSNHFSEWMYDYNSSTPHKCFS
                     DQYPTTEQMLNFVYSYVSHLRGGVKTDIDDDARLLYNDIKKWRGTVQLFWSLWALIQS
                     GKIQFQEQESTKVDEGLVGEKYIIKTEDTAIDELVDDIDTNDVIEAPEGVSIDTFDYL
                     GYCTDKISVFWGDIIGFNIITKSECIENKVKYLSTDLL"
     gene            <481522..>483702
                     /locus_tag="CAGL0M04389g"
                     /db_xref="GeneID:2891547"
     mRNA            <481522..>483702
                     /locus_tag="CAGL0M04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449538.1"
                     /db_xref="GeneID:2891547"
     CDS             481522..483702
                     /locus_tag="CAGL0M04389g"
                     /note="weakly similar to uniprot|Q12098 Saccharomyces
                     cerevisiae YLR135w subunit of SLX1P/Ybr228p-SLX4P complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449538.1"
                     /db_xref="GeneID:2891547"
                     /db_xref="GOA:Q6FJQ6"
                     /db_xref="InterPro:IPR018574"
                     /db_xref="InterPro:IPR027784"
                     /translation="MDFERAQKNFDAFVINGETDETPNDELRHESQHSDFDTCGTQVP
                     EMNFSDDDNSDCGNNEIDRLAHNATETTDKEGDDSIIVTQERIAENRNNSVIEIEDED
                     QIDLSVVNSKEEDNIFLNTQIQSRLDDHEKDLQQKAVLKSFNFEYVDKDESPNMMGSR
                     YIRKKSPKKRNSRKNTEEAIQASKSISKRQNNANSLLQILSGKKSKVNAIIKNQRFKY
                     ESKTGVLKRASQVSNSTSTTYGKEEWKQIKNVLRTRYSKLENSDDRELENFINYLSEQ
                     LEKEPNLWTSSQIAISTNENNESYRQDSIGSLLTLSQVMGDKSAILESDDEYPDVRPN
                     GESFFKCADDSQQLKDDLNIVSQTNSNTNVSGVESVHGLEGKNLYSMGEKEEVTNKMT
                     DFVSKEVEQSQVPLLSIHRRGRNNGSYFIFDSSDEYKTIIEIDSSIRQPMDNSNEPSI
                     TNHRRTPVFSKSQSILDQECDSIEDISLSQGSFKAVTTLISPVKDGSTAQNSQAMDIP
                     TQFSGIPRLLDLKTVPKLPFESFNENSKDYRIIISKKKLLELKQAIKRLANIELTEEH
                     EVLGNIDGQPGEELFAVVLSISNNLELLSSPGVDTHTKEKSPSLAELRKDLDKIGLKP
                     VRLKSQIIENLASASQVVTVDESNQKKVGVTSKSEVFEFLTHLVKQEPDLLTRIYCFQ
                     PITMNDLINKLRNKDSFVDLIDDGTIREWTDKLGICIRSNNLKD"
     gene            <483972..>485030
                     /locus_tag="CAGL0M04411g"
                     /db_xref="GeneID:2891548"
     mRNA            <483972..>485030
                     /locus_tag="CAGL0M04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449539.1"
                     /db_xref="GeneID:2891548"
     CDS             483972..485030
                     /locus_tag="CAGL0M04411g"
                     /inference="similar to AA sequence:UniProtKB:Q12367"
                     /note="similar to uniprot|Q12367 Saccharomyces cerevisiae
                     YLR137w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449539.1"
                     /db_xref="GeneID:2891548"
                     /db_xref="GOA:Q6FJQ5"
                     /db_xref="InterPro:IPR029063"
                     /translation="MPFSLVRIDEDDVLEYVFERYTAINSDADSIRQDLGIQDSKSTT
                     LNIEIAPPKSLINDTNITKKGKKKKGNKSSSDYDFYSFEIKQNVTSLHSTRDNDNSTT
                     GYVLWSLTPVFCEWLLYNEQASPLHRAQMVNICSLEKKIIHDIEFPSLLNEDTTVIEL
                     GSGISSVLPILCSNFVGTYICTDQRGILNGLKQNIANNLDLVNKRTIVSETLDISNIQ
                     EQPTNSDDETIPIKPTTQLEVAILDWETFPKSIKSGSSNILTDFVKPHGTIFLLALDV
                     IYNEYLINPFLHTLHSIMFYYKNQREIVALVGIHLRSDDIVQEFLEKVTTEFPFKLHV
                     VDDPQWSHSRYDIYYITL"
     gene            <485936..>488773
                     /locus_tag="CAGL0M04433g"
                     /db_xref="GeneID:2891549"
     mRNA            <485936..>488773
                     /locus_tag="CAGL0M04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449540.1"
                     /db_xref="GeneID:2891549"
     CDS             485936..488773
                     /locus_tag="CAGL0M04433g"
                     /inference="similar to AA sequence:UniProtKB:Q99271"
                     /note="similar to uniprot|Q99271 Saccharomyces cerevisiae
                     YLR138w NHA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449540.1"
                     /db_xref="GeneID:2891549"
                     /db_xref="GOA:Q6FJQ4"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ4"
                     /translation="MAVWEQLEVSKAHVAYACVGVFSSIFSLVSLFVKEKLYIGESTV
                     AGIFGLIVGPVCLDWFNPLEWGNSDVITLEITRIVLCLQIFAVAVELPRKYMKKHWLS
                     VTMLLVPVMTAGWLIIGLFVWIIIPHINFPAALLVSACITATDPILAQSVVSGKFAKK
                     VPGHLRNLLSAESGCNDGMAFPFIYLSLNLVLHPGRGGLIVKDWICITILYECLFGCI
                     LGVVIGYVGRISIRFAEEKNIIDRESFLAFYVVLAFICAGFGSLLGVDDLLVSFAAGA
                     AFAWDGWFSQKTEESNVSTVIDVLLNYAYFIYFGAIIPWDQFNNGDIGLNVWRLIVLA
                     IIVIFLRRIPAVMILKPVIPDIKSWREALFVGHFGPIGVGAIFAAILARGELEHEFLE
                     EPTPLNVVPPEVETEHWQLIAILWPTICFFIITSIIVHGSSVAVITLGRHLNTVTLTK
                     TFTTHTTNGNGKSSWMQRLPSLDKSGRSFSLHRVDTSATNETIHHETEPDELKQNDTM
                     EDYSGVTTSGKPVRAAGGMRRRVTRKKKKSRGRKHAERLMRKTEKLNPMFGGYDDELN
                     DLGREKLQLEKEAEAGTFALGRKNWPNADNDDDADGSPHTVIGTSISGSDQYDEEKVD
                     SRHSLESTQSEKERKLAELKEQEETPHVAYAEGNKIIFENKQGEIIDEAKLNSPSDEE
                     AQQSFRSPSSLKKTRSNDSTSRSMTSMNSLKRIITPPSVKKVHSLIDRSHPKYIAYKI
                     DNQLIIEDDEGEVLRRYKINTHDKEESKTSPKVQTRNERSSSIVSRALSAVGLRNGSK
                     TTLASDEVTGVAEGERQFVLTPVPTHMYDQNENQINEEDEEGTSYSGSENDNEEENSQ
                     SDDSYEYDSNQLSGEESNERSEDEESEDYDEDSDNYSETQIERDRRLNALGHISLPAE
                     ADDEEPAPYIPQLDQNNSRNKMKSTFARFKK"
     gene            complement(<489048..>491183)
                     /locus_tag="CAGL0M04455g"
                     /db_xref="GeneID:2891550"
     mRNA            complement(<489048..>491183)
                     /locus_tag="CAGL0M04455g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449541.1"
                     /db_xref="GeneID:2891550"
     CDS             complement(489048..491183)
                     /locus_tag="CAGL0M04455g"
                     /note="weakly similar to uniprot|P42900 Saccharomyces
                     cerevisiae YLR139c SLS1 suppresses lethality of SSM4
                     deletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449541.1"
                     /db_xref="GeneID:2891550"
                     /db_xref="GOA:Q6FJQ3"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ3"
                     /translation="MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEK
                     QKIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDL
                     GISTNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQ
                     KRYEQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINE
                     KDDLIIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIR
                     YVEISLNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLIS
                     DSSEEKQYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTD
                     MDSFNWLDKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLKQK
                     LLPVKGTRQHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVL
                     GENDDYYVQLKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAV
                     MLEAPQHPFDFKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAKLDFGQGNKML
                     LGNSVCVNIPTEEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNR
                     IDLICDDNPDYNDFSNFIQQSLEFGKKKI"
     gene            <491638..>493329
                     /locus_tag="CAGL0M04477g"
                     /db_xref="GeneID:2891551"
     mRNA            <491638..>493329
                     /locus_tag="CAGL0M04477g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449542.1"
                     /db_xref="GeneID:2891551"
     CDS             491638..493329
                     /locus_tag="CAGL0M04477g"
                     /note="some similarities with uniprot|Q02983 Saccharomyces
                     cerevisiae YLR141w RRN5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449542.1"
                     /db_xref="GeneID:2891551"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ2"
                     /translation="MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEE
                     LTRSKVHVNSRVRCLEPDHFSGQVLRRDDYDDYDDDNDEEHDDSESDGDYTTDDEVEP
                     AEDDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQ
                     LKTTRYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSI
                     IDIEKWNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLP
                     SLESARISKAALLGRQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVL
                     QAVITLKQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQSVLSNLVSS
                     HQRHHNAEDDSALALTGELATRYYDGISYMDRKYMSRMNRLLTSTYADSELWHVTEST
                     TASQGPPDLFVQYYSHSVPTPHENNVTEKLALQLHDTQLANAVLDNPCEVALACEESR
                     RLDLEDLARSRKHENMLLRYLVGVSERAQPMRVITDQTRSTAVSNKLLQWFQVSP"
     gene            <494202..>495611
                     /locus_tag="CAGL0M04499g"
                     /db_xref="GeneID:2891552"
     mRNA            <494202..>495611
                     /locus_tag="CAGL0M04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449543.1"
                     /db_xref="GeneID:2891552"
     CDS             494202..495611
                     /locus_tag="CAGL0M04499g"
                     /note="highly similar to uniprot|P09368 Saccharomyces
                     cerevisiae YLR142w PUT1 Proline oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449543.1"
                     /db_xref="GeneID:2891552"
                     /db_xref="GOA:Q6FJQ1"
                     /db_xref="InterPro:IPR002872"
                     /db_xref="InterPro:IPR015659"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ1"
                     /translation="MLRIYRPRVMAIARRYVSQTAQTSNAMVADTTDPMMNPMQPKLS
                     SHSQLPPSSVAYLKTLSRAEVFSLGMIGLATTSKPVLNLVIKLFPYVPMPLIKMFVSR
                     LYCGGDNINEVKTFGEKLQKRGISNMMLSLTIEDSEGTKNIDINYIVEETIKSVHGVL
                     KPNLVNQLEKCGNDAKKINEIAPGYIALKPSALVSNPHDVLMNFNNPDPHWVAQREKL
                     IDNCSRIAQEIYDLNNDLLKKYPSRTAPFCVATIDAEKYDLQNSGVYELQRILFQKFN
                     KLSSPMVSVIGTWQLYLVDSAAQLAREHARAMKEGYKLGVKLVRGAYIHSETKRDSII
                     FKTKEGTDENYDAVMTTVIQDLLKNGTKSYYGHLVVASHNYGSQMLATKILKDAPENV
                     GKANIVLGQLLGMSDNVTHDLITKHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVK
                     SDNGFPLVKAVIKSLFSRA"
     gene            <496157..>498223
                     /locus_tag="CAGL0M04521g"
                     /db_xref="GeneID:2891553"
     mRNA            <496157..>498223
                     /locus_tag="CAGL0M04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449544.1"
                     /db_xref="GeneID:2891553"
     CDS             496157..498223
                     /locus_tag="CAGL0M04521g"
                     /inference="similar to AA sequence:UniProtKB:Q12429"
                     /note="similar to uniprot|Q12429 Saccharomyces cerevisiae
                     YLR143w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449544.1"
                     /db_xref="GeneID:2891553"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FJQ0"
                     /translation="MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELD
                     SFMFQTVGHDIVSLYENCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEV
                     KQSIPDLQAVSVGAILSSYQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQE
                     DELNTSESCKLDARIIKVAAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFE
                     SMVLDAPFFRKGFLKLEEVIDTTDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPV
                     PPLFDPAWNELYELIDNENFEDTKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKD
                     GTVQEQVKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNG
                     PLPPARACIESNIINDGSALQLSVVVKYADQTLGNDIEKCEKSGLHVQGRSYWAPCNI
                     GPYSQSIWLSNDLNQLSYLSGQIALEPSQMEMIDTNDAKQQAVLSLKHLDSIKQVINA
                     RNQVQLTCFISNNSIVPLLTQTWAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNL
                     PRNALCEWGGIAAKSLEVEHDDHDLTAELRKLNLDGGINIINHHDLTLRRFKTTFANT
                     AEQLITQIRGVTSKNTHCIIFFSEYLCVDKLQDTSAEFIPVEKVYNYKGEEVKFAAHI
                     VNHTKF"
     gene            <498691..>499533
                     /locus_tag="CAGL0M04543g"
                     /db_xref="GeneID:2891554"
     mRNA            <498691..>499533
                     /locus_tag="CAGL0M04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449545.1"
                     /db_xref="GeneID:2891554"
     CDS             498691..499533
                     /locus_tag="CAGL0M04543g"
                     /note="weakly similar to uniprot|P25623 Saccharomyces
                     cerevisiae YCR030c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449545.1"
                     /db_xref="GeneID:2891554"
                     /db_xref="GOA:Q6FJP9"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP9"
                     /translation="MDFTSQARRIIKFAEKALQDETLDSDTVQRAIIERNLRIEFRRQ
                     NIVSNALKDCHYHQITDEELQSNLTNYPFMASIQARVAWRSILSSPTDPDKDYHNQTS
                     TSINRKRSIYNSGHIPNKRLRNEKDRVDKLNQMVRDIENNTKVVETLLNESDITTSVD
                     RPAINVHPFVEDEAPPPTITMDDLEIVSNATKNISNTNTVEKPYVSVSSNSRNEYETR
                     HLKYDSTISRFGKIDHRRHSKENILIRNDNETHTIRRNSKSNKNPKSIRKMRAVAKKY
                     HLEE"
     gene            complement(<499618..>501930)
                     /locus_tag="CAGL0M04565g"
                     /db_xref="GeneID:2891555"
     mRNA            complement(<499618..>501930)
                     /locus_tag="CAGL0M04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449546.1"
                     /db_xref="GeneID:2891555"
     CDS             complement(499618..501930)
                     /locus_tag="CAGL0M04565g"
                     /inference="similar to AA sequence:UniProtKB:Q12168"
                     /note="similar to uniprot|Q12168 Saccharomyces cerevisiae
                     YLR144c ACF2 or uniprot|P53753 Saccharomyces cerevisiae
                     YNR067c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449546.1"
                     /db_xref="GeneID:2891555"
                     /db_xref="GOA:Q6FJP8"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP8"
                     /translation="MSYNRPPMPLPKDANPNRSTSGLFYPNEPIMPPRNEEPDSMISS
                     LVLDTATPTIDAMNSINITNDMVQEAEYVTVNDLPINTSAPPAMFTRTGHEIPIPDGV
                     ERNGRPVATNKFYGNFLLGSQTCATWTHPYSVWISKDNAFPGFAANHVRASQRVFGDG
                     NPAPFFFSPIGIRSFVFGANELPSFESMSLRFTDLSHMSIHVWLKKSESEHIRFPIVQ
                     GMGFITANYSNLTPRLQSAVGFRNLNSMASPRTDMQKYQVLLENDVKWTIYVKLDSKC
                     NNFQLFIANGNTIQANQRVSSATIQVVADTVEAIDQAAGCYPVNCDVVNAVNKDKGIY
                     RLAYKTEGYSNKGTTLLYGLRHHMVSMTIPTALTSINSELDSTVMGVMRGFITNTLEM
                     QVQIPANVDFIPATTIPGRRVLYSHEVLEKVRDAARKEVNGDVINESNVNSMYFSGKV
                     LAKYAWILFCCQYIVNDRGLVDILLPKLKEAFARFSQNQQQLPLRYDTTWGGVISSGT
                     SGDDFGNSYYNDHHFHYSYHIIAAAILTKVDRDIGNGSWFTENREWVETLIRDYANPS
                     ENDPYFPMYRSFDWFTGHSWAKGLFESGDGKDEESSSEDVNSCYALKLWGMVSGNVAL
                     VNRSNVQLGILNTSLNQYFLYDDANKTEPPQFIGNKVSGILFENKIDHTTYFGNYLQY
                     IQMIHAIPITPMSSFIRHPSYVEQEWIQKLQGIVNDVNDGWKGIMMLNLALFNPRASF
                     EFFSSPNFSGNFLDNGQSLTWSLAYSGAFI"
     gene            <502567..>503199
                     /locus_tag="CAGL0M04587g"
                     /db_xref="GeneID:2891556"
     mRNA            <502567..>503199
                     /locus_tag="CAGL0M04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449547.1"
                     /db_xref="GeneID:2891556"
     CDS             502567..503199
                     /locus_tag="CAGL0M04587g"
                     /inference="similar to AA sequence:UniProtKB:Q12530"
                     /note="similar to uniprot|Q12530 Saccharomyces cerevisiae
                     YLR145w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449547.1"
                     /db_xref="GeneID:2891556"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP7"
                     /translation="MSLVVDKYIQLHQEYRILHLLNHRNKNQHRVATWWKWFNMLRRS
                     VGDVVEILQPLGRRKNQKLKDKKDGRFLYRTLHKFFQMESKLYYSFNNIIKLGQFITL
                     GVVLVGILGRVHSIYHEIFELYKEQFISMGCLRVPKKNAQIEEAHVTNNDNEELGELI
                     NDADVLIEPSALLKQDVILSKNIKNESKSSKDKKKKKKKKKGSAIDDLFG"
     gene            complement(<503641..>504537)
                     /locus_tag="CAGL0M04609g"
                     /db_xref="GeneID:2891557"
     mRNA            complement(<503641..>504537)
                     /locus_tag="CAGL0M04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449548.1"
                     /db_xref="GeneID:2891557"
     CDS             complement(503641..504537)
                     /locus_tag="CAGL0M04609g"
                     /inference="similar to AA sequence:UniProtKB:Q12455"
                     /note="similar to uniprot|Q12455 Saccharomyces cerevisiae
                     YLR146c SPE4 or uniprot|Q12074 Saccharomyces cerevisiae
                     YPR069c SPE3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449548.1"
                     /db_xref="GeneID:2891557"
                     /db_xref="GOA:Q6FJP6"
                     /db_xref="InterPro:IPR001045"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP6"
                     /translation="MAEQKYIKDGWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDIL
                     VFESTNHGVCLVLDGIIQCSERDEFAYQEMIAHIPLYCHANPKKVLVIGGGDGGVVRE
                     VVKHDKVESVTMVEIDKTVIELAKKYLPGMSCAMDHPKLKLNLCDGFKFLKEASMLSN
                     DDKYDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDGIVIAQASENVWLDINYLASL
                     RKTANEVFTNTMISYTTVPTYTSGQLGLIVCTNSNDYDLTTPQRQPSVSEQNQLRYYN
                     SQIHSASFVLPNWADMLIYDKK"
     gene            complement(<505301..>505600)
                     /locus_tag="CAGL0M04631g"
                     /db_xref="GeneID:2891558"
     mRNA            complement(<505301..>505600)
                     /locus_tag="CAGL0M04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449549.1"
                     /db_xref="GeneID:2891558"
     CDS             complement(505301..505600)
                     /locus_tag="CAGL0M04631g"
                     /note="highly similar to uniprot|P43321 Saccharomyces
                     cerevisiae YLR147c SMD3 spliceosomal snRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449549.1"
                     /db_xref="GeneID:2891558"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP5"
                     /translation="MSNIPVKLLSEAQGHVVTIELNNGDTYRGKLVESEDNMNVQLRD
                     VMVTSSTQKLSRMDHVFVRGSHIRFFVVPDMLKNAPLFKKNQSRQPPPVRGPRRR"
     gene            <505982..>508861
                     /locus_tag="CAGL0M04653g"
                     /db_xref="GeneID:2891559"
     mRNA            <505982..>508861
                     /locus_tag="CAGL0M04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449550.1"
                     /db_xref="GeneID:2891559"
     CDS             505982..508861
                     /locus_tag="CAGL0M04653g"
                     /inference="similar to AA sequence:UniProtKB:P27801"
                     /note="similar to uniprot|P27801 Saccharomyces cerevisiae
                     YLR148w PEP3 vacuolar membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449550.1"
                     /db_xref="GeneID:2891559"
                     /db_xref="GOA:Q6FJP4"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR007810"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019453"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP4"
                     /translation="MEVEIEHVELGFINELNKNICGLQVEGNLMCFALRTGSLFLIDL
                     DTPSNVIRCQIPLVRDGGVNAEKVLKIWLNPSRSLILVKTNFAKYYLCDVDVIVKTNG
                     ESMTQNAIASVKQLSKKNCDVRSVAWVRNAKATGMHDKFNLLIGTARGQVYYIEINSK
                     LSEQNATLLYESPDSIDGIYWNDANGDIIIASKNKLIYWDGLQSSSNNNKNDREISPK
                     ITLSKKRKSNEVEEYEHMHMEYTNKFAVYKNSFAWVTESGIVFSNVEQVKKSNKKVLG
                     SSKVILNVELPNSKKPIRDIILSDYHILILRESSITIVNQLDNSVIYNQSIWSNDNEH
                     ILGFASDVHYKQATFWCFSASNIFEIILKKESNSVWRLLCDQQRYDDALNLQDLSLFE
                     QSSIQYLKGMHLLEENVYSDAAKCFGKSDTVSIPEIALKLLDGDDGMLKIGEQKLNAL
                     QFFLSEKLLNYRHKDSLKYTIILDWIMWNYVRLFCLIDEKACSEREPDRLKYWDQRKE
                     EISASVKKLIDDNINLLERGTFYQLLEKSGRRIELLYLAEKLNDHQYLMNYWIRNENW
                     YESLKVLQKAKDPQLAYKHANILLVNCSQSTINTWMTMENLNPVFLIDAILTYFSIYQ
                     KSTKGSKVLQENYALTYLKWYVGNNDVNDKIIYNTIVYMMITTPIIQEGNDAMQTDHN
                     NDNDVIEFMENYSSKSHLEFVLRLSLKFERIKVAIYLLKLSDQYEDAVDLALSNGLVD
                     EAKEIANMESLAKDFTIKRKHWIKIAQVVLSQHLEKPDIKQNIRSIIRESEGTVKIND
                     LLPFFNEFTTVANLKDELVRSLEEHNHEIITIRDKIKHSLELKKDIIHETEKFKERYR
                     ILEPGKSCDQCQKMLQTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGKIENFQKRLN
                     KDRKSVNPKELEELMATKCCLCSDIAINKIDEATIDDKERSQWVI"
     gene            <509383..>509799
                     /locus_tag="CAGL0M04675g"
                     /db_xref="GeneID:2891560"
     mRNA            <509383..>509799
                     /locus_tag="CAGL0M04675g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449551.1"
                     /db_xref="GeneID:2891560"
     CDS             509383..509799
                     /locus_tag="CAGL0M04675g"
                     /inference="similar to AA sequence:UniProtKB:Q12305"
                     /note="similar to uniprot|Q12305 Saccharomyces cerevisiae
                     YOR285w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449551.1"
                     /db_xref="GeneID:2891560"
                     /db_xref="GOA:Q6FJP3"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP3"
                     /translation="MWKRIVDAWNGNATSPSTPGVNTYDFEGMKKVAMQHDPSTVLVD
                     VREPSEFSVVHIPGSINVPYRSHPEGFSLDPVTFKQTFGYEKPPVSNHLIFYCASGRR
                     GSMAREVAAKNGYTNLSEYPGSMNDWVAKGGDRLAL"
     gene            <510203..>510664
                     /locus_tag="CAGL0M04697g"
                     /db_xref="GeneID:2891561"
     mRNA            <510203..>510664
                     /locus_tag="CAGL0M04697g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449552.1"
                     /db_xref="GeneID:2891561"
     CDS             510203..510664
                     /locus_tag="CAGL0M04697g"
                     /inference="similar to AA sequence:UniProtKB:Q08742"
                     /note="similar to uniprot|Q08742 Saccharomyces cerevisiae
                     YOR286w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449552.1"
                     /db_xref="GeneID:2891561"
                     /db_xref="GOA:Q6FJP2"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP2"
                     /translation="MFKRVVSISRGRVSPIRLVGLNRSANMIRYLSTNGPKAYNFEDI
                     KQLVQHPDPKKVLVDVREPEELKECKLPNSINIPLKSAPGALGLPEEEFQELFHIEKP
                     PKDKELIFFCALGVRAKTSEELARSYGYESTGVWEGSMKEWKEKGGDKIKV"
     gene            complement(<510921..>511862)
                     /locus_tag="CAGL0M04719g"
                     /db_xref="GeneID:2891562"
     mRNA            complement(<510921..>511862)
                     /locus_tag="CAGL0M04719g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449553.1"
                     /db_xref="GeneID:2891562"
     CDS             complement(510921..511862)
                     /locus_tag="CAGL0M04719g"
                     /inference="similar to AA sequence:UniProtKB:Q12481"
                     /note="similar to uniprot|Q12481 Saccharomyces cerevisiae
                     YOR287c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449553.1"
                     /db_xref="GeneID:2891562"
                     /db_xref="GOA:Q6FJP1"
                     /db_xref="InterPro:IPR009292"
                     /translation="MSYYFKNIKPSYDDDSDEVSDEQDLDAILASKMRGRAESDDESS
                     EEEDDGLSKLSFGSLKKAEDQLEEEERGELRKKRKPQHSKPINDEPEVRHKVYKEEEQ
                     EESDSESGSDDGAFFEEDERDNHSRPKNKNSKKRKHAPTEHSSKKRVSKIRDIPGLEI
                     ARQAKSGIYQDVRFTKATGEATDFSVIRRRYKFLDEYREKEIEEMERLLNDKKFVNKA
                     ESREIENMKEKVRSMKSRLQSVKNRELEQQIVKDYEGKLNEGNKNRFHLKKAEKRKVI
                     QKWKFDHMKAKQREKVMERKRKKKLGKEFKQFEFHNR"
     gene            complement(<512229..>513143)
                     /locus_tag="CAGL0M04741g"
                     /db_xref="GeneID:2891563"
     mRNA            complement(<512229..>513143)
                     /locus_tag="CAGL0M04741g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449554.1"
                     /db_xref="GeneID:2891563"
     CDS             complement(512229..513143)
                     /locus_tag="CAGL0M04741g"
                     /inference="similar to AA sequence:UniProtKB:Q12404"
                     /note="similar to uniprot|Q12404 Saccharomyces cerevisiae
                     YOR288c MPD1 disulfide isomerase related protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449554.1"
                     /db_xref="GeneID:2891563"
                     /db_xref="GOA:Q6FJP0"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:Q6FJP0"
                     /translation="MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNT
                     NYTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGF
                     PTLKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLV
                     NSQSSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESA
                     EIIGPLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKE
                     GPYSKRDDYLAKLKLNKKKKTQVQNDEL"
     gene            <513555..>514259
                     /locus_tag="CAGL0M04763g"
                     /db_xref="GeneID:2891564"
     mRNA            <513555..>514259
                     /locus_tag="CAGL0M04763g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449555.1"
                     /db_xref="GeneID:2891564"
     CDS             513555..514259
                     /locus_tag="CAGL0M04763g"
                     /inference="similar to AA sequence:UniProtKB:Q12012"
                     /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
                     YOR289w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449555.1"
                     /db_xref="GeneID:2891564"
                     /db_xref="GOA:Q6FJN9"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR023473"
                     /db_xref="InterPro:IPR027485"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN9"
                     /translation="MVGKNNELYAFYAFLQLYKHMGHVQRDYSLRQVAEALYDTTLII
                     KEDTSLFITWKRLDSQKTSIDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDS
                     RFTPISERELKTLKCSCNILRHFEKIYSSGDDHGDIDNWEIGKNGIELLFKHPKSGKT
                     CSATFLPDVMVEQGWDKKETFLNLIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEI
                     TYDAFISGFEKLETLV"
     gene            complement(514590..514662)
                     /gene="tRNA-Ala (TGC)"
                     /locus_tag="CAGL0M04785r"
                     /db_xref="GeneID:2891565"
     tRNA            complement(514590..514662)
                     /gene="tRNA-Ala (TGC)"
                     /locus_tag="CAGL0M04785r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2891565"
     gene            complement(<514847..>520039)
                     /locus_tag="CAGL0M04807g"
                     /db_xref="GeneID:2891566"
     mRNA            complement(<514847..>520039)
                     /locus_tag="CAGL0M04807g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449556.1"
                     /db_xref="GeneID:2891566"
     CDS             complement(514847..520039)
                     /locus_tag="CAGL0M04807g"
                     /inference="similar to AA sequence:UniProtKB:P22082"
                     /note="similar to uniprot|P22082 Saccharomyces cerevisiae
                     YOR290c SNF2 or uniprot|P32597 Saccharomyces cerevisiae
                     YIL126w STH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449556.1"
                     /db_xref="GeneID:2891566"
                     /db_xref="GOA:Q6FJN8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR014978"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN8"
                     /translation="MDVPMPQRQLTKEEINRCYLKWQQLRNEHGKNAANVPEFIHLTK
                     ILHVAAKQQQEQKQKLQQQQQQQQQQQQVHVGTPQNDNKNNSEPWRVDNPNGSTFSHN
                     KEQLETSTDQRPPNFTMNGTEGSASSASPATNPQVQFYKKENSNNGASQRDNFQSRTI
                     SDNSNSPATSPKSQVVTQNMPVRNNSQPNKSINSPHTINKPNDRQTQPAPLNPTQQRP
                     VPQNSIFTPQQSELLRAQISALKSLVNNQPVPQEYQKVIQQSINNPPDFKRMLLSLSD
                     FVKKKQLNQQSGSPASEIPEPQPQAQPPVQPPTEPQVQPQATPQAQSQPHAQSQQQDK
                     NSTSDNAKIDTNTASANTSMTEEKPIIKTGTNTPNVTHEQIPPVGVQGTSSNTLREET
                     HKTDTPSPRTIPGSVTHQIATPNLNKQENQNPETQNQYALKPPTERVPDPLVDGELKP
                     AQQLPPVPIQKFVEKYPYVKNVVSIEDPDLMVDTFSIPTIPEEPVDYYSLFPNTANPK
                     LVMEPGMLPAGVDIHTATDIYQTLIALNLDTSVNECISDMLDDSKDENTKEETLYDYF
                     ALQLLPLQKAVRGHVLQYEWYQNSLLTNAHPNFLSKIRNINFNDVLLTIELYRKREVI
                     RQEEESKRYQQKLTRIRNSVVNTFNHKVHRRNKRIKLGHKLVATHANIEKEEQKRAER
                     KAKERLQALKANDEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKDQQKYTKDML
                     NQHLMEKKEESAEPVVYNDDQMLTMSMNDDDDDEENIDYYNVAHRIKEEVRQQPSILV
                     GGTLKEYQIKGLQWMVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIKGPFLI
                     IVPLSTLPNWSSEFAKWAPKLRTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKE
                     RAILSKVKWVHMIIDEGHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWAL
                     LNFVLPKIFNSAKSFDEWFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRL
                     KKDVEKELPDKVEKVIKCKMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLM
                     QLKKICNHPFVFEEVEDHINPTRDTNMNIWRVAGKFELLERILPKLKASRHRVLIFFQ
                     MTQIMDIMEDFLRYIDIKYLRLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLG
                     LNLQTADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYK
                     KLDIDGKVIQAGKFDNKSTAEEQEALLRSLLEAEEGRRRRREAGIEEEEELRDNEINE
                     ILARSEDDLALFSKLDTEREEADKAMHINSRLMTLDELPEIYHRNIDEELKKEESESA
                     ETYGRGTRERKQMIYSDNMSEEQWLKQFEVSDSEDKDPNKIMELKDDETDVNSNTIKT
                     ESNEAIRSSSISIPSSPTQTMNNTPETNDLDSDSGEYAKKRKAPSTRPRGRPKKIKTD
                     DGENNPTESITGDVGDNTEDVVKRAGKTSIKSANTSSRGRGRGRGRGKPRGRAGMRGR
                     GRPPKSKNGMVYVRMLPEDPVSEEERKGIAEQATKLYDFALNYVNSDERRLSDIFLVK
                     PSKHLYPDYYLIIKYPIAFDTIKDAIDRLQYNSITEVMEDFHLMFANARVYNTEGSII
                     YEDAIELEDAMLQKYVEITNDTATLDFTEFDAKYGTKPLHIQEPETHSTNENTPQDSS
                     KDII"
     gene            complement(<524685..>529805)
                     /locus_tag="CAGL0M04829g"
                     /db_xref="GeneID:2891567"
     mRNA            complement(<524685..>529805)
                     /locus_tag="CAGL0M04829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449557.1"
                     /db_xref="GeneID:2891567"
     CDS             complement(524685..529805)
                     /locus_tag="CAGL0M04829g"
                     /inference="similar to AA sequence:UniProtKB:Q05022"
                     /note="similar to uniprot|Q05022 Saccharomyces cerevisiae
                     YMR229c RRP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449557.1"
                     /db_xref="GeneID:2891567"
                     /db_xref="GOA:Q6FJN7"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN7"
                     /translation="MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLE
                     LKHVANEAAHDVLFGNEKRPLTEDDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEH
                     LNFNNVKEGTILLGQIDSITKNDLRITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDS
                     DSKEDDAEYESSDDESEQKSLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELT
                     IEPSVVNNFDVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKP
                     GSVFISCITKKTDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVG
                     KVFGSISAFIGKPHLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHV
                     ISLNNTLGSIESLEAFPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQ
                     DKLKSRVIGYDVADCIFELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELK
                     LLGGQFTAFVPPLHISDIRLIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDE
                     ELEKPVIESFETAKSIKNKNEKTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVK
                     RAEDHLRLGQTVQVKVLEVDEERRRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVV
                     VEKTKDSVIVEIPDVGIRGVIYVGHISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRT
                     QIFNLSLKKSLMKDAQNKRLPTTFAEITKFKKTDPLHGYVKSISSTGVFVAFTGKFVG
                     LVLPSYAVESRQVDIEKAFYSNQSVTAYLLRTDDDNERFLLTLKAPKVEKAAETISAE
                     NIIDTSIKSVKDIKLGKILDAKIKGVKKNQLNIILADNVHGRVDISEVFDNYNDIKDK
                     KHPLSHYKANDKVRVKIIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQLKSKDVKEL
                     DIRDITVGDEIIAFVNNYQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNVEDDFPLG
                     SVLKVNVTGKDQNKSILQVTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIELENKI
                     TGISTALEALNDFTEPLDQVFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQKIT
                     SHSDLKVGEVVNGLVKTVTDKGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQPV
                     VGKIVSCNEDDRILLTLRETEVNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLD
                     NTANVTGLAHITEIADEVPEDIQSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTN
                     ETITEKAESQPQPRKIDEDQDELMDDEVVYNSESEASDDEEAHSSKSTTVISNDGGLS
                     LSAGFDWTTSILDQANASSDSESDEEDFMESKRSKNKKKKSKNLVEDKTIDINTRAPE
                     SVADFERLIIGNPNSSVIWMNYMAFQLQLSEIDKARELAERALKTINYREEAEKLNIW
                     IAMLNLENTFGSEETLEDVFTRSCQYMDSFTMHSKLIGIYQLSEKFDKASELFKITTK
                     KFGSEKTSIWVSWASFVLSQNEPDQVGTILSSALKSLPKRNHIEVVRKFAQLEFSEGN
                     PERGRSLFEGLLADAPKRIDIWNVYLDQEIKQKDNKSRVEELFERVIKMKITRKQAKF
                     FFNKWLQFEESNNDEKMTDYVKAKASEYVEKHTQKDEQ"
     gene            <532127..>532318
                     /locus_tag="CAGL0M04851g"
                     /db_xref="GeneID:2891568"
     mRNA            <532127..>532318
                     /locus_tag="CAGL0M04851g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449558.1"
                     /db_xref="GeneID:2891568"
     CDS             532127..532318
                     /locus_tag="CAGL0M04851g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449558.1"
                     /db_xref="GeneID:2891568"
                     /db_xref="GOA:Q6FJN6"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN6"
                     /translation="MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSEN
                     YRRVQDYKILVLHYFCKQR"
     gene            <532872..>533189
                     /locus_tag="CAGL0M04873g"
                     /db_xref="GeneID:2891569"
     mRNA            <532872..>533189
                     /locus_tag="CAGL0M04873g"
                     /product="40S ribosomal protein S10"
                     /transcript_id="XM_449559.1"
                     /db_xref="GeneID:2891569"
     CDS             532872..533189
                     /locus_tag="CAGL0M04873g"
                     /note="highly similar to uniprot|P46784 Saccharomyces
                     cerevisiae YMR230w RPS10B or uniprot|Q08745 Saccharomyces
                     cerevisiae YOR293w RPS10A"
                     /codon_start=1
                     /product="40S ribosomal protein S10"
                     /protein_id="XP_449559.1"
                     /db_xref="GeneID:2891569"
                     /db_xref="GOA:Q6FJN5"
                     /db_xref="InterPro:IPR005326"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN5"
                     /translation="MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIK
                     ALQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPN
                     RRY"
     gene            <534252..>537362
                     /locus_tag="CAGL0M04895g"
                     /db_xref="GeneID:2891570"
     mRNA            <534252..>537362
                     /locus_tag="CAGL0M04895g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449560.1"
                     /db_xref="GeneID:2891570"
     CDS             534252..537362
                     /locus_tag="CAGL0M04895g"
                     /inference="similar to AA sequence:UniProtKB:P12868"
                     /note="similar to uniprot|P12868 Saccharomyces cerevisiae
                     YMR231w PEP5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449560.1"
                     /db_xref="GeneID:2891570"
                     /db_xref="GOA:Q6FJN4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR016528"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024763"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN4"
                     /translation="MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDL
                     FFIAVRSNYIRHFSLKKAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLK
                     LFKINDLPTNEFHYHSLVEIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLS
                     RDRGSQQRILYEDSTGDPITSLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSS
                     KEGVALNCASFSKFTNENICCMNDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLI
                     IFEEERQKTTSIEYESGASNNICKAIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSI
                     LYLVTAEGLMYKVSKKSLDERLSIVMNKEMFPFALQLASDCNLPDNKIQKINKLYGDY
                     LYSKGLHTEAAQQYMKCIDILDISDIITKLGANDVFDVKAMRNLADFVWELIRKGRAD
                     HDTVTLLLSVLIKLKDEDGLKRFVSYFRRSGKYIETENYKDLDDESYFFSDLRLFDLE
                     LIRSLLIDSKLNQLCYQFVFKFSKDPIMITDVLLNVLKETEATLKYVKSLSVDDILRV
                     LVRFSKQLLYLSPNETNLLLIEVFTGKYRPSSYVSDINNVVNTKTGTKSEKNPVFYSY
                     TAFLKYMNPLADASVLDASENGDRLDVDRPTYHPPKPSLVFNAFLSRPFEFVVFLEAC
                     LESYKQFDGFKNDRQEILTTLYDLYLTLSKQDVGERKSEWTEKANLVLNESNELANEL
                     DQNSNNNLNKVDNSLMKLIAHMNGLNVADISSPINENKEFSNDVTDNARIINGFRNLT
                     YMGEVSECMKFFEEHSKNNIDLFPMALSYFISKKEILEFIGGEDQLVKKIIKPIIENN
                     IMSILDLLQILSSRDFITYGCVKDILLDRMKEEDAVAKRTKKLIASYSEELQDKKTQL
                     RTYLSPDHEQHIAIKDKKCDLCHITLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLY
                     KCPKCVIDIETSSKRISKERELASRKELLDLAFKEEGNNSDRFRIVSDFIGRGALENS
                     YITIES"
     gene            <537760..>539520
                     /locus_tag="CAGL0M04917g"
                     /db_xref="GeneID:2891571"
     mRNA            <537760..>539520
                     /locus_tag="CAGL0M04917g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449561.1"
                     /db_xref="GeneID:2891571"
     CDS             537760..539520
                     /locus_tag="CAGL0M04917g"
                     /note="weakly similar to uniprot|Q05670 Saccharomyces
                     cerevisiae YMR232w FUS2 required for cell fusion during
                     mating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449561.1"
                     /db_xref="GeneID:2891571"
                     /db_xref="GOA:Q6FJN3"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN3"
                     /translation="MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGA
                     RASYSDSIGGDLDTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMT
                     EKALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLE
                     LNPSSIDVIYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYH
                     RSYDDARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISH
                     LNIDNEDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVI
                     KPRMSPKISLDEKPCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIM
                     QIHSWTSLLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKL
                     ETVLALMKTVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQL
                     PRFLTYINQFMVLFLLSFNAYLRDALDILISVQADLLHTEEGVNEIEKDYDKRRNVMK
                     KTVNSHYEKSNNNIVLRRLF"
     gene            <539988..>540689
                     /locus_tag="CAGL0M04939g"
                     /db_xref="GeneID:2891572"
     mRNA            <539988..>540689
                     /locus_tag="CAGL0M04939g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449562.1"
                     /db_xref="GeneID:2891572"
     CDS             539988..540689
                     /locus_tag="CAGL0M04939g"
                     /inference="similar to AA sequence:UniProtKB:Q05024"
                     /note="similar to uniprot|Q05024 Saccharomyces cerevisiae
                     YMR233w and similar to uniprot|Q08747 Saccharomyces
                     cerevisiae YOR295w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449562.1"
                     /db_xref="GeneID:2891572"
                     /db_xref="GOA:Q6FJN2"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014876"
                     /db_xref="InterPro:IPR019835"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN2"
                     /translation="MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLE
                     NKKKEVNELIVARFQILQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTES
                     SKKTRIQVKKKKSKKSSKDGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVV
                     KQVWDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEA
                     DNSRLSVKLEDGTQA"
     gene            complement(<540950..>542158)
                     /locus_tag="CAGL0M04961g"
                     /db_xref="GeneID:2891573"
     mRNA            complement(<540950..>542158)
                     /locus_tag="CAGL0M04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449563.1"
                     /db_xref="GeneID:2891573"
     CDS             complement(540950..542158)
                     /locus_tag="CAGL0M04961g"
                     /note="highly similar to uniprot|P11745 Saccharomyces
                     cerevisiae YMR235c RNA1 GTPase activating protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449563.1"
                     /db_xref="GeneID:2891573"
                     /db_xref="GOA:Q6FJN1"
                     /db_xref="InterPro:IPR027038"
                     /db_xref="UniProtKB/TrEMBL:Q6FJN1"
                     /translation="MATLHFTPKYEDDEVFSIAGKALKLTTKEDIQPHLDDLAKLKKC
                     KKLDFSGNTIGTEASKALADFLGSTESVRDVVEEINFADMYTSRLVDEVVDSLKALLP
                     VLLKCNKLTILNLSDNAFGLRTIDYLENYIANAVHLKHLILSNNGMGPFAGERIGKAL
                     FYLAQNKTKAKESMLETFICGRNRLENGSALYLALGLKSHGDGLKVVKLYQNGIRPKG
                     VATLIHYGLKYNTKLEIIDLQDNTFTTAASLVLAKNLPLWKNTLVELNLNDCLLKAKG
                     SKEVFKVFEDNTFENLETLRFEYNEMEQDTLETVFLPAIEDNKFPKLKNLEINGNRFE
                     EDSDPVNALMDHFEDLELDDLEEPDSEEEEEEEEEEEKMEEIETSKIENELIELQIDN
                     LAQELSKASI"
     gene            complement(<542562..>543017)
                     /locus_tag="CAGL0M04983g"
                     /db_xref="GeneID:2891574"
     mRNA            complement(<542562..>543017)
                     /locus_tag="CAGL0M04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449564.1"
                     /db_xref="GeneID:2891574"
     CDS             complement(542562..543017)
                     /locus_tag="CAGL0M04983g"
                     /note="highly similar to uniprot|O14467 Saccharomyces
                     cerevisiae YOR298ca MBF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449564.1"
                     /db_xref="GeneID:2891574"
                     /db_xref="GOA:Q6FJN0"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR013729"
                     /translation="MSDWESHTVIGQKARAGGSGPRANVARTQGQINAARRQGLVLSV
                     DKKYGTANTKGDAEGQRLTKVDRETDIVKPKKLDANVGKTIARVRTEKKMSQKDLATK
                     INEKPTVINDYEAGRAIPNQQVLGKMERALGVKLRGKAIGEPLGGPKKK"
     gene            <543281..>543781
                     /locus_tag="CAGL0M05005g"
                     /db_xref="GeneID:2891575"
     mRNA            <543281..>543781
                     /locus_tag="CAGL0M05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449565.1"
                     /db_xref="GeneID:2891575"
     CDS             543281..543781
                     /locus_tag="CAGL0M05005g"
                     /inference="similar to AA sequence:UniProtKB:Q05027"
                     /note="similar to uniprot|Q05027 Saccharomyces cerevisiae
                     YMR236w TAF17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449565.1"
                     /db_xref="GeneID:2891575"
                     /db_xref="GOA:Q6FJM9"
                     /db_xref="InterPro:IPR003162"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM9"
                     /translation="MEEVDSQGDLPRDVRLLHLLLASQSIQQYEDRVPLQLMDFAHRY
                     TRGVLMDAMVYNDYASENAPGGSNAAANATNAKNAPKANTLGSGMTSNGGKNINVEDV
                     RLAIAARTQYMFKPTAPKELLLQLAAERNKKALPQVMGSWGVRLPPEKYCLTAKSWDL
                     DEKEEK"
     gene            <544448..>546676
                     /locus_tag="CAGL0M05027g"
                     /db_xref="GeneID:2891576"
     mRNA            <544448..>546676
                     /locus_tag="CAGL0M05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449566.1"
                     /db_xref="GeneID:2891576"
     CDS             544448..546676
                     /locus_tag="CAGL0M05027g"
                     /inference="similar to AA sequence:UniProtKB:Q05029"
                     /note="similar to uniprot|Q05029 Saccharomyces cerevisiae
                     YMR237w and similar to uniprot|Q08754 Saccharomyces
                     cerevisiae YOR299w BUD7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449566.1"
                     /db_xref="GeneID:2891576"
                     /db_xref="GOA:Q6FJM8"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM8"
                     /translation="MITQASIPEVREDVIGFALGERKAILPQCQDLGPPDLITMVKYV
                     PTPNSNATAGTTSGNGAGGANNGTAGAANGNNSLSTADPAALLAEIHSHDKLKGAIGT
                     FFYTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDV
                     NVIVHIPGAVQTYVLDSNGEHLPVSGNQTTPTVASTASANPIDQASEMDVIWAETFIS
                     GVIRSIMFMKDNADDGEAQPLVETLILNPLTAGKLDDVANTFIKLFPTVYERGVLTEA
                     PCHVLVPTRTNNYLVDTLVELVRLTKSVDICRPMLEELIKSYPDASIVLARVLMACDY
                     EIDAIDIINRELLPHGEEDDTISPIFRAELLCLQTQFLMNVKNDYKLALEVALSAVKF
                     SPSEFIPWFLLTKIYIKLNDIENALLALNSCPMAQSHERYVLKRAVPIGSEDNLHLPL
                     PENIGVDEILQLNPSDVNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWET
                     LLKCRSKIFVMEDEYQISTDEVSLTNQSNRNEDTPSELNMRTKRLCDRWLDNLFMLLY
                     EDLKIYTLWQTEQLYFEAQNSKYKKLTYEWEAFGLCAQRLGHLPEAASAFQRGLSQRF
                     APMSARMLLNYYIQEHHRVRNQSLSPNSELTSSQIISRINDLDSRIIDLCVKLCCWNH
                     RWYIEFSIQLIDALSVAVQDMGIMKVINEIASRYPDAVVSIMKENFLDFLENYTNGFF
                     DA"
     gene            <547489..>548850
                     /locus_tag="CAGL0M05049g"
                     /db_xref="GeneID:2891577"
     mRNA            <547489..>548850
                     /locus_tag="CAGL0M05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449567.1"
                     /db_xref="GeneID:2891577"
     CDS             547489..548850
                     /locus_tag="CAGL0M05049g"
                     /inference="similar to AA sequence:UniProtKB:P36091"
                     /note="similar to uniprot|P36091 Saccharomyces cerevisiae
                     YKL046c or uniprot|Q05031 Saccharomyces cerevisiae YMR238w
                     DFG5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449567.1"
                     /db_xref="GeneID:2891577"
                     /db_xref="GOA:Q6FJM7"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM7"
                     /translation="MKLLFSLQLWVLIGTLFPDAGAINLQDNKDSICAATALIQGGML
                     DYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPN
                     YDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWD
                     MQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLV
                     GVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSR
                     LTSVLGGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTI
                     DPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERP
                     APYRADNGGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAW
                     MMF"
     gene            complement(549092..549163)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0M05071r"
                     /db_xref="GeneID:2891578"
     tRNA            complement(549092..549163)
                     /gene="tRNA-Asp (GTC)"
                     /locus_tag="CAGL0M05071r"
                     /product="tRNA-Asp"
                     /db_xref="GeneID:2891578"
     gene            complement(549525..549596)
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0M05093r"
                     /db_xref="GeneID:2891579"
     tRNA            complement(549525..549596)
                     /gene="tRNA-Arg (TCT)"
                     /locus_tag="CAGL0M05093r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2891579"
     gene            <549946..>551247
                     /locus_tag="CAGL0M05115g"
                     /db_xref="GeneID:2891580"
     mRNA            <549946..>551247
                     /locus_tag="CAGL0M05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449568.1"
                     /db_xref="GeneID:2891580"
     CDS             549946..551247
                     /locus_tag="CAGL0M05115g"
                     /note="weakly similar to uniprot|O42838 Saccharomyces
                     paradoxus retrotransposon Ty5-6p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449568.1"
                     /db_xref="GeneID:2891580"
                     /db_xref="GOA:Q6FJM6"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM6"
                     /translation="MELVYPLLCQTIANGELASLKQQVMSLAANTYDASTTIKLTEVG
                     DYKKWIQMLESTLTMAHSAWSEFYHAGPYDVKTISDPTVKIQLSFLNDALVCLIKKRV
                     SDDAVKNINKIILSLTNFSNSAFKILDYLKGRYDRNNSRTSFKQNYGWITNYQSMTHE
                     DLFREITSMMEALLNYDEYELALLNTIPKDDQAKFIVRKENLIKQSAAGMMLGYLPEH
                     LREGYFKQWGHTAEFQTYEIVDIVVGSNVNNSQSVNHGSLANAENKNYKKQNRDKKPH
                     FRKQKTKPKCLYCGKPHKLSECKILFQDNPDAEVFKTFGPPSIDEELSGAYEYTIQEK
                     PETLIWNSGASTHMCCNKQFFIEYKDLKAHTSEISQYPTTSCREAREASIHAYKEPAS
                     RHHDQDHTQNPARGLKELDSVAIIKSGGSTTYSVQAVWRGC"
     gene            <552160..>556215
                     /locus_tag="CAGL0M05137g"
                     /db_xref="GeneID:2891581"
     mRNA            <552160..>556215
                     /locus_tag="CAGL0M05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449569.1"
                     /db_xref="GeneID:2891581"
     CDS             552160..556215
                     /locus_tag="CAGL0M05137g"
                     /note="weakly similar to uniprot|P21827 Saccharomyces
                     cerevisiae YGL097w SRM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449569.1"
                     /db_xref="GeneID:2891581"
                     /db_xref="GOA:Q6FJM5"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM5"
                     /translation="MPKSYNENDIWKIRDVFGRDLSYISSCLPSLEDYKQINLNSSDL
                     ESGYSPLHVTLRERLLQKSFLLYKRWVDDEKQMSYKIGQHILARKDREGLTPMDLYNI
                     EFQRALKVKPQLLEYTIDNGNLKPKVIFEKVNHLDSEGIATTKSCSNNELLRSTSFLE
                     IPQNYSDMAKIRNLGGSHLLTFGSNVNAQLGTGNKDDRQHFHETDYQQLGGDLPLDPK
                     KFSIKEVLMSRYHCLVINSFGEVFTCGNSNRGRLGNGETNTTVSVFTKIATFETGVRH
                     VSISNHHNLLVDGNGYIYSWGWNQYYQLGYTSSNKQGDSKHTLCKSSPKRIPYFDNIN
                     IKYVACSKVHSCALSQDNKLYLWGLNLGQMGNKKPLHVNLDISHDHNNGYIIESPLVI
                     DLSHLQVEQVLALELVTFIRCSGNTLIVLTDFCMRTFKISTPKPKNPTRIDIFSHYTP
                     KTISADVVDMKCSNKVGNHLFFKYASGRVGYLSLKKENVESWSKLSNELPISFSWKPN
                     FARNNCTDFAVGYNGDIIICTYGGEIFISRNHAEFERIYSNKLITGRAVKISSDTSLG
                     SVAIIKQDYLFMPAKYLKDTFDFDLAIYSPIYQNVGDTLSLGSLGLQCHVKETDSQLF
                     LSSKSNISNLRYSEINGSSVNENQIKCSSYDVILNNDRGIIECYSFKSLFSLRCSKFL
                     NAILNDGKFTVNNELFFTANETANGILQIKTHDLTTSAVYYKISVDLVHFLLTDVKPA
                     NQQRSIAILSITDNYAHGTTLRNALSSYLLGMLTNDTDENRIKSPGNHLLGDTILRLK
                     DKTLIVDSFLLSARSNYFKGLLSNSVFCEKDNDGKYLINLEIYSYKQFDIILKYLYGV
                     DFSDLHPHYESEDGGLTNFLESLVLADELCLEPLKCYMQVLLSQFIDGNSIIPLFIYS
                     VRSNAEMLCLLCSTFIAIHIGVLFVKDNVQLISQNFDDSHWKILQNNISYITSEQLNH
                     ELWYNNSTDNWRSLFKNDINKFNSKFISPKDKFSPIFDIKDTLEVSSKKTSTDRRRSS
                     TSTRPIKFKNTTMNNTSDNPHRRQSNGSVSIAEKLSASNSSDEDSQFIEVTRKPKRKS
                     VSNIQESQTPVPKLHPPKPNILIHRKLSGDEKLLPSLISNEPIVEIPNQKKNQSEIGP
                     KKPISFKKTSQKERIKTTTQADKQKENKTKESAWTNQKQNSSLSNPKDNQTSKLAALP
                     SLNDSKLQKQDLKPNKKSKKKANNKQSAEFISSGNFAGLTPYLSTVHKESVTTDTTPS
                     WTASTVSDFKQKVEAQEFEKWFQEESKRVQLELERRGSSHHDELKVLYDSSQNIPGFV
                     IDSNVKKAGRKIKGKFKAKLKNKDENINSIQ"
     gene            complement(<556347..>557696)
                     /locus_tag="CAGL0M05159g"
                     /db_xref="GeneID:2891582"
     mRNA            complement(<556347..>557696)
                     /locus_tag="CAGL0M05159g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449570.1"
                     /db_xref="GeneID:2891582"
     CDS             complement(556347..557696)
                     /locus_tag="CAGL0M05159g"
                     /inference="similar to AA sequence:UniProtKB:Q02555"
                     /note="similar to uniprot|Q02555 Saccharomyces cerevisiae
                     YMR239c RNT1 double-stranded ribonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449570.1"
                     /db_xref="GeneID:2891582"
                     /db_xref="GOA:Q6FJM4"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM4"
                     /translation="MGKIGKVGKASKKKSRLTSELVDLYEKNSTEQVGTYQYSNAIQI
                     EHAVHKLVEAYQRILKLSPNIVQYYETLNSLSDPEKVPPQLISLFTRYPLKLAAEIKT
                     LHDLNKSTLLDDISGYEAKFDASNREPVLGDLELSDLQDLEDDDIGRLDLDLSVAKSS
                     ESSECITSKEKSSKWPPEMPEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLE
                     FLGDSILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELPKQLKSNLS
                     PDVDLSTSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEP
                     TNNLDMNAKRKLYSLIGYAALKLHYHTVQRPTNENPVTIVQCRTGDGTILGVGKARNI
                     KLAGVKAAEDVLRKEDVIEKYAKLRASIPREQSVSKNEQPRTTNKEQGEKDICELSG"
     gene            complement(<558426..>559691)
                     /locus_tag="CAGL0M05181g"
                     /db_xref="GeneID:2891583"
     mRNA            complement(<558426..>559691)
                     /locus_tag="CAGL0M05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449571.1"
                     /db_xref="GeneID:2891583"
     CDS             complement(558426..559691)
                     /locus_tag="CAGL0M05181g"
                     /inference="similar to AA sequence:UniProtKB:Q02554"
                     /note="similar to uniprot|Q02554 Saccharomyces cerevisiae
                     YMR240c CUS1U2 snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449571.1"
                     /db_xref="GeneID:2891583"
                     /db_xref="GOA:Q6FJM3"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM3"
                     /translation="MARSKRKRSGVSDVKASIIDAIETTHKQPAKKKKRVNATPNLES
                     EYRELFKKFNGVEERDVEEDRNPKVASHEPTLRDDHVADAKSADAKSADAKSADAIPQ
                     PLSNRKARLMNKPTLAELKSSVLTPQLIEKHDCDAKEPYFLASVKTSFNVVQVPSHWQ
                     SKRDYLSGRSLLEKKPFELPDLIKQTGVDSMRNTLPEDEEQEKLKEQTRNAVRPKLGK
                     LDLDYKKLYDVFFKLGKKWKPDTMLPYGDVYYENRNLQGEARWRKLVKDRIPGRLSDD
                     LRHALGLQPGQLPPWCLRMKDLGMPPSYPNMKIAGLNWDISNFKDNKYGKVSKSNWTN
                     TPLFGAILQFDDHQQAPEVEVPEVEVEVEVPVPEVPVPEEVKKPEPVTSIPESHSAKP
                     VNTIRGSVEHGGIQDNVESAQDELANYKF"
     gene            <560321..>562494
                     /locus_tag="CAGL0M05203g"
                     /db_xref="GeneID:2891584"
     mRNA            join(<560321..560506,560842..>562494)
                     /locus_tag="CAGL0M05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449572.2"
                     /db_xref="GeneID:2891584"
     CDS             join(560321..560506,560842..562494)
                     /locus_tag="CAGL0M05203g"
                     /note="highly similar to uniprot|P36070 Saccharomyces
                     cerevisiae YKL125w RRN3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449572.2"
                     /db_xref="GeneID:2891584"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM2"
                     /translation="MMVFESNNKRPATEELPDIESKKPRVDIVGSTEIYVEAGNDAHF
                     SDEMYRKFIKNALDELEKNDPMQINAITSQISLSAKNPDRISTKNFTILLEVLSNNIN
                     KVDSSKGLPLIQCIINFEKWWELPDPALGKYIFFIKVLCSSIPKWWQDVAMIMISSFI
                     LSSEKTTQHHELLKYFLRMIPSSMSYIDSYLIRYFPNKNDSKKNIVNYISNVLMLTSY
                     CQELKFQAWSLIMERVISIDVELQNELDELDDDIDDEMVDDDGDDSDEDEDDEDEDHS
                     GAEDDAEDDEDEDDGDDFDDADGQEEYNIDLTQGIKELSNKLDAILSLLSSEIIKDMT
                     PEKLESGEGIGTFNTLTTLFKTHILPTYYTRSVQYIMFHLSQQQLELMDSYLVTLIDI
                     SFAANETSEKRIKSLQYLGSYIARAKKLSRTQIVFVASYLTSWLNRYVIEREEEVNQP
                     GGMDRFKHFYAAFQALCYIFCFRHKDLRDVDGSWECELDKFFTRMVISKFNPLKYCNE
                     NVMLMFARIAQEEDVAYCFSIIENNNNELLRGIMGKADSSRGGTPTPMGPATSWSLAT
                     RQQFIDLQSYFPYDPLFLKNYKNMMKEYYIEWSEAGGEYESDGSDE"
     gene            <563163..>564308
                     /locus_tag="CAGL0M05225g"
                     /db_xref="GeneID:2891585"
     mRNA            <563163..>564308
                     /locus_tag="CAGL0M05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449573.1"
                     /db_xref="GeneID:2891585"
     CDS             563163..564308
                     /locus_tag="CAGL0M05225g"
                     /note="highly similar to uniprot|P38127 Saccharomyces
                     cerevisiae YBR192w RIM2 mitochondrial carrier protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449573.1"
                     /db_xref="GeneID:2891585"
                     /db_xref="GOA:Q6FJM1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FJM1"
                     /translation="MPKRTLEEWEEDAMESVPYLASDEKGSNYREATQPVILEDSKIV
                     QPKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMM
                     NTTRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFT
                     YGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTY
                     KNSYDCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAH
                     DESTMTTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLV
                     QSFRVIIKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI"
     gene            complement(<564780..>565481)
                     /locus_tag="CAGL0M05247g"
                     /db_xref="GeneID:2891586"
     mRNA            complement(<564780..>565481)
                     /locus_tag="CAGL0M05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449574.1"
                     /db_xref="GeneID:2891586"
     CDS             complement(564780..565481)
                     /locus_tag="CAGL0M05247g"
                     /inference="similar to AA sequence:UniProtKB:P38304"
                     /note="similar to uniprot|P38304 Saccharomyces cerevisiae
                     YBR193c MED8 transcriptional regulation mediator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449574.1"
                     /db_xref="GeneID:2891586"
                     /db_xref="GOA:Q6FJM0"
                     /db_xref="InterPro:IPR019364"
                     /db_xref="InterPro:IPR020178"
                     /translation="MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDD
                     LSRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLT
                     TLLRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEK
                     RESNGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLS
                     TNNEQSGDKDIIMAD"
     gene            <565772..>566170
                     /locus_tag="CAGL0M05269g"
                     /db_xref="GeneID:2891622"
     mRNA            <565772..>566170
                     /locus_tag="CAGL0M05269g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449575.1"
                     /db_xref="GeneID:2891622"
     CDS             565772..566170
                     /locus_tag="CAGL0M05269g"
                     /inference="similar to AA sequence:UniProtKB:P38305"
                     /note="similar to uniprot|P38305 Saccharomyces cerevisiae
                     YBR194w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449575.1"
                     /db_xref="GeneID:2891622"
                     /db_xref="GOA:Q6FJL9"
                     /translation="MVHSDNNIIKDPKRNGEKPVEMILNGNRKESKRYNEQLSSLEER
                     KQKKKLKVVQEDSAYMDQSANQTSSAGLDKDTNELGPKSIFYDPDWNPKGEAPDGFRN
                     VPYNPKTFKRLHNQIEEDLGSLSGKLKYPE"
     gene            complement(<566250..>567509)
                     /locus_tag="CAGL0M05291g"
                     /db_xref="GeneID:2891623"
     mRNA            complement(<566250..>567509)
                     /locus_tag="CAGL0M05291g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449576.1"
                     /db_xref="GeneID:2891623"
     CDS             complement(566250..567509)
                     /locus_tag="CAGL0M05291g"
                     /inference="similar to AA sequence:UniProtKB:P13712"
                     /note="similar to uniprot|P13712 Saccharomyces cerevisiae
                     YBR195c MSI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449576.1"
                     /db_xref="GeneID:2891623"
                     /db_xref="GOA:Q6FJL8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL8"
                     /translation="MDADNIEDIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNST
                     KWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFD
                     MDEMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFN
                     KTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQ
                     CNIWDVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMR
                     LNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQEPISTMQ
                     HGSSISTIEWNPNIGVVFASAGQEDGLVKLWDASVGKEIFVHGGHMLGVNDISWDMHD
                     PWLMASVSNDNTIQIWRPAKNIVSKPS"
     gene            complement(<567906..>568646)
                     /locus_tag="CAGL0M05313g"
                     /db_xref="GeneID:2891624"
     mRNA            complement(<567906..>568646)
                     /locus_tag="CAGL0M05313g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449577.1"
                     /db_xref="GeneID:2891624"
     CDS             complement(567906..568646)
                     /locus_tag="CAGL0M05313g"
                     /note="weakly similar to uniprot|P38306 Saccharomyces
                     cerevisiae YBR197c or uniprot|Q02831 Saccharomyces
                     cerevisiae YPL077c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449577.1"
                     /db_xref="GeneID:2891624"
                     /db_xref="GOA:Q6FJL7"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL7"
                     /translation="MDIEFGSPLKPSKSEDLERAAKQPEDVKNEFHAPVKSFPDLKNI
                     AAEADAAMVADLKKKLKGKTKKLKHKDKDRAKRIDQPTLSTATSYSTIHGFSNRRGNM
                     EDQTSSHRSGSPPFFNNSLSSRGDLQSRQSHKPDSKWTEIDMLDDVRRMAKDKFFEGG
                     FPEEFEENLTKNRMSQAKLFQIMRDRNEKLAKTKRRTIRASHVDTRSQSHVEDEGMEP
                     FDQDELESTKQEEKAYVKEIIDTISSLR"
     gene            complement(<569132..>571552)
                     /locus_tag="CAGL0M05335g"
                     /db_xref="GeneID:2891625"
     mRNA            complement(<569132..>571552)
                     /locus_tag="CAGL0M05335g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449578.1"
                     /db_xref="GeneID:2891625"
     CDS             complement(569132..571552)
                     /locus_tag="CAGL0M05335g"
                     /inference="similar to AA sequence:UniProtKB:P38129"
                     /note="similar to uniprot|P38129 Saccharomyces cerevisiae
                     YBR198c Transcription initiation factor TFIID 90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449578.1"
                     /db_xref="GeneID:2891625"
                     /db_xref="GOA:Q6FJL6"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR007582"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL6"
                     /translation="MSGKEKDQKNVKGAAAGAKSGAKAPANGSRPSGQFSASDLNRIV
                     LEYLNKKGYHRTEAMLRAESSRTATPVNKNSPANTKDGSLPEPSTVPPAQDANAKPVS
                     NPVDSASAKRDASGEVVLKDKVRQDMSPEHYIRAYTMLKNWVDSSLDIYRSELSYIMY
                     PVFIYLFLYLVSKDPIYARRFFDKFSSDFRVKHGSEINRLFSVNSVDHIKENEVAKAF
                     NGNRYRVTISRAAFYLMLYFLTDNEGVGGSLIIGIINDHIQPNVMDTVRSKDRISDGV
                     EIAADTAGTDGLAEINNAPVTLGPFPKDEEFVKEIETELKIKDDQEKKQIEQSKKGDG
                     SKEGSVASEDVAKEPTADLDDTNDRPTLLQEYRKMNGDESSATPQEESDAAADKQDGK
                     SGDSTKVKSEDKKTAVAVVKTEEVAAMMSSPSKDTLPLPPKTALDIKIEIQKVKESRD
                     AIKLDNLQAALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLI
                     NPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHT
                     ALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVS
                     FHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGV
                     ICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGP
                     EPEQPFNAHVGDITASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLA
                     LAGGAIRE"
     gene            <572309..>573982
                     /locus_tag="CAGL0M05357g"
                     /db_xref="GeneID:2891626"
     mRNA            <572309..>573982
                     /locus_tag="CAGL0M05357g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449579.1"
                     /db_xref="GeneID:2891626"
     CDS             572309..573982
                     /locus_tag="CAGL0M05357g"
                     /inference="similar to AA sequence:UniProtKB:P29366"
                     /note="similar to uniprot|P29366 Saccharomyces cerevisiae
                     YBR200w BEM1 bud emergence mediator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449579.1"
                     /db_xref="GeneID:2891626"
                     /db_xref="GOA:Q6FJL5"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL5"
                     /translation="MLKNFKLGKEKHSRITSADISTPRQDGNNVIKHVKTVPVQVLNQ
                     RSTPSRHASNSSRPQMQSPEKVIKARDSYKAKRANELSFNKGEFFYVTGEDTSYYKAS
                     DPSAGKNGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEK
                     SDELDTFVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIIDIGTGYATGNDVK
                     EDIASVNLPTVQEWKSNIAKYKASNINLGAVEVPPNGEFGTRQKIQQQIMEEERLRQQ
                     QIEAQMTPKVPEPPEIIYASVDAYGLENEKYWYTVSCILDNGRARRLKRYYQDFYDLQ
                     VQLLDAFPAESGKLRDANGNWTRRIMPYIPGPVPYVTDTITKKRREDLNIYVADLIRL
                     PKYITSSRMIQNIFRVKNNGYDTEFDKKDASIHTDNSSTHSKSRTSKIHDKDSTLTGE
                     ELNLYEKMSELSVSTPGSRPHSRPPSSLPPQLKSIKVKFYYKDDIFALMLPQHISLDE
                     LKNKIGPRIDTEDFILNIKLKDGLGEEIKTDDQVSYIIQSKQKIAVTDA"
     gene            <574752..>575390
                     /locus_tag="CAGL0M05379g"
                     /db_xref="GeneID:2891627"
     mRNA            <574752..>575390
                     /locus_tag="CAGL0M05379g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449580.1"
                     /db_xref="GeneID:2891627"
     CDS             574752..575390
                     /locus_tag="CAGL0M05379g"
                     /note="highly similar to uniprot|P38307 Saccharomyces
                     cerevisiae YBR201w DER1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449580.1"
                     /db_xref="GeneID:2891627"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL4"
                     /translation="MDAVLLNIVNDVPVVTRYWTMGCIAVSALVRFNMINSIKMLYSY
                     EIVFQKGHYERILYSLFDYGLFNWMSLMNIVIAANHLSFLENSFSLKRRYVWILFLTL
                     CSLLGMSYFGQPVASLGVLLQENLSYYYLKKNNEQMNIRLFGNIAVSPLLVPFYLNCL
                     LLFVYHMDVVEVAMFFLPGHIMFYMDDMLKRIYGVDLTKTPYDWWLGLKETQ"
     gene            complement(<575740..>575952)
                     /locus_tag="CAGL0M05401g"
                     /db_xref="GeneID:2891628"
     mRNA            complement(<575740..>575952)
                     /locus_tag="CAGL0M05401g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449581.1"
                     /db_xref="GeneID:2891628"
     CDS             complement(575740..575952)
                     /locus_tag="CAGL0M05401g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449581.1"
                     /db_xref="GeneID:2891628"
                     /db_xref="GOA:Q6FJL3"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL3"
                     /translation="MSLLKFSANQKLQTALQFTYLGLCLVGPFMMPAKQANTGFLALS
                     KSLLSEDHMNSHSLVKGKRHPRAYFR"
     gene            <577097..>579535
                     /locus_tag="CAGL0M05423g"
                     /db_xref="GeneID:2891629"
     mRNA            <577097..>579535
                     /locus_tag="CAGL0M05423g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449582.1"
                     /db_xref="GeneID:2891629"
     CDS             577097..579535
                     /locus_tag="CAGL0M05423g"
                     /note="highly similar to uniprot|P38132 Saccharomyces
                     cerevisiae YBR202w CDC47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449582.1"
                     /db_xref="GeneID:2891629"
                     /db_xref="GOA:Q6FJL2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008050"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL2"
                     /translation="MSTALPSIQLSVDYQTLLSEISDFLQHFKVDEVGAADDSATIDA
                     DVNIDDAEELMKRGPKYMYLLQQIANRERDTIEIELNDVLRFQNEKFLEGGVAQDLVA
                     LIQKNANHFIDLFSRCIDSVMPLPTKEISYKDDVLDVILNQRRLRNERMLSDRTNEIR
                     SEMDTDTTSNDIMRELAQDETETFPANLTRRYTVYFRPLTRSYAVRYNSKKYLTGSIP
                     LSVRQIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLV
                     ECTSRECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLV
                     RSVTPGDIVDIAGIFLPSPYTGFKALKAGLLTETYLEAHHVRQHKKKFASFQMTPQVR
                     SNVDALAQSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINI
                     CLMGDPGVAKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALV
                     LADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYG
                     RYNPRLSPLENINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVHMYNKQPDLDF
                     EPIEPTMMREFIAYARTMRPVMTAEINDHVVSAYIRLRQDSKREMDSKFSFGQATPRT
                     LLAIIRLSQALAKLRLSETVDIDDVEEALRLIRVSKESLYQENRKRDEDSNPTTKIFT
                     IIKKMSQEGDYKGSLPYDSIVKTVRSRGFTMLQLNNCIQEYSFLNVWHLINEGNTLKF
                     VDDEDQSSQDIEMA"
     gene            <580648..>583446
                     /locus_tag="CAGL0M05445g"
                     /db_xref="GeneID:2891630"
     mRNA            <580648..>583446
                     /locus_tag="CAGL0M05445g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449583.1"
                     /db_xref="GeneID:2891630"
     CDS             580648..583446
                     /locus_tag="CAGL0M05445g"
                     /inference="similar to AA sequence:UniProtKB:P38308"
                     /note="similar to uniprot|P38308 Saccharomyces cerevisiae
                     YBR203w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449583.1"
                     /db_xref="GeneID:2891630"
                     /db_xref="GOA:Q6FJL1"
                     /db_xref="InterPro:IPR001810"
                     /translation="MQSVNIVSTNYSRYGVSVYDRLYRKDKNVSAKHRPSSTGVYGHD
                     ASTVDHASRSNNNLNLTRSTSAISESDDVATISTNNSRRSVIKRKYKSLITASSKKLI
                     TKLYEHGSNSDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKEISDLPDEVLRNI
                     LSNVKDDQRTLVNCLYVNKAFYNATKPTLYERPKFTSTYRVAQFVTSIRTNPQNGLYV
                     RELDLSKLKNGSLNGKSTSNTGVVADSPDVDEYNPMRTRTGSVTSFTSVTSTANSNTA
                     LSITTNNKDVALAGWRDWRYRHDPLYSSPVLNSYNAKRTVSRAPSIKSSHSSSSLTLF
                     PGLKSKESFAQLSEGKSSDNGNNGKRQRSNSSVSSITNSLMSSLYNGSHISLNTTLSG
                     SDNNSSKTQSKGKSSSSPGNPNDSSGEQDSIISSSSQIDTNTFGMTSSKSTSSTSNWF
                     RMKLHGNGTRKLRLRSNKAISSKKDEQQNEESAQTAQKIETPIIKRTEPFSTPHPYTN
                     KFLLKYAQYKDLPLGYILHILDHCPYLYILDLSNLTLCTDFEIIEGRRYKGRKQRFGS
                     SRALPVVQESVISTDVPNDLDVIYLTDSSKTYEYYDRLRNTNKHKRSSSSNNLWSIPN
                     QGWSDAPAPIGSHKNDLRRTHSQTIGRSNVELRKLNASEIFEHIATNQKSAYNTHLRV
                     YMKNVLWCTQDMVKSFVLENFDQQAENLGEDKSSEMFIHDMNFSFENSGLNRNFVWTC
                     EGNLQEFIAMVVLDEVNRKDDLEIENLFNIKAERILTPTNGPERAPEVHYISNVFTVS
                     YGFQSNKKREMKFRVTILKTDTPMYFSIKKLADDYTSVVIKLQTNKNVALHGSETADI
                     ITTDQGSVLPEDVPEDNNADDTNNGENTIAQPFSNDPKERIERITQEIVARLKDLRGS
                     DLRRNIGENNYVRERFLL"
     gene            complement(<583722..>584786)
                     /locus_tag="CAGL0M05467g"
                     /db_xref="GeneID:2891631"
     mRNA            complement(<583722..>584786)
                     /locus_tag="CAGL0M05467g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449584.1"
                     /db_xref="GeneID:2891631"
     CDS             complement(583722..584786)
                     /locus_tag="CAGL0M05467g"
                     /note="weakly similar to uniprot|P38139 Saccharomyces
                     cerevisiae YBR204c peroxisomal serine-active lipase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449584.1"
                     /db_xref="GeneID:2891631"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FJL0"
                     /translation="MEVLREACSLEGELVNGRVDDILAKYEQVPQRELSRVIDSRDFE
                     VRFLKERTRVVTLDGIDMRCFDNIRDGERRDSVFLLIHGLGGSMDQFQPLMKLLTLLK
                     YRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIA
                     SHFVQMYHEEYNIDKLVLTCPPPPSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVWFD
                     QSKGLNSSGIMNFFSANTETFQDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFLGWK
                     FPDWEDLDNIINTNNVELVVIYAEHDKITPKQDAQLIFDAFKNVAATKKKLLEITNCG
                     HNIFFNCPEKACKLFQEQVF"
     gene            <585392..>586672
                     /locus_tag="CAGL0M05489g"
                     /db_xref="GeneID:2891632"
     mRNA            <585392..>586672
                     /locus_tag="CAGL0M05489g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449585.1"
                     /db_xref="GeneID:2891632"
     CDS             585392..586672
                     /locus_tag="CAGL0M05489g"
                     /inference="similar to AA sequence:UniProtKB:P38130"
                     /note="similar to uniprot|P38130 Saccharomyces cerevisiae
                     YBR205w KTR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449585.1"
                     /db_xref="GeneID:2891632"
                     /db_xref="GOA:Q6FJK9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK9"
                     /translation="MGAVKKKLMPKSAMFVRKYEKTIRVGFASFLMALTVLFLMHKPD
                     AGTTAMAPQQTMAGFTSVVKNGQPGYVIPASDLLQDVKEHPLDDGVKEKAAFITLARN
                     GDLWSLVNTIRHVEDRLNHRYHYDWVFLNDKGFTDEFIRLTSALVSGKAKYGKVPKEH
                     WEVPSHIDKEKYEISRRKMVLDKVPYGDSTPYRHMCRYQSGLFYRHELVQEYDYYWRV
                     DTDITVFCNFQYDIFKFLRQNKKKYGFVISLTEYEETIPTLWATVKEFMKKYPQHIHK
                     NNFLNFISDDGGETYNGCHFWTNFEVGDLNFWRSQAYTDFFNFLDQKGGFYYERWGDA
                     PVHSIAAALLLDKDEIHFFDGFGYHHPDFQSCPHEEEVRLQNKCTCNFSKDKIWMTYY
                     FCNLRYFEAKEIGLPPKIEANLDEEYKKKLKVSS"
     gene            <587202..>588509
                     /locus_tag="CAGL0M05511g"
                     /db_xref="GeneID:2891633"
     mRNA            <587202..>588509
                     /locus_tag="CAGL0M05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449586.1"
                     /db_xref="GeneID:2891633"
     CDS             587202..588509
                     /locus_tag="CAGL0M05511g"
                     /inference="similar to AA sequence:UniProtKB:P38310"
                     /note="similar to uniprot|P38310 Saccharomyces cerevisiae
                     YBR207w FTH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449586.1"
                     /db_xref="GeneID:2891633"
                     /db_xref="GOA:Q6FJK8"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK8"
                     /translation="MAFEDYFSFQVFFIFLRESLEIAVIISILLTIVKQGLSVGDDSE
                     DTGNQISHGIDDGIPINDVNAERIPLTVEEEEEAFNIEGESMVPSTDESLSYADNLKL
                     YKKLKIQIVSGGALGLIICAFIGGAFIAVFYHIGTDLWTMSEHYYEGILSLVASVIIS
                     VMGLFFLRMGKLREKFRVKLASIIYSDRGGMISKVNSSKAVSFSEKYAFFILPFVTSL
                     REGLEAVVFIGGVGLDQPMSAIMVSMACAVCISGVFGVFFFRYSSSLSLKICLVVTTC
                     FMYLIASGLFSKGVWQLELQDYVNKCNGQDMSEVGSGPGSYDISRSVWHVNCCNGETD
                     GGWMILTAIFGWTNSATYGSVLSYIIYWLILIGCLKLLTLEEQYGYIPGLPVSWQKKR
                     IIKRLKIAHASLKLKQNIGSTSMSNGVQSQRVSKDSTTPLISH"
     gene            complement(<588667..>594171)
                     /locus_tag="CAGL0M05533g"
                     /db_xref="GeneID:2891634"
     mRNA            complement(<588667..>594171)
                     /locus_tag="CAGL0M05533g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449587.1"
                     /db_xref="GeneID:2891634"
     CDS             complement(588667..594171)
                     /locus_tag="CAGL0M05533g"
                     /inference="similar to AA sequence:UniProtKB:P32528"
                     /note="similar to uniprot|P32528 Saccharomyces cerevisiae
                     YBR208c DUR1 urea amidolyase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449587.1"
                     /db_xref="GeneID:2891634"
                     /db_xref="GOA:Q6FJK7"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014084"
                     /db_xref="InterPro:IPR014085"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK7"
                     /translation="MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAP
                     EDPAWISVATESLLEQQWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFS
                     YMPTRDSTVVELLKQAGAIIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSA
                     GSASVVARGIVPIALGTDTAGSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVS
                     VFSMNLSDAEKCLKIMTKLDIENDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKEN
                     PLLYDRAIDNFKQLGAQIKIIDFEPLLELARCLYEGTWVAERYAATRKFLETSPQQST
                     LDPVVYGIIKSATKFDAADAFEYEYKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEV
                     DKEPILVNSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDYALLQLAK
                     RFLAQLYPSGTRPYGMFLDRYVGLKDDSLEGPIVSSDDSIVLAVVGAHLRGLPLHWQL
                     EKVNATFICSTKTAKKYELYALPKNGPVLKPGLRRITSGTGSQIELELYSVPKEKFGE
                     FISFVPEPLGIGSVELENGKWVKSFICEESGYNSTGSIDISHYGGFRAYIESIIPSNE
                     SKKGHFKTVLVANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGH
                     TVEETYLHVEKIISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRK
                     LGLKHSAREVAKSAGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKV
                     DNEQDMRKAFETVKHQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDC
                     SLQRRNQKVIEETPAPNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYF
                     LEVNTRLQVEHPITEMVTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENP
                     LKDFRPSPGELVDVQFPNDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILKMK
                     KALNETKIYGCVTNVDYLKSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTI
                     QDYPGRVNYWRIGVPPCGPMDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLV
                     SIAGGEVCCKLDEKKIPMFEPISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSF
                     STFTMGNLGGFNGRALKRGDVLSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVW
                     TIGVLAGPHGAPDIFESEGMMEFFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGL
                     HPSNTHDYVYSLGAINFTGDEPVIITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTI
                     NFTPIDWQSARNLKENQDVIINDMSSCALQKLSDQPLLKSPEDPILFQKDGQELQSPK
                     VVYRQAGDRYILIEYGDDIFELNLCYRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYD
                     GYEISQKELLKTLIAYEEQLPQEKNWSVKSRIFRLPMAFEDKETLACVKRYQETIRSK
                     APWLPNNVDFVAEVNNLTHDDIRQLIYTTRYMVLGVGDVFLGSPCAIPLDPRNRLLGS
                     KYNPSRTFTKRGVVGIGGSYMCIYAADSPGGYQLVGRTIPIWDRLMLQSKKDEPWLLS
                     PFDQIEFYPVSEEQIDEYTDEWDNGNYKIDVDDVVFDHGSYLKWVQDNIEAIEEHQRA
                     QRGDNYSKFAQKIQEANADLKQTTTEVIEQNILEDDCEYIFSEYAGRFWKPIVEIGAS
                     IEKDQGVAVIEAMKTEMIVSSSVVGKLKKFLFKNGDMVDAGDPVAIIQCL"
     gene            complement(595677..595748)
                     /gene="tRNA-Cys (GCA)"
                     /locus_tag="CAGL0M05555r"
                     /db_xref="GeneID:2891635"
     tRNA            complement(595677..595748)
                     /gene="tRNA-Cys (GCA)"
                     /locus_tag="CAGL0M05555r"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:2891635"
     gene            complement(<596196..>597707)
                     /locus_tag="CAGL0M05577g"
                     /db_xref="GeneID:2891636"
     mRNA            complement(<596196..>597707)
                     /locus_tag="CAGL0M05577g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449588.1"
                     /db_xref="GeneID:2891636"
     CDS             complement(596196..597707)
                     /locus_tag="CAGL0M05577g"
                     /note="some similarities with uniprot|P38289 Saccharomyces
                     cerevisiae YBR163w DEM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449588.1"
                     /db_xref="GeneID:2891636"
                     /db_xref="GOA:Q6FJK6"
                     /db_xref="InterPro:IPR016610"
                     /db_xref="InterPro:IPR019190"
                     /translation="MTLRDVEKLRLWRLKIFRNQQPILRAKPPHASRKTQYLFQKIDN
                     VKSQFGTDGKGDLLWQRDGMNPYHDLYDPGDLKTHRLSVTKLLTKSWCELRFAYDLYS
                     RLPLFREAHLAAGERTHQKLENSEHTPVIRPQDIPQFSETVEIVEDDLHVLAASWAET
                     ITRLIHLFSSGDAREILCHGYLNKETNQLYDPMETEVWDPSQHILISGIIDHLTLTSK
                     NGNLPLNNHHRSIDDSIAKLKNTRNEFAKNGLTIQISDVKTRTRKFIPPQESVQNATK
                     LQLMYYRHFLLSLGTDSDNTYEMLLYNARIRGVDVDQPLNPANCLLIMIQMDGFVGDF
                     VKLQNGDGFQFPKFDNAPISHSFTLADAKHHQFLQNINSHELAGQLLNGTFAKPITLR
                     YFAMRLAQMYSMLTPLISEKLKVEYYHNNECFQEVEFVNDKKSLGESCRSASSFWFGK
                     RAIEPVEATTFNYNQYCKHCDYRDHCAWIKDSLAKSTKLGDELTQIARRIHNI"
     gene            complement(<598033..>598227)
                     /locus_tag="CAGL0M05593g"
                     /db_xref="GeneID:9488057"
     mRNA            complement(<598033..>598227)
                     /locus_tag="CAGL0M05593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999555.1"
                     /db_xref="GeneID:9488057"
     CDS             complement(598033..598227)
                     /locus_tag="CAGL0M05593g"
                     /note="highly similar to uniprot|P38374 Saccharomyces
                     cerevisiae YBR162wa YSY6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999601.1"
                     /db_xref="GeneID:9488057"
                     /db_xref="GOA:B4UN58"
                     /db_xref="InterPro:IPR010580"
                     /db_xref="UniProtKB/TrEMBL:B4UN58"
                     /translation="MAVQTPKQRLANEKFNKNVEKQRKFGKKKQDKQKTELPISKSWV
                     YFILFLLIGGGVLELFSLLF"
     gene            <599520..>600860
                     /locus_tag="CAGL0M05599g"
                     /db_xref="GeneID:2891637"
     mRNA            <599520..>600860
                     /locus_tag="CAGL0M05599g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449589.1"
                     /db_xref="GeneID:2891637"
     CDS             599520..600860
                     /locus_tag="CAGL0M05599g"
                     /inference="similar to AA sequence:UniProtKB:P38288"
                     /note="similar to uniprot|P38288 Saccharomyces cerevisiae
                     YBR162c TOS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449589.1"
                     /db_xref="GeneID:2891637"
                     /db_xref="GOA:Q6FJK5"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK5"
                     /translation="MFQLLTLLLPLVSKVSADCQMIAGNYYCSKTDAAIYSNVGFSGS
                     YQDVTSMDEQSCVCSQQPFSFGGALAPFDEELSVHFRGPLKLSQFAVYYPASSNSKRA
                     VAEEDCDSVVAKPVHKHKRDVAVEVIEVTETVFIDENGNTVTASGTSTSMSTPTPSNP
                     SQVQSSQAPSQAPVSSSNKGTTTLSSTSKNTPSSSSSFQAASSSAAPIQDGGDWSRVA
                     YFSPGTASGCTFMNHQGGTAGSGVWSSCFGNSISFANSDGVTGAGSPQPLGDVTIKSG
                     QEYMIFSSTQCSANNAECGYYREGIPAYKGFGGNRKIFYFEFSMPSDTNGNGYNQDMP
                     AIWLLNAKIPRTLQYGLSTCSCWATGCGELDLFEVLSPGSDKMITHIHDGQGGGTQDF
                     FQRPTDGIFRAVVIFNASDKTIHLVQVDSAPAGGLSNDQVQQWLNKAGSAAALP"
     gene            complement(<601941..>603266)
                     /locus_tag="CAGL0M05621g"
                     /db_xref="GeneID:2891638"
     mRNA            complement(<601941..>603266)
                     /locus_tag="CAGL0M05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449590.1"
                     /db_xref="GeneID:2891638"
     CDS             complement(601941..603266)
                     /locus_tag="CAGL0M05621g"
                     /inference="similar to AA sequence:UniProtKB:P33300"
                     /note="similar to uniprot|P33300 Saccharomyces cerevisiae
                     YPL057c SUR1 or uniprot|P38287 Saccharomyces cerevisiae
                     YBR161w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449590.1"
                     /db_xref="GeneID:2891638"
                     /db_xref="GOA:Q6FJK4"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK4"
                     /translation="MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFEL
                     NPPRDRVTGLEVHDGKPELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTD
                     EMALKFIKEEYAWFLDTFENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLL
                     KVPAFVRKTSPLGVSNNVMGSVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFV
                     SVIWKQYKRWGVPENGVVRIMQPADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHIL
                     SCVVAGFIVGFIILYGEYVFYCWLCASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQG
                     HGSIFLGTSISPLRKLNKSLFSTLYTKLVPSSSSSSASACSVSEKYSTPKLSRSVAEY
                     YSLRKENSVHFNSPTPKGKRSRKDSNVRFTNFLLSDIEKLDPNVEDLTN"
     gene            <603919..>604449
                     /locus_tag="CAGL0M05643g"
                     /db_xref="GeneID:2891639"
     mRNA            <603919..>604449
                     /locus_tag="CAGL0M05643g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449591.1"
                     /db_xref="GeneID:2891639"
     CDS             603919..604449
                     /locus_tag="CAGL0M05643g"
                     /inference="similar to AA sequence:UniProtKB:Q07540"
                     /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
                     YDL120w YFH1 regulates mitochondrial iron accumulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449591.1"
                     /db_xref="GeneID:2891639"
                     /db_xref="GOA:Q6FJK3"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK3"
                     /translation="MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNE
                     GGPAMTNGVQIPKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGV
                     MSLTVAGVGTYVINKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKEL
                     HDALPNDAEFKVESDQ"
     gene            <604987..>605217
                     /locus_tag="CAGL0M05665g"
                     /db_xref="GeneID:2891640"
     mRNA            <604987..>605217
                     /locus_tag="CAGL0M05665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449592.1"
                     /db_xref="GeneID:2891640"
     CDS             604987..605217
                     /locus_tag="CAGL0M05665g"
                     /inference="similar to AA sequence:UniProtKB:P01095"
                     /note="similar to uniprot|P01095 Saccharomyces cerevisiae
                     YNL015w PBI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449592.1"
                     /db_xref="GeneID:2891640"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK2"
                     /translation="MANSFIVTLKKSVPEREVKEFIDSVNGVGGQIVHEFSLIKGYTI
                     KMPEKVSLSSFKDKHNNVIESVEEDKEVKIAK"
     gene            <605540..>606652
                     /locus_tag="CAGL0M05687g"
                     /db_xref="GeneID:2891641"
     mRNA            <605540..>606652
                     /locus_tag="CAGL0M05687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449593.1"
                     /db_xref="GeneID:2891641"
     CDS             605540..606652
                     /locus_tag="CAGL0M05687g"
                     /inference="similar to AA sequence:UniProtKB:P53164"
                     /note="similar to uniprot|P53164 Saccharomyces cerevisiae
                     YGL067w NPY1 NADH pyrophosphatase I of the Nudix family of
                     hydrolases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449593.1"
                     /db_xref="GeneID:2891641"
                     /db_xref="GOA:Q6FJK1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK1"
                     /translation="MSTFFGDVGLNRVSFLREDTEFIKLAFTSSEAKFIVFVNGEAFY
                     DISSDGKPQLHIETSTSLKGIITTLSPLLETKDLRVDVSGVSITFLGLDDRIDGFSYK
                     GKYKGAPYFGLEFKVDDKTLLTPKDIEFTTSLQRMDRESLFMIDNHSATLYSHAKMYL
                     DWLNKYKFCPGCGSVIYPVHGGTKLQCSSAPEVNCNVRNARVNNVCFPRSDPVIIIAM
                     ANEDYSKICLARSFRKHGNFVMYSTIAGFMEPGESIENACAREIWEETGVHCDVDNVK
                     IISSQPWPYPANLMIGCLGIVKFNNKDEIIDLGNDPELMDAQWFDTNEVRAAMDSYKT
                     GWLVPFKDEINFPGETAIAHHLIRHVCKQHQRLQKL"
     gene            <607368..>608978
                     /locus_tag="CAGL0M05709g"
                     /db_xref="GeneID:2891642"
     mRNA            <607368..>608978
                     /locus_tag="CAGL0M05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449594.1"
                     /db_xref="GeneID:2891642"
     CDS             607368..608978
                     /locus_tag="CAGL0M05709g"
                     /inference="similar to AA sequence:UniProtKB:P53165"
                     /note="similar to uniprot|P53165 Saccharomyces cerevisiae
                     YGL066w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449594.1"
                     /db_xref="GeneID:2891642"
                     /db_xref="InterPro:IPR013243"
                     /db_xref="UniProtKB/TrEMBL:Q6FJK0"
                     /translation="MEVQAQIKGIKESYIRDLNSGTSWKDLIDVAKNNPQEYSSDINS
                     ETVSKYFEPNTRIIIDALDKQTNFRVCKGCGKPILLEAIVDHIENHCSNSRDQKEGTV
                     GDMDSFSESLINSPTNGSIDGSLQTKENLKRSLDNESSDIMSSPGKQDAKKMKSETPG
                     NSNRKPKKVKQRNPTDKHLIDFDKQCGVKLPEGGYCARSLTCKSHSMGDKRSVVGRTE
                     PFDTLLAEYHRKHQTKIGAAAEKRAKQQEMQKMQKQTQRDHKDQKKTTQTKTDKRKKA
                     STTTNKTVRGTGSNRGKNSSTQNTMNYPVLTPEEETTQVLNGVSRSFPLPLESRVLSS
                     VRYRTKYVRMREMFASAFSVKPGFSNPGYGAIHSRVGCIDIDRTTDYKYRIRTPQPVN
                     QQGTQNLTPQQIQKMQQQRMIQNQMLQQKQAQNAQQMGFNNNNNNNQNIGSPGANMVN
                     SPSINNQDQLLRQTKQTNSNDLNHIGGQHPIPNVQGPSSPENNLINGVGVGSPVNNPQ
                     SPGMGNLQMGTQMVGKDSSPSQFGGRVN"
     gene            complement(<609160..>610536)
                     /locus_tag="CAGL0M05731g"
                     /db_xref="GeneID:2891643"
     mRNA            complement(<609160..>610536)
                     /locus_tag="CAGL0M05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449595.1"
                     /db_xref="GeneID:2891643"
     CDS             complement(609160..610536)
                     /locus_tag="CAGL0M05731g"
                     /inference="similar to AA sequence:UniProtKB:P43636"
                     /note="similar to uniprot|P43636 Saccharomyces cerevisiae
                     YGL065c ALG2 mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449595.1"
                     /db_xref="GeneID:2891643"
                     /db_xref="GOA:Q6FJJ9"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR027054"
                     /db_xref="InterPro:IPR028098"
                     /translation="MVPAKKLKIAFVHPDLGIGGAERLVVDAALGLQEAGHEVIIYTS
                     HCDKTHCFEEVKNGTLKVEVFGDFLPTDLGKRFFIVFANLRQLYLTAKVVLSGRSKDK
                     DVFIIDQLSTCVPFFKLANNKVLFYCHFPDQLLAIRTNWIKSLYRIPFDLLEQFTMYC
                     SDEVVVNSNFTKSMYKKTFKYLQKNPNVIYPCVDTDTETLINDRDMQIGNLLVGKCPN
                     FYLSINRYERKKNIELAIQAFAKASVENTNLVVCGGYDPRIHENVQYLQELTCLCKEL
                     DLSYTVNHYSDFIEDSYSVNEIEKLFGAKVIFLTSISSSLKEFLIQNMQLLLYTPSYE
                     HFGIVPLEAMKYGKPVLAVNNGGPVETVVSYQKEDNEKSTTGWLRSADADEWASALIE
                     SKEVLNQNPELFKNNGPKRVIELFSRKAMTQEFETNIKLALRHTSNISIIYVVSIIFA
                     VLLKVFVF"
     gene            complement(<610837..>612543)
                     /locus_tag="CAGL0M05753g"
                     /db_xref="GeneID:2891644"
     mRNA            complement(<610837..>612543)
                     /locus_tag="CAGL0M05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449596.1"
                     /db_xref="GeneID:2891644"
     CDS             complement(610837..612543)
                     /locus_tag="CAGL0M05753g"
                     /inference="similar to AA sequence:UniProtKB:P53166"
                     /note="similar to uniprot|P53166 Saccharomyces cerevisiae
                     YGL064c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449596.1"
                     /db_xref="GeneID:2891644"
                     /db_xref="GOA:Q6FJJ8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVSILAIRTFNPLGHFVSTQCVRAYAINSVRAGSKSSSVRAGSK
                     NDTTRASSKKNKAGKSKLQLSARFKQNANKSQKADKFKSQKQFKYGLYGGLKENENKF
                     LETNANLVEKITEFEELKLLPEVRKHVINLIKKDSLNTTEEIHPSPIQTIAIKRLSKN
                     LMEPKLQVHAIAAETGSGKTMAYCAPLLDYLKRQEIETPEKWESIKDKAIIRSVILVP
                     TLELVDQIYTTLTCIPDTLGIHVHKWTTGVDYQQLLENLKSRTDILITTPSKLLSLQR
                     VRMISRADLILKRIEFVVLDEADTLLDKSWLEDTHKALKAMSDVNHLVLCSATIPNEF
                     DRTMTKMFPNAIPLTTPRLHKLPKGINFRIINAAVSPYKGSKIKALAQTLYAIAYDGT
                     DPGFEKRCIVFINEKKNVDNVVQKLRNEYGHDVVGLTGDMEGRTRLELIRPFISPPEK
                     LTEQEKQIDKDLNDQETVNISGSNISIGNIENSNKASNFIPKLRVLVTTDLLARGLNF
                     KGVRNVILYDVPITAIDLVHRAGRTARMRQSGRVFMIIDKKTQSWAKAVPTILKKNKA
                     LT"
     gene            complement(<612846..>613391)
                     /locus_tag="CAGL0M05775g"
                     /db_xref="GeneID:2891645"
     mRNA            complement(<612846..>613391)
                     /locus_tag="CAGL0M05775g"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="XM_449597.1"
                     /db_xref="GeneID:2891645"
     CDS             complement(612846..613391)
                     /locus_tag="CAGL0M05775g"
                     /note="highly similar to uniprot|Q08962 Saccharomyces
                     cerevisiae YPL211w NIP7"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="XP_449597.1"
                     /db_xref="GeneID:2891645"
                     /db_xref="GOA:Q6FJJ7"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005155"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ7"
                     /translation="MRQLTEEETKVVFEKLAGYIGRNIAYLVDNKEVPHVFRLQKDRV
                     YYVPEYIAKLATSVARQNLMSVGICLGKFTKTGKFRLHITALSVLAKHAKYKIWIKPN
                     GEMPFLYGNHVLKAHVGKMTDDIPEHAGLIVFSMNDMPLGFGVSAKSTLESKNLQPTA
                     IVAFRQADIGEYLRDEDTLFT"
     gene            <613807..>614760
                     /locus_tag="CAGL0M05797g"
                     /db_xref="GeneID:2891646"
     mRNA            <613807..>614760
                     /locus_tag="CAGL0M05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449598.1"
                     /db_xref="GeneID:2891646"
     CDS             613807..614760
                     /locus_tag="CAGL0M05797g"
                     /inference="similar to AA sequence:UniProtKB:P53167"
                     /note="similar to uniprot|P53167 Saccharomyces cerevisiae
                     YGL063w PUS2 pseudouridine synthase 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449598.1"
                     /db_xref="GeneID:2891646"
                     /db_xref="GOA:Q6FJJ6"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ6"
                     /translation="MALVLGYLGTGYQGIQYNPPAHTIDNELFKALVATNCISQSNSD
                     DFSKSSFSRATRTDKGVHALTNLVALKMQRYEVPQQVKAELNEILPDDIRIWDVVPVK
                     KKFNARVMAGTRHYRYVIPTFLLQCGPHSDLSTSQLARFKNIWNMFLGTHNYYNFTPR
                     RKDTNADSPQNMRHMYSIQVSDPFTIAGSTQWLSIAIHGQSFLLHQIRKMVHYALSEY
                     HRSSSDTKSMELLETVDPDLTSATALDTPTEQYIPLAPAAGLYLHHPTFEGYNNQPAA
                     RRLQVLDLSGYPACATFEDRIHTEIARSEHVFHEYMAVIRQ"
     gene            <615435..>615635
                     /locus_tag="CAGL0M05819g"
                     /db_xref="GeneID:2891647"
     mRNA            <615435..>615635
                     /locus_tag="CAGL0M05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449599.1"
                     /db_xref="GeneID:2891647"
     CDS             615435..615635
                     /locus_tag="CAGL0M05819g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449599.1"
                     /db_xref="GeneID:2891647"
                     /db_xref="GOA:Q6FJJ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ5"
                     /translation="MQCQLERERDFFHAFMEYLYASLSANIPIAWDLEMYWAMKCRRL
                     VRTILWINGSELDTEAIFLDLA"
     gene            <615972..>617207
                     /locus_tag="CAGL0M05841g"
                     /db_xref="GeneID:2891648"
     mRNA            <615972..>617207
                     /locus_tag="CAGL0M05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449600.1"
                     /db_xref="GeneID:2891648"
     CDS             615972..617207
                     /locus_tag="CAGL0M05841g"
                     /inference="similar to AA sequence:UniProtKB:P33550"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061w KTR2 mannosyltransferase or uniprot|P26725
                     Saccharomyces cerevisiae YJL139c YUR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449600.1"
                     /db_xref="GeneID:2891648"
                     /db_xref="GOA:Q6FJJ4"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ4"
                     /translation="MKEWLIWVVEVFIWWGQLWFCGDIDRNYFERSVAVKTKYDGVRR
                     REYFVPLKLATNSYDDMAVFTELEYSPKRENATLLMLVRNWELSGALASMRSLEDRFN
                     RKYNYDWVFLNDVPFDEDFMLATSAMASGMTYYGMVPPHEWSTPTWINEDQYAQCLRD
                     MEGSGVIYGGSRSYRNMCRFYSGFFYKQDLLKNYDYYMRVEPNVEYFCDFPYDPFKVM
                     RANKYKYGFLMSLYEYENTIPHLWHAVEDYINEYGHKLNFENNSYSFLVDKDHFSPNT
                     MGIIESHTDYNLCHFWSNFEVGDLSFFRSKEYEEFFDFMDQKGGFYYERWGDAPIHTI
                     AASLLLNTSEVIHFDELGYRHEPYLSCPRSLGIQLQQRCLCDVNSDVNLDISLASCLP
                     RWWRNGSGKTFVKPKQFTD"
     gene            <617997..>618944
                     /locus_tag="CAGL0M05863g"
                     /db_xref="GeneID:2891649"
     mRNA            <617997..>618944
                     /locus_tag="CAGL0M05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449601.1"
                     /db_xref="GeneID:2891649"
     CDS             617997..618944
                     /locus_tag="CAGL0M05863g"
                     /note="highly similar to uniprot|P36145 Saccharomyces
                     cerevisiae YKR062w TFA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449601.1"
                     /db_xref="GeneID:2891649"
                     /db_xref="GOA:Q6FJJ3"
                     /db_xref="InterPro:IPR003166"
                     /db_xref="InterPro:IPR016656"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ3"
                     /translation="MSKSNPLLANLKAFKSKVKSAPVLGVPRSNSNSRANSNTSVNNS
                     DNIVEIKDEDDTSATPKKRNRAATEDEVDLIDDDSDYDSSPSKRVKPGSLAAAALQAS
                     QADISKSHDSSKLLWATEYIQKKGKPVPLTELMDYLSMKRDDKVIGLLKKLERIEFDE
                     KKSTFKYLSTYDVHSAQELLTLLKNQVTFKGISFKDLKDGWPQCEETINDLEEESQIL
                     VLRTKKDKTPRYVWYNRGGNLNCIDEEFVKVWENVQLPQFTELPRKLQELGLKPASID
                     PSSVKRQTTRVEVKKKRNRRGKITNTHMAGILKDYSNKA"
     gene            complement(<620069..>621535)
                     /locus_tag="CAGL0M05885g"
                     /db_xref="GeneID:2891650"
     mRNA            complement(<620069..>621535)
                     /locus_tag="CAGL0M05885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449602.1"
                     /db_xref="GeneID:2891650"
     CDS             complement(620069..621535)
                     /locus_tag="CAGL0M05885g"
                     /inference="similar to AA sequence:UniProtKB:P36146"
                     /note="similar to uniprot|P36146 Saccharomyces cerevisiae
                     YKR063c LAS1 involved in cell morphogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449602.1"
                     /db_xref="GeneID:2891650"
                     /db_xref="GOA:Q6FJJ2"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:Q6FJJ2"
                     /translation="MSHGRVVPWKDEKELDELKQWFYSVSDGNDLRLKAISRVKSYKL
                     KGSQYLPHVIDSTAQLTSAILADEKHGGSDDLFDKMNIRMTYTMAMIRFVNGVLDPSQ
                     QTQFAIPLHTIARNVGLPSWFVDLRHWGTHERDLPNIDMLRMAAKDALQWLWKNYWDN
                     DELDDSLNEDDALDEETIRQQEYLDRLRLKIELWKNNNTELRDNCNIWLEEKNSIISS
                     DNFVVDDGGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSL
                     LVRKLPGFDLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRFSKWIVLEKELLSPLVS
                     LLNIRSRISELSELFNPDMTFMQFKLLSLLVKKLEEDIGNHNWRRKKRRKDNNDTTAK
                     LNDTQRQWNQLVADYLKSHVMLEEEKQFSMYGAKAKAVVKKAKEASVHNNELSDDLQK
                     LKQRLLNLKSKESVKPPSIETFNWDSHDDWQPKPFGIL"
     gene            <622029..>624704
                     /locus_tag="CAGL0M05907g"
                     /db_xref="GeneID:2891651"
     mRNA            <622029..>624704
                     /locus_tag="CAGL0M05907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449603.1"
                     /db_xref="GeneID:2891651"
     CDS             622029..624704
                     /locus_tag="CAGL0M05907g"
                     /inference="similar to AA sequence:UniProtKB:P36023"
                     /note="similar to uniprot|P36023 Saccharomyces cerevisiae
                     YKR064w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449603.1"
                     /db_xref="GeneID:2891651"
                     /db_xref="GOA:Q6FJJ1"
                     /db_xref="InterPro:IPR001138"
                     /translation="MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTD
                     TCTYLNDVPIGKKNNVPNTQVTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEIN
                     NNIWGRNSPIFPDSSDHSPPTQVFGDGPNLKPKVIGHCRYSGENQYINMVPKGYLIEV
                     KRSSVTRYAMWTSTSVEYRDPYLSCMLMFKKGAVKATTEQMKKKMKFKNLPNSFALFT
                     AFDNADDGKDKPNLNHAKIFNKFAEYRQQKSIGDLSEDHILDTKDLPRRQAVENCVLM
                     FAKFHLCPLLPLFNLPHLMEEVKIFYDNVEKTGKVSTKNGDNWIYCIILLLTKICKLA
                     ICMSNIPGDDVSPIAQLDTTRFIPLVHKYIMNHNLFRKCTLHQLQVLLLLRFYNWCAP
                     EDGDGQQGQQNSILMGMIISSAKELGIGWDLFTPGFPVGIDISDGSRPSAQHMNAEEY
                     TTLYQKIWCYILFWDRKMLLVNGQNCIIQRSRDTDYSLLEATFSKEDGSEFFRYFIHL
                     DSLLLEINDLISSNPTKVNITALNNCMTSLEEEFRNIHTIVNSREILQSNDDPRFFEV
                     SWNIKIARACILHAEVVSYEKECDFVRCHYAIQKLWEIVLSMCSDCMEYWSQRSEAFL
                     GSLNNFYTNRIVEIAADRLVHFVKAIILRLHRFHNVKAEDKQILVQFMHKFCSLYFTN
                     FGREYFRCFKSLFNLKMDYRVLSYSSVKDPWTVMLTFILHEMSYGEQPEGKLSLRDRL
                     PLIAKLHDKLSYMPSSFKNHDLILDAWQTSIYPICRYDEHFQLNLYISEIKKLDEHYK
                     IDKDKNLFESFYNNEVKLFGEEFGTQESCNSAFQKDSSEPPQETITLDEWGTLSGPYE
                     GNDILLASETDSKALRYNDQLIQEIFNPKDFLPFL"
     gene            complement(<624997..>625557)
                     /locus_tag="CAGL0M05929g"
                     /db_xref="GeneID:2891652"
     mRNA            complement(<624997..>625557)
                     /locus_tag="CAGL0M05929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449604.1"
                     /db_xref="GeneID:2891652"
     CDS             complement(624997..625557)
                     /locus_tag="CAGL0M05929g"
                     /note="some similarities with uniprot|P36147 Saccharomyces
                     cerevisiae YKR065c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449604.1"
                     /db_xref="GeneID:2891652"
                     /db_xref="GOA:Q6FJJ0"
                     /db_xref="InterPro:IPR013875"
                     /translation="MLSITQGIVRRSVARPGLIRPLVKCNARYYSDKPEDSLTWTDFF
                     QLRKQERRINVGSSVFTALVGANVSWAYLSTMEIDPTQMIFGFDPLVVVTAGLMASGA
                     LGYLMGPAVGSQVFKLTKGNKLAQYNLKNKEFLKHVIQNRVDASSQSFSNPVPDYYGE
                     KIGSVKEYRQWLRDCHAYAKKAKEFL"
     gene            <626330..>626719
                     /locus_tag="CAGL0M05951g"
                     /db_xref="GeneID:2891653"
     mRNA            <626330..>626719
                     /locus_tag="CAGL0M05951g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449605.1"
                     /db_xref="GeneID:2891653"
     CDS             626330..626719
                     /locus_tag="CAGL0M05951g"
                     /inference="similar to AA sequence:UniProtKB:P36141"
                     /note="similar to uniprot|P36141 Saccharomyces cerevisiae
                     YKR049c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449605.1"
                     /db_xref="GeneID:2891653"
                     /db_xref="GOA:Q6FJI9"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR012882"
                     /translation="MSMFRTLQRQPRTISLFTHDLENSRPCLSILEYLKSHTTNRFDL
                     ELSTKFPTLDQVHYMNAINPMILRAQIPHLTKIMKLKSYDPLFGSQLSDCVTKGFWNK
                     EAPLWVDWEKKALGTDLQSIKELLEKD"
     gene            <627289..>628521
                     /locus_tag="CAGL0M05973g"
                     /db_xref="GeneID:2891654"
     mRNA            <627289..>628521
                     /locus_tag="CAGL0M05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449606.1"
                     /db_xref="GeneID:2891654"
     CDS             627289..628521
                     /locus_tag="CAGL0M05973g"
                     /note="highly similar to uniprot|P25293 Saccharomyces
                     cerevisiae YKR048c NAP1 nucleosome assembly protein I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449606.1"
                     /db_xref="GeneID:2891654"
                     /db_xref="GOA:Q6FJI8"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI8"
                     /translation="MSAPIKTKPKSSMKIDNAPTPHNTPASVLNNSYLKNGNPVGKSK
                     PPPTISEEDIQTALSSQQPLLLGAIQEKLGSLVGQDSGYVDSLPQVVRNRIFALKKLQ
                     SDLFGIEKDFQVELFELEHKYLQKYAPLHARRSEIISGKQEPTSEEVAAGKEIQEKEE
                     GEEEEGEKPTDIQLTEEDIKGIPSFWLTALENLPIVSDTITDRDAEVLEYLQDVSIEY
                     LTEGKPGFLLKFKFSEENPYFKTPELTKTYYYQSELGYSGDFIYDHADGCSIDWVDND
                     SNVTIAVEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKMAGDEEDEEDLEDLEERL
                     ALDYSIGEQIKDKLIPRAVDWFTGAALEFEFNDAPEDEFDEFEDEDEDEDEDEEEDED
                     ERDDFANKKEEPPECKQS"
     gene            <629453..>630400
                     /locus_tag="CAGL0M05995g"
                     /db_xref="GeneID:2891655"
     mRNA            <629453..>630400
                     /locus_tag="CAGL0M05995g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449607.1"
                     /db_xref="GeneID:2891655"
     CDS             629453..630400
                     /locus_tag="CAGL0M05995g"
                     /inference="similar to AA sequence:UniProtKB:P36139"
                     /note="similar to uniprot|P36139 Saccharomyces cerevisiae
                     YKR046c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449607.1"
                     /db_xref="GeneID:2891655"
                     /db_xref="GOA:Q6FJI7"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI7"
                     /translation="MTEGNYAEVASNGQEKKVAKEELHSSLVTYSSPTLQHLHRYPVV
                     DKLIKRAVSVPVVSKAIAVSLLAVTGLKHKVWDSGKFPAVAKPVVSSSFKLLHKFDEL
                     VNLLVFSEGIDALFYAAKEHKNRPGVWLVWFLLDYFANVFNIILKEFVLKPFKLGNVA
                     IKDASDATHKVTDVKELPHVSELSDTTKRLSQDLQSKVSESYIQPTKESAMQKYDTYI
                     KPTAEKLHNVYAGNAKEKIDTYVKPKYDSYVKPGYDTAKETYKTITATYEQKLNKTES
                     IPRAIVDTGYEVGVTTIGKLRGSTPPKEQQRPQTTEVSS"
     gene            complement(<630670..>632010)
                     /locus_tag="CAGL0M06017g"
                     /db_xref="GeneID:2891656"
     mRNA            complement(<630670..>632010)
                     /locus_tag="CAGL0M06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449608.1"
                     /db_xref="GeneID:2891656"
     CDS             complement(630670..632010)
                     /locus_tag="CAGL0M06017g"
                     /note="highly similar to uniprot|P20049 Saccharomyces
                     cerevisiae YBR166c TYR1 prephenate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449608.1"
                     /db_xref="GeneID:2891656"
                     /db_xref="GOA:Q6FJI6"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012385"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI6"
                     /translation="MMEEQWQANKVIGIIGLGDMGLLYATKFSSAGWKVVACDREELF
                     DSLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGG
                     QTSCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIES
                     LVSCLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGL
                     ENVKVNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTER
                     LNKAKEFVFGNHTGLLLLDDTIFEKYSLSKDSASSDSKESTSLPNSHLSLLAIVDSWH
                     QLGINPYDHMICSTPLFRIFLGVSEFLFLSPDLLEKTIDAAIDDHSFRRDDLEFVVAA
                     REWSSIVTFGNFDLYKRQFEDVQKFFEPMLPEANQIGNEMIKTILMHSQDSKEA"
     gene            complement(<632430..>632798)
                     /locus_tag="CAGL0M06039g"
                     /db_xref="GeneID:2891657"
     mRNA            complement(<632430..>632798)
                     /locus_tag="CAGL0M06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449609.1"
                     /db_xref="GeneID:2891657"
     CDS             complement(632430..632798)
                     /locus_tag="CAGL0M06039g"
                     /inference="similar to AA sequence:UniProtKB:P38291"
                     /note="similar to uniprot|P38291 Saccharomyces cerevisiae
                     YBR167c POP7 nuclear RNase P subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449609.1"
                     /db_xref="GeneID:2891657"
                     /db_xref="GOA:Q6FJI5"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR020241"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI5"
                     /translation="MAEKLVRKLPTVKTMSHKKIKSTMYVKSGTPFKSATKRIDKLLN
                     QCQRYVTVLGMGHSVTKTLAIATTYQEKLHKVQVMTKTIEVLDEVVEDTESIDDSDSD
                     IETKLKKRLLSGVEVRIFKV"
     gene            <633324..>634628
                     /locus_tag="CAGL0M06061g"
                     /db_xref="GeneID:2891658"
     mRNA            <633324..>634628
                     /locus_tag="CAGL0M06061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449610.1"
                     /db_xref="GeneID:2891658"
     CDS             633324..634628
                     /locus_tag="CAGL0M06061g"
                     /note="weakly similar to uniprot|P38292 Saccharomyces
                     cerevisiae YBR168w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449610.1"
                     /db_xref="GeneID:2891658"
                     /db_xref="GOA:Q6FJI4"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI4"
                     /translation="MAYHAKFINSHGQKPSLTLVTPVMLSMSLAKIYPLLIIADAALD
                     NLMWICEDPNLPFLYVVLTYLSLSLYSWSWEYPVAGSQMANIILLWLELSSGVFLLFA
                     ASYFISSVYYNISTSEPPTVDDIILNLESLLDKLETLRNEIMFRRWFKKPISKVKMLQ
                     IFVRLVLVLTPVHYVLMKVITVHNYSKLLILFALFYHSDWMQVVLRLCWRLLIVRRFY
                     FRVFNYIFGDEYTLLGNNSKFGLKTLNLQHIMHLTSNCYLQIPLPLNAVTKMKENHLL
                     EILLLRYLNKNSKALENDDNIIKEFDSKTTADVVPKENTTDESATTSYNSSKVKIKEI
                     VVFENQRKWKYKGWISKMLPYERPQFTTNCNNKYNDPGAYITESPEQLDLQVPPDWSW
                     IEKEWTVSSWVYSDTDWNVTGTMDSLEGYTRSRIWKRKMFTL"
     gene            complement(<634963..>637047)
                     /locus_tag="CAGL0M06083g"
                     /db_xref="GeneID:2891659"
     mRNA            complement(<634963..>637047)
                     /locus_tag="CAGL0M06083g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449611.1"
                     /db_xref="GeneID:2891659"
     CDS             complement(634963..637047)
                     /locus_tag="CAGL0M06083g"
                     /note="highly similar to uniprot|P32589 Saccharomyces
                     cerevisiae YPL106c SSE1 or uniprot|P32590 Saccharomyces
                     cerevisiae YBR169c SSE2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449611.1"
                     /db_xref="GeneID:2891659"
                     /db_xref="GOA:Q6FJI3"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /translation="MSTPFGLDFGNDNSVLAVARNRGIDIVVNEVSNRSTPSMVGFGQ
                     KNRFLGESAKTKQTSNIKNTVGNLKRILGLDYDHPDFQEESKFFTSKLVKLEDGKIGT
                     QVRFAGESTTFSATQLNAMFINKVKQTVETETKANITDVCIAVPTWYTEEQRYAAADA
                     ARIAGLNPVRIVNDITAAGVSYGVFKTDLPEGEEKPRIVAFIDIGHSSYTCSIMAFKK
                     GELKVLGTAWDKNFGGRNFDRAITEHFADEFKTKYKIDIRENPKAYNRVMTSAERLKK
                     VLSANTAAPFSVENVMNDVDASSQLSREELEELVKPMLERVTEPVTKALAQAGLTKDD
                     VDFVEIIGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPF
                     KFEDIHQFSVSYKWDKQVEDEDHLEVFPANSNFPSTKLITLHRSGDFSMEANYTNKEE
                     LPPHLDANIAKWDITGVQIPEGETSVPVKLKLRCDPSGLHIIEEAYSLEDIVVKEEVP
                     LPEDAPEDAVPEVKEVTKTVKKDTLEITAHTFTLADDKLNTLIEKENDMTAQDRLVAE
                     TEDRKNNLEEYIYTLRGKLDEEYSDFASDAEKTKLKDMLAKAEEWLYEDGFDTIKAKY
                     IAKYEELAAIGNVIRGRYLAKEEEKKQALRAKQEAANLAALSEKLAAQRSADSEAKKD
                     ATPEGDAQMDLD"
     gene            complement(<637479..>639221)
                     /locus_tag="CAGL0M06105g"
                     /db_xref="GeneID:2891660"
     mRNA            complement(<637479..>639221)
                     /locus_tag="CAGL0M06105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449612.1"
                     /db_xref="GeneID:2891660"
     CDS             complement(637479..639221)
                     /locus_tag="CAGL0M06105g"
                     /inference="similar to AA sequence:UniProtKB:P33755"
                     /note="similar to uniprot|P33755 Saccharomyces cerevisiae
                     YBR170c NPL4 nuclear protein localization factor and ER
                     translocation component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449612.1"
                     /db_xref="GeneID:2891660"
                     /db_xref="GOA:Q6FJI2"
                     /db_xref="InterPro:IPR007716"
                     /db_xref="InterPro:IPR007717"
                     /db_xref="InterPro:IPR016563"
                     /db_xref="InterPro:IPR024682"
                     /db_xref="InterPro:IPR029071"
                     /translation="MIIRFRSPVGMHRVRCEGSETLGQVLPQLQTILNEHGITPRAIE
                     LGKEANGKDKTNVESLLEKTIEALGFRHGDIVYVHYQVDSSETKGSANDNNGSVAVNI
                     PNNLVPGKSQKADELEVDKELEKLDGLIPRQKTKLCKHGDRGMCEYCSPLPPWDANYA
                     NENNIKHISFHAYLKKLNESTNKRESGSSYIAPLSQPNFKINKHCTNGHEPWPKGICS
                     KCQPSAITLQQQEFRMVDHVEFQSSELINQFIEFWRASGTQRFAYLYGKYEKYDATPL
                     GIKACVHAIYEPPQHDEQDGITMDMEQVTQELNTIDLLAKEMGLLRVGMIFSDLTDAG
                     NGDGTVLCKRHKDSFFLSSLETIMAAQHQTRHPNVSKFSEQGIFSSKFVTCVVSGNLK
                     EEIDIASYQVSIDAEALVSADMIGGSTHPSMAYINDTTEDRYVPEIFYMKKNEYGLTV
                     KENAKPAFPVDYLIVSLTHGFPKDEDTTTQLFNSVTGFPWSNRQAMGYSQDYHELKRY
                     LHSTAASGNFNDLHDKLANFHLLLYIHSLQILSQEEWELLVKGALSQDYQEPLYKLSA
                     SPGWQTLLMIIESA"
     gene            <640057..>640749
                     /locus_tag="CAGL0M06127g"
                     /db_xref="GeneID:2891661"
     mRNA            <640057..>640749
                     /locus_tag="CAGL0M06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449613.1"
                     /db_xref="GeneID:2891661"
     CDS             640057..640749
                     /locus_tag="CAGL0M06127g"
                     /inference="similar to AA sequence:UniProtKB:P33754"
                     /note="similar to uniprot|P33754 Saccharomyces cerevisiae
                     YBR171w SEC66 ER protein-translocation complex subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449613.1"
                     /db_xref="GeneID:2891661"
                     /db_xref="GOA:Q6FJI1"
                     /db_xref="InterPro:IPR018624"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI1"
                     /translation="MDQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGTFFEEPQVEM
                     KAVSFYTPLLYVSLLVISLFIFASQYRKNKIKKISELPSIFDESDAKDLYMDLLKLQK
                     SGDKKIHEKVLKAGLLNRCAEAIRRSLKLKEMAPQVEILYKNGSIGDDYWQRYQTEVK
                     LVDVEFKECIQESERLQPGWVPTFVPLAREICLNQALSRRYNAIATRREVCIEEWGLK
                     LDKDGKLISSKN"
     gene            complement(<640964..>642556)
                     /locus_tag="CAGL0M06149g"
                     /db_xref="GeneID:2891662"
     mRNA            complement(<640964..>642556)
                     /locus_tag="CAGL0M06149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449614.1"
                     /db_xref="GeneID:2891662"
     CDS             complement(640964..642556)
                     /locus_tag="CAGL0M06149g"
                     /note="weakly similar to uniprot|P32909 Saccharomyces
                     cerevisiae YBR172c SMY2 kinesin-related protein and weakly
                     similar to uniprot|Q02875 Saccharomyces cerevisiae
                     YPL105c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449614.1"
                     /db_xref="GeneID:2891662"
                     /db_xref="GOA:Q6FJI0"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:Q6FJI0"
                     /translation="MDFSSSQKYIQTQTLLDNINGLQNLHVQDREGSKNNLTYAKNAA
                     SDVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSAHSSGNLNDLHAELSSPFYNI
                     PTIQNTTDMFDSHSHVSKTPLSIHQDVGTPTPTNKNSKVMETYGFVNTFLSPPVWRYI
                     DIQGNTQGPFSSSDMTGWYLQGYFQPTLQLFRDSTSHDNSNSTSQMCNQLITLMDILN
                     HTQNYQDPFNKFDEMLMTKTPVTEMVNPIPNHINNNAVTLAEECSNKDVNIESQIVES
                     SIQKEDVQAIASKHNAIENTTLEKPKLPSLMESHTNSINNLNNTTKESSTTISIGGSN
                     LNKQKSFTSSNQSQLRNDEKYNGENTTRNSSNKWSEIAKKNAPQNNPVAPVQKKTIAV
                     QKTSLTTAKSTEIDEKKTLLSATEPISIVNEDPQLSVDEFFFWCRKQIKLNDGHSLKD
                     VLELILSLPTDSESESIISETIYASSDTMDGRRFTKEFNQKRRECEKSNSGIQLTELV
                     SSYITDEDDWDFQVVNRKGKKN"
     gene            complement(<643102..>643542)
                     /locus_tag="CAGL0M06171g"
                     /db_xref="GeneID:2891663"
     mRNA            complement(<643102..>643542)
                     /locus_tag="CAGL0M06171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449615.1"
                     /db_xref="GeneID:2891663"
     CDS             complement(643102..643542)
                     /locus_tag="CAGL0M06171g"
                     /inference="similar to AA sequence:UniProtKB:P38293"
                     /note="similar to uniprot|P38293 Saccharomyces cerevisiae
                     YBR173c UMP1 proteasome maturation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449615.1"
                     /db_xref="GeneID:2891663"
                     /db_xref="GOA:Q6FJH9"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH9"
                     /translation="MSIVPKGHQDRVSTSQGVTSNAASLPDTLRMQEGGAVPLSSQLN
                     DRHPLMHRVQNWEETQHRRQLEQYRNIFGLAEPMRRMMEIGIVDATDFNPVSQGQSSI
                     HRDILMNKETSVDWEDIYPENNGLLSGNMVGDDVHTQIERKVGI"
     gene            <643917..>644867
                     /locus_tag="CAGL0M06193g"
                     /db_xref="GeneID:2891664"
     mRNA            <643917..>644867
                     /locus_tag="CAGL0M06193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449616.1"
                     /db_xref="GeneID:2891664"
     CDS             643917..644867
                     /locus_tag="CAGL0M06193g"
                     /inference="similar to AA sequence:UniProtKB:P38123"
                     /note="similar to uniprot|P38123 Saccharomyces cerevisiae
                     YBR175w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449616.1"
                     /db_xref="GeneID:2891664"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH8"
                     /translation="MMEVLKQIEIPGGGPSTCGVFSRDGQWLAVVRGIEVYIYETSGY
                     QLRETLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISL
                     CYNNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHD
                     GLIRIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKIWDS
                     VSGDVVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCWDSNTKAELQ
                     VLKIEECDSAIISIDCHNNLMCSLSLAGNCTIWKYVTETT"
     gene            <645200..>646153
                     /locus_tag="CAGL0M06215g"
                     /db_xref="GeneID:2891665"
     mRNA            <645200..>646153
                     /locus_tag="CAGL0M06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449617.1"
                     /db_xref="GeneID:2891665"
     CDS             645200..646153
                     /locus_tag="CAGL0M06215g"
                     /inference="similar to AA sequence:UniProtKB:P38122"
                     /note="similar to uniprot|P38122 Saccharomyces cerevisiae
                     YBR176w ECM31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449617.1"
                     /db_xref="GeneID:2891665"
                     /db_xref="GOA:Q6FJH7"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH7"
                     /translation="MMMLNRLKCLGKGPLRFYSVHSDTAGATKTILDLQRKYVERKPL
                     TMCTAYDFITASWVQKADTDILLIGDSMGMTSLGYDSTSSLTLDEFKYHVKSVCRAEG
                     PSFIVSDMPFGSFETSISQGIQTAIDLMRSSSKVKSMKIESGSCHSDHHTYKLIGELC
                     SRGIPVMGHIGLTPQRQHSLGGFKVQANKSVQEIHDLLASAKKLEELGCWGIVLECIP
                     QRVAGFITKALSIPTIGIGAGNQTSGQVLVVSDLLGFLDSTPPKFVKEYDNLGQRAID
                     SIKAYNSDVTTKAFPETGKHNFKIKEDIWNQFLSEVKVDKT"
     gene            complement(<646413..>647774)
                     /locus_tag="CAGL0M06237g"
                     /db_xref="GeneID:2891666"
     mRNA            complement(<646413..>647774)
                     /locus_tag="CAGL0M06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449618.1"
                     /db_xref="GeneID:2891666"
     CDS             complement(646413..647774)
                     /locus_tag="CAGL0M06237g"
                     /note="highly similar to uniprot|P38295 Saccharomyces
                     cerevisiae YBR177c EHT1 or uniprot|Q02891 Saccharomyces
                     cerevisiae YPL095c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449618.1"
                     /db_xref="GeneID:2891666"
                     /db_xref="GOA:Q6FJH6"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000952"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH6"
                     /translation="MSVNTWPLINPFNWGYNGTIKHVTHDEGTVKLQLKNGEEPLQFE
                     EFLNKYVPELKNDAKFKLNPALFTGILQTMYLGSADYSREFQVFYGREIVKFSDGGVC
                     TVDYVMKDWENEYKLNETTKKFDVEKFKQDEADTHAEGWPRLQPRTRYLRDNELQEVH
                     SDDRPLVLVLHGLAGGSHEPVIRSLTQQLSRIGGGKFQVAVLNSRGCARSKITTRSLF
                     TAFHTGDTREFLQRVRNHHPNKKIYAVGFSFGATMLANYLGEEGENTPLSAACTLSNP
                     WDMVMSSVKTSNDWWSKNLFSANITQFLVRLVKVNMGELEVPEGTEPDHPPTVKNPSY
                     YNFTKSNLQKAFKFKTIADFDSTYTAPCLGFKSAMDYYKSASSINRLPNIKIPLLSIN
                     ARDDPVVGPEGVPFDLMKQNPHVVHCETDIGGHLAYLDLEWKPWVTKEIAQYFNVFDD
                     HVE"
     gene            complement(<648689..>651244)
                     /locus_tag="CAGL0M06259g"
                     /db_xref="GeneID:2891667"
     mRNA            complement(<648689..>651244)
                     /locus_tag="CAGL0M06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449619.1"
                     /db_xref="GeneID:2891667"
     CDS             complement(648689..651244)
                     /locus_tag="CAGL0M06259g"
                     /inference="similar to AA sequence:UniProtKB:P38297"
                     /note="similar to uniprot|P38297 Saccharomyces cerevisiae
                     YBR179c FZO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449619.1"
                     /db_xref="GeneID:2891667"
                     /db_xref="GOA:Q6FJH5"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027091"
                     /db_xref="InterPro:IPR027094"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH5"
                     /translation="MSKQINFKGNGNKEEEEDPAKEILESLNNDDSYDSFVTPPPSQL
                     TYSRNDGQLILDEQDQDLSASHHRRASNENMLSAQLSQWTYNNNRATLQKAISHVSDL
                     LDKIDQENEERPMFLIQEDDVNKLNVLQPHLKLEGTYTVKHDKSFNLDKAALAKLFHS
                     QVQVAKKHLSSLKIRLDDMSSKVFITGDVNTGKSAFCNSLLRRRLLPEDQLPCTNVFC
                     EILESRDNNNLEEVHAIPLRLATTVKDVPAIYDIHNRTTYDIFPLSSLPELVQRNDKY
                     VLLKIYIKDDKVSPEKSLLRNGIVDISLMDSPGLNIDSLQTAEVMAKQEEIDLVIFVV
                     NAENQLTLSAKEFISLASTEKKFMFFVVKKFDKIRDKQRCKDLILKQIKDLSPESHKR
                     ANEFVHFISSPESDINSPRAGNGPDGDPDPGDDGGEYNSADPDFDHLQSSIRNFVLKK
                     RSLSKLLPVKTYIAKLLTDAEIISKANLKLFEEEDKQLDKELQELEPVLNEAQNKTGY
                     LTMKIEHIAENAIYSCYEFTKSQINSSLELTYDELPSYQGVSRIHDFVFSTEQCIRDK
                     IKSNVISSEQFARMQTEKTVNELESLGKQELGDEFMKERSFQSDLMFTKRIHTVSKKI
                     NVRMSIMDFFAPSWSSFVSYIGWSLSVPLLTSGESQNTADKTGAVVKKTVPGILGLKE
                     YPLVQYFSRPSLLFTSRLPTMAIYSVGGSKLMSNIAYNGLRLTSVNSLKKIASPLLIL
                     ASLLGVAYLIHDLPRALPLNLLRKYKRKLKELDFVHQNAERISREVRVVLKVPIREIY
                     TSCEAVVEKKRAIKREIEDKRASNALSMTFFNRLLAKSQTQLTIVQNINLDID"
     gene            <651932..>653560
                     /locus_tag="CAGL0M06281g"
                     /db_xref="GeneID:2891668"
     mRNA            <651932..>653560
                     /locus_tag="CAGL0M06281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449620.1"
                     /db_xref="GeneID:2891668"
     CDS             651932..653560
                     /locus_tag="CAGL0M06281g"
                     /inference="similar to AA sequence:UniProtKB:P38125"
                     /note="similar to uniprot|P38125 Saccharomyces cerevisiae
                     YBR180w DTR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449620.1"
                     /db_xref="GeneID:2891668"
                     /db_xref="GOA:Q6FJH4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH4"
                     /translation="MSTSSNTSGECSPFSITDSIVVQATDDNADKILQEVDLSDPNID
                     KNDTFELRQQVSIKESPLYYLRDIPYSAYTSFQVSLIFLIVIYNGFLGPLAGNVFIPA
                     LPLLQKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILYIISISLMVIINI
                     LLASVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGPNLGP
                     ILAPIIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQWENWS
                     QNENDMSTQPVDFSSPISRWSFVSDIGFLNPITQDSIFKGLYPHPPKFSVWTYLRIMT
                     FPPVILTSIANALLFCTYYSISVTLSHFLATEYSYSNLKIGACYVCPGVCMLLGSQIG
                     GHLSDSMRKSWKKENYNTEYPLEFRLILTVCGVLLAIGGSIGYGWCIQFHYHISAVLV
                     FAGLMAFGLTWCNNTIMTYLSELLSLRVSSAIAVSSFFRNIAAAISSALIAKLCQKMG
                     IGFCFLGLGLINLVSLFSILVLINNRNKWVKDSF"
     gene            complement(<654006..>655506)
                     /locus_tag="CAGL0M06303g"
                     /db_xref="GeneID:2891669"
     mRNA            complement(join(<654006..654710,655501..>655506))
                     /locus_tag="CAGL0M06303g"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_449621.1"
                     /db_xref="GeneID:2891669"
     CDS             complement(join(654006..654710,655501..655506))
                     /locus_tag="CAGL0M06303g"
                     /note="highly similar to uniprot|P02365 Saccharomyces
                     cerevisiae YPL090c RPS10B or uniprot|P02365 Saccharomyces
                     cerevisiae YBR181c RPS101"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_449621.1"
                     /db_xref="GeneID:2891669"
                     /db_xref="GOA:Q6FJH3"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDE
                     FKGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIV
                     GPDLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRR
                     EVTKGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAE
                     RKAEKAETRKRRASSLKA"
     gene            complement(<657290..>659269)
                     /locus_tag="CAGL0M06325g"
                     /db_xref="GeneID:2891670"
     mRNA            complement(<657290..>659269)
                     /locus_tag="CAGL0M06325g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449622.1"
                     /db_xref="GeneID:2891670"
     CDS             complement(657290..659269)
                     /locus_tag="CAGL0M06325g"
                     /note="some similarities with uniprot|Q12224 Saccharomyces
                     cerevisiae YPL089c RLM1 or uniprot|P38128 Saccharomyces
                     cerevisiae YBR182c SMP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449622.1"
                     /db_xref="GeneID:2891670"
                     /db_xref="GOA:Q6FJH2"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH2"
                     /translation="MGRRKIEIEPITDSKTRGITFLKRKAGIFKKAHELSVLCNVDVA
                     VVVLGANGTFYEFSSVEMDELLRYYTDQNGMGLLHIKTEPSAYGDGYKKTPTVKYQGT
                     RHLKRGRRLAKTKSVDLNQIRRASVGAPDNSTVNASSETNKKRQIKDEEGNGVDDDLN
                     NAAVKLRKLTHARHHSTGNSLLPQMDSNVKLGSLAFDSHERDSDLKLTRTRSFPFVGD
                     ISTEKVTQTNEQLEKAAPKFIVNSPPGSLNRESSHSNYMRPATNFNMGRSSTNGSTSK
                     KLKPILKLNIPIDNTNAANGVRNYSNQHASNSAENDLPKHIIRTPFQGSNFRVSPNVK
                     HEGSYFKNENIIDSENGNSKLTFSYGNDKNIKNQFRPPFFGSMKGNNSAGGSNNIAGS
                     PTNQYLITPLQQMNPNRVPLYKGAATTNSGSSLSTSLNMNGEVSTPNTANGNTASQRQ
                     LFGAFYSSGADSGKLHKNDKPNMFSNNQGDENDDVEGQDDVGQETRSENTSMAMNRNI
                     MPATTPIGPESSSQPLKMGPDFLGSTNSPNTSTMLFPDWNLSATGTNFSGQNFLNSAG
                     PKSGNIFGFPPLANYPFVGTGYGNSSNNSNNNNNNNGNNTNSNSNNQSINGGNPSKIS
                     GSELSPYLPHLHTPYPGKIFQFNNNDTNESYQASK"
     gene            <660288..>661232
                     /locus_tag="CAGL0M06347g"
                     /db_xref="GeneID:2891671"
     mRNA            <660288..>661232
                     /locus_tag="CAGL0M06347g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449623.1"
                     /db_xref="GeneID:2891671"
     CDS             660288..661232
                     /locus_tag="CAGL0M06347g"
                     /inference="similar to AA sequence:UniProtKB:P38298"
                     /note="similar to uniprot|P38298 Saccharomyces cerevisiae
                     YBR183w YPC1 or uniprot|Q02896 Saccharomyces cerevisiae
                     YPL087w YDC1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449623.1"
                     /db_xref="GeneID:2891671"
                     /db_xref="GOA:Q6FJH1"
                     /db_xref="InterPro:IPR008901"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH1"
                     /translation="MIRWEYPQAQDGYWGEITSTIDWCEENYVVSHYVAEWSNTFTNS
                     IFISTALYTIYCTRRNKLELRFLLIGLAYCLVGVGSWLFHMTLKYHFQLLDELPMIYA
                     MCVPCWSLITELIATFTGPTKNKHSNGKTNTLSSVKQVVIASLILLTASTVTVVYLIV
                     KNATIHQAFFGCLIGVVAFSSAYMVMTFVKDPQHKKNLHNSMMMGAIFFMSGYAVWLM
                     DIHLCKLWRFIRREYLLLPLGLLLELHGWWHVLTGLGIYYYIVCLQYLRLITTDRLQH
                     YKLIWRWGLLPELVPADYNIGTPYSLTFRGPREKAKPE"
     gene            complement(<661547..>663220)
                     /locus_tag="CAGL0M06369g"
                     /db_xref="GeneID:2891672"
     mRNA            complement(<661547..>663220)
                     /locus_tag="CAGL0M06369g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449624.1"
                     /db_xref="GeneID:2891672"
     CDS             complement(661547..663220)
                     /locus_tag="CAGL0M06369g"
                     /note="highly similar to uniprot|Q02908 Saccharomyces
                     cerevisiae YPL086c ELP3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449624.1"
                     /db_xref="GeneID:2891672"
                     /db_xref="GOA:Q6FJH0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR005910"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="UniProtKB/TrEMBL:Q6FJH0"
                     /translation="MGRHGKGPKTNKQKLAPEKERFLQCCTDITLELTNSLTSGTTRE
                     INLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVM
                     CKPHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGR
                     VEQLKQLGHSIDKVEYVVMGGTFMSLPKDYREDFIVKLHNALSGYNGNDIDEAIRYSQ
                     QSLTKCVGITIETRPDYCTETHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKAV
                     TETFAIAKDAGYKVVSHMMPDLPNVGMERDLQQFKEYFENPAFRTDGLKIYPTLVIRG
                     TGLYELWKTGRYKSYNANALVDLVARIMAMVPPWTRIYRVQRDIPMPLVTSGVDNGNL
                     RELALARMKDLGVTSRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYED
                     PKQDILIGLLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPLHSRDPKKFQHQGF
                     GTLLMEEAERIAKEEHGSSKISVISGVGVRNYYAKLGYELDGPYMSKKI"
     gene            complement(<663660..>664514)
                     /locus_tag="CAGL0M06391g"
                     /db_xref="GeneID:2891673"
     mRNA            complement(<663660..>664514)
                     /locus_tag="CAGL0M06391g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449625.1"
                     /db_xref="GeneID:2891673"
     CDS             complement(663660..664514)
                     /locus_tag="CAGL0M06391g"
                     /inference="similar to AA sequence:UniProtKB:P38300"
                     /note="similar to uniprot|P38300 Saccharomyces cerevisiae
                     YBR185c MBA1 respiratory chain assembly protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449625.1"
                     /db_xref="GeneID:2891673"
                     /db_xref="InterPro:IPR012483"
                     /db_xref="InterPro:IPR024621"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG9"
                     /translation="MIVGYRGVVVRRVGVSRLANVYNTRLFSSGVKLLDEAEQKQDTK
                     KIQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRF
                     QTGIKPAFLLWKNKAIETYVQVNANFASKSVEKLKPEVSVWVEEALNARSKQIPDNVK
                     LDWQLLKFNDVPKLISIQPMMIPGRPLEHIQLLYRFNTKQRLVKLNKTNNKVEKLDRD
                     VVDYMVFLCDATTNDLILMGSVFESKPDAKLPKNYDDNTEKAVRRMKECGDIYRVPSS
                     SENPQITN"
     gene            <664851..>667517
                     /locus_tag="CAGL0M06413g"
                     /db_xref="GeneID:2891674"
     mRNA            <664851..>667517
                     /locus_tag="CAGL0M06413g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449626.1"
                     /db_xref="GeneID:2891674"
     CDS             664851..667517
                     /locus_tag="CAGL0M06413g"
                     /inference="similar to AA sequence:UniProtKB:P48582"
                     /note="similar to uniprot|P48582 Saccharomyces cerevisiae
                     YPL084w BRO1 required for normal response to nutrient
                     limitation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449626.1"
                     /db_xref="GeneID:2891674"
                     /db_xref="GOA:Q6FJG8"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /translation="MKPSVIGLKCKDTDKVDWKRGLSSYLKRIYGSRQWKEFYDEQLC
                     VEMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIGQFKLEFTWYDAEYGLV
                     SSPTKHTQKTLVFEKSCTLYNLGVALTEVANEKINEDFKTAMVHMAKAMECFRYLSEN
                     FFNSPSADLQTENTKFLSDLSHAEAQEMFLINAINNGTSEKQASLISKLAYSGSNLYE
                     NCWEFLRTEEGGLTPYGEARWNSIVSGKHHFFRSLAAYYNALALEQNNKYGEAIAFLK
                     LATQCLSSSLPYKYALNDNFDFDGFGETIKDKTKQLIKDNDYIFHDSIPQSVSLSSIK
                     ALDAIKAPKWEEQLKPFMEAIAHKCEKLYRGIVPMEVFEKESIYSEKKASMLRQCIND
                     SETADMEYSSFIEFTHLPNLLSDLKRRYKSQNFSGTTDPQGDMMRDQIQSWIKSISQS
                     KYKDPDEQLKLISSKKQEILTLLAGLPSEQKENVVKLKMALVEAAASDEKLFSLVQPY
                     AAQLRLLKQPDELWKIFNMFSIDESNKQSLLDIDDSKNQEILAKISDIEQMAEDLRLL
                     KEERGRTLKELKSQTNDDDITNTLLVNSKAESEELEVIFKKELDKFKPLTTRIEATIF
                     KQESVVNEVKNELDNVFSLSGLENKTSEEEEKQKKRKEFFMQIEEAATKFLIFNNDLP
                     KGLEFYDSLLKMSKDLAVSVKVQNNASGSDNNSNNGYVSGNVIPPSLPPQPRNVGSSI
                     DSQFQSMNLGSVPTPQRFPQPPAPNSRPIVSMENYTSQFSVPPAHGDLPPAYNQVPLV
                     PTRNYDQPHGSGNYPGNVSSQHPVSSSPIPGAYDQVPMVPPKQPPAEGRSQISRQEQM
                     EREERELQRDPTAFYKKSSVFDESLYSRYSGK"
     gene            <668126..>669691
                     /locus_tag="CAGL0M06435g"
                     /db_xref="GeneID:2891675"
     mRNA            <668126..>669691
                     /locus_tag="CAGL0M06435g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449627.1"
                     /db_xref="GeneID:2891675"
     CDS             668126..669691
                     /locus_tag="CAGL0M06435g"
                     /inference="similar to AA sequence:UniProtKB:P38126"
                     /note="similar to uniprot|P38126 Saccharomyces cerevisiae
                     YBR186w PCH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449627.1"
                     /db_xref="GeneID:2891675"
                     /db_xref="GOA:Q6FJG7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG7"
                     /translation="MLVTVDACLRQSSINLVRQYMKNEEIRCNGNKYSTEDIFETVIK
                     AIRNAIQRRVGASQNCNGVLTFEDIFRDGKGSISIQDPPTQAQENIILSLIKVIFHST
                     STDPQFFLKISTHDNMILSLFVKVVYLNKHDELDDLKLDNVGLHEINHMVNQILTNQV
                     LKHTQPIDKVNDNDRFEIYFYILAAENHNEQEKLLTTEFDKFSIVDSYSNDDESTYNE
                     FSLDQNSSYEKNARQTQSIAHKVILPCPELEGVWENLYYNKDIKIKLLNYSTASLRLA
                     WYLETTSSSTDVVNEMISANNKMILLHGPPGTGKTTLCKALCNKLAIRMAKTKNCVVI
                     DQGSLLYELSCSRVFSRWFGESSKNITQLFRDIEADIITANKHNNFVFLLIDEVETIA
                     TSRINLSNKNEASDSVRVVNSLLTHLDKLKRYPNFLVLATSNLLETLDTAFVDRADGV
                     FFIGNPTSKELKYMINSSIDKLIKTGVIVDQDSYNLRKYDDVLQLLATFCEVCIKKTT
                     HPTYLSNYCCSYI"
     gene            <670483..>671286
                     /locus_tag="CAGL0M06457g"
                     /db_xref="GeneID:2891676"
     mRNA            <670483..>671286
                     /locus_tag="CAGL0M06457g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449628.1"
                     /db_xref="GeneID:2891676"
     CDS             670483..671286
                     /locus_tag="CAGL0M06457g"
                     /inference="similar to AA sequence:UniProtKB:P38301"
                     /note="similar to uniprot|P38301 Saccharomyces cerevisiae
                     YBR187w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449628.1"
                     /db_xref="GeneID:2891676"
                     /db_xref="GOA:Q6FJG6"
                     /db_xref="InterPro:IPR001727"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG6"
                     /translation="MTTIIAALALLPYVSATTTTTTNTTNDIPASHFGSFAMAVAMIG
                     LSEIGDKTFLIAALMAMRHARLLVFTAAAISLTIMTVLSGFLGHTFVSLIPESYTTFL
                     AGILFLVFAYKLLIEGLEMSKDAGVEEEMTEVEEEIAISTMNEKMDDIEGGSGKGKYT
                     DAASGPVNQVKQLFSKVFSPIWVSIFLMVFLGELGDRSQISIIAMATDNDYWYVIAGG
                     VMGHCICTGIAVLGGKLLATKISMRTITLSSAVLFLIFGIMYIYHAFHY"
     gene            complement(<671472..>671810)
                     /locus_tag="CAGL0M06479g"
                     /db_xref="GeneID:2891677"
     mRNA            complement(<671472..>671810)
                     /locus_tag="CAGL0M06479g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449629.1"
                     /db_xref="GeneID:2891677"
     CDS             complement(671472..671810)
                     /locus_tag="CAGL0M06479g"
                     /note="weakly similar to uniprot|P38302 Saccharomyces
                     cerevisiae YBR188c NTC20 splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449629.1"
                     /db_xref="GeneID:2891677"
                     /db_xref="GOA:Q6FJG5"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG5"
                     /translation="MSLLKQQAEERQRRLDQLRNIATSNSILPRDEVIEQNVEDSQVK
                     DEGQLVEEVNSEQEELADDEQHILEQNGSETADFKAQLQPQLDLLKKKTDEAIKRILR
                     RKIMQDKLDD"
     gene            <672743..>674201
                     /locus_tag="CAGL0M06501g"
                     /db_xref="GeneID:2891678"
     mRNA            join(<672743..672749,673624..>674201)
                     /locus_tag="CAGL0M06501g"
                     /product="40S ribosomal protein S9"
                     /transcript_id="XM_449630.1"
                     /db_xref="GeneID:2891678"
     CDS             join(672743..672749,673624..674201)
                     /locus_tag="CAGL0M06501g"
                     /note="highly similar to uniprot|P05755 Saccharomyces
                     cerevisiae YBR189w SUP46 or uniprot|O13516 Saccharomyces
                     cerevisiae YPL081w RPS13B"
                     /codon_start=1
                     /product="40S ribosomal protein S9"
                     /protein_id="XP_449630.1"
                     /db_xref="GeneID:2891678"
                     /db_xref="GOA:Q6FJG4"
                     /db_xref="InterPro:IPR001912"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005710"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG4"
                     /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYR
                     ISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIE
                     DFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAP
                     TSPFGGARPGRVARKNSGKASEGGDDAAEEADEE"
     gene            <675227..>676479
                     /locus_tag="CAGL0M06523g"
                     /db_xref="GeneID:2891679"
     mRNA            join(<675227..675237,676008..>676479)
                     /locus_tag="CAGL0M06523g"
                     /product="60S ribosomal protein L21"
                     /transcript_id="XM_449631.1"
                     /db_xref="GeneID:2891679"
     CDS             join(675227..675237,676008..676479)
                     /locus_tag="CAGL0M06523g"
                     /note="highly similar to uniprot|Q02753 Saccharomyces
                     cerevisiae YBR191w URP1A or uniprot|Q12672 Saccharomyces
                     cerevisiae YPL079w URP1B"
                     /codon_start=1
                     /product="60S ribosomal protein L21"
                     /protein_id="XP_449631.1"
                     /db_xref="GeneID:2891679"
                     /db_xref="GOA:Q6FJG3"
                     /db_xref="InterPro:IPR001147"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR018259"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG3"
                     /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKA
                     NGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIVNKMVGNRYLEKRLNLRVEHVKHSKCR
                     QEFLDRVKSNAAKRAEAKAQGKAVQLKRQPAQPREARVVSTEGNVPQTLAPVAYETFI
                     "
     gene            <677238..>679001
                     /locus_tag="CAGL0M06545g"
                     /db_xref="GeneID:2891680"
     mRNA            <677238..>679001
                     /locus_tag="CAGL0M06545g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449632.1"
                     /db_xref="GeneID:2891680"
     CDS             677238..679001
                     /locus_tag="CAGL0M06545g"
                     /inference="similar to AA sequence:UniProtKB:P32343"
                     /note="similar to uniprot|P32343 Saccharomyces cerevisiae
                     YKL124w SSH4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449632.1"
                     /db_xref="GeneID:2891680"
                     /db_xref="GOA:Q6FJG2"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /translation="MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAV
                     VFSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLL
                     DSNFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDS
                     KDLQMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYP
                     LPYNKKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRI
                     NDPFFPSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMN
                     ASYTRTYTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIE
                     LHVNLGQTGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPPQYPE
                     DTENFGLFGNLKIKSHIKNPLKEVSSNPSAPELIQKKLKTPIVKTPKVGIYEFTTPID
                     RKRETNMQPSINPPVYEINDTRQSSPEITNETISNEETVSSSSKAEPALQHGQSNKTP
                     NKRQNKKTKQRKNKKKGKKNK"
     gene            complement(<679126..>680325)
                     /locus_tag="CAGL0M06567g"
                     /db_xref="GeneID:2891681"
     mRNA            complement(<679126..>680325)
                     /locus_tag="CAGL0M06567g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449633.1"
                     /db_xref="GeneID:2891681"
     CDS             complement(679126..680325)
                     /locus_tag="CAGL0M06567g"
                     /note="highly similar to uniprot|Q12099 Saccharomyces
                     cerevisiae YDR021w FAL1 involved in maturation of 18S
                     rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449633.1"
                     /db_xref="GeneID:2891681"
                     /db_xref="GOA:Q6FJG1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSFNREHDLKLKFKSSKKLKISATFESMDLKEGLLRGIYSYGFE
                     APSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKKHDLQALVLSPTRE
                     LAAQIGKVVTNLGDYMNVKAYAMTGGKTMKDDLKKIQKHGCQVISGTPGRVLDMIKRR
                     LIETRHVQILVLDEADELLSDTLGFKHQIYDIFTKLPRTSQVVVVSATMSPEILEITK
                     KFMNDPVKILVKRDEITLEGIKQYYVNVEKEEWKFDTLCDIYDSLTITQCVIFCNSKK
                     KVDWLAHKLKQSNFAVISMHGDMKQDERDRVMNEFRTGQSRVLISTDVWARGIDVQQV
                     SLVINYDLPEITENYVHRIGRSGRFGRKGVAINFLTKIDASRMKEIEKYYKIKVKPMP
                     ADLSELS"
     gene            <680678..>681355
                     /locus_tag="CAGL0M06589g"
                     /db_xref="GeneID:2891682"
     mRNA            <680678..>681355
                     /locus_tag="CAGL0M06589g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449634.1"
                     /db_xref="GeneID:2891682"
     CDS             680678..681355
                     /locus_tag="CAGL0M06589g"
                     /note="weakly similar to uniprot|Q12084 Saccharomyces
                     cerevisiae YDR020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449634.1"
                     /db_xref="GeneID:2891682"
                     /db_xref="GOA:Q6FJG0"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJG0"
                     /translation="MDKRILLLIGGGHDTGVKSMSNELKTKFDSLFPESNIKVIDIDY
                     EQEYMISPARIKRSYSNEDYDFDVLYNTLTHQSEHKAEGEVDIIIVCGCYALYNQKIN
                     ELANLRVFVESDGDVRLINKIRSENIDNSEQLATTLQEYLQNLRPEMENYIEPTRVHA
                     HLIIPYANKDSGVAIIVDGMVKIVNEVSNSRSPDRQNSKEIARNQLYDFLGESMDNER
                     SRYYDLA"
     gene            complement(<681693..>683150)
                     /locus_tag="CAGL0M06611g"
                     /db_xref="GeneID:2891683"
     mRNA            complement(<681693..>683150)
                     /locus_tag="CAGL0M06611g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449635.1"
                     /db_xref="GeneID:2891683"
     CDS             complement(681693..683150)
                     /locus_tag="CAGL0M06611g"
                     /inference="similar to AA sequence:UniProtKB:P40501"
                     /note="similar to uniprot|P40501 Saccharomyces cerevisiae
                     YIL088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449635.1"
                     /db_xref="GeneID:2891683"
                     /db_xref="GOA:Q6FJF9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF9"
                     /translation="MIDNPTATVGSSITNLVKTIVGAGLFAIPFAFKNDGVAVGLLLI
                     FLAAVTSSFGLILLAKCSKTLINPRNSSFFTICMLTYPSLAPLFDLAMVVQCFGVGLS
                     YLVLVGDFFPDLFGGERKYWILLSAILVVPLCCLKKLDNLKYSSIVGVIALLYLSLLI
                     GFRYLTDVAFAPEISFERGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQD
                     NSMTNVRKVVDSSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCL
                     AMMLILTFPLLFHPLRTAINNIVVWFIIKFEKSSLTPEISARDSEASNYVTAETHTSR
                     PINLIINDDEVNDCEELNEDLLDSNNVIYQEHGHEEEPPKGGLNGVEHDVPFPETRFY
                     IITALLLVSMYAMALNVKSFALVLSLVGATGSTSISFILPGLFGYKLIGTDALAIGHT
                     MTKEDRLYRRLSLLLIYFGFAVMFLSLYVTLKYQQ"
     gene            complement(<683660..>684133)
                     /locus_tag="CAGL0M06633g"
                     /db_xref="GeneID:2891684"
     mRNA            complement(<683660..>684133)
                     /locus_tag="CAGL0M06633g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449636.1"
                     /db_xref="GeneID:2891684"
     CDS             complement(683660..684133)
                     /locus_tag="CAGL0M06633g"
                     /note="some similarities with uniprot|P40502 Saccharomyces
                     cerevisiae YIL087c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449636.1"
                     /db_xref="GeneID:2891684"
                     /db_xref="GOA:Q6FJF8"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF8"
                     /translation="MASVGKNESLSAQAYQLTATPYPAVVNGLALLATPMVSPQMSAT
                     AGMTSPASSAKGVMKNVLSMPSSRNSTRTIGPSNKAAMLFGGAQLLGAYIINDGDLEN
                     GAGFVTAWSALYMIVSGKGSVKALRYGRVWPLALSTLALGNTVLYGRRFLFSDFK"
     gene            complement(<684606..>685016)
                     /locus_tag="CAGL0M06655g"
                     /db_xref="GeneID:2891685"
     mRNA            complement(<684606..>685016)
                     /locus_tag="CAGL0M06655g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449637.1"
                     /db_xref="GeneID:2891685"
     CDS             complement(684606..685016)
                     /locus_tag="CAGL0M06655g"
                     /note="highly similar to uniprot|P05755 Saccharomyces
                     cerevisiae YNL031c HHT2 highly similar to uniprot|O13516
                     Saccharomyces cerevisiae YBR010w HHT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449637.1"
                     /db_xref="GeneID:2891685"
                     /db_xref="GOA:P61833"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <685761..>686072
                     /locus_tag="CAGL0M06677g"
                     /db_xref="GeneID:2891686"
     mRNA            <685761..>686072
                     /locus_tag="CAGL0M06677g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449638.1"
                     /db_xref="GeneID:2891686"
     CDS             685761..686072
                     /locus_tag="CAGL0M06677g"
                     /note="highly similar to uniprot|P02309 Saccharomyces
                     cerevisiae YNL030w HHF2 histone H4 and highly similar to
                     uniprot|P02309 Saccharomyces cerevisiae YBR009c HHF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449638.1"
                     /db_xref="GeneID:2891686"
                     /db_xref="GOA:Q8NIG3"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<686466..>687554)
                     /locus_tag="CAGL0M06699g"
                     /db_xref="GeneID:2891687"
     mRNA            complement(<686466..>687554)
                     /locus_tag="CAGL0M06699g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449639.1"
                     /db_xref="GeneID:2891687"
     CDS             complement(686466..687554)
                     /locus_tag="CAGL0M06699g"
                     /inference="similar to AA sequence:UniProtKB:P40505"
                     /note="similar to uniprot|P40505 Saccharomyces cerevisiae
                     YIL084c SDS3 transcriptional regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449639.1"
                     /db_xref="GeneID:2891687"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF5"
                     /translation="MEEMEVQKRLTSKDVPRKDKRRVNLENRVGKIQQSFILERDSYY
                     RDRLTSLQTDLTSLHQGNNELFMRKLRDLEEARDLELVRLRLYEEYRVYRSGIEFQEE
                     IEKTKEDHERLVKICKERLYQNIEMKTKKLQEERLLMDVANIHTYSMDYDRPHYQKNT
                     RSHTASGWESSSNDFGRDTANESATDTGLSGFGNERRSLRRRVVLGREGSGLEGGNGG
                     NATSGYTSGGINGDGYNYGKSYNTEDSDGGRYGANPYASPSGRGSQRQNNSGGYRTDM
                     NSDTEFLQSIGDSSELYNLLFGDKNVGGKDGNKSSSDKKKPRGTQRYSMKTAPPLQSL
                     KTEEVSEDIALIRELTGQPPAPFKVDKQ"
     gene            complement(<687902..>688978)
                     /locus_tag="CAGL0M06721g"
                     /db_xref="GeneID:2891688"
     mRNA            complement(<687902..>688978)
                     /locus_tag="CAGL0M06721g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449640.1"
                     /db_xref="GeneID:2891688"
     CDS             complement(687902..688978)
                     /locus_tag="CAGL0M06721g"
                     /note="highly similar to uniprot|P40506 Saccharomyces
                     cerevisiae YIL083c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449640.1"
                     /db_xref="GeneID:2891688"
                     /db_xref="GOA:Q6FJF4"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF4"
                     /translation="MVPPYSNGRPNIHTSITEVEHAIDRSISENVFPVAQTSEEASFF
                     HNNPRPAYMDELIQDTREFIEYQHEQGRDKIVLVTSGGTTVPLENNTVRFIDNFSAGT
                     RGAASAEQFLKNGYSVIFLHREFSLTPYNRKFTHNLKNSFLDFIDKDGVVKPEFKEQV
                     LENKRLYDLYVSEEKKLLLLPFTTVNQYLWSLKSVAKLLDSRGSLFYLAAAVSDFFVP
                     HSRMPQHKIQSRDYKLDGDSSSDDTTTTTADGKLIVNLDPVPKFLRRLVESWASQAMI
                     VSFKLETDERILIHKAITALDRYNHQLVIGNLLQTRNKEVVFVSSTNRDGDWIRLDNS
                     VKTIEELIVPEVIKRHDAWVAKNT"
     gene            complement(689384..689457)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0M06743r"
                     /db_xref="GeneID:2891689"
     tRNA            complement(689384..689457)
                     /gene="tRNA-Ile (AAT)"
                     /locus_tag="CAGL0M06743r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2891689"
     gene            <690036..>690878
                     /locus_tag="CAGL0M06765g"
                     /db_xref="GeneID:2891690"
     mRNA            <690036..>690878
                     /locus_tag="CAGL0M06765g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449641.1"
                     /db_xref="GeneID:2891690"
     CDS             690036..690878
                     /locus_tag="CAGL0M06765g"
                     /inference="similar to AA sequence:UniProtKB:P53965"
                     /note="similar to uniprot|P53965 Saccharomyces cerevisiae
                     YNL032w SIW14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449641.1"
                     /db_xref="GeneID:2891690"
                     /db_xref="GOA:Q6FJF3"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF3"
                     /translation="MSPGSGEESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLL
                     MDNGRVRNVHHLVDEDNLLREEFDKVLKQFHGNEDNELKIKGNEEDIDDLFDEEEHKK
                     SSTGLLLSCDSEVTPPENFSHVVGEIYRSSFPRTENFAFLQKRLKLKSILVLIPEEYP
                     QENLDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKH
                     RTGCLIGCIRKLQSWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWL
                     PLQW"
     gene            complement(<691398..>692996)
                     /locus_tag="CAGL0M06787g"
                     /db_xref="GeneID:2891691"
     mRNA            complement(<691398..>692996)
                     /locus_tag="CAGL0M06787g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449642.1"
                     /db_xref="GeneID:2891691"
     CDS             complement(691398..692996)
                     /locus_tag="CAGL0M06787g"
                     /inference="similar to AA sequence:UniProtKB:P53966"
                     /note="similar to uniprot|P53966 Saccharomyces cerevisiae
                     YNL029c KTR5 or uniprot|P40504 Saccharomyces cerevisiae
                     YIL085c KTR7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449642.1"
                     /db_xref="GeneID:2891691"
                     /db_xref="GOA:Q6FJF2"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF2"
                     /translation="MRVKVKRWVNDAVEEVLDWLLSTIAIYMYITAIICGTFLYFTYP
                     SRTDIRFYSEQDLGTERDAPFYYGCVNTEGYLQAPEYKKMNAAFVMLTRNNELKDVLS
                     SMNSIEAHFNQWFKYPYVFLNDEPFSEEFKKSIREATDADIEFGTLDESQWEFPEEVR
                     NTFEYQNAITDQGDRGILYGNMESYHKMCRFYSGIFYKHPLMQKYEWYWRLEPDVEFF
                     CDLTYDPFFEMHRRNKKYAFTMIIPEIYWTVPNLFRYTKAFIREYGVKVGTLWKLFAT
                     NYDILKTDKGRDEFTDYENMVRDDLHQWVKFGGDVEPKLSEKVAIDHLLESETADDDV
                     GLMFLVNRARSKVPLIEDEFEGEEYNLCHFWSNFEIARLDVFDNEVYNSYFQYLEASG
                     GFWKERWGDAPVHSIGLALTLDVDDIHYFRDIGYMHSILKHCPKNSPDLNEFQYKPAN
                     KKYKRSSWTRYDTPIEGGSGCRCRCPSKPAEVEDTITFCFEKWMDVTHLKKGEVELYQ
                     LFNIEEKEEMVRNDFERHHQQQNQ"
     gene            <693356..>694603
                     /locus_tag="CAGL0M06809g"
                     /db_xref="GeneID:2891692"
     mRNA            <693356..>694603
                     /locus_tag="CAGL0M06809g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449643.1"
                     /db_xref="GeneID:2891692"
     CDS             693356..694603
                     /locus_tag="CAGL0M06809g"
                     /inference="similar to AA sequence:UniProtKB:Q04235"
                     /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
                     YML005w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449643.1"
                     /db_xref="GeneID:2891692"
                     /db_xref="GOA:Q6FJF1"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF1"
                     /translation="MVLELVVRDLKLLKPIKTILENEGLFVKPIYSEGEDKIIRTRIS
                     DSNHQLLESLGTGVLIREIDGPVIQSHTKNDITEFTRHFFEGKLENATVIKLLEVLPV
                     KYTVFPPLLLFNYSKQRSFLNELWQQTVPSELMDQFYQAMLSAPFLANKKVSHIATNM
                     PIIESDVMRRPFNIVPLYGFKNSIPNEDKIWDSPSAQDFQDALWCQVNQNGIEQVWAP
                     QFTMFSRGNIKEKKRILDTFTDIEGNDVVDMYSGIGYFTLSYLTRNARTVFAFELNPW
                     SVEGLKRGLKANRIDQNRCHIFNESNANCLTRIKEYASIHGPPHIRHINLGLLPSSRD
                     GWPLAVQLYRYQLQFSTDRITIHIHENVHIDHIRDNSFIANTVAQLQEIDSELTYTPT
                     HLEQIKTFAPDVWHICLDVDIDH"
     gene            <695162..>697099
                     /locus_tag="CAGL0M06831g"
                     /db_xref="GeneID:2891693"
     mRNA            <695162..>697099
                     /locus_tag="CAGL0M06831g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449644.1"
                     /db_xref="GeneID:2891693"
     CDS             695162..697099
                     /locus_tag="CAGL0M06831g"
                     /note="weakly similar to uniprot|P53968 Saccharomyces
                     cerevisiae YNL027w CRZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449644.1"
                     /db_xref="GeneID:2891693"
                     /db_xref="GOA:Q6FJF0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FJF0"
                     /translation="MGDNEEDRRKKFLNGLQLQPDQDNMFLDQYLDQAAELQRHLQGN
                     NSMNGDVYEQDNNNHNFSTGQNILSESTFSPSSDMSNPVSNLFNSKSINFSDMPYEMG
                     VGEETPNDDRDRQDSNQNNNNNLMNTPTLKIECFDEDGVFLPGDTTNDPFTQDSGPKY
                     DSSQNINAGIVSDMNNFENMDSNFLDFGGDNQVSKEDGTYLDLYDNNLKNASTEKIAS
                     SNNLSVSRNSEDNLSRVSSTLNSPFMQPTDRSVSPILSPPVMYLGDHSHTDDNDDVVS
                     ILSNNSNILLPVNSHGYKYVTDFNQLGQLIGGDPFELDFNGDNDIINSNDLKVDAETL
                     LNSENVHLQAPQPNNNSSNNNNVSSPSGSNKMPTTPIISIEEYDDNNKNSNDDEYAID
                     MDSSNALQENRGFLGISLLPAEDSDATHDEILQGRKQKLKNRRVSQSSSRRSSRSSMR
                     SLTPEEKARSLSSNRNKLLEMADLLPKSPSSNNGSNNNSRRSSFYEESEDISMDTNIS
                     ENNNTNNNTGTDYVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKR
                     HEDLHTGKKRYVCGGKLKDGTFWGCGKKFARSDALGRHFKTSSGRKCITPLYEETARE
                     RNLPSIDDTNIQATEMGVTLE"
     gene            <697615..>699015
                     /locus_tag="CAGL0M06853g"
                     /db_xref="GeneID:2891694"
     mRNA            <697615..>699015
                     /locus_tag="CAGL0M06853g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449645.1"
                     /db_xref="GeneID:2891694"
     CDS             697615..699015
                     /locus_tag="CAGL0M06853g"
                     /inference="similar to AA sequence:UniProtKB:P53969"
                     /note="similar to uniprot|P53969 Saccharomyces cerevisiae
                     YNL026w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449645.1"
                     /db_xref="GeneID:2891694"
                     /db_xref="GOA:Q6FJE9"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE9"
                     /translation="MMSASDDQLQAELQAELQRFQNFQNGLLNRNLNTPVSVTKVITN
                     GTETIKPQTLQTYLDNTILQATTLKQLVKNADFLSAKLVQHGLAQDVYQNFSTNEKVM
                     SPSAENPIPIIDVISQLNILPVKKFVAKTGTNVGNNEGEGYLEFQLRNVFGNGESLRL
                     DMLRGTAKNSSMLASFVKPINPYHVLDLNIYKHSKNLGNICPLDLHFNGGKMSIKSEL
                     GNTQKRINQEWFYEGVTRTTKVTSDHASDTLLFQAGTDFKSSIGHTYAIDTRDSVMAP
                     NRGNLFKLNNEVALGKYWKSQFELSKVQSWFKNDFITTTTTLKGGYLGNFHPDKKTLH
                     INDKFMSGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKFEDSHFRL
                     HWFFNGGKLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLPLTVSTE
                     DSLRKGFQFGLGMSFL"
     gene            complement(<699260..>700279)
                     /locus_tag="CAGL0M06875g"
                     /db_xref="GeneID:2891695"
     mRNA            complement(<699260..>700279)
                     /locus_tag="CAGL0M06875g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449646.1"
                     /db_xref="GeneID:2891695"
     CDS             complement(699260..700279)
                     /locus_tag="CAGL0M06875g"
                     /note="highly similar to uniprot|P47821 Saccharomyces
                     cerevisiae YNL025c SSN8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449646.1"
                     /db_xref="GeneID:2891695"
                     /db_xref="GOA:Q6FJE8"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="InterPro:IPR028367"
                     /translation="MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIV
                     DSKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMK
                     LGRRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLV
                     SEARSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTF
                     TSDELQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETL
                     TSQSSLTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYL
                     RPLSA"
     gene            complement(<702211..>702957)
                     /locus_tag="CAGL0M06897g"
                     /db_xref="GeneID:2891696"
     mRNA            complement(<702211..>702957)
                     /locus_tag="CAGL0M06897g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449647.1"
                     /db_xref="GeneID:2891696"
     CDS             complement(702211..702957)
                     /locus_tag="CAGL0M06897g"
                     /inference="similar to AA sequence:UniProtKB:P53970"
                     /note="similar to uniprot|P53970 Saccharomyces cerevisiae
                     YNL024c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449647.1"
                     /db_xref="GeneID:2891696"
                     /db_xref="GOA:Q6FJE7"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE7"
                     /translation="MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESG
                     CGGKVWIAGELLCEFILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVT
                     KKQSQRMVKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHA
                     TTSSLDLVLAADCVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIR
                     KNFNVIVINDFKNYDQYLKQRTHLFQLVRK"
     gene            complement(<703702..>706572)
                     /locus_tag="CAGL0M06919g"
                     /db_xref="GeneID:2891697"
     mRNA            complement(<703702..>706572)
                     /locus_tag="CAGL0M06919g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449648.1"
                     /db_xref="GeneID:2891697"
     CDS             complement(703702..706572)
                     /locus_tag="CAGL0M06919g"
                     /inference="similar to AA sequence:UniProtKB:P53971"
                     /note="similar to uniprot|P53971 Saccharomyces cerevisiae
                     YNL023c FAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449648.1"
                     /db_xref="GeneID:2891697"
                     /db_xref="GOA:Q6FJE6"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE6"
                     /translation="MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAEL
                     SEELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDY
                     ECIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCG
                     QTCNAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETV
                     CDKLLPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPA
                     NAAYSKDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLK
                     TCPCGKNELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIE
                     KVRCACEQKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKI
                     NVRDLADESTIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGK
                     TIVEAPVRCGTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCK
                     CGKEQRVRTVCFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYC
                     NHRCPKPCHKFEECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEE
                     CAVLQRHMQLKEAFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIR
                     HENWCTDIENTLNKLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRS
                     VFVKKNLDGSSTKPILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPE
                     LESAARFNGFLVTNVGEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKY
                     KEISINVERDMETLVQHFDFLIKESLLAGGVELCNIENVLAE"
     gene            complement(<706878..>708356)
                     /locus_tag="CAGL0M06941g"
                     /db_xref="GeneID:2891698"
     mRNA            complement(<706878..>708356)
                     /locus_tag="CAGL0M06941g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449649.1"
                     /db_xref="GeneID:2891698"
     CDS             complement(706878..708356)
                     /locus_tag="CAGL0M06941g"
                     /inference="similar to AA sequence:UniProtKB:P53972"
                     /note="similar to uniprot|P53972 Saccharomyces cerevisiae
                     YNL022c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449649.1"
                     /db_xref="GeneID:2891698"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE5"
                     /translation="MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTN
                     PKHIYAIVSSCWKYKPYLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAK
                     RIQMGKHPIKNYVLKYKNALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRIN
                     PLRISNHDTDQVLNELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHEL
                     YKQGKIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNV
                     QIYAFEKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSG
                     SGIFGRKSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHA
                     MSFPNAKKIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKE
                     EFQEVFTDKTEQECQELADGCVRALPKEDGGIGFFAVCFVRD"
     gene            <709544..>710338
                     /locus_tag="CAGL0M06963g"
                     /db_xref="GeneID:2891699"
     mRNA            <709544..>710338
                     /locus_tag="CAGL0M06963g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449650.1"
                     /db_xref="GeneID:2891699"
     CDS             709544..710338
                     /locus_tag="CAGL0M06963g"
                     /inference="similar to AA sequence:UniProtKB:P50278"
                     /note="similar to uniprot|P50278 Saccharomyces cerevisiae
                     YNR034w SOL1 or uniprot|P37262 Saccharomyces cerevisiae
                     YCR073wa SOL2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449650.1"
                     /db_xref="GeneID:2891699"
                     /db_xref="GOA:Q6FJE4"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE4"
                     /translation="MTTAAPKLIQFDDEREVACATTEQIIKSQNSKLRQPVKKRTRRE
                     NRFRLAISGGQLMQTLLKALLYRKEEIEWEKWDIFFVDERLVPFNSNESNYGQLKRGL
                     LDPLKSINYPQPNVYHIEETEIDDANVVAQTYEKQLINIFASRDSVRLPTFDMILLGC
                     APDGHIASLFPQCHHNLREEMAWVIPITDAPLEPTKRISMSVPVISNSNQIIFMVTGS
                     NNAELMKMIIEKPSCELPSALISTCAPGRVSWYVENEALKEVMLLD"
     gene            complement(<710622..>711371)
                     /locus_tag="CAGL0M06985g"
                     /db_xref="GeneID:2891700"
     mRNA            complement(<710622..>711371)
                     /locus_tag="CAGL0M06985g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449651.1"
                     /db_xref="GeneID:2891700"
     CDS             complement(710622..711371)
                     /locus_tag="CAGL0M06985g"
                     /inference="similar to AA sequence:UniProtKB:P17261"
                     /note="similar to uniprot|P17261 Saccharomyces cerevisiae
                     YCR075c ERS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449651.1"
                     /db_xref="GeneID:2891700"
                     /db_xref="InterPro:IPR005282"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE3"
                     /translation="MEFEDILGVIYVTAWSISMYPPLYINWKRKSARAISPDFVLLNL
                     TGYFYLVCSLTLQMYKWIPHLQSNIERPKLTGFDYCYCLHGFILTVLIASQLFMSRSV
                     WRFPDTHQFRMKPVYKKVLLLSIFLFGVLTLQFTYHNMQSGWDNERTLAYCNNLFLLK
                     ISMSLIKYIPQVLHNFERKSMQGFAISGVFLDMTGGIASIVQLIFQILKESEINLSIL
                     ISNFGKIGLAMVTLIFNTIFISQWLLYEKKV"
     gene            <711794..>712030
                     /locus_tag="CAGL0M07001g"
                     /db_xref="GeneID:9488058"
     mRNA            <711794..>712030
                     /locus_tag="CAGL0M07001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999556.1"
                     /db_xref="GeneID:9488058"
     CDS             711794..712030
                     /locus_tag="CAGL0M07001g"
                     /inference="similar to AA sequence:UniProtKB:Q3E841"
                     /note="similar to uniprot|Q3E841 Saccharomyces cerevisiae
                     YNR034wa"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999602.1"
                     /db_xref="GeneID:9488058"
                     /db_xref="GOA:B4UN59"
                     /db_xref="InterPro:IPR021591"
                     /db_xref="UniProtKB/TrEMBL:B4UN59"
                     /translation="MLSSKLQELLPGSVGVMTFDSNNNLVLADGVAKDKVNDIPELSE
                     VQCNAEGVAVLENGDYIVHVCKKDGNTLVVYTGK"
     gene            complement(<712268..>713125)
                     /locus_tag="CAGL0M07007g"
                     /db_xref="GeneID:2891701"
     mRNA            complement(<712268..>713125)
                     /locus_tag="CAGL0M07007g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449652.1"
                     /db_xref="GeneID:2891701"
     CDS             complement(712268..713125)
                     /locus_tag="CAGL0M07007g"
                     /note="weakly similar to uniprot|P25659 Saccharomyces
                     cerevisiae YCR076c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449652.1"
                     /db_xref="GeneID:2891701"
                     /db_xref="GOA:Q6FJE2"
                     /db_xref="InterPro:IPR013886"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE2"
                     /translation="MMLVNTKLELAVKLVQEYFTEYATASVSFDNWFSNEVVKVEIVC
                     KKCEEQQILKLAAFETIKDKQCMISIYSGDEILSQSLFQYADDMQVVDAIKLPLDFEE
                     YKDRYSSKINEVLEGIGVKLNLKNYVNKLREDSAQDQNERAHPHDMHNNPLERYPQRV
                     ERTSNRDDIPKFEDEYEINSRRTDPNCLEPPGGYGDRDLYPTGQKYPNLNNPNVMPHL
                     PNNQGGMVFDPFGDRNHVRNPRDMPPGWIPGAKFDDPYGRPPSGFPGGPSSGPGGFGS
                     GGFGSNGFI"
     gene            complement(<713658..>716174)
                     /locus_tag="CAGL0M07029g"
                     /db_xref="GeneID:2891702"
     mRNA            complement(<713658..>716174)
                     /locus_tag="CAGL0M07029g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449653.1"
                     /db_xref="GeneID:2891702"
     CDS             complement(713658..716174)
                     /locus_tag="CAGL0M07029g"
                     /inference="similar to AA sequence:UniProtKB:P25644"
                     /note="similar to uniprot|P25644 Saccharomyces cerevisiae
                     YCR077c PAT1 topoisomerase II-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449653.1"
                     /db_xref="GeneID:2891702"
                     /db_xref="InterPro:IPR019167"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE1"
                     /translation="MSQRRRESALNFEETYNGFGEHELEENDYLNDETFGADIEVGTD
                     FDFGHPGKAATNNNVPAQASVMPQRSYVTAASSGINKPGQQNVDASMDLKPMESLWGG
                     QTEARPEEPVLSMEEIERQQRQMQQQQHQGPHGPMPPMPMMPPNMPPPNMAMPPPGYG
                     PMPGYQYPMNVNPSMFQGPPPPNMAMPPMQPSQGGQPMQPGQGGQPMQPPQRMPMPHQ
                     PEPPVQSPMSAVQQSSGVSTPQQSVISSSASPANSNQAALHQEQGQQNLAFQQDEQSQ
                     QHQQQQQYYQRNRFNNQNNNRGNQRREPLSPEEKMRLQIRHAKVEKILKHAGLMTPRD
                     KDFITRYQLSQIVTEDPYNEDFYFQVYKLIQRGGVAAESNKGLIARAYLEHSGHRLGG
                     RYKRADIALQRMQSQVEKAVTVAKERPQKNKDVDSVREGVLGKISTTMNSKAPRRQLA
                     IPSHKSNEDIAFSDDGKLSRDSTPALEEVTRNLDSVDLNAHSRTRRRSSYAFSSIDHN
                     SVLSRSGGRKFVLSLIETVYEEVLDLEANLRNDKETDSTALWETLHIDDEVYEVCPFI
                     SMLSFDKGVKIIPRIFNFLSKQQKLKLLQKFFSELSHLNIIILSSYKTNPDPTESQLK
                     KMDLFQTVFLKIIVSFLSSSSSFIEIMGLLLYLIKNNNVSFISTSKIGLNLITVLISR
                     AALIRQDSNRSNVLSSPEISTWNEIYDKLFTALESKLSAVFPPKEYCDKVVKIQTANA
                     GLSLAANPVSNKFYDQAYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINTAEQLKK
                     LPTEDQNGSLYRREKLYQDLNLFLNVMGLVSRDGEIMELK"
     gene            complement(<716775..>719546)
                     /locus_tag="CAGL0M07051g"
                     /db_xref="GeneID:2891703"
     mRNA            complement(<716775..>719546)
                     /locus_tag="CAGL0M07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449654.1"
                     /db_xref="GeneID:2891703"
     CDS             complement(716775..719546)
                     /locus_tag="CAGL0M07051g"
                     /inference="similar to AA sequence:UniProtKB:P39112"
                     /note="similar to uniprot|P39112 Saccharomyces cerevisiae
                     YMR287c MSU1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449654.1"
                     /db_xref="GeneID:2891703"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6FJE0"
                     /translation="MKVRVQRRWFHCCRRLDNAPLENSVKNYLARTKGLEPDFEIRQL
                     PQIISGFNKRYRARYLEPSQRWFKADWKASDHGEDKATRLLRPEVFDKFIINSDFHRG
                     NMEQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAKK
                     DGTLVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQ
                     LIVSFTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIKEA
                     TDAINGDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNNLWGSVYTNTALLSP
                     TTVAVLPLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLND
                     YAAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWD
                     LNIPKSSGISSVEQKLYDTAMPTIVSDTDRYDFGDMPVFCIDSEDAHEIDDGISIEEL
                     DGVRSRIHIHIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKSF
                     CNRADLGKHDRKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSI
                     LNGDDNSLPSKQKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGEL
                     CIPTFYDQSQTKSTLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFE
                     LLKENIKLGKLPSLKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLI
                     NHLQLHRFLKKLPLCFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHLEQSGTKT
                     HDVIVTSVPQNGTVNCLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGI
                     LTLTHVNRK"
     gene            <719729..>720319
                     /locus_tag="CAGL0M07073g"
                     /db_xref="GeneID:2891704"
     mRNA            <719729..>720319
                     /locus_tag="CAGL0M07073g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449655.1"
                     /db_xref="GeneID:2891704"
     CDS             719729..720319
                     /locus_tag="CAGL0M07073g"
                     /inference="similar to AA sequence:UniProtKB:P38876"
                     /note="similar to uniprot|P38876 Saccharomyces cerevisiae
                     YHR189w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449655.1"
                     /db_xref="GeneID:2891704"
                     /db_xref="GOA:Q6FJD9"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD9"
                     /translation="MKLEKSIKYGRAMNKARHLCLTGIGNPEPSYKGTRHNVGLTVLD
                     LLIKQLVPRDQHVFRREGKVHVLRTPTITFIRSDIGFMNLSGRSVVPMWQKLYTDHTD
                     YAVIHDELSLRTGALQLRQPQASLRGHNGLRDISAHWRHQYYKLAIGIDRPESRDPQA
                     VADYVLSKVPQRDATYIENTTTSKALELLQRQFPYI"
     gene            <720613..>721944
                     /locus_tag="CAGL0M07095g"
                     /db_xref="GeneID:2891705"
     mRNA            <720613..>721944
                     /locus_tag="CAGL0M07095g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449656.1"
                     /db_xref="GeneID:2891705"
     CDS             720613..721944
                     /locus_tag="CAGL0M07095g"
                     /note="highly similar to uniprot|P29704 Saccharomyces
                     cerevisiae YHR190w ERG9 farnesyl-diphosphate
                     farnesyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449656.1"
                     /db_xref="GeneID:2891705"
                     /db_xref="GOA:Q9HGZ6"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /translation="MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYE
                     LLNLTSRSFAAVIMELHPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSK
                     LDTTDWSFDGNDLKEKDRVVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYIL
                     DENFNLNGVQTVKDYDKYCHYVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMG
                     LFLQKTNIIRDYAEDLDDGRSFWPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNA
                     LTHVIDVLTYLSSIHEQSSFQFCAIPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDL
                     ILNSRTLKGCVDIFQYYLRDMKQRLPVEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGV
                     EPRETMIYLKVQERLKWDTQVIPRVQEEDYKFNMALSVVFCVLLSFYFFTK"
     gene            complement(<722174..>722575)
                     /locus_tag="CAGL0M07117g"
                     /db_xref="GeneID:2891706"
     mRNA            complement(<722174..>722575)
                     /locus_tag="CAGL0M07117g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449657.1"
                     /db_xref="GeneID:2891706"
     CDS             complement(722174..722575)
                     /locus_tag="CAGL0M07117g"
                     /inference="similar to AA sequence:UniProtKB:P38877"
                     /note="similar to uniprot|P38877 Saccharomyces cerevisiae
                     YHR191c CFT8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449657.1"
                     /db_xref="GeneID:2891706"
                     /db_xref="GOA:Q6FJD7"
                     /db_xref="InterPro:IPR018607"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD7"
                     /translation="MPSVDINYDKLKELLSKDSSTDGGSATPANTIETPLGTIMVEIQ
                     GSLELPTSIDEDSELSKKFDGVDAVKFGSLNIEDKKAVLYVGKKQRLLGKVVKLSTPL
                     GILKFNEGKNVEMLDIIEYKVIFSDRPLPIM"
     gene            <722830..>723591
                     /locus_tag="CAGL0M07139g"
                     /db_xref="GeneID:2891707"
     mRNA            <722830..>723591
                     /locus_tag="CAGL0M07139g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449658.1"
                     /db_xref="GeneID:2891707"
     CDS             722830..723591
                     /locus_tag="CAGL0M07139g"
                     /inference="similar to AA sequence:UniProtKB:P38878"
                     /note="similar to uniprot|P38878 Saccharomyces cerevisiae
                     YHR192w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449658.1"
                     /db_xref="GeneID:2891707"
                     /db_xref="GOA:Q6FJD6"
                     /db_xref="InterPro:IPR019273"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD6"
                     /translation="MFWFRDKRTLVQRYTADLAQITTQIHDLDKSIKHGSKRVARLQR
                     QVTYFGLSAITLLGSYMFLNYTPAITVIAMAGAVAIVVIVKLLLSRMYQVYHQYRIKK
                     LSQLRGLHQKKLDKLKEETNYNATSSIIQRFSSGETQSEDAVILMDEEISKKYNELTE
                     LQKQLTELKQNEKKLMDPKERDVWFDKVLGVLSGGDEMAPKPIICTNCNEHCGAYRLL
                     NRPLKYVCPNCGIKIDETAKMEQAVNEEVNEDKTK"
     gene            complement(<723774..>724271)
                     /locus_tag="CAGL0M07161g"
                     /db_xref="GeneID:2891708"
     mRNA            complement(<723774..>724271)
                     /locus_tag="CAGL0M07161g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449659.1"
                     /db_xref="GeneID:2891708"
     CDS             complement(723774..724271)
                     /locus_tag="CAGL0M07161g"
                     /note="highly similar to uniprot|P38879 Saccharomyces
                     cerevisiae YHR193c EGD2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449659.1"
                     /db_xref="GeneID:2891708"
                     /db_xref="GOA:Q6FJD5"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR016641"
                     /translation="MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKD
                     NQIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQ
                     AAAVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAI
                     MSLSK"
     gene            <724616..>726373
                     /locus_tag="CAGL0M07183g"
                     /db_xref="GeneID:2891709"
     mRNA            <724616..>726373
                     /locus_tag="CAGL0M07183g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449660.1"
                     /db_xref="GeneID:2891709"
     CDS             724616..726373
                     /locus_tag="CAGL0M07183g"
                     /inference="similar to AA sequence:UniProtKB:P38880"
                     /note="similar to uniprot|P38880 Saccharomyces cerevisiae
                     YHR194w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449660.1"
                     /db_xref="GeneID:2891709"
                     /db_xref="GOA:Q6FJD4"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD4"
                     /translation="MMLRRWVCNASNASSARLRLPTRVPVWLPDGSPARLAHRAPNQL
                     VPGMSSFQIWSIQVRWASDKNAVRKSIKEKIAQYKFITERDRTLAQTSGLFAKLRINT
                     RWFLKRSLNRPFNTDDIGAFISWILVSNFIILLLWTTSFVSVIIYLLNTVYAQEYVAE
                     KIGNYLTRNTALSVVFESAVVPDWSSGKISFKNVFISRRPKTSHSFTKGSQKEAAQRA
                     KLALSESLLVNREDFDHGNYTQFDLTLDQLDISLNLRKWINGKGFIDEVIINGLRGIV
                     DRTHVVWKANDDPRNYKNIAQPGDFEISNFKMNDVLFTLYQPQGFRPFQVSIFNCELP
                     QLRKHWLFYDILNANSMSGTYDNSMFTIHRKYNTLGDGSSESPVSPWRKVTRFRVDSL
                     DVDHLNAGIEGPFGWITEGKVNMIGDVLLPDKNADSLQLTELLTEISNRLIKQAKMYN
                     IIPQNKSETPDIDPDDYFIMDFSLKLNHVKATVPLFAPGMTYINNALIRPIVGYINSH
                     RTYIPIKCRVVKKIDDFEGSWTVYDSYLMQDLSAEVYDAFAVYVADDQQRSQRIKKVG
                     FWSLQVLLQLILLSLGSIA"
     gene            <726724..>727449
                     /locus_tag="CAGL0M07205g"
                     /db_xref="GeneID:2891710"
     mRNA            <726724..>727449
                     /locus_tag="CAGL0M07205g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449661.1"
                     /db_xref="GeneID:2891710"
     CDS             726724..727449
                     /locus_tag="CAGL0M07205g"
                     /note="weakly similar to uniprot|P38881 Saccharomyces
                     cerevisiae YHR195w NVJ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449661.1"
                     /db_xref="GeneID:2891710"
                     /db_xref="GOA:Q6FJD3"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD3"
                     /translation="MTRPPVLQYGIPFGVTVGAWKSLRKYLGHRMPYSSLHEPSQFEQ
                     WADDFFVPETLQEKIIEHIPEPVKHNKLSELFEQVTQRFFDMDTRLSIIMLIVIVLAP
                     LLSPSRKETHENCNDNENELQQSTAEERLKSAETTAVDLDEQEKEIHMEEIEDSTVVA
                     VKLPVATAEEVELMHETFGAVPALKREPNPSHTASSSSLDSANSKLSRESPRVPLQVS
                     PAKACNSNAQINNFQAYSQPFTY"
     gene            <728096..>729724
                     /locus_tag="CAGL0M07227g"
                     /db_xref="GeneID:2891711"
     mRNA            <728096..>729724
                     /locus_tag="CAGL0M07227g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449662.1"
                     /db_xref="GeneID:2891711"
     CDS             728096..729724
                     /locus_tag="CAGL0M07227g"
                     /inference="similar to AA sequence:UniProtKB:P38882"
                     /note="similar to uniprot|P38882 Saccharomyces cerevisiae
                     YHR196w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449662.1"
                     /db_xref="GeneID:2891711"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD2"
                     /translation="MSQIACFSKDGLTFAYQADRSKKNTIDLYPLDPENNYMINSSLV
                     NNIDCESNDLKISELNFYGWCYNEIANGSTKTKRRNSDDAGVISTTSHENYFVNVYGT
                     SKIVVYTQTGKDIVNILKSKDSIIGMATDGPFIWVLDENMVAKKFHYNQSKQQKSFTF
                     SEGRDSNVKNFEVLYRDEKTFYIVIFTEDKVYLIDPSKRRAVTKLVLEIGYYSHAEFL
                     NNGEYLVLSNSENLLVVDFESGKEVFRWETEAAFKFKVIKDFVFVLTGNDNSIDVFKF
                     GEKQPTRKIVASSSTIIDFEHTSGDNLLVAWLNVNEPNFKKLSLGDINSAGSIIDVNT
                     SQHDGTDLSEDNISVAGNEDSSEKEITQRQKITKAGQDKISQELLTALIEGEDKEIIE
                     ILNLPTWSSDRISNFLNNKIEENDQAVRLYQLVADEIEKDPWSDNATLPVWLKWILLI
                     KGKDMNISNDKKTRKQTRHLKSALRTSSTTLPILLGIQGRLEMLKTQAKLRKELAGIQ
                     LEQDDSTTTENNITYADGESDSFVDAAEYVEAKQ"
     gene            <730042..>731235
                     /locus_tag="CAGL0M07249g"
                     /db_xref="GeneID:2891712"
     mRNA            <730042..>731235
                     /locus_tag="CAGL0M07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449663.1"
                     /db_xref="GeneID:2891712"
     CDS             730042..731235
                     /locus_tag="CAGL0M07249g"
                     /inference="similar to AA sequence:UniProtKB:Q02783"
                     /note="similar to uniprot|Q02783 Saccharomyces cerevisiae
                     YPL060w or uniprot|Q01926 Saccharomyces cerevisiae YOR334w
                     MRS2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449663.1"
                     /db_xref="GeneID:2891712"
                     /db_xref="GOA:Q6FJD1"
                     /db_xref="InterPro:IPR026573"
                     /translation="MLLVNRAITLNLVKRCCWRSTMFMTPKRFLGTSEEESTAALLLQ
                     KNLIQRNNMLYGHGSGTIRCTVFDAGGNIVSPALDIKREELVAKHGLLPRDLRKIEKS
                     RKNDLVPSFLVRKNGILVSLATIKTLIKPDMVIVFDSFGSLNSTSHKAFLNSLKLRLQ
                     NLDMVELKKDPLPYEFRALESIFISALSNLTSEMNVQVTICKGILQDLEYSITRDKLK
                     FLLGQNKKLSNFYKKTVLIRDMLDDLLEQSDVLCSMYLSDLKNGVEHKDDDHSEIEML
                     LETYHNHLDEIVQITENIISNVKTTEEIINIILDSNRNQLMLLGIRFSIGMLSLGGPI
                     FIGSLYGMNLENFIEETDYGFIAASAIGMISLGALYFYSIKHLHKLQKMSLFNYTNYA
                     RDVKK"
     gene            <731627..>732076
                     /locus_tag="CAGL0M07271g"
                     /db_xref="GeneID:2891713"
     mRNA            <731627..>732076
                     /locus_tag="CAGL0M07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449664.1"
                     /db_xref="GeneID:2891713"
     CDS             731627..732076
                     /locus_tag="CAGL0M07271g"
                     /inference="similar to AA sequence:UniProtKB:Q02784"
                     /note="similar to uniprot|Q02784 Saccharomyces cerevisiae
                     YPL059w GRX5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449664.1"
                     /db_xref="GeneID:2891713"
                     /db_xref="GOA:Q6FJD0"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014434"
                     /db_xref="UniProtKB/TrEMBL:Q6FJD0"
                     /translation="MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIAS
                     APVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLEDPELREGIKEFSNWP
                     TIPQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD"
     gene            complement(<733072..>737619)
                     /locus_tag="CAGL0M07293g"
                     /db_xref="GeneID:2891714"
     mRNA            complement(<733072..>737619)
                     /locus_tag="CAGL0M07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449665.1"
                     /db_xref="GeneID:2891714"
     CDS             complement(733072..737619)
                     /locus_tag="CAGL0M07293g"
                     /inference="similar to AA sequence:UniProtKB:Q02785"
                     /note="similar to uniprot|Q02785 Saccharomyces cerevisiae
                     YPL058c PDR12 or uniprot|P32568 Saccharomyces cerevisiae
                     YDR011w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449665.1"
                     /db_xref="GeneID:2891714"
                     /db_xref="GOA:Q6FJC9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC9"
                     /translation="MPASISSSIISKERKDDADTTSNSYADSVHSYENINRDDNEQQP
                     VSTQLSRHLTQILSEEGGKERLESMARVISTKTKAEMDKFEVNDMDFDLRMLLNYLRN
                     RQLEQGIEPGDSGVAFKNLTAVGIDASAAYGPSVEEMLRDTGKLPLTLINKLRRKKDS
                     VPLRNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQ
                     EEMMKNYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIRDM
                     WCTVFGLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTA
                     LEFAQAIRTATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIYFGPAKKAVQYFE
                     NMGWIKPPRMTSAEFLTSVTVDFENRTLDIKPGYEDTIPKSGFEFEEYWLNSPEYQEL
                     LRHYDDYHARHPAEETRERFDTAKKQMLQSGQRESSRYVVNYWSQVWYCMIRGFQRVK
                     GDSTYTKVYLSSFLIKGLIVGSMFHKIDNKSQSTTAGAYSRGGLLFYVLLFASVTSLA
                     EIANSFSTRPIIVKHKSYSMYHISAESLQEIITELPTKFVAIIVLSLVTYWIPYLKFE
                     AGAFFQYILYLFTVQQCTSFIFKFVATITKDGVTAHAIGGLWVLMLCVYAGFVLPLGE
                     MHHWIKWLHFLNPLTYAFESLVSTEFHHREMLCSQLIPSGPGYENVSVANQICNAAGA
                     IKGHMFVNGDTYIDRQYHFAYRHAWRSWGVNIVWTFGYIVFNVILSEFIKPVSGGGDL
                     LLYKRGHMPEFGTENADARVASREEMMETLNGPDVDLPKVIAAKDVFTWNHLNYTIPY
                     DGATRQLLSDVFGYVKPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNSQSL
                     PASFNRSCGYVAQADNHMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQ
                     NYAEALVGKTGRGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMR
                     ALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSG
                     VKCGISENPAEYILNCIGAGATASASADWHDLWQQSPECAAARAELDELHKNLLSRPV
                     TEDPELVTKFAASYTTQMKCVLRRTMIQFWRSPVYIRAKFLECVSCALFVGLSYIAVN
                     HSVGGATEAFSSIFMLLLIALAMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHY
                     VVETGWSTLCQFMCFICYYWPAGYSGRASHAGFFFFFYVLIFPMYFVSYGLWILYMSP
                     DVPSASMINSNLFAAMLLFCGILQPKEKMPGFWRGLMYNVSPFTYVVQALVGPLVHDK
                     KVVCNKNEFAIMDPPAGQTCGEYLRTYIGNNSGYLVNPQATSNCNYCPYSVQDEVVAR
                     FNVKWSYRWRNFGFMWVYICFNIFAMLSCYYIMRVKVWSLKSVLDFKKWFNGPRKDRH
                     EKDKSIFEKKPGDEEKVKQKF"
     gene            complement(<740469..>741557)
                     /locus_tag="CAGL0M07315g"
                     /db_xref="GeneID:2891715"
     mRNA            complement(<740469..>741557)
                     /locus_tag="CAGL0M07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449666.1"
                     /db_xref="GeneID:2891715"
     CDS             complement(740469..741557)
                     /locus_tag="CAGL0M07315g"
                     /note="highly similar to uniprot|P33300 Saccharomyces
                     cerevisiae YPL057c SUR1 or uniprot|P38287 Saccharomyces
                     cerevisiae YBR161w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449666.1"
                     /db_xref="GeneID:2891715"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC8"
                     /translation="MKREVAYLAITNAFLVFFILFYTFDLLTLCIDDTIHDTLTASDL
                     NSSVPREDELIPRIIHQTYKTEDIPKHWIEGQHRCQELHSDYQYIMWTDQMALDFITE
                     HYSWFLPTFVGYKRPIQRADAIRYFILYHYGGIYIDLDDKCERPLDNLLKLPAFVRKT
                     SPLGISNDVMGSMPGHPFFWKAIHNLNHYNKNWYVPYLTIMSSTGPLFISIVWKHYRR
                     WKIFTKNYVPVKIIQPQDYKGSSSSFFSIVKGSSWHTDDAKWMKSLENHILSCVVAGF
                     IFAFFILYGEYIFYCWLCYKKPITLTNSDSGSKNSWSSKLLWVWNRIKFRSSSYTTTY
                     PTTPTTSPKRSRKDSNAVFDIEKRTVNV"
     gene            complement(<743020..>743961)
                     /locus_tag="CAGL0M07337g"
                     /db_xref="GeneID:2891716"
     mRNA            complement(<743020..>743961)
                     /locus_tag="CAGL0M07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449667.1"
                     /db_xref="GeneID:2891716"
     CDS             complement(743020..743961)
                     /locus_tag="CAGL0M07337g"
                     /note="some similarities with uniprot|Q02796 Saccharomyces
                     cerevisiae YPL055c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449667.1"
                     /db_xref="GeneID:2891716"
                     /db_xref="GOA:Q6FJC7"
                     /translation="MSDERYQSRYGRYDSGRGGRSGYYSNYQNSSHHRSNDGPNTNTH
                     GPSNGNGNSGGYYHGYYNRHGSMNGRAASSGRGYYGGHNTHITSAPHNNPNAYSRAPA
                     TGNTSYTGSYYSRGGNSSGRGGYSSYNRGGYHASHQYNNGGYYHRNNNYNSSYTERQK
                     SVSGDSATSGGMKYTSSHRTTHVTHPAHPPITIQRSGSNGNGVAQGNASSGEVPTAPR
                     RETTAQNNGRDKREEQLKKYGISNMAQGYLEIMDQNSSSTTSVTQTEIELDEKLREMN
                     SQVFRTMCELALVENQYTRDTLNVQLTQEKLDTLLLS"
     gene            <744461..>744790
                     /locus_tag="CAGL0M07359g"
                     /db_xref="GeneID:2891717"
     mRNA            <744461..>744790
                     /locus_tag="CAGL0M07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449668.1"
                     /db_xref="GeneID:2891717"
     CDS             744461..744790
                     /locus_tag="CAGL0M07359g"
                     /note="some similarities with uniprot|Q02799 Saccharomyces
                     cerevisiae YPL054w LEE1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449668.1"
                     /db_xref="GeneID:2891717"
                     /db_xref="GOA:Q6FJC6"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC6"
                     /translation="MTNVDLSKFSAKQQQLILQCLAITNQVNQSKNIGSGSQNKYSRR
                     KDCSHIPCKFYMVGSCQAGQSCPFSHQTQTIERAYSTPCKYYQKGYCKFGDRCINLHI
                     HEDQNEK"
     gene            complement(<745077..>746510)
                     /locus_tag="CAGL0M07381g"
                     /db_xref="GeneID:2891718"
     mRNA            complement(<745077..>746510)
                     /locus_tag="CAGL0M07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449669.1"
                     /db_xref="GeneID:2891718"
     CDS             complement(745077..746510)
                     /locus_tag="CAGL0M07381g"
                     /note="some similarities with uniprot|P54070 Saccharomyces
                     cerevisiae YPL053c KTR6 mannosylphosphate transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449669.1"
                     /db_xref="GeneID:2891718"
                     /db_xref="GOA:Q6FJC5"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC5"
                     /translation="METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDI
                     TDKLVTFAGEENVKSLHAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMS
                     LAEMGELPIDAETIEEQKSIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSF
                     VTGNSELRKLLRTIESVQKKFNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDD
                     VKTEVEFGTVPPEHWGFPDFIDSTVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHH
                     TLLKKYDWYMRVSPGIRLNCEMEYDIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNL
                     NFTAHNREFYNPIEKSSLRSYIQVGRDTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYM
                     DKAGGIFYERWSDSIIQSMAYSTMVPAKMIQHISPMGYQNKETVVCPADDIMWREYKC
                     ECDQGSDISFNRDLTCTQRYKDTQGMF"
     gene            <747805..>748398
                     /locus_tag="CAGL0M07403g"
                     /db_xref="GeneID:2891719"
     mRNA            <747805..>748398
                     /locus_tag="CAGL0M07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449670.1"
                     /db_xref="GeneID:2891719"
     CDS             747805..748398
                     /locus_tag="CAGL0M07403g"
                     /inference="similar to AA sequence:UniProtKB:Q02803"
                     /note="similar to uniprot|Q02803 Saccharomyces cerevisiae
                     YPL052w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449670.1"
                     /db_xref="GeneID:2891719"
                     /db_xref="GOA:Q6FJC4"
                     /db_xref="InterPro:IPR002993"
                     /db_xref="InterPro:IPR016181"
                     /translation="MSGARDIELGANTNELVTELLWDIIYLTEHQFLLPYYHGEHKKF
                     QKKLVKRVGNHLNSLVNNSASKPTGSMTVNVRHVWRNVGDRYTLLYLPLYFKELIWCK
                     ANGSIFHVIIPHTKEHVIHEHKEWLLAILEMAGYWNLSHVRLYLPRDDLTNIQTLLKN
                     LHWIGANLLPNENRNECNENDDITLSDETYIILECEC"
     gene            complement(<748504..>749631)
                     /locus_tag="CAGL0M07425g"
                     /db_xref="GeneID:2891720"
     mRNA            complement(<748504..>749631)
                     /locus_tag="CAGL0M07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449671.1"
                     /db_xref="GeneID:2891720"
     CDS             complement(748504..749631)
                     /locus_tag="CAGL0M07425g"
                     /inference="similar to AA sequence:UniProtKB:Q04372"
                     /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
                     YMR028w TAP42 component of the Tor signaling pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449671.1"
                     /db_xref="GeneID:2891720"
                     /db_xref="GOA:Q6FJC3"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC3"
                     /translation="MSGTILEQFRGIQGTIDRKLLHTQLRQDSEEYQKLLTGTIQELL
                     DLKSKVYHKLSLFSSNETVEDIATSSLLYLSLDYYLGLLCSRKQATSNQLANPMDKNK
                     MRIMFLDKAIQLFMQYLSTLQDNEILDESISKKIDGFENTFMPTMDELYAVPKHKEDL
                     SGAQLRRQEKIEMHKQNTAVAQQLRILEGKVSEDQENDDDELLRKLYLQKLKLLSYET
                     FDEIEKILYEKELLSNFVRMAPQSDNEPHLAGNDQSKSSNDDPTGYTDKLETLNKPLL
                     SKHGKVLRNFTLVDKRSELKSKVKGYGQYGPTMSVEEFLEQEWEQGRVLQGGEEPTKE
                     EIEALNEDNMEWQDKETYKAREWDEFKEENPKGSGNTMNRG"
     gene            complement(<749980..>751392)
                     /locus_tag="CAGL0M07447g"
                     /db_xref="GeneID:2891721"
     mRNA            complement(<749980..>751392)
                     /locus_tag="CAGL0M07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449672.1"
                     /db_xref="GeneID:2891721"
     CDS             complement(749980..751392)
                     /locus_tag="CAGL0M07447g"
                     /inference="similar to AA sequence:UniProtKB:Q04371"
                     /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
                     YMR027w high level expression reduced Ty3 transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449672.1"
                     /db_xref="GeneID:2891721"
                     /db_xref="GOA:Q6FJC2"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC2"
                     /translation="MSLPRRCMTSDKGTFGAYTAEERWPIIVQNAIDDVDAELKDIKD
                     RGDDSEQILEDGELLKKQLIEFREEILANTPLRKFTEQEIAIANIPLSFNETLDETAD
                     INKSWISSEWLFTEVYMYRRINVLFKSKKSPFWQEFDIFDRLKQSTFKASLHGVVELA
                     IRYKKLSHELQSLDLSSGESQEVLKILFKEFTEVSLWGNATDLSLLTSISLEDIKSIQ
                     GAKAREASESKIVVNDTDKAWDALISSKPGNRRVDFVLDNSGFELYADFLMGAFLLRS
                     KLASKCIFHAKDMPYMVSDVMMKDFETLLKDLEDRDFFPVTSGSEDDLALNDLATDIR
                     DFIKEGSFEFRTDSFWTTELDYWNIDPSEKKYHGAEIHNDFTKSNLVIFKGDLNYRKL
                     TGDRTWPRTTSWEAAIGPLAHNGVPTLSLRTCKATVQVALPEGKDEELSAVWEKDHPG
                     QGSWWCCSGKWAVICFSDGK"
     gene            <752098..>753375
                     /locus_tag="CAGL0M07469g"
                     /db_xref="GeneID:2891722"
     mRNA            <752098..>753375
                     /locus_tag="CAGL0M07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449673.1"
                     /db_xref="GeneID:2891722"
     CDS             752098..753375
                     /locus_tag="CAGL0M07469g"
                     /inference="similar to AA sequence:UniProtKB:Q04370"
                     /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
                     YMR026c PEX12 required for biogenesis of peroxisomes
                     -peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449673.1"
                     /db_xref="GeneID:2891722"
                     /db_xref="GOA:Q6FJC1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC1"
                     /translation="MSFFSNLPATATSNSGEGVSSLFPTIFEIVSSQEIDELLPASIR
                     YILTNYWISRYPSWTTLQVNNYFEEWFGVGVQGLVEWYHIDKYNSTFVDKFYGLQRFN
                     NSDPVLTQAQAIRQAREAGNPNLQWPKSLQLTNGQKRVVFLQKIILPYISHRLSEVYN
                     KLKSRIAMLSTELDDETGGADKKTKLKRFVIKWFVRLYPLWNSLTSLLNMVVKLAFLT
                     GRTGSMTFLEYLFKIEYTRMTLPLENGSISPSKTLKNNERPTRTNMSSIRGIFESAIG
                     SLGGMAGLTGSQLFPAFIFMLRVYQWWNTEDLTTKLQKKLNDIDKDIPRPPNAHISEE
                     ASNDSFEDSEMSQISEKIGTKKSDICPICKDSIENPCVLETGYVTCYACALDYIPKHE
                     GRCPVTGKRLLGCQFDSESGEWKVVTGIRRLLV"
     gene            complement(<753496..>754350)
                     /locus_tag="CAGL0M07491g"
                     /db_xref="GeneID:2891723"
     mRNA            complement(<753496..>754350)
                     /locus_tag="CAGL0M07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449674.1"
                     /db_xref="GeneID:2891723"
     CDS             complement(753496..754350)
                     /locus_tag="CAGL0M07491g"
                     /note="weakly similar to uniprot|Q04368 Saccharomyces
                     cerevisiae YMR025w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449674.1"
                     /db_xref="GeneID:2891723"
                     /db_xref="GOA:Q6FJC0"
                     /db_xref="UniProtKB/TrEMBL:Q6FJC0"
                     /translation="MDNRVNEVLLNSNIILEANFHYEKLTMVNGLYNGKQPMLFLLLG
                     TINDDGVASASEALSVVLNVDSRTGHFSFDKEQLATRIELMKVTHKQDELIGFLTINS
                     KYYNYEETIRMILIDFMPQFVGSAIIFSYTPNESSSENKTQQKNTSHLDLSCQLIENY
                     NIDTCDLKFQIEYNNIEIPVVSGSKSELELDEMPLQDEINYYHDRKKHIKQELSRVIS
                     YLGNASSVEQPLNAAILNRAAIITHLLNRNPTNDIETAISNMENEIRLLQTTLEQWEI
                     VNMKDNPS"
     gene            complement(<754838..>755914)
                     /locus_tag="CAGL0M07513g"
                     /db_xref="GeneID:2891724"
     mRNA            complement(<754838..>755914)
                     /locus_tag="CAGL0M07513g"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="XM_449675.1"
                     /db_xref="GeneID:2891724"
     CDS             complement(754838..755914)
                     /locus_tag="CAGL0M07513g"
                     /inference="similar to AA sequence:UniProtKB:P36516"
                     /note="similar to uniprot|P36516 Saccharomyces cerevisiae
                     YMR024w MRPL3"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="XP_449675.1"
                     /db_xref="GeneID:2891724"
                     /db_xref="GOA:Q6FJB9"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB9"
                     /translation="MMLCRVTRPITFRGFATFGRLQQAVDTAELDQYRSYYLGLKDVI
                     GKVPEEVAQRSPSLVALHRRLGLPREFTYSTLARCLTCRTSDLPAKIKNPFVTEASAR
                     YLAGTANVVPASKKLDNHGLNIFGKNLLTYHVTQYLVKRYPRLPVVVLNAAVDSYLSQ
                     RVLASIGKSWGIESEDSPVVNRYLANEPYEITLGKLRFFNNTLKREDGLQLITSKNFS
                     EEAAYALAVRSIIAALWASTQNTAKPDSAIHFIKDHILSRKLDVTKIFQFENPTRELA
                     VLCRRENLDLPVSKLIAESGRLSKAPVFIVGVFSGEEKLGEGYGSSLKEAKARAASDA
                     LLKWYCYEPTEEQAAVIDHGAVIV"
     gene            756146..756218
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0M07535r"
                     /db_xref="GeneID:2891725"
     tRNA            756146..756218
                     /gene="tRNA-Ala (AGC)"
                     /locus_tag="CAGL0M07535r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2891725"
     gene            <756457..>757920
                     /locus_tag="CAGL0M07546g"
                     /db_xref="GeneID:2891726"
     mRNA            <756457..>757920
                     /locus_tag="CAGL0M07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449676.1"
                     /db_xref="GeneID:2891726"
     CDS             756457..757920
                     /locus_tag="CAGL0M07546g"
                     /inference="similar to AA sequence:UniProtKB:P32559"
                     /note="similar to uniprot|P32559 Saccharomyces cerevisiae
                     YMR023c MSS1 mitochondrial GTPase involved in expression
                     of COX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449676.1"
                     /db_xref="GeneID:2891726"
                     /db_xref="GOA:Q6FJB8"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB8"
                     /translation="MVGIRFLSHTRQRLPTIYSMVTPRAKSAVSVIRVSGDKAQYVYR
                     KLTRRDDVPRSRQACLRGLYNGDNELIDRALVLYFKSPGSFTGEDVVEFQVHGGRAVS
                     ESVLSAIGSLNNRDQDVEIRMADRGEFSRRSFLNGKADLTGLEGINTLINADTEAQRR
                     AAMGSFTGKNKALFNRWRDIAIQNSAQLTAIIDFSEDSDFADEYTAVMAEVRQELMGL
                     RTEIGNFIARVTKASIVENGINMTLLGAPNVGKSSLLNQIASDDISIVSDIPGTTRDI
                     VSSIVNINGYKVNLFDTAGIRVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPL
                     NVLDLLKSSDLSGSEIIFVVNKIDIVDDSCKLSKIQQYIGNNLTGCKICFVSCLKSTG
                     IDELVTVLTGKFKTLTQNEENEDPIIVSDRVKEILEKDVLYGIDQFLQIQDDMHDIVI
                     ATEHLRYVIDGIGKITGEVIGLEEVLDVVFSKFCVGK"
     gene            complement(<758110..>758607)
                     /locus_tag="CAGL0M07568g"
                     /db_xref="GeneID:2891727"
     mRNA            complement(<758110..>758607)
                     /locus_tag="CAGL0M07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449677.1"
                     /db_xref="GeneID:2891727"
     CDS             complement(758110..758607)
                     /locus_tag="CAGL0M07568g"
                     /note="highly similar to uniprot|Q02159 Saccharomyces
                     cerevisiae YMR022w E2 ubiquitin-conjugation enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449677.1"
                     /db_xref="GeneID:2891727"
                     /db_xref="GOA:Q6FJB7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB7"
                     /translation="MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGP
                     PDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNM
                     YESAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSIL
                     KSLGF"
     gene            <758940..>760310
                     /locus_tag="CAGL0M07590g"
                     /db_xref="GeneID:2891728"
     mRNA            <758940..>760310
                     /locus_tag="CAGL0M07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449678.1"
                     /db_xref="GeneID:2891728"
     CDS             758940..760310
                     /locus_tag="CAGL0M07590g"
                     /note="weakly similar to uniprot|P35192 Saccharomyces
                     cerevisiae YMR021c metal binding activator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449678.1"
                     /db_xref="GeneID:2891728"
                     /db_xref="GOA:Q6FJB6"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB6"
                     /translation="MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDV
                     RDAIVVGDIHRKRSCECASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILF
                     VRAKKVLKAQLIGGELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQ
                     GNIDDDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVT
                     AAATETEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPL
                     TNLDSSTSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLT
                     KKTLIQYRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKE
                     KVDAGSIQNLTSQAENFIMNMNNSIDNGVSSNTTNNMNNINDTRLQSHYANLVKTEGT
                     ISPMFM"
     gene            complement(<760610..>762355)
                     /locus_tag="CAGL0M07612g"
                     /db_xref="GeneID:2891729"
     mRNA            complement(<760610..>762355)
                     /locus_tag="CAGL0M07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449679.1"
                     /db_xref="GeneID:2891729"
     CDS             complement(760610..762355)
                     /locus_tag="CAGL0M07612g"
                     /inference="similar to AA sequence:UniProtKB:P50264"
                     /note="similar to uniprot|P50264 Saccharomyces cerevisiae
                     YMR020w FMS1 suppressor of fenpropimorph resistance
                     mutation FEN2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449679.1"
                     /db_xref="GeneID:2891729"
                     /db_xref="GOA:Q6FJB5"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB5"
                     /translation="MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLC
                     TVTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSAS
                     SASSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSE
                     YTAELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELW
                     HGVSWYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAG
                     AHTTVSYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIVTIPQSLLSEGAVEFKPPLV
                     PQISAALQKMHFGSLGKVVFEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESRE
                     KNYTAQRLQALVQDVKQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHY
                     IESLHDSHQVYEFFKPVLSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNV
                     IVTDWTNDPYSKGAYSACYAGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAW
                     ESGEREANYILKQMK"
     gene            <763929..>764702
                     /locus_tag="CAGL0M07634g"
                     /db_xref="GeneID:2891730"
     mRNA            <763929..>764702
                     /locus_tag="CAGL0M07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449680.1"
                     /db_xref="GeneID:2891730"
     CDS             763929..764702
                     /locus_tag="CAGL0M07634g"
                     /inference="similar to AA sequence:UniProtKB:P53438"
                     /note="similar to uniprot|P53438 Saccharomyces cerevisiae
                     YMR016c SOK2 or uniprot|P36093 Saccharomyces cerevisiae
                     YKL043w PHD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449680.1"
                     /db_xref="GeneID:2891730"
                     /db_xref="GOA:Q6FJB4"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB4"
                     /translation="MSERELPGYTYLPPPRLSYQPSIALVPGVMQVRPPASPASPVGT
                     GAGTPGAAGTTGITGISSTTGTTGTGGTALGTVPTSALTNNNNNNNSSSSGNAYMTSA
                     LASWNQYQYPWLQHPLLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLN
                     VTGMTRGRRDGILKNEPVRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFID
                     DLHQAITLLRQQVQPQVQMPAPQLPVQSQQLIPQIHHHM"
     gene            <765772..>767379
                     /locus_tag="CAGL0M07656g"
                     /db_xref="GeneID:2891731"
     mRNA            <765772..>767379
                     /locus_tag="CAGL0M07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449681.1"
                     /db_xref="GeneID:2891731"
     CDS             765772..767379
                     /locus_tag="CAGL0M07656g"
                     /note="highly similar to uniprot|P54781 Saccharomyces
                     cerevisiae YMR015c C-22 sterol desaturase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449681.1"
                     /db_xref="GeneID:2891731"
                     /db_xref="GOA:Q6FJB3"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB3"
                     /translation="MASVVDQVHMSMNATAHAAGAASAGAVMAAPSLLDKLQGMSYLQ
                     MFVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPL
                     SCVSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYR
                     KSLNGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLR
                     SFCGDYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIFESCA
                     QRAKDHIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFAS
                     QDASSSLACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKE
                     TLRYRPPVLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERW
                     VEGSPANEAKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIK
                     VFATIFPKDDLLLSFKKRDPVTGEIKE"
     gene            complement(<767857..>769278)
                     /locus_tag="CAGL0M07678g"
                     /db_xref="GeneID:2891732"
     mRNA            complement(<767857..>769278)
                     /locus_tag="CAGL0M07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449682.1"
                     /db_xref="GeneID:2891732"
     CDS             complement(767857..769278)
                     /locus_tag="CAGL0M07678g"
                     /inference="similar to AA sequence:UniProtKB:Q04347"
                     /note="similar to uniprot|Q04347 Saccharomyces cerevisiae
                     YMR014w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449682.1"
                     /db_xref="GeneID:2891732"
                     /db_xref="GOA:Q6FJB2"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB2"
                     /translation="MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKK
                     NNKKVTKILESSDKEKVRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSV
                     FQPVLEAVEAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRI
                     PKWAADHEYVKMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDD
                     SLDLFLNINKQKRLQKQQEKKKSTKTSSKQHEEENEDASGDDFGYSDNDDPRYNENID
                     EDELLKQYDGMLVGSDDESDEEEDSAKSSASEDETSERIGKQEPVPKLKKKEKAKLPE
                     LMVGYVSGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREI
                     EKEMEKKRKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEHRKKLEKIEDHPSW
                     VAKKMAEDKEKNAKFAGKKITFD"
     gene            <772364..>773746
                     /locus_tag="CAGL0M07700g"
                     /db_xref="GeneID:2891733"
     mRNA            <772364..>773746
                     /locus_tag="CAGL0M07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449683.2"
                     /db_xref="GeneID:2891733"
     CDS             772364..773746
                     /locus_tag="CAGL0M07700g"
                     /inference="similar to AA sequence:UniProtKB:P20048"
                     /note="similar to uniprot|P20048 Saccharomyces cerevisiae
                     YMR013c dolichol kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449683.2"
                     /db_xref="GeneID:2891733"
                     /db_xref="GOA:Q6FJB1"
                     /db_xref="InterPro:IPR026566"
                     /db_xref="UniProtKB/TrEMBL:Q6FJB1"
                     /translation="MEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVVVQMVIVVHLVC
                     FVLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQA
                     GLMKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINN
                     ATAPNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDF
                     SNEKITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHF
                     VIFLLIVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRD
                     QRGPLIVSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTI
                     EGTVAFIVGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFM
                     VSMEKLLAQS"
     gene            complement(<774048..>777851)
                     /locus_tag="CAGL0M07722g"
                     /db_xref="GeneID:2891734"
     mRNA            complement(<774048..>777851)
                     /locus_tag="CAGL0M07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449684.1"
                     /db_xref="GeneID:2891734"
     CDS             complement(774048..777851)
                     /locus_tag="CAGL0M07722g"
                     /inference="similar to AA sequence:UniProtKB:Q03690"
                     /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
                     YMR012w translation initiation factor eIF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449684.1"
                     /db_xref="GeneID:2891734"
                     /db_xref="GOA:Q6FJB0"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="InterPro:IPR027523"
                     /db_xref="InterPro:IPR028275"
                     /translation="MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSK
                     LQNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYN
                     QYQALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTEN
                     KKPTSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPY
                     NPVPAFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDT
                     VHYTLYDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPD
                     YLRTQIDSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAM
                     DILYGNGTAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTL
                     NMLTRLNLPNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELS
                     SDICVKYGLDENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGS
                     DKRHYILDLANTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDK
                     VELVKAYEENLYSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYN
                     GEHLADTFHKNGVNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYL
                     QKIETMIKERQAKINKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPL
                     IKTAELEIISRSLKHILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLY
                     PVDQYEFKNLTHDTLLKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQL
                     LNKDYFFSTEQLEEYKQSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEEL
                     WSQGASIINENQKDGLTLLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAI
                     AFCRKSCAIYERVCGVDSFELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLD
                     KIHHPIFTNIFNYLEQLSLGVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGN
                     LLAADNRFSDALNQIKVAERIFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQ
                     DQTAASGLKQQPQKSKSGHNKKETTNPDLADKSVDELLSFIEGEDGKSSKTTKKSKSK
                     GKNKK"
     gene            complement(<779281..>779985)
                     /locus_tag="CAGL0M07744g"
                     /db_xref="GeneID:2891735"
     mRNA            complement(<779281..>779985)
                     /locus_tag="CAGL0M07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449685.1"
                     /db_xref="GeneID:2891735"
     CDS             complement(779281..779985)
                     /locus_tag="CAGL0M07744g"
                     /note="weakly similar to uniprot|Q8TFJ1 Pichia angusta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449685.1"
                     /db_xref="GeneID:2891735"
                     /db_xref="GOA:Q6FJA9"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA9"
                     /translation="MSLEKKLVYPWVAEIDGSDTSAIFEEIRNPAICEFKTFILSEVG
                     DFQIWIERFEDIILLTNMYWYRFYKAGPYYKEGITDIYERHVISNFDNAMIQLVLKTV
                     SAKVRELCDSYLQFGAHHKQVTVFGLIDQIRSHYDRDNPLITYKRYYAWLGHMSNISN
                     VERELDIRRLITDLLDDMPVMELSDKLSFEEQANKRAEISKYKNDIIAYMTIATTPNI
                     TADGITRALREKFGDF"
     gene            <781830..>782546
                     /locus_tag="CAGL0M07766g"
                     /db_xref="GeneID:2891736"
     mRNA            <781830..>782546
                     /locus_tag="CAGL0M07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449686.1"
                     /db_xref="GeneID:2891736"
     CDS             781830..782546
                     /locus_tag="CAGL0M07766g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449686.1"
                     /db_xref="GeneID:2891736"
                     /db_xref="GOA:Q6FJA8"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA8"
                     /translation="MAYPLLSKLDDIKDEVWLFEKINKPFLSIGFKTIILNEIGDFQK
                     WILQLEWIIKSTDHLWYQFYQAGPFNFAGISDPHKQYIVSVFDGALKKLISNTVSERV
                     NIDYEDFLQSHLSNCKITSFDLLEILKIEYDWVNAEKYFRENFEWLQNMDNFNTTQKM
                     LRCQRLVHIITEPLVDKIQMTKETKNEIDDFKQQIAANLMIALSPNHTQEILRHYRIG
                     KRLDLYDITNTIAYLEDKSI"
     gene            complement(783270..783341)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0M07788r"
                     /db_xref="GeneID:2891737"
     tRNA            complement(783270..783341)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0M07788r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2891737"
     gene            complement(<783505..>784724)
                     /locus_tag="CAGL0M07832g"
                     /db_xref="GeneID:2891738"
     mRNA            complement(join(<783505..784319,784445..>784724))
                     /locus_tag="CAGL0M07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449687.1"
                     /db_xref="GeneID:2891738"
     CDS             complement(join(783505..784319,784445..784724))
                     /locus_tag="CAGL0M07832g"
                     /note="some similarities with uniprot|P21651 Saccharomyces
                     cerevisiae YJR021c meiotic recombination protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449687.1"
                     /db_xref="GeneID:2891738"
                     /db_xref="GOA:Q6FJA7"
                     /db_xref="InterPro:IPR015159"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA7"
                     /translation="MEQRLETEDLHSESTDISSSIDADDLLHSGDSSLGEADKQIMEW
                     AGKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQLENCNHSKEEDIVDQVYKL
                     DVNINNQLQDWKKSFSDQLKSINHNSNLGQIKNLTECMANQEANILGAIRHNSTILKD
                     ECRDIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELLLSIDKQLHNIDLALIK
                     EKDQYKVQFKAFKRSLRDMITSNRNNVEDTVVNTVQVTIERKLEDMFDKMFDQKLLGK
                     LRLLITKGEIPVPEGSKLANAIPLNRHTNDYDLNGTTWTDSSSQDGPRTRARFRTKNK
                     VTKPRKSEISRTIIPWCEISSPPVEYTSDL"
     gene            <785153..>785470
                     /locus_tag="CAGL0M07854g"
                     /db_xref="GeneID:2891739"
     mRNA            <785153..>785470
                     /locus_tag="CAGL0M07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449688.1"
                     /db_xref="GeneID:2891739"
     CDS             785153..785470
                     /locus_tag="CAGL0M07854g"
                     /inference="similar to AA sequence:UniProtKB:P47093"
                     /note="similar to uniprot|P47093 Saccharomyces cerevisiae
                     YJR022w pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449688.1"
                     /db_xref="GeneID:2891739"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA6"
                     /translation="MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKI
                     RLLRGSEIVVCGLLEDAKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKR
                     KLK"
     gene            complement(<785578..>786204)
                     /locus_tag="CAGL0M07876g"
                     /db_xref="GeneID:2891740"
     mRNA            complement(<785578..>786204)
                     /locus_tag="CAGL0M07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449689.1"
                     /db_xref="GeneID:2891740"
     CDS             complement(785578..786204)
                     /locus_tag="CAGL0M07876g"
                     /note="highly similar to uniprot|P47095 Saccharomyces
                     cerevisiae YJR024c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449689.1"
                     /db_xref="GeneID:2891740"
                     /db_xref="GOA:Q6FJA5"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MGEAAELICTLCKQFYHLNWCTGTGGGISIRERNGESDVAYIAP
                     SGVQKELMRPEDLFVMDLIKGDYLSIPRGLKPSACTPLFLACYKKRNSGAVIHTHSQN
                     AVMCSLLFDKEFKISNIEQIKAMPNHGYYDTLTIPIIENMAHEDELIDQLNDVLDKYS
                     QDTVAVIVRRHGIFVWGPSIEKCKIYNEAIDYLLELALKMHQYNIPLP"
     gene            <786678..>789155
                     /locus_tag="CAGL0M07898g"
                     /db_xref="GeneID:2891741"
     mRNA            <786678..>789155
                     /locus_tag="CAGL0M07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449690.1"
                     /db_xref="GeneID:2891741"
     CDS             786678..789155
                     /locus_tag="CAGL0M07898g"
                     /inference="similar to AA sequence:UniProtKB:P46675"
                     /note="similar to uniprot|P46675 Saccharomyces cerevisiae
                     YLR045c STU2 suppressor of a cs tubulin mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449690.1"
                     /db_xref="GeneID:2891741"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA4"
                     /translation="MADEEVDIERLTLQEKLDHKLWKARQRGYQDLQKELEEGILDPS
                     FFDQLWGETGRFEQYIQDSNVVALESAVVALNSFLGKKISKIVDSGDDTIKTHAKFQV
                     DAWVPVLIIKPLSSTRAATKKNAMECIIKLVSLMDSVDYTISAILTKLPSVIKQPKPT
                     AAIINILNQILTKFQCNLLASADLLKQLLEPLPKLSSHADRNVRSETMNLIVTVFLKV
                     DGFQNRALLDELLLNSLKPIQIKDMEKMIDKVKDQKPEIMPYVWEDVIAKNKQQFNVD
                     EDGDTVMMGSNTEPKQDNTNNNVNALDSLVAGDTILDKFPDEFHSRVESQKWKDRAEA
                     LEEFYDHALSKLKKIDGNANENYTNLFSMYGHIISKDINVQVVTIAAESIDKICHALP
                     KQKLTKHLIQLVFNPLLERTKEKKPTLLDAIRKTLKTLVEHSNPVLPHNEDMLQLILQ
                     YMEHKVPQIRMECTSLFNYVLQLEAPGFDIHSSYLFGEISRIVPKVVKIVNDTNPSIR
                     QVGFDCFATLVTLLGKRPFIDSLDKLDTQKRKKIEELINSKSRPSSGALPGTRAGATS
                     TVLPVKRPPTSPLKKPPTSTSPRSRVLLTSRSLTKPNFGGSQPAPVAELTTGTLTPNK
                     RFDKAVDNGVQGITSNGGANYVSKFNSERERWDKERGGLLSSIKKLEDTNAELTARNF
                     ELVDKLTSFEKEREQQNLVINSKNEENGKLLEKIDFLEMKVKELQEKLDSNLSSARTF
                     SLGTELSVPEAKRVVESSDDELPKRVNSLRINSRASTLSSSDQQLFSRQFSGRDDEES
                     WKRAAEVTRKLKERIETMKARNRELSN"
     gene            complement(<789467..>791161)
                     /locus_tag="CAGL0M07920g"
                     /db_xref="GeneID:2891742"
     mRNA            complement(<789467..>791161)
                     /locus_tag="CAGL0M07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449691.1"
                     /db_xref="GeneID:2891742"
     CDS             complement(789467..791161)
                     /locus_tag="CAGL0M07920g"
                     /note="highly similar to uniprot|P06169 Saccharomyces
                     cerevisiae YLR044c PDC1 pyruvate decarboxylase or
                     uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449691.1"
                     /db_xref="GeneID:2891742"
                     /db_xref="GOA:Q6FJA3"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /translation="MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMR
                     WAGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVP
                     SISSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQ
                     RPVYLGLPANLVDLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILA
                     DACASRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAV
                     ESADLILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLL
                     NAVPEAIKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSA
                     FGINQTPFPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLT
                     VQEISTMIRWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALLPTFGAKDYE
                     NHRVATTGEWDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKLTASINAKQE"
     gene            complement(<792135..>794111)
                     /locus_tag="CAGL0M07942g"
                     /db_xref="GeneID:2891743"
     mRNA            complement(<792135..>794111)
                     /locus_tag="CAGL0M07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449692.1"
                     /db_xref="GeneID:2891743"
     CDS             complement(792135..794111)
                     /locus_tag="CAGL0M07942g"
                     /inference="similar to AA sequence:UniProtKB:Q12209"
                     /note="similar to uniprot|Q12209 Saccharomyces cerevisiae
                     YLR047c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449692.1"
                     /db_xref="GeneID:2891743"
                     /db_xref="GOA:Q6FJA2"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA2"
                     /translation="MNAYDGNSTVPDRRAEKLAQSRIADLYSRACFTCALIIICVMIP
                     SYNRVTLSQRYFQVMHYFRHHFVARHAWIHRLRVYHNKSLQQCIFWCSFVGIFTLHGS
                     QGNFFIVVKKLGRLAVALMPPLLFLTLRPSPLPKTLYLTLLPFHKWIGRIVVLAAFLH
                     SVFYAYVMCANKVLLEKMRKPANLYGLIAMVLFVLIVVTSLAPIRRRAFRVFYTVHYL
                     STWLVVVLIYMHARPGVPYYTAMSLSILVAQVIYRVRITRVCVAKVQRISPTLTLMEF
                     PLEQLALRPQYPGAHVRIRPAKGGGLARAVDYLVNGLVVPLQHPFTIANLPKDDKIQL
                     IIRSEKFPMRDGMRYHVSGAFEPVINFLTKPRNLADSLVKYRSTFALGRGTQALLGSP
                     LNYIVDSQRVLIVVGGTGISFGLPLLRVLNFNGCLVKLKWAIRDFRDLRILSHIRNNF
                     EGMEVYISGQGAEDEIEIEYTDNDFSDNEHTPLLSHHHMQGGSLLDSMDHVGSGNARA
                     MDPGAKRDTKATNNANGVNSANGANGGYCLRNVARENTADEIDFTDVFKNDTEHKRVP
                     VGVFREPSIIEEQEDRDKKIAIPSGVKVFHGRPRLDQHDYNWCMESECGVNDVSVDKR
                     RVWVVAAGPPGLIDATSRWSTDSGLRFHGESFAV"
     gene            complement(794833..794903)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0M07964r"
                     /db_xref="GeneID:2891744"
     tRNA            complement(794833..794903)
                     /gene="tRNA-Gly (GCC)"
                     /locus_tag="CAGL0M07964r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2891744"
     gene            complement(<795243..>795569)
                     /locus_tag="CAGL0M07986g"
                     /db_xref="GeneID:2891745"
     mRNA            complement(<795243..>795569)
                     /locus_tag="CAGL0M07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449693.1"
                     /db_xref="GeneID:2891745"
     CDS             complement(795243..795569)
                     /locus_tag="CAGL0M07986g"
                     /note="highly similar to uniprot|Q02772 Saccharomyces
                     cerevisiae YJR034w involved in assembly of cytochrome
                     oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449693.1"
                     /db_xref="GeneID:2891745"
                     /db_xref="GOA:Q6FJA1"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA1"
                     /translation="MGASCKDQKRAVAICLQRSPCVMIERHKPQECLDNPELSKDLPE
                     LCIAQMKAFLDCKRGMVDMTKRFRGNAPLSTGKYDQQYDKLCSGDFNPREEMNKLNTL
                     NSSEKE"
     gene            <795893..>800059
                     /locus_tag="CAGL0M08008g"
                     /db_xref="GeneID:2891746"
     mRNA            <795893..>800059
                     /locus_tag="CAGL0M08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449694.1"
                     /db_xref="GeneID:2891746"
     CDS             795893..800059
                     /locus_tag="CAGL0M08008g"
                     /inference="similar to AA sequence:UniProtKB:P47104"
                     /note="similar to uniprot|P47104 Saccharomyces cerevisiae
                     YJR033c RAV1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449694.1"
                     /db_xref="GeneID:2891746"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:Q6FJA0"
                     /translation="MSLTFLPGKPNDTVTSVCQRLWLDQTLLAYCSGNNLIIMSNELT
                     KLQTLYLDEDCVSVDINATNGFIAVGFGNKTKIYKPMYQVMKNPKWVNCCEVFHDESK
                     VNCVKWGNANELVIGSKYLSLWNIKDEFGDYRPVLLWTKLQPKPVYCCDISQDSQLIA
                     SYGKYEKTVKLWKRVSISGEENVFNVTLLKHDAPITALKWKRNSIDDDINRASQVLFT
                     LCEDRQLRVWFCYKLDSCHTVDLWGSLTLSHRQRYCLIIDNWLLSYCSKNSKLRSIDR
                     NTIVNSDVVLLADSEGNVEIHALDHLSNDPPRIMKKRLLHNKRLHKDSFVAKPDILYF
                     SEVQPFTSKDNILSIVIHDLKGVIRHSTISLAELLDNDKEVIGTLEHKFTGHNKSIQK
                     LIRSSDGEALLTTTRFSENCVWTPQYLGHGITLRMKNIICTESPIETAVVHEKGKLVI
                     ALLQNNKLQAWRCPNYDSKMSDTKLSTLEAELTLQKDKTVKPILMLNTPEEKHNHDRH
                     FIAIFYDDGSINAFEVSERRGISEIRSQNLALDGREIHQLSTIDPVHRTFNANRPLLA
                     VCTTGGTVITFRAKIDYEKLELSWIQAHEINTGGQKLRLVRGSSTGKMCIVDQSEKIM
                     SLWDMRRGVLEYEEHFEEPILDIDWTNTVHHQSVVSIGFESHVILYTQLRYDYTNKTP
                     SYLPIEDINVISHTAHKIGDSIWMKDGIFVVASGNQFYVKDKTLDTNDPFTHASIGSR
                     MIFSNDLFHLSSVLNGPLPVYHPQFLIQALYANKLELVKELLLRLFLELRKLQLNAKN
                     IIDLDSTLNIEPYKFLYRLNKDYPKEIFPAPYQEFNEQVAGQLSEQLTKIALPYMTRH
                     QQITLMTVITTVIELMKHQSTVDFNGLRFLLGTKLYQSHKKSQKSVLMRDVSWALHSD
                     NKELLMSILGAQILSWQQARQYKIAYWAKQDDLLASFEKIAKYEFSKDDTRDPNRCAV
                     FYLALKKKQVLSSLWRVCPGHPEQQKMMKFLGNDFKQSRWRTAALKNAFVLSSKHRYI
                     EAASFFLLADSLKDSVNVICRQLKDIDLAIAVCRVYEGDNGPILAEFLTKEVLPTAIV
                     DNDRWTTSYIYWKLRKQELAIKALITAPYDLEDNKQLVEENKVVNKSFLVEDPALLFL
                     YNHLRNRNLRYFLASLDLSNEYERYLILRATEILCRMGCDYLAISLVKNWNFIDKPKV
                     ATKLPFSPIKDQTYSGINAMTEEPTSTNKVRKSLFDMFDKSGEDNTSSSSANNVTKSV
                     LDDFNSNNNLRTSSILDQFKPSGGLNTNTDSLCTQKIEKNPDQQPKNLLDAFTYNNVP
                     EGKENDNKLTEKSVPNKPRSLLDDFETIPSTSVTNSSQNSVENKTVTEENVALRSEPP
                     KVKNLLDDFM"
     gene            complement(<800149..>801312)
                     /locus_tag="CAGL0M08030g"
                     /db_xref="GeneID:2891747"
     mRNA            complement(<800149..>801312)
                     /locus_tag="CAGL0M08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449695.1"
                     /db_xref="GeneID:2891747"
     CDS             complement(800149..801312)
                     /locus_tag="CAGL0M08030g"
                     /inference="similar to AA sequence:UniProtKB:P47103"
                     /note="similar to uniprot|P47103 Saccharomyces cerevisiae
                     YJR032w Peptidyl-prolyl cis-trans isomerase CYP7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449695.1"
                     /db_xref="GeneID:2891747"
                     /db_xref="GOA:Q6FJ99"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ99"
                     /translation="MKVYLDIAIAGEQIGRIVCELYNDKAPKAVENFHRLCVGSGSVG
                     GIHLTYKRSCFHRVIRNFMIQGGDLVFGKEDNLDSDKVGLGGCSIYATEEEIKDDTKE
                     LQCHGLFEDENVGEFDEPFLLAMANTGSPNTNSSQFFITTYPSPHLTGKHSIFGRVIH
                     GKSVVRTIEYGKVDKEGTPENLVVIEDCGDWDETMSIPLYNASNSTIGGDIYEEYPDD
                     DTHFDSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEK
                     HCLLFIELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSL
                     FAKKRYDEALKNYRLCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFFR"
     gene            <801812..>805744
                     /locus_tag="CAGL0M08052g"
                     /db_xref="GeneID:2891748"
     mRNA            <801812..>805744
                     /locus_tag="CAGL0M08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449696.1"
                     /db_xref="GeneID:2891748"
     CDS             801812..805744
                     /locus_tag="CAGL0M08052g"
                     /inference="similar to AA sequence:UniProtKB:P39993"
                     /note="similar to uniprot|P39993 Saccharomyces cerevisiae
                     YEL022w GEA2 or uniprot|P47102 Saccharomyces cerevisiae
                     YJR031c GEA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449696.1"
                     /db_xref="GeneID:2891748"
                     /db_xref="GOA:Q6FJ98"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ98"
                     /translation="MLVSDPNTIILRECRELLYVIASERQDEYIPAVPDLIGGSNEYS
                     EDEEDTQKAELMKGEGTEDVDDKTAVKNQLQTLIDTVLLSQTLDNIDACTIVAPFNRT
                     LISPRLNREATIRTLDALEKFINFEVINVNMSNYSTAFRMLIDSLNNISFDAYDKTSD
                     DSILFKTLVLLRSSITKNSFEILSDSVAYDLLKTTITLACNSKRSPLLQEYARSSIYE
                     LTAIAFNKIRSLKSSDDTNNYINDKSLGSSTLKKYLANRSSSEEDSMGLKGDEYFNST
                     VDLIKENKYKDPNCGLPVIKRYLQLLLSLLTIDQDNKHTKQVKALGFSLIICGIEVAG
                     KDIILFPSLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIEL
                     TFSHICDILLDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLN
                     RMDLANIISGTLCKLLTSNGNDDINTWLLSFESLEIFINFMYEMTIKNASMSTNGIKE
                     GSDIISQKKKKIEYLSCVDRFNKKPKEGITYFHRSGFLKTLSDKDIATFLFENKGPLN
                     KQKIGLLLCDPNEQKLLQSYMQNFDFRDFRLDEALRIMLSKFRLPGESQQIERIIEMF
                     SEVYSSQNERKNENIQPESIDSNEADSELCVSISNKNVTCDADSAFVLSYSLIMLNTD
                     LHNPQIKTHMSFSDYTSNLRGCYKGADFPDSFLAKLYNSIKEKEILMPEEHHGNEQLF
                     KDDWNNLIASAFILTKPSSKIQEHEERTKDFTDFIGAIFETFGFSLVSAFLSTTHANQ
                     ISSNNTRLFAIIEKCGRITSIYGLSAPYNKVIDSLLKMTVLIGNLDKELRLVENDNDD
                     YAQIEVESSTSNEAICVSNESIAFGRDEKAQLSYITAYKLLNLEKNNIGLLPDTLETL
                     IEVLTILYDKHIIDMSYIDNVNELMRCDILPRTPTEITIKKEALNRSLLSTFASYIKG
                     DEGPSKEQISLSELTISLVREHNVFTALNAHPKLINSGPMKSVLSLTSNARYNSRKNY
                     CNYNFFFLVEFLIKLCIDNNIIEECGGSMINHLENHSNTPGITTRSRYAIMIIKNLIN
                     KHLGEQDKIIIDTLTFLNSEDKDLQENDFDLFTTLINELISHSEKNLTVLNNPLFWRA
                     LSRACEYNILIETVSSILDNFVLNEDTDLTDQIMIHLLFIQTIHQSKALTKLLENITK
                     LPQNYSDANVPHLIELLLNNHDEPLRVQVEQCLVALTKECSSSEQPEPSNLVQKYYLP
                     VLSRNITDENVVVSLVNIITTVSNQCTDTNSWNKEELKKIMMPFVNHE"
     gene            <806323..>808878
                     /locus_tag="CAGL0M08074g"
                     /db_xref="GeneID:2891749"
     mRNA            <806323..>808878
                     /locus_tag="CAGL0M08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449697.1"
                     /db_xref="GeneID:2891749"
     CDS             806323..808878
                     /locus_tag="CAGL0M08074g"
                     /note="weakly similar to uniprot|Q05848 Saccharomyces
                     cerevisiae YJR030c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449697.1"
                     /db_xref="GeneID:2891749"
                     /db_xref="GOA:Q6FJ97"
                     /translation="MDIHTLRSRWAYNVQLLKQLQWACTDTAKRSLNGTISNIEASSF
                     ANNLQKCTEALQFCIQKSLTIERTLKNYEIDVPLPVIKDVLLEQELMKYYTVILMEGC
                     KLIFDYSISIFRIGTEPRFMLCLIKLYLNLDSITELLGNEGNQFSDLLNSFEYQFMTQ
                     YNIINCNTIHLDQVRDIFAKSNPLIAPPLLTVNDIEKRGYFFLSSVDLHIDNKLIEIA
                     QLKNGHLAVFYVNSQRQSFSTNGAKQLLKELVEGRMELLNMGRTLLFQTLKQRDMVIF
                     LEFEDSLELVTNNSLTKKLLIQCVDKVSWCTYWKIYLENLFSEEQARTNVKASTSMLN
                     PSHSFQNFKIKHTKLSELRPVSHQGIALNIPQKKSQNCQANITKSDDLEEDPGFKFAI
                     HQSNPINEIYTSQTEELITSPSLNEIEYLSYDKLIALDRSLELTLSPKLLESPREANY
                     KTVSQTFSLDRINNISQNTPEVSDQESIVSNDELEKEPVFNPSVEDHKPQLLRKKSSL
                     LSIFSNKNKSKNKNNLKLEINSQMSSSNLSLNSASSSRTFFSVNSNDSTSTTVSDKYI
                     EDSDRFQLDNTTSILQLKVTKASCWDKSSWQVLSSFPLLLSLVKDHEAVYLTLQNPSN
                     SGRFKFVTRISNIWKTTRSTAKDIQISIPTKDILATILDDLTNTTPRYQVLSLRTEEA
                     ERLKNTIDHCINGDMLSSISNSTTTRTLSSDASSSYMSQVSSNVSRSSTEVSDLNVHD
                     FKSMASVKNILVLSDIKARLHTKNNGRWCPHHIGLVNIYSLETPNNKKGIRFELTTDT
                     RTTFQFNSKIHDLKRLGRTGIAMIDDSEYLFEFPNNVITEQIYRYIAPSHPMI"
     gene            <809185..>809559
                     /locus_tag="CAGL0M08096g"
                     /db_xref="GeneID:2891750"
     mRNA            <809185..>809559
                     /locus_tag="CAGL0M08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449698.1"
                     /db_xref="GeneID:2891750"
     CDS             809185..809559
                     /locus_tag="CAGL0M08096g"
                     /note="weakly similar to uniprot|P29461 Saccharomyces
                     cerevisiae YOR208w PTP2 protein-tyrosine-phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449698.1"
                     /db_xref="GeneID:2891750"
                     /db_xref="GOA:Q6FJ96"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ96"
                     /translation="MQLKNTPLFVTCIEYTHTLPNNTRTPSNLNKYLTTIGKLTLLTN
                     ECIPDADFLSNSVEVHEPSFETVVMMLQLCELPNVSSTDGKFHHTDITPRVGLLPSVR
                     LGRSHHRLRQYRKSFAPIREFH"
     gene            <810184..>811352
                     /locus_tag="CAGL0M08118g"
                     /db_xref="GeneID:2891258"
     mRNA            join(<810184..810492,811107..>811352)
                     /locus_tag="CAGL0M08118g"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_449699.1"
                     /db_xref="GeneID:2891258"
     CDS             join(810184..810492,811107..811352)
                     /locus_tag="CAGL0M08118g"
                     /note="highly similar to uniprot|P46990 Saccharomyces
                     cerevisiae YJL177w RPL17B or uniprot|P05740 Saccharomyces
                     cerevisiae YKL180w RPL17A"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_449699.1"
                     /db_xref="GeneID:2891258"
                     /db_xref="GOA:Q6FJ95"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ95"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKA
                     QKYLDQVLEHQRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFIQGLLQNAAANA
                     EAKGLDATKLYVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKA
                     AEKKLVRLSSRQRGRIASQKRITA"
     gene            complement(<811750..>813732)
                     /locus_tag="CAGL0M08162g"
                     /db_xref="GeneID:2891259"
     mRNA            complement(<811750..>813732)
                     /locus_tag="CAGL0M08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449700.1"
                     /db_xref="GeneID:2891259"
     CDS             complement(811750..813732)
                     /locus_tag="CAGL0M08162g"
                     /inference="similar to AA sequence:UniProtKB:P34237"
                     /note="similar to uniprot|P34237 Saccharomyces cerevisiae
                     YKL179c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449700.1"
                     /db_xref="GeneID:2891259"
                     /db_xref="GOA:Q6FJ94"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ94"
                     /translation="MDGSVYHHAADLWAKADLTNLQKDLDTSILAIKDRESSSLESRK
                     HLASETKVFKKLESDEKLNGINKIIKQYQQEIDSLTKRAKSAEQDLLDFYSKISEAPD
                     PLPLLKNSADNVEKIEDSDKLNGKITELEDKLARCADYDKIKERLSDLEQSSVKTLAK
                     RLAAKEQELNSTWEEKQRNWSEKEKELSKQITILQDNNKALEATIAKKIDIEGGETTS
                     TGTPSSMDFSASTERNLLMQELESSQSRVFQLEKRNEELSGKLAKATSEAEKESDLAA
                     KQQQISQLESENALIMASSERERTNLNNITRELQQKVDNLKTESVSYKNELETLRRKV
                     NTFSDYNEIKSELEALKKIEFGASDDADDEDDQNQESNKVQKSLMNANKKLQATLVEL
                     RTENISQKELNSKLQKEIAQLTDKLGELEEANAKLEIDLQQIEDIDQKFNDTASMVSG
                     ATRQMNNRTSKGRGKLSPTSSIVGIPEEGEYEPMQNTAILPIITKQRDRFRNRATDLE
                     KQLRQLNQDKGKLRQEMQILKAENTKLYEKVRYLTNNQNSSTIGVSSLDTEAQLSHSY
                     DESLNPLSKFKKTERDYYLNRHLSVWEKLFSTFAKIVLQNKSTRLIFLLYCVCLHGLV
                     FMMSMYVINISGYLTPEVNVVQTSASKIGNAVDKNI"
     gene            complement(<814364..>815722)
                     /locus_tag="CAGL0M08184g"
                     /db_xref="GeneID:2891260"
     mRNA            complement(<814364..>815722)
                     /locus_tag="CAGL0M08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449701.1"
                     /db_xref="GeneID:2891260"
     CDS             complement(814364..815722)
                     /locus_tag="CAGL0M08184g"
                     /inference="similar to AA sequence:UniProtKB:P06783"
                     /note="similar to uniprot|P06783 Saccharomyces cerevisiae
                     YKL178c STE3 pheromone a-factor receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449701.1"
                     /db_xref="GeneID:2891260"
                     /db_xref="GOA:Q6FJ93"
                     /db_xref="InterPro:IPR001499"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ93"
                     /translation="MSFESAIIGLCTLGMLALVPPLAWHTKTKNTPAVILIMWLILMD
                     FKCIVNAAIWSGSDFMMKWEGKGWCDIVIKLEVGANVGISCAVTNIIYNLHKILKADN
                     ALLKHNSWRKIAQDLSISLLTPIMVMALSYLVQVFRFGIARCYGCLNILSPTWVTTVV
                     YTMWLLIWSSIGSIYAVLVLIVYYRKRKDVKDILYCTNSGLNITRFARLLIFCFLIIL
                     VMFPFSIYLFVKDLRQVGTKFSFRATHSKEFWGTILKFDVGHKFVNVWIYVLMSYLVF
                     LIFGLGTDALDMYASFMRLIGLGFTLDKFSAKRDEKNNNRFSAFMESIILHQNSDMQQ
                     RYSESLTPTSQDCTFDCEMGNFKDAMFSNKPYHINVKKSYVLNDCVLEKIPQGQYLLS
                     DLYSYDDQITFHQHSANSLGSLGHVYSISYRSEVNSANTNKEIDTEGSSNGSPITRVE
                     SG"
     gene            complement(<816472..>817674)
                     /locus_tag="CAGL0M08206g"
                     /db_xref="GeneID:2891261"
     mRNA            complement(<816472..>817674)
                     /locus_tag="CAGL0M08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449702.1"
                     /db_xref="GeneID:2891261"
     CDS             complement(816472..817674)
                     /locus_tag="CAGL0M08206g"
                     /inference="similar to AA sequence:UniProtKB:P46992"
                     /note="similar to uniprot|P46992 Saccharomyces cerevisiae
                     YJL171c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449702.1"
                     /db_xref="GeneID:2891261"
                     /db_xref="GOA:Q6FJ92"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ92"
                     /translation="MAMIKNVIAATAAALMCGSLVEAEVRGYDMIEFSNVGFTGSYTP
                     VKKMSNLDNNSTCKCEVGDRTWFQGDNAPLNEHLSVHFRGPLSLEKFAFYTSPNFVIN
                     DNSSNSQSWNRSAFYDASAQTADNVTFMNNQGADSPCVGKALSYASDNGTSSASSPNV
                     LKADNYVSSDQEYSIFSTVKCPKSGVKNGCGYYRDGIPAFYGFGGETKMFLFEFKMPT
                     ETQSNSSSFEFYDMPAIWLLNDKIPRTSQYPINANCSCWSSGCGEFDIFEVMNGTERN
                     HLYSTFHTYQGIEDLGTGIQSYGYIPRDTKGTMMGGVIFDSNGNTVSFISNSTSFDQT
                     LSPSAVNSLLRAIPSNETYSTKLMSISGVAPSSSKSKSSGAALSVDQGIWYYVFTAFT
                     AVAHFLLI"
     gene            complement(<818072..>820594)
                     /locus_tag="CAGL0M08228g"
                     /db_xref="GeneID:2891262"
     mRNA            complement(<818072..>820594)
                     /locus_tag="CAGL0M08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449703.1"
                     /db_xref="GeneID:2891262"
     CDS             complement(818072..820594)
                     /locus_tag="CAGL0M08228g"
                     /inference="similar to AA sequence:UniProtKB:P34239"
                     /note="similar to uniprot|P34239 Saccharomyces cerevisiae
                     YKL176c protein required for regulated transport of
                     nitrogen-regulated permeases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449703.1"
                     /db_xref="GeneID:2891262"
                     /db_xref="GOA:Q6FJ91"
                     /translation="MGERFEGLENLNDECKVKLFGCRMRAPGSGTGGHESIEYRLLIL
                     EENAEMVCRQRYRTILDYSSRGHGSMGLKHDEMTNGNVSAPFITASELRQYIYGSPIR
                     SKTRVTEDKFRIIPNSRQLLITRVFYPRRTSMNLHGTFPKNYQSSDRRVSITMCLPSY
                     LLADISDSWADIDGWLTQTERHLMATSFHVVETQDNFVTLVNKLLIPALRSCHEIPRL
                     FLYPQDNIDFIHTWFKDVFNWIELKEGTKLSFLPFLIAKTLIEYRDDPQESECHRIVI
                     TSGNLVIANKLVFILGGLLKPRYDGEMKIMITPVSTPTPSNHLMPPSMNGSNESSYHS
                     SSNSHTPSKLKIPATINEHRPSRPRYSSTENIHVQSRTMDIPIVKSDQSPFSTSRGWK
                     IPSSYRSATSSVSISSDESLAEVIQPSSLKSTTSIPFQNFSSSLSNQLYSSSYGSWFN
                     GSITGSFTNSNPLSNGTSNMATFSSSFKKNNISSIFQSNSPTAGTDSWERPENNTGLN
                     PNITLQRTASNSSLRHMLTPYQQQLISPSTNSEYDEYPWFGATNNAGGATVGTSSETV
                     GSQQPVLLQGAHMDTTTLLDSIRTSNNNGAYTFPLKNVGFDRDCSSLDHHKLLTSCFE
                     EIFEGDIDANKVTTMVPCSDIAVHIHSKQEDSEGVTSHPRVVIDVDIPGTTISKYPEE
                     LLPRYTMYLSHFNPFFKLQAIPATNEIENKIVHGLKRDFISEKCDVSKTLFISMRSRS
                     IKEIVVRKTTSINTPSNSSNQDPRNKSKGSMLKQKIKKVFSNGTCTGRVTPVLNNCVA
                     FVEAALMSAMSLYSDPTIDKKYRDERILKIFLAVAHYNVDEV"
     gene            <821047..>822765
                     /locus_tag="CAGL0M08250g"
                     /db_xref="GeneID:2891263"
     mRNA            <821047..>822765
                     /locus_tag="CAGL0M08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449704.1"
                     /db_xref="GeneID:2891263"
     CDS             821047..822765
                     /locus_tag="CAGL0M08250g"
                     /inference="similar to AA sequence:UniProtKB:P34240"
                     /note="similar to uniprot|P34240 Saccharomyces cerevisiae
                     YKL175w vacuolar membrane protein involved in the
                     regulation of zinc storage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449704.1"
                     /db_xref="GeneID:2891263"
                     /db_xref="GOA:Q6FJ90"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ90"
                     /translation="MIARWLLFSLISSLLCILGALFVPIISRYSSKSHENNNTKLVNY
                     GLSLSAGSMMTTALYKMLPAMDPDNRFTVFFGFTFGILISFFLNYVVHAFTSESLIHC
                     AHGDDHSHSHGDHDRAHDHDHDHNDSHEYGHGHEHSHEHGNNNNHVHLDDNEADDDLY
                     DPLSRHRSVETEHSALLPHGKEGVRRRLSLLDLFSKKHRDIGPCCDSIVKSCGVLSVP
                     ADKLTCVPLNQRGKCLNEQCHNYMQEVDQRPNHVSSQTDSSYSPNHSNSSSYESQDDA
                     EHKHEHTSGVVCLENNIGYDLENLDTYRNNYMLGRRNTIEYQPSAKVSTNAGSTSVRS
                     QAISRPSLKGINSAPHYSENAQATKASNHDGHGHDDGHEHFHHHDEEALYSHHHHLET
                     PFSKLLSIGLQTCLVLTLHKFPEGLIIFYTNQSDETKSLGLSIFISLLIHNFVEGFAM
                     TLPFYTAFESKWKAILITTILGGGSQPFGAVLGYFIFKSSGGDHKHSDGAPPIMGLLL
                     SITAGFLVVISVQMFQTGVSFSDSHHHHSDDNEEEIAQNHTMGTTCLKWCCAGICLIL
                     LSGIFV"
     gene            complement(<823019..>824884)
                     /locus_tag="CAGL0M08272g"
                     /db_xref="GeneID:2891264"
     mRNA            complement(<823019..>824884)
                     /locus_tag="CAGL0M08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449705.1"
                     /db_xref="GeneID:2891264"
     CDS             complement(823019..824884)
                     /locus_tag="CAGL0M08272g"
                     /note="highly similar to uniprot|P36029 Saccharomyces
                     cerevisiae YKL174c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449705.1"
                     /db_xref="GeneID:2891264"
                     /db_xref="GOA:Q6FJ89"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ89"
                     /translation="MIQEYTLIPENIRENIRENMPNLDPHEIFENLHHYVQEDEVTDE
                     PEEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFF
                     ISGILIWFSSLSLGEIVSKFPMELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTS
                     ITFAGAQLTISLILMANNELISETHLILFTVIVFYMVVTLVGLVNLKFARFIEIINKV
                     CVYWIIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFT
                     LQGFSMLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLILPDIETIFSNHK
                     VLPIVTIFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDL
                     WTFVPPDSQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLV
                     LVLCTGRRSIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAIV
                     VYVLCLIGITILYFKWGKYNFRLPLSDDAKNNPFSLEAQFPTTKEDNEYEHSGSNAKT
                     ANLPEGQASPVENPFIGEHENSQTDIDFDVVSVDLQDAIEERDTRLEGQTRNDTN"
     gene            <825250..>828219
                     /locus_tag="CAGL0M08294g"
                     /db_xref="GeneID:2891265"
     mRNA            <825250..>828219
                     /locus_tag="CAGL0M08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449706.1"
                     /db_xref="GeneID:2891265"
     CDS             825250..828219
                     /locus_tag="CAGL0M08294g"
                     /inference="similar to AA sequence:UniProtKB:P36048"
                     /note="similar to uniprot|P36048 Saccharomyces cerevisiae
                     YKL173w U5 snRNP-specific protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449706.1"
                     /db_xref="GeneID:2891265"
                     /db_xref="GOA:Q6FJ88"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ88"
                     /translation="MDFDEFGNPIGDELELGEEIEVKKEETESIGTNGEGSNHSDNEI
                     NEEDDDYMSDLDADFDDENLALESLRHTYGDQVEVLMEYEDRDANEPIVESGDTGESH
                     SKEGVFIRLKKNIPRAQFDREYMMQMMKVPERIRTVCILGPLHSGKTSIADIFVLNNY
                     DRLNCITKNIRLGWKQLRYMDNTRQEIERGMTLKLNGMTFLATDMQDKSHVINLLDTP
                     GHVDFIDEVAVAMSVSDTALVCIDIIEGISSTTRYIIKECQKRGLSMVFLINKIDRLV
                     LELMLPPTEAYMKLQELVLNIQGATKDSMFTPENNNILFASAKFGIIFSIEQFVSKCY
                     GKVLAGPKLNEFVKRVWRNNYYDRGVFHPRTLNDKNHEATFVTFILNPIYKIFTHTLS
                     REVDVVSKTLKKNFGVSLTEDEMANDPQPLLKVVFTKIFPDQKALISSLTSCSGSGNY
                     YQKQVNLLENGVQNTSSRQFLAHAVKNMSIGDSEWTLVKVYHGNIAVGDKISVIVPVS
                     NISDSGVKFIDEEMLEEGSQHVIEAISLLGGRFCYPVPSASEGQLVLLKGISKSFVKS
                     ATLCSNNIESAGLPLFQAINYIGRPVFKVIIAPLNPKELPKLLSGLEKTNRYYPGLHV
                     KVEESGEHVLLGNGELYFDCLMHDLRNVYGGIEVKISDPVTVFAESCQGESFAAIPVE
                     SSNHNISLTVCAEPLDKKIVQDISKKKLDVELLGDKKGLREMAKVLRRDYGWDSLAAR
                     NIWAFFHTSILVDDTLPDETDKNLLQHFREQVLQGFYWAVREGPLMEEAIHGVKFRIL
                     KFEMSGRVNLDSLDVGIIGVQLIPLMRKACNVALLTAKPIVVEPIYEMDIIMKKVYYP
                     VLEEVLKKRRSAYIYATETIPGTPLIEVKTQVPVIESFGLETDIRLSSEGNAIIQSHQ
                     WNDIWRKVPGDVMDEDAPIPKLKPAPTSSLSRDFVMKTRRRKGISNDGFMSNDGPTLQ
                     KYIDKELFSQLKEAGFV"
     gene            <829069..>831963
                     /locus_tag="CAGL0M08316g"
                     /db_xref="GeneID:2891266"
     mRNA            <829069..>831963
                     /locus_tag="CAGL0M08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449707.1"
                     /db_xref="GeneID:2891266"
     CDS             829069..831963
                     /locus_tag="CAGL0M08316g"
                     /note="weakly similar to uniprot|P36003 Saccharomyces
                     cerevisiae YKL171w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449707.1"
                     /db_xref="GeneID:2891266"
                     /db_xref="GOA:Q6FJ87"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016241"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ87"
                     /translation="MYGQRRVRSERYSSDISSGKDEEIKVSRSKGIDCPPRRRESSTN
                     EDSLYFQPTKIYKLEKELASRSTLVKSDKDSTDEERDSDEIVSNRFNEADSVRHFGRY
                     TDENYQYRHINGLVPDYYEGMRKNKLGLVSDLTNESRNNYIFEQNANFEMEFPIDESA
                     LGGNETRGMHDEYIPNLNYGQLIENWVDEEKQVQTMEDLQREDSMLQGQLMKEASMIL
                     SNKVRSPTQERSQTPRLATWVNDYDSEPRIMTNRSSSVIPEALSDDDIREDSLSPNTS
                     AIFSNSHAQVEPIPLPSKNSSRMPTSTLEDRRSYMNFLGKPASTFGAIDSMGMSALKN
                     VNSFLPIHKSSLPSTIPVRKGSSGQSTANSDSSSLNLQHNLSSSVGDLKLDSDQMMDL
                     IRKLPKDFLTLPYSQRKKQIIKLAPDKDSRLIMSLLKKVMITNSKSASSIQKPSMRSR
                     HGSLASQFLSSFSPSVASMASSGGFRPDDKGLFIMGHKLGKVIGFGAWGMIRECVDIQ
                     SGAQRAMKIVRFKDNQKVKRNVIREVNVWKEMHHMYILPLLDWKLISDYAMYCLTERV
                     KDGTLYDLVLSWEDRKNNQIPVDERIKLTMFLMLQLISALKYMHSNSTVHGDIKLENC
                     LLKKGRQHKNWTIFLCDFGMSCRFGSYRSRYDTLIDEEKNNSGIIREESYMPLSFEAS
                     PKPIYREVSQLNSQHSQLSSQLTPQLQLQSNSASFSQPQQFLAVQQLPQPEPSLPHVH
                     SDSNSTSQPPSKFMKIVTDRNVIHDDTPFEILTARQASRRSFESHNSKKSQKMSTVSV
                     ESLPSSPSATPLDNVNAFDPCSLDAQRHFSLSVENSNTKTPSSLIGSLPYAAPELLVP
                     EPSPLGPGADIWALGVTMYTMLMGKLPFKHDLESKLKQLIASGKFDKKSLKCMCNGGH
                     SNLSDEALKYQGLYDAILGCLTINLLDRWGLHDVETALREELKKNGELSQ"
     gene            <832444..>832860
                     /locus_tag="CAGL0M08338g"
                     /db_xref="GeneID:2891267"
     mRNA            <832444..>832860
                     /locus_tag="CAGL0M08338g"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_449708.1"
                     /db_xref="GeneID:2891267"
     CDS             832444..832860
                     /locus_tag="CAGL0M08338g"
                     /note="highly similar to uniprot|P35996 Saccharomyces
                     cerevisiae YKL170w MRPL38"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_449708.1"
                     /db_xref="GeneID:2891267"
                     /db_xref="GOA:Q6FJ86"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ86"
                     /translation="MIYLKSIIKVIDNSGAQLAECIKVIGKGSPKSPGRVGDRIVCVI
                     QKARPLTQNITGTATTNRVKKGDICHAIVVRTKQTNEYRRDGSMISFGDNACVLINKN
                     TGEPLGTRIMANDGVVDRTLKDKGFNKICSLASKAL"
     gene            complement(<833220..>835520)
                     /locus_tag="CAGL0M08360g"
                     /db_xref="GeneID:2891268"
     mRNA            complement(<833220..>835520)
                     /locus_tag="CAGL0M08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449709.1"
                     /db_xref="GeneID:2891268"
     CDS             complement(833220..835520)
                     /locus_tag="CAGL0M08360g"
                     /note="some similarities with uniprot|P38970 Saccharomyces
                     cerevisiae YJL165c ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449709.1"
                     /db_xref="GeneID:2891268"
                     /db_xref="GOA:Q6FJ85"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /translation="MPEHEERHSHGVNRSLSLGSSMRSLFKSQRSRGPSDRGANGTPG
                     PAQKVDIRVDTASASREHTPVVHKTPQSANPELQQPRHHLGLPNILKLNLTPTNSNPQ
                     SKSGSPVSQNTSQESLITDTDIEVEDYRPSKDSRRTVRNASPMSSNGNLPINANTVIG
                     PDTSSNNIDSMLDGTGLRPFYEEADSSDYIENLRSFPLPTGHYAPGFIQPPKSPTSSR
                     VPSRSNSRKGREHAGTVSAAQLPRYNETPGKCILDLEYFKLYEDGHHVHTLKVMTSVN
                     SDANGNSHNHASKNDGHLDLPKGDDGSVVRQKSKFSLSGFFKPHSKEDIANADEKLKY
                     AVSLLPRNKICSKVETDRDTFAPVFTKTRSHVQSGSDDSSDDDEELDDPSIPKIVNKN
                     AAVGSQELKLINNLSEKIRMGLSTAAKNKHNQSSKHRTPSGAGVQDENQPAFADLYGK
                     CVAVVGHGAYGVVKVCARTRDEKDDLPATKTYMDSKKIYFAVKELKPRPSDPIEKFST
                     RITSEFIIGHSLSHYYDKNGEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTA
                     RKNKIGKPLHPLEADCFMKQLLKGIQFMHDHGVAHCDLKPENILLHPNGLLKICDFGT
                     SCVFQTAWERHVHFQTGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHY
                     LWRNAARGKDSLYDSFYEEMASKKEFYVFEELRHINQEINRLRRIALYQIFQPNPEKR
                     ISIDKLLQTGWMRHTKCCVPYKNIPR"
     gene            complement(<835962..>836369)
                     /locus_tag="CAGL0M08382g"
                     /db_xref="GeneID:2891269"
     mRNA            complement(<835962..>836369)
                     /locus_tag="CAGL0M08382g"
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /transcript_id="XM_449710.1"
                     /db_xref="GeneID:2891269"
     CDS             complement(835962..836369)
                     /locus_tag="CAGL0M08382g"
                     /inference="similar to AA sequence:UniProtKB:P32388"
                     /note="similar to uniprot|P32388 Saccharomyces cerevisiae
                     YKL167c MRP49"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRP49"
                     /protein_id="XP_449710.1"
                     /db_xref="GeneID:2891269"
                     /db_xref="InterPro:IPR007741"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ84"
                     /translation="MSKVARQLKFLNKISSTTTDAQVILSPGKYQRLSLTFQTKNHNG
                     HMGARKFWKDYLPTIQFYNPQLRIDVTRIKNESKTVSVPCTLQAIGTDGKVVEEIDMS
                     NKHAPEILQSLLQKLDHERVPESQIISVGTQSA"
     gene            complement(<836791..>838179)
                     /locus_tag="CAGL0M08404g"
                     /db_xref="GeneID:2891270"
     mRNA            complement(<836791..>838179)
                     /locus_tag="CAGL0M08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449711.1"
                     /db_xref="GeneID:2891270"
     CDS             complement(836791..838179)
                     /locus_tag="CAGL0M08404g"
                     /note="some similarities with uniprot|P05986 Saccharomyces
                     cerevisiae YKL166c TPK3 or uniprot|P06244 Saccharomyces
                     cerevisiae YJL164c SRA3 or uniprot|P06245 Saccharomyces
                     cerevisiae YPL203w TPK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449711.1"
                     /db_xref="GeneID:2891270"
                     /db_xref="GOA:Q6FJ83"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ83"
                     /translation="MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQL
                     ENHIDKATESQMSKELVVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQS
                     NEQQTESNHEQQQQQRLQQTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGT
                     GSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGT
                     FQDSQHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDL
                     KPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFG
                     ILIYEMLAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRDLSKRLGN
                     LQNGSEDVKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQ
                     GEDPYADLFREF"
     gene            complement(<838957..>840594)
                     /locus_tag="CAGL0M08426g"
                     /db_xref="GeneID:2891271"
     mRNA            complement(<838957..>840594)
                     /locus_tag="CAGL0M08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449712.1"
                     /db_xref="GeneID:2891271"
     CDS             complement(838957..840594)
                     /locus_tag="CAGL0M08426g"
                     /inference="similar to AA sequence:UniProtKB:P46996"
                     /note="similar to uniprot|P46996 Saccharomyces cerevisiae
                     YJL163c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449712.1"
                     /db_xref="GeneID:2891271"
                     /db_xref="GOA:Q6FJ82"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ82"
                     /translation="MQLGASHSDEEIDESHYTNREGTVEAALLESFFDESHPMPVSAE
                     LKRIQENQARHIHLPWYQKPSTFLICLLIMLIALAETLYMTPIIIITKDKVCESISNG
                     QIKGEETICDPIKVQTILSEISSMTIIISGVISTFMAGKMGELSDRFGRVHVFIYIGL
                     IRLLGNAAHVYALWPSTTYYKWFIILAGSLNSFSGGMYAIIANANSYLSDIVEPENRS
                     VSFGKVTSALFATMGVGFLLASNIVTLFHGNNFAPIYFAISCSSLFILLCLFFIKETR
                     HEDSLRDSQEAFGRRMDKHFERLMADIESAERPGLAGKIYLYGHYYTNQALHLLSPLK
                     TLWIPRDSNGSLRGRHTVILLLVIDIAYVCSTTACMPPLILLTTYKYNWQTVEIGYFV
                     SFSGISKAVVLLLLSPYIVAWLKKIYTACTDKVDNIDMICIRISMVAIVFGISAIIFK
                     TESESSVIGFALFQAFSAFLSPTIQSTVIKYCPKDRTGQCFGGMALVRSLTMLVFPPL
                     LLKIYGATVAGSPEVFLWIPMIASIISVVLSLMIKTH"
     gene            complement(<841439..>844204)
                     /locus_tag="CAGL0M08448g"
                     /db_xref="GeneID:2891272"
     mRNA            complement(<841439..>844204)
                     /locus_tag="CAGL0M08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449713.1"
                     /db_xref="GeneID:2891272"
     CDS             complement(841439..844204)
                     /locus_tag="CAGL0M08448g"
                     /note="highly similar to uniprot|P36051 Saccharomyces
                     cerevisiae YKL165c sporulation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449713.1"
                     /db_xref="GeneID:2891272"
                     /db_xref="GOA:Q6FJ81"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR007070"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR017852"
                     /translation="MKNNTRFTLIVVGVLFHLLYLWSIFDIYFISPLVHGMEQKISTN
                     NPPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILPMFKDGAS
                     DPNKVDAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQDGNAFFL
                     HLLGCDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADHGMSA
                     FGSHGDGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKRNDVKQADIAA
                     LMSYLIGTNYPANSVGELPLAYIEGSEGQKLEALLNNAESILEQYRVKENEVINSQFV
                     YKIYPKFAEKSPTEYLKEIKELIKKIENGEESLEPEAIRLTEELMKVTLEGLHYLTTY
                     NWRFIRTIVTFGFLGWICYSFMIFLKLFILNNSQTTHPSILNISIFTSLGLILNYILF
                     YQKSPLNFYLYLIFPLFFWSKIFSNTAIIRDGVNEFFKGISKAESVIIGLTIISIYEG
                     IVYGFFHRWILSLILVSFAFYPLVCGVTDLFTNLLWILTSVGLSSFTLLDAVKIENLQ
                     QIQVAGILIVLSSAYAVMRLSQDISKYTQHLLSIQIFLVSGMLHFTSKSVISLQKREG
                     LPAFAQVGGWAILVISLTIMPFLHYLKPNNNYQVRLLTIYLTFAPSFIILSISFEALF
                     YFIFTAYIVQWLQIEKNIKVLKDEQKSDSNGIQLLRVAIIGFFLQQIAFFGTGNVASI
                     SSFSLDSVYRLLPVFDPFPMGALLMLKLIIPYVLLSCGLGIMNIQLDIKDYTISSLII
                     STSDILSLNFFYLLKTEGSWLDIGVTISNYCLAILSSLFMLILEIVGHQLLKNVTRAT
                     SSQKKTN"
     gene            complement(845650..845721)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0M08470r"
                     /db_xref="GeneID:2891273"
     tRNA            complement(845650..845721)
                     /gene="tRNA-Glu (TTC)"
                     /locus_tag="CAGL0M08470r"
                     /product="tRNA-Glu"
                     /db_xref="GeneID:2891273"
     gene            <848089..>849096
                     /locus_tag="CAGL0M08492g"
                     /db_xref="GeneID:2891274"
     mRNA            <848089..>849096
                     /locus_tag="CAGL0M08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449714.1"
                     /db_xref="GeneID:2891274"
     CDS             848089..849096
                     /locus_tag="CAGL0M08492g"
                     /note="highly similar to uniprot|Q03178 Saccharomyces
                     cerevisiae YKL164c PIR1 or uniprot|Q03180 Saccharomyces
                     cerevisiae YKL163w PIR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449714.1"
                     /db_xref="GeneID:2891274"
                     /db_xref="GOA:Q6FJ80"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ80"
                     /translation="MQYKKSLAATALLASSGLAAYVPGNPWSTLTPSGTYKGGLTDYS
                     STFGIAVQPIATSSSVAKRAVSQIGDGQVQAATKTQAAPVSQIGDGQIQATTKTQAAP
                     VSQIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPV
                     SQIGDGQIQATTKTQAAPVSQIGDGQIQATTKTTQAASQIGDGQVQAATKTASAASQI
                     ADGQVQQNKDPKDPVGAVSCKVDGTLQMNLKGGILTDEKGRIGSIVANRQFQFDGPPP
                     QAGAIYAAGWSLTPQGNLALGDSDVFYQCLSGNFYNLYDQSIGAQCHPVHLSAIDLVK
                     C"
     gene            complement(<849926..>850558)
                     /locus_tag="CAGL0M08514g"
                     /db_xref="GeneID:2891275"
     mRNA            complement(<849926..>850558)
                     /locus_tag="CAGL0M08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449715.1"
                     /db_xref="GeneID:2891275"
     CDS             complement(849926..850558)
                     /locus_tag="CAGL0M08514g"
                     /inference="similar to AA sequence:UniProtKB:P47001"
                     /note="similar to uniprot|P47001 Saccharomyces cerevisiae
                     YJL158c or uniprot|Q03178 Saccharomyces cerevisiae YKL164c
                     PIR1 or uniprot|Q03180 Saccharomyces cerevisiae YKL163w
                     PIR3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449715.1"
                     /db_xref="GeneID:2891275"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ79"
                     /translation="MQFNKISLLAMASAASAATTSPTTTETKPTTTKFFTPGDNFSTF
                     APNATFSGAAVNFTSTFGIAVQSIDSKSVVSKSLVSTSTTSTLAPSSSTSSAASSTTS
                     SPNITIVNKSCKADGTLVMELENGILRDGKGRIGSIVSNRQFQFDGPPPQAGAIYAAG
                     WSVTPEGNLALGDSDVFYQCSSGNFYNLYDEYIAEQCHPIHLEVLSLVDC"
     gene            complement(<852150..>853376)
                     /locus_tag="CAGL0M08536g"
                     /db_xref="GeneID:2891276"
     mRNA            complement(<852150..>853376)
                     /locus_tag="CAGL0M08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449716.1"
                     /db_xref="GeneID:2891276"
     CDS             complement(852150..853376)
                     /locus_tag="CAGL0M08536g"
                     /note="weakly similar to uniprot|P36052 Saccharomyces
                     cerevisiae YKL162c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449716.1"
                     /db_xref="GeneID:2891276"
                     /db_xref="GOA:Q6FJ78"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ78"
                     /translation="MSRCLSKSLRDYLAWVNLPVARSNFFITYDYRLRHQRQQNALTA
                     DLLRSVATCLAKYLLVDYKLNEYPYYDLTVVNVFSNYRQSMEILSAAMRYLEPVVDRQ
                     LLSRVKVYMMPLYPSPQHPGETRQVSENVWVLGDDQAVFGTPATLQDMRLADLLPLEY
                     STASSIAEEDPVHVVMFDDVLQNLAPDLVRVRPDCGNVNTSAGAGGSASGSASAGEWE
                     QCFVNTSDMSRTYLGQGMGMDPLCELAVQLCLPPAENVACGTEVYVPSQAALLFSHLK
                     RRFPEHKLFAVDSFEVTHETMYFRWKSWLAAIMGFGTRGITGTGTGSASAPYGIESSS
                     LVLGYTSGTGTSTSYSHRALKLVPNAHQCQLLYTGINDGRKACTVEPLDTFIDKWRGS
                     DLPAPEAGPFSVMYQE"
     gene            <854646..>854813
                     /locus_tag="CAGL0M08552g"
                     /db_xref="GeneID:9488059"
     mRNA            <854646..>854813
                     /locus_tag="CAGL0M08552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999557.1"
                     /db_xref="GeneID:9488059"
     CDS             854646..854813
                     /locus_tag="CAGL0M08552g"
                     /note="highly similar to uniprot|P87284 Saccharomyces
                     cerevisiae YDR276c PMP3 plasma membrane proteolipid 3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999603.1"
                     /db_xref="GeneID:9488059"
                     /db_xref="GOA:B4UN60"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:B4UN60"
                     /translation="MDSTKIVNIFLAIFLPPVAVFSARGFGTECILSIILTICAWFPG
                     MLYALYVVLTD"
     gene            complement(<855046..>855342)
                     /locus_tag="CAGL0M08558g"
                     /db_xref="GeneID:2891277"
     mRNA            complement(<855046..>855342)
                     /locus_tag="CAGL0M08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449717.1"
                     /db_xref="GeneID:2891277"
     CDS             complement(855046..855342)
                     /locus_tag="CAGL0M08558g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449717.1"
                     /db_xref="GeneID:2891277"
                     /db_xref="GOA:Q6FJ77"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ77"
                     /translation="MFISFFSLNCGYMTQTLYTRIHTISTHIKKYHGIADTRSSRAIT
                     GACLQDVPAGVQCAHLAAVGTNPTTRCDRYRTVRSPAHRLLYPTHSILPEDIRL"
     gene            complement(<855443..>856036)
                     /locus_tag="CAGL0M08580g"
                     /db_xref="GeneID:2891278"
     mRNA            complement(<855443..>856036)
                     /locus_tag="CAGL0M08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449718.1"
                     /db_xref="GeneID:2891278"
     CDS             complement(855443..856036)
                     /locus_tag="CAGL0M08580g"
                     /note="some similarities with uniprot|Q05610 Saccharomyces
                     cerevisiae YDR273w DON1 and some similarities with
                     uniprot|Q08412 Saccharomyces cerevisiae YOR042w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449718.1"
                     /db_xref="GeneID:2891278"
                     /db_xref="GOA:Q6FJ76"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ76"
                     /translation="MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKL
                     IIRAILLAARGDLAPAFNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDML
                     EQLSQLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDIT
                     DKGLISDTKSEEANISVVEPQVENGKSVNPFELLQDE"
     gene            complement(<856349..>859387)
                     /locus_tag="CAGL0M08602g"
                     /db_xref="GeneID:2891279"
     mRNA            complement(<856349..>859387)
                     /locus_tag="CAGL0M08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449719.1"
                     /db_xref="GeneID:2891279"
     CDS             complement(856349..859387)
                     /locus_tag="CAGL0M08602g"
                     /inference="similar to AA sequence:UniProtKB:P38995"
                     /note="similar to uniprot|P38995 Saccharomyces cerevisiae
                     YDR270w CCC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449719.1"
                     /db_xref="GeneID:2891279"
                     /db_xref="GOA:Q6FJ75"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006122"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ75"
                     /translation="MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKV
                     VSEDSVATDGIIEAVEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLE
                     AIEGVSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAK
                     YVDLRLLGFNSKDDNELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIR
                     KIIDILESLGINAVVDVSFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGL
                     PALFPSLMKDKIFPYSSVGAVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYA
                     GTMDTLVCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLEN
                     KAKSKTSTALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDG
                     IVTKGISEVDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIK
                     VMKNAQLKKASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETS
                     ESRFYMCLQIATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVN
                     TFVFDKTGTLTTGHMTVQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDL
                     LGESFEGTSMIIEDEQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQMYGR
                     AGPCTVTYLAIDDKVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVA
                     EMVDIPPNNVYSEVTPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSG
                     TEVAIEAAGIVILNDPDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPIA
                     MGILVPWGITLHPMVAGLAMAFSSVSVVVNSLMLKWWKAPELTSKNSHSSKGYGYYTK
                     GTEQLNRLLGSASTGMSDDTEIEIQDLELQPTSLSSQRTL"
     gene            complement(<859796..>860809)
                     /locus_tag="CAGL0M08624g"
                     /db_xref="GeneID:2891281"
     mRNA            complement(<859796..>860809)
                     /locus_tag="CAGL0M08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449720.1"
                     /db_xref="GeneID:2891281"
     CDS             complement(859796..860809)
                     /locus_tag="CAGL0M08624g"
                     /note="highly similar to uniprot|P04803 Saccharomyces
                     cerevisiae YDR268w MSW1 tryptophanyl-tRNA synthetase
                     mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449720.1"
                     /db_xref="GeneID:2891281"
                     /db_xref="GOA:Q6FJ74"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ74"
                     /translation="MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAIT
                     IPKPDAAQFKQLRREAIASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLN
                     RMTQWKSKSNLREDKDATAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHL
                     ELTRTLAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDP
                     PETIIRKIKKARTDSITDKFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNY
                     RDLKAHVSEVIIEELRVPREKFHQYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTM
                     GFI"
     gene            <861488..>862501
                     /locus_tag="CAGL0M08646g"
                     /db_xref="GeneID:2891282"
     mRNA            <861488..>862501
                     /locus_tag="CAGL0M08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449721.1"
                     /db_xref="GeneID:2891282"
     CDS             861488..862501
                     /locus_tag="CAGL0M08646g"
                     /inference="similar to AA sequence:UniProtKB:Q05583"
                     /note="similar to uniprot|Q05583 Saccharomyces cerevisiae
                     YDR267c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449721.1"
                     /db_xref="GeneID:2891282"
                     /db_xref="GOA:Q6FJ73"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028608"
                     /translation="MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKN
                     GKENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEME
                     LLAIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDV
                     KHVVWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRL
                     CSGSDDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGV
                     LAVYKEKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWN
                     YQD"
     gene            <862981..>864954
                     /locus_tag="CAGL0M08668g"
                     /db_xref="GeneID:2891283"
     mRNA            <862981..>864954
                     /locus_tag="CAGL0M08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449722.1"
                     /db_xref="GeneID:2891283"
     CDS             862981..864954
                     /locus_tag="CAGL0M08668g"
                     /inference="similar to AA sequence:UniProtKB:Q05580"
                     /note="similar to uniprot|Q05580 Saccharomyces cerevisiae
                     YDR266c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449722.1"
                     /db_xref="GeneID:2891283"
                     /db_xref="GOA:Q6FJ72"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ72"
                     /translation="MSSEQQQNGSKPKNRNFRRTQTGGRSNGESGNGRKAKKITGNPD
                     FLQKEIKSGKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSF
                     RQRALYEKKSCLICRTENDRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATL
                     DLLKYACPLCPDNEQHVSTTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQ
                     LKNHHSRGDSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYF
                     KDYEQLFEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSE
                     LSTFISAPSQVIRERDSYNYDMGSVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGF
                     QKFETLNENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDV
                     IYQEYEQTEKRKNALPSLLDDHIQTVPGGAWGSSTGRSKSHSSIKNLNQLPSLGGVSS
                     SFDPFKNPNKAPVYKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAAT
                     PSWGSQPSSNSSSKNKLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQKGEPAPQL
                     TEEQQLLESLNLNGNSKSKKKGKQKQLLFHIGV"
     gene            complement(<865182..>866168)
                     /locus_tag="CAGL0M08690g"
                     /db_xref="GeneID:2891284"
     mRNA            complement(<865182..>866168)
                     /locus_tag="CAGL0M08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449723.1"
                     /db_xref="GeneID:2891284"
     CDS             complement(865182..866168)
                     /locus_tag="CAGL0M08690g"
                     /inference="similar to AA sequence:UniProtKB:Q05568"
                     /note="similar to uniprot|Q05568 Saccharomyces cerevisiae
                     YDR265w peroxisomal assembly protein - peroxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449723.1"
                     /db_xref="GeneID:2891284"
                     /db_xref="GOA:Q6FJ71"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR025654"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ71"
                     /translation="MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVR
                     GQLFINNYQKEISVVVKLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLF
                     VLSYTSIPYLVTKLSKKVNNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYY
                     DVFKRFWGMRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSIL
                     PQTKETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRN
                     CILCLMEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQVLALRA"
     gene            <866454..>868745
                     /locus_tag="CAGL0M08712g"
                     /db_xref="GeneID:2891285"
     mRNA            <866454..>868745
                     /locus_tag="CAGL0M08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449724.1"
                     /db_xref="GeneID:2891285"
     CDS             866454..868745
                     /locus_tag="CAGL0M08712g"
                     /inference="similar to AA sequence:UniProtKB:P39010"
                     /note="similar to uniprot|P39010 Saccharomyces cerevisiae
                     YDR264c ankyrin repeat-containing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449724.1"
                     /db_xref="GeneID:2891285"
                     /db_xref="GOA:Q6FJ70"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /translation="MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSV
                     GVDGENGNEDDDPILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAI
                     NNRLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQG
                     FNLLHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALI
                     KFNASVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSN
                     THSFQEALRHNNFDKNGYPINKLVKRDDHAKIITFLIPLLVLGFAFFGFSHLHILFAL
                     PVIILLLLASNKFIKSFLLPSYETKGTNSASLLKSPLIAGILFGSIFWLAFVWILRIL
                     PYTFTKRPLGNLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKF
                     DTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALEL
                     GIFSFVKVCLKYFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLV
                     IVQLFQITKGLTNSELNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPV
                     RNNTNERISTTFSGNLPKPRTCMGMICAVTGLHQCVAIIKDTFGIARHGSSRSTNTRS
                     LLSSISTDYGWRRNWCDFWLLSDTNTPLWKRIFFSPPSTKALLNGKEADYATLYEVPN
                     KNHGSVSQLQELQDPLSEIDDMV"
     gene            complement(<869007..>869768)
                     /locus_tag="CAGL0M08734g"
                     /db_xref="GeneID:2891286"
     mRNA            complement(<869007..>869768)
                     /locus_tag="CAGL0M08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449725.1"
                     /db_xref="GeneID:2891286"
     CDS             complement(869007..869768)
                     /locus_tag="CAGL0M08734g"
                     /inference="similar to AA sequence:UniProtKB:Q12331"
                     /note="similar to uniprot|Q12331 Saccharomyces cerevisiae
                     YDR262w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449725.1"
                     /db_xref="GeneID:2891286"
                     /db_xref="GOA:Q6FJ69"
                     /db_xref="InterPro:IPR000782"
                     /translation="MVALKYVLVPVALVAAKNIVEMITFRDENGKLHRRLAPEEYRGG
                     VLDGEESRLLQKRDLEMHPPVDLGVYFSNRPIHRTIDVPDIYLDSQISVLTELDIFAS
                     YSRNDEKSYDMFRDPESDLIVIAPTNAAITALAKKPWQFPMDIDTMEQAGSSERDIDN
                     AIHNNIVNFVRSHVVAYQKDTKTSKDGTVLLQSKQYSMQHSNGKGGDVLLKREGEKYC
                     VASVVDEVFHDVQNIYSTKNGVILVIDATLSRPGA"
     gene            <870824..>872533
                     /locus_tag="CAGL0M08756g"
                     /db_xref="GeneID:2891287"
     mRNA            <870824..>872533
                     /locus_tag="CAGL0M08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449726.1"
                     /db_xref="GeneID:2891287"
     CDS             870824..872533
                     /locus_tag="CAGL0M08756g"
                     /inference="similar to AA sequence:UniProtKB:P52911"
                     /note="similar to uniprot|P52911 Saccharomyces cerevisiae
                     YDR261c exo-beta-1 3-glucanase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449726.1"
                     /db_xref="GeneID:2891287"
                     /db_xref="GOA:Q6FJ68"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ68"
                     /translation="MLHLFVVIFLALGVLGYDNSGLTTDELQSLQKRFQDYYNDGEVQ
                     VKGITIGGWLVTEPYITPSLYETAFTHVNKTLNGTNSTTFQNSTFGNYSIVDEYTLCK
                     ELGYQNALTLLKDHYETFITEDDFAQIKENGFNLVRLPIGYWAWKKNSNDTSRYNYVG
                     NISYDDPYVSEGLQLQYLLKAIDWASKYELNVWIDLHGAPGSQNGFDNSGQRILYDDL
                     GWLHADKTKPLTLAIWKDMFEKFVRTNNYNGYNTSSVVGLEIMNEPLGPKIGMRNIAQ
                     SYYEAFDMFKTAEAENNNPQNDNLTFVIHDAFQSIGYWNLHLNPDYRNVSNQYYNLTN
                     VTYNSQSVLVDHHHYEVFTDFQLKNNQYNRIMDIINYGDSISKELDFHPAVVGEWSGA
                     ITDCARWVNGIGIGARYDGSYYKTTAFQSDSPPNGTCISQNDISTWSESYKTRVRQFI
                     EAQLATYSAKTTGWIFWNWKTENAAEWDYLKLKENNLFPQPFDNFTYFNKDGQINSSF
                     STSLSIEAFGSPTSSRVSSTKHKNFAISTKMRTSITGSSNNNTWMYFLSAALGMLAVC
                     CVM"
     gene            <873232..>873642
                     /locus_tag="CAGL0M08778g"
                     /db_xref="GeneID:2891288"
     mRNA            <873232..>873642
                     /locus_tag="CAGL0M08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449727.1"
                     /db_xref="GeneID:2891288"
     CDS             873232..873642
                     /locus_tag="CAGL0M08778g"
                     /note="weakly similar to uniprot|Q12379 Saccharomyces
                     cerevisiae YDR260c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449727.1"
                     /db_xref="GeneID:2891288"
                     /db_xref="GOA:Q6FJ67"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ67"
                     /translation="MTYNNSHFNYHHLNRSHYVLYSEWNKDEFPNPTRTALGSRLEGP
                     SKDSANPNDLKIDDEYWDNYLEEEDYQLFKNAKLESNGVVTFTIANLSLPLPSQNTAL
                     EVHNEESSTLTGSIFVRDGRVIAKAKHRQLTGGL"
     gene            <878328..>879119
                     /locus_tag="CAGL0M08800g"
                     /db_xref="GeneID:2891289"
     mRNA            <878328..>879119
                     /locus_tag="CAGL0M08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449728.1"
                     /db_xref="GeneID:2891289"
     CDS             878328..879119
                     /locus_tag="CAGL0M08800g"
                     /note="weakly similar to uniprot|Q03935 Saccharomyces
                     cerevisiae YDR259c YAP6 transcription factor of a
                     fungal-specific family of bzip proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449728.1"
                     /db_xref="GeneID:2891289"
                     /db_xref="GOA:Q6FJ66"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ66"
                     /translation="MGQVNMRPSLASQPAHYQLPSIAPNIHPHQYTTSQPPHQQHYHV
                     VHTPISRISSENGQQQHMMPPSMNPTAYQGPEQVIIDHGIPTFQYAHQPQHVLRSSIM
                     TGANMSPGQPQPQTIVMGPQPIQHAIDGHLASQTIATPMGTTLLTSSAQLQGQKTKKN
                     TKRAMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRLIE
                     KLKDNGIEVDIPSDFLDKINASISASRRLQEQHEEISKSIAGEKS"
     gene            <880145..>882508
                     /locus_tag="CAGL0M08822g"
                     /db_xref="GeneID:2891290"
     mRNA            <880145..>882508
                     /locus_tag="CAGL0M08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449729.1"
                     /db_xref="GeneID:2891290"
     CDS             880145..882508
                     /locus_tag="CAGL0M08822g"
                     /note="highly similar to uniprot|Q12137 Saccharomyces
                     cerevisiae YDR258c heat shock protein of clpb family of
                     ATP-dependent proteases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449729.1"
                     /db_xref="GeneID:2891290"
                     /db_xref="GOA:Q6FJ65"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ65"
                     /translation="MLSRVCRSSLRNSVARVSRYAGPRALALSMVVSGRQVSGSWQTC
                     AYGVRYIHSSRPRYVQMRMNPNQGEPEKPPLEQFGTNLTKLARDGKLDPVIGRDEEIS
                     RAIQILSRRTKNNPVLIGRAGVGKTALIDGLAQRIVAGEVPESLKDKELVALDLGALI
                     AGAKYRGEFEERLKKVLEDIDKADGKVIVFIDEVHMLLGLGKTDGSMDASNILKPKLA
                     RGLRCISATTIDEFKIIEKDPALTRRFQPILLNEPSVQDTISILRGLKERYEVHHGVR
                     ITDTALVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDEIQRLDRAIMKI
                     QIELESLKKETDPVSIERKEDLEKELERKNEELQRLTKIWEEEKAEIESIKNSKADLE
                     KARIELDRCQREGDYAKASELRYAKIPALEEKVKLSETKDSNKENLLHDAVTSDDISK
                     VIAKMTGIPMETVLKGDKDRLLYMENSLRERVVGQDEAIEAVSDAVRLQRAGLTSEKR
                     PIASFMFLGPTGTGKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSKLIGAPPGYV
                     LSESGGQLTEAVRRKPYAVVLFDEFEKAHPDVCKILLQVLDEGKLTDSLGHHVDFRNT
                     IIVMTSNIGQDILLSDTKLDDEGKIDPSTRNEVIEAMKRSYPPEFINRIDDILVFNRL
                     SKKVLRSIVDIRAKEIQERLNDKRMTIEISDTAKEWLTEHGYDQLYGARPLNRLIHRR
                     ILNPMATYLLKGQIRNGETVQVDVENKELVVKSNHAEGEIVDEEPEK"
     gene            <882940..>884472
                     /locus_tag="CAGL0M08844g"
                     /db_xref="GeneID:2891291"
     mRNA            <882940..>884472
                     /locus_tag="CAGL0M08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449730.1"
                     /db_xref="GeneID:2891291"
     CDS             882940..884472
                     /locus_tag="CAGL0M08844g"
                     /inference="similar to AA sequence:UniProtKB:Q12504"
                     /note="similar to uniprot|Q12504 Saccharomyces cerevisiae
                     YDR257c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449730.1"
                     /db_xref="GeneID:2891291"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ64"
                     /translation="MADNYTETTTEYVSWLTNNGVKISPKLKVEDNRYKDEGRCVVTT
                     TDIQKDELLFEIPRNVLLNCETSQLVKDIPAVLTELETFSGSEPLSWEPLILCLFYEM
                     YILKDKSRWWPYFEVLPTLEDMNVLVLWSDEDLAALEPSYVLSCIGKEQVENMYQLLK
                     RFIEASDHEQLKSNLNKFSWDSFIRIGSLIMSYSFDVGKEIHNEGKEGESMNENDNMT
                     NGDEDEDEDEEDLEVEMIKSMVPLADTLNADTKKCNANLLHSKQTLRMIAIRDIPSGE
                     QVYNTYGELSNSELLRRYGYVEWDGSYYDCGEISKSAIHKSLLQLFPTSTETLERLDA
                     VIDENEKVLDLFDDDTIVEDTYIFESDGEIPFKFLFYIQLMALLLQNSRIEKMGPIAL
                     NKCMAPTIDKTSKILQEQKVTRKALDVLNDSLDTRMKQYEQKITDSGEDSLEPPSHEA
                     STKEKRMRMVKMILLSEYKSLRKCSEVIREEFGPLSDSDVLSEIKQSKEEKRPKKRAK
                     TR"
     gene            <884842..>886491
                     /locus_tag="CAGL0M08866g"
                     /db_xref="GeneID:2891292"
     mRNA            <884842..>886491
                     /locus_tag="CAGL0M08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449731.1"
                     /db_xref="GeneID:2891292"
     CDS             884842..886491
                     /locus_tag="CAGL0M08866g"
                     /inference="similar to AA sequence:UniProtKB:Q03370"
                     /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
                     YDR479c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449731.1"
                     /db_xref="GeneID:2891292"
                     /db_xref="GOA:Q6FJ63"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ63"
                     /translation="MDSVTNFFWNDTYGRGSASTIDTVGSDSNDKDKNTNGTPTTNRH
                     NRRFSNSLEKMNSRDSGSNVQGSFANTAFSTSGGLQKAMTDTLVEKIIKMAIPASSEL
                     AANTIKNRMAAGKERPSLSVPITSRNFILMNSRLSVPFLVIDEIIKILNWVDPAYTLS
                     MALIYTLIVLRPLQVLSSLPILYLLFGIMVPEYLHIHEPSENVYLDTNRVPAQGPPLR
                     KAEVPKPVPEFSQEFVLNLTDLQNHMLLYVQLYDSIIYVLQKFAFFVNEQISAVAFVL
                     LMILAVTNIIFIDVLVRIIPIKLILVATGWAFIIICHPKYRDNFFNKVNSEETRLRLL
                     KLTSSYDDWVNDNLGYVEARETKVVIIYEMQKYKDKHKEWHPVGYANDDFTLFSQFRI
                     NENAIESVAVPSLDSISPPTGWEWAENSSWVLDLDPTGWVEEGFIQFVQIDPETKWVY
                     DINLDGKRGKYRRRLWTNTCVRQIHAGVDERNASDKLREVSNPLRSDETHSRSIHGVS
                     KGSMSGNVKTEADIEENAFTDEDDSHITDDSIASNILNTTI"
     gene            complement(<886536..>887063)
                     /locus_tag="CAGL0M08888g"
                     /db_xref="GeneID:2891293"
     mRNA            complement(<886536..>887063)
                     /locus_tag="CAGL0M08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449732.1"
                     /db_xref="GeneID:2891293"
     CDS             complement(886536..887063)
                     /locus_tag="CAGL0M08888g"
                     /inference="similar to AA sequence:UniProtKB:P40993"
                     /note="similar to uniprot|P40993 Saccharomyces cerevisiae
                     YDR478w RNA binding protein of RNase MRP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449732.1"
                     /db_xref="GeneID:2891293"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ62"
                     /translation="MNRDQKIQFRDKQIRHKYALLHAMPTIDVPELSGMYLKNFYNSV
                     KRYQLNLPDHIVQPDKKFCGECGYIQIPDHSVDINIISGERPEISSIAKFKCKKCGHH
                     YDETVLCRKQKVADSANISKDIGQVKKKTNNAKMRAKMRKQNSLTSLLSKKDKEKKDV
                     TKSASMLSLDSFMKR"
     gene            complement(<887703..>889541)
                     /locus_tag="CAGL0M08910g"
                     /db_xref="GeneID:2891294"
     mRNA            complement(<887703..>889541)
                     /locus_tag="CAGL0M08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449733.1"
                     /db_xref="GeneID:2891294"
     CDS             complement(887703..889541)
                     /locus_tag="CAGL0M08910g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449733.1"
                     /db_xref="GeneID:2891294"
                     /db_xref="GOA:Q00372"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /translation="MENKEHHHHHHHHHHHHSNGSYVSNKVSSLADGSRVGNYQIVKT
                     LGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKL
                     YDVIKSKDEIIMVIEYAGNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHR
                     DLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVD
                     VWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPL
                     NRISIHEIMQDEWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEEIDDEMVVTLSKTM
                     GYDKDEIYEALESSEDTPAYNEIRNAYILIKDNKSLIKDMKQDNNVTQELDTFLSQSP
                     PTFQQNGDGMKASEDQKKKHSGRRLASSVTQQRTFHQPPFMDQSKEEDSTISILPTSL
                     PQIHRANMLAQGLPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAE
                     WAKPSEEDLWTIRVRWKYDSDESRLIEDGVKKIPNLMKIVIQLFQIETNNYLVDFKFD
                     GWESTYGDSTISTNMSEDEMSTFSAYPFLHLTTKLIMELAVNSQGN"
     gene            <889916..>890548
                     /locus_tag="CAGL0M08932g"
                     /db_xref="GeneID:2891295"
     mRNA            <889916..>890548
                     /locus_tag="CAGL0M08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449734.1"
                     /db_xref="GeneID:2891295"
     CDS             889916..890548
                     /locus_tag="CAGL0M08932g"
                     /note="weakly similar to uniprot|Q03362 Saccharomyces
                     cerevisiae YDR476c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449734.1"
                     /db_xref="GeneID:2891295"
                     /db_xref="GOA:Q6FJ60"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ60"
                     /translation="MDAADIAKWNTERAHNLKDILCVYGKVKQRPYAVKLQGVDAQAM
                     ELNFKNHESDTQMTKFVDIRDQLEGVSPDYNEVVMSLARQSARKLNKSFNKLDKVLYP
                     CGVADLLVILAVLLPPLCYLYRPLLHWLFPPQVPVLGQLGQLVDSDYRLLAVIVLEFA
                     IHAGEVYLGLWPLLHYYRITESPDLLIEYTLFGLLEGYGPIRRLKSLQWD"
     gene            <890764..>893316
                     /locus_tag="CAGL0M08954g"
                     /db_xref="GeneID:2891296"
     mRNA            <890764..>893316
                     /locus_tag="CAGL0M08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449735.1"
                     /db_xref="GeneID:2891296"
     CDS             890764..893316
                     /locus_tag="CAGL0M08954g"
                     /note="weakly similar to uniprot|Q99248 Saccharomyces
                     cerevisiae YOR019w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449735.1"
                     /db_xref="GeneID:2891296"
                     /db_xref="GOA:Q6FJ59"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ59"
                     /translation="MEQDESLRSFYRRVKVYRRSVGDGEPGLGGDIGNLDSRLCESES
                     ALSGNDSLEPGTPVLDAVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQ
                     DFPGVQLFPQEYTMEEYYDDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSP
                     PPLDREYPSAGKQKKMSSKQQANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDL
                     NDWHNTWRSRRHTIEQRKEDLSETFEYPQLLFPQQTKPSEPVIMMGEDYKPLTKEQRK
                     KEKIIHKKIESTSGPRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMISS
                     RRLITSASASRSRSRTRSRSRDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWA
                     SGYSQEDVETTMENIFDYIANILPEERSVKITVEVVVGAALHTIIDATNAYQPDLMVA
                     STLRWERTDNLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLE
                     KENIEMEKENNVTGDIVESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSL
                     GTSVSAPIAENVFEEESGSETGSDVDSELSDLSSDEGNDKLTVREKLHLKARSYRLQT
                     AQYLKDLDNNKSISHEEIQIKKVETIINQTIKFSLAIEDLGSESDDDDDVGLTKLKRV
                     ITGGAVLNPQSGSKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVK
                     HKDGNNALGNSVVHTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNSLR
                     RVKSNDSSRISQSSKKSSSSTSSGGFMSLFKGKSKERSESPSSKRKSGLKFW"
     gene            <893866..>895236
                     /locus_tag="CAGL0M08976g"
                     /db_xref="GeneID:2891297"
     mRNA            <893866..>895236
                     /locus_tag="CAGL0M08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449736.1"
                     /db_xref="GeneID:2891297"
     CDS             893866..895236
                     /locus_tag="CAGL0M08976g"
                     /inference="similar to AA sequence:UniProtKB:Q03338"
                     /note="similar to uniprot|Q03338 Saccharomyces cerevisiae
                     YDR473c essential splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449736.1"
                     /db_xref="GeneID:2891297"
                     /db_xref="GOA:Q6FJ58"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ58"
                     /translation="MPPKNTTSRKPRSGRGLDVELHPALASSNANIIKAQQKQVNPYL
                     SDIGQQNGKVFKKYKDGLRFYKKGEISAQLHKEREELARRLKEEELRAAAEKAHRVSL
                     AEQKRERIANAEIPDDSIGEELYMQRFKDIPNYEWWDESYLDKSGNILPKYTTEYPED
                     MDSDYDSDDMNSGVECMKSQTEETGPPSIRYVQHPVPIKIPEEITAPKMYLTKLEHKK
                     ARRRNRKLQREEKMAKVQLGLEPKPETKVKLSNMMNVLDNNKNISDPTAWENMVKDQI
                     EERRQRHIQENEKRHEEAVLRKKSKVSDQIEGSEDLFCKAFYFQSLQNPKIRYKLKMN
                     SQQLNLKGFCLRVGEGGPGIIVVIGKEKSCNFYKKLVCTRIKWNENFKIKDATNNGEL
                     IDMTGNYAVEIWDGLLKETKLRNWFMKICQTEDEMKNILQQNDALSFFNLFIENKAEN
                     TNLSQQ"
     gene            895492..895573
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0M08998r"
                     /db_xref="GeneID:2891298"
     tRNA            895492..895573
                     /gene="tRNA-Ser (AGA)"
                     /locus_tag="CAGL0M08998r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2891298"
     gene            complement(<896312..>897358)
                     /locus_tag="CAGL0M09020g"
                     /db_xref="GeneID:2891299"
     mRNA            complement(<896312..>897358)
                     /locus_tag="CAGL0M09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449737.1"
                     /db_xref="GeneID:2891299"
     CDS             complement(896312..897358)
                     /locus_tag="CAGL0M09020g"
                     /note="highly similar to uniprot|P33303 Saccharomyces
                     cerevisiae YJR095w succinate-fumarate transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449737.1"
                     /db_xref="GeneID:2891299"
                     /db_xref="GOA:Q6FJ57"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ57"
                     /translation="MSSSKKKSSNPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKR
                     QAAPAAAAVASMAGGAGGAATATVGGGDATAAIKPPGFIRTGRNIYAQEGFLALYKGL
                     GAVVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPME
                     VVKIRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGA
                     NFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTS
                     FKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENL
                     GVFSKPTPKPKKLN"
     gene            <901459..>902817
                     /locus_tag="CAGL0M09042g"
                     /db_xref="GeneID:2891300"
     mRNA            <901459..>902817
                     /locus_tag="CAGL0M09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449738.1"
                     /db_xref="GeneID:2891300"
     CDS             901459..902817
                     /locus_tag="CAGL0M09042g"
                     /note="weakly similar to uniprot|P21190 Saccharomyces
                     cerevisiae YJR094c IME1 transcription factor required for
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449738.1"
                     /db_xref="GeneID:2891300"
                     /db_xref="UniProtKB/TrEMBL:F2Z6G0"
                     /translation="MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSR
                     AMHSSSPNFKEAKVASRGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIK
                     LATNWDDTDKYINFSVCEELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGS
                     AYSELDFHSNYDFEDYSISYDNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQ
                     PHKLINPKILSTTFDIELSSFINEETYLLSSKYSEASSFSSIFSYDIDNIQNIASITN
                     SSGELMKEANFCNEQNERDSVVTIKLETKNNKKTTKYSIKKETHFPIPDQHKFNDNIE
                     YYYYFDPDEGNPIILPEYPPLRTYEVSTGFKKKKRINKEPKPVIKTKKSQANSYVHRT
                     SKNRIRKSKDSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYKFSKT
                     YF"
     gene            <903560..>904543
                     /locus_tag="CAGL0M09064g"
                     /db_xref="GeneID:2891301"
     mRNA            <903560..>904543
                     /locus_tag="CAGL0M09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449739.1"
                     /db_xref="GeneID:2891301"
     CDS             903560..904543
                     /locus_tag="CAGL0M09064g"
                     /inference="similar to AA sequence:UniProtKB:P45976"
                     /note="similar to uniprot|P45976 Saccharomyces cerevisiae
                     YJR093c component of pre-mRNA polyadenylation factor PF I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449739.1"
                     /db_xref="GeneID:2891301"
                     /db_xref="GOA:Q6FJ55"
                     /db_xref="InterPro:IPR007854"
                     /translation="MSSSEDEDDKFLYGSDNEEPKNEKKRPREAAEDDNEGPTSDKVV
                     SQHNNDLKRPKLAKDSLANASSDEEESGSESDSDIEFIISTGPDPHRLDSSTVPGSNN
                     AIVTVSEGANVGGETMSKSTATATTAEISTLNALGDTEVAGTSELDNETLGPETTTKS
                     GTSAEGIDLDKEGLYNDEPVSTIDPEVLKEKPWRQPGANISDYFNYGFNEYTWMEYLH
                     RQEKLRQEYNPRRILMGLMTLQQQGRLDQPQGGHQSMPDNMAINNPQPTNNDNMMHKP
                     TPPLPNFPMPPMFGGFSPFMPPGMMAPMNRMPNQNQNQGQNQNQNQNQLSK"
     gene            complement(<904879..>909219)
                     /locus_tag="CAGL0M09086g"
                     /db_xref="GeneID:2891302"
     mRNA            complement(<904879..>909219)
                     /locus_tag="CAGL0M09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449740.1"
                     /db_xref="GeneID:2891302"
     CDS             complement(904879..909219)
                     /locus_tag="CAGL0M09086g"
                     /inference="similar to AA sequence:UniProtKB:P47136"
                     /note="similar to uniprot|P47136 Saccharomyces cerevisiae
                     YJR092w budding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449740.1"
                     /db_xref="GeneID:2891302"
                     /db_xref="GOA:Q6FJ54"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /translation="MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETM
                     DMLVQYNTENNANSNVNANANANANQWNKVDDPQDLLPMENNYDDDEEQGDESDTTNL
                     LSGNKHLTEEESEQVLVDSKNLVLPPSSSKSNLINNLKQVVEDEVSDSQLSNDMDDTR
                     TLNFSVKGTEPLLADELQDKEPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPV
                     SPSKIPITNAQTINYFKDAPVEDAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTL
                     ERPSFVISNLKEASQSVENLGFPDYEEDSQSEQETSVLHHTPTDFHAHEFEVFATELP
                     DINVTPSIKPIDIDNNCEHENRLVSEEESKGVISSVPENENLPAVKSNPSSNSISDML
                     EIRQENKLDETLNMIDHQLSSNKSIDSVKTVSDNNISKSANDGSVEDVADSGKETSDI
                     ARNIEESHNSLINLTSGNNFDQSMHNDLIEESNTRVNVTESDITASEDSFNGSHDQNS
                     SLNNLTKNDNGIQQNLEDNHTGIQPEMVVPEEVTTTLPEVNILPASENMLENTSESEI
                     SVQFLQNRDNEDKVSSDPQLEENIRSTETVMNTQETFEPKPAKKNQYTDREIEVLNSQ
                     KDISEATDNSAVNSRISSSASNFTPVLPPLPKLEKLSIDDPFDDEFETSNESMQMKNS
                     VKPTDYLSIWHLQEQTTKAVSPALSSNSQFSYNSNSTKSSVASPVPATAFKFKPKIVS
                     RSKYYYPDNNIQQEQSMDFIYTKLPSILDPMRRNTINSKKIRQTVIDKRKSHPSFSVD
                     EGNTITEVNIEPEVKVQPISIENDSSSLKANNQDDNESCSSGSQAFVTPSATMDNFDS
                     QFNELGTSFENDLENVLNYFDKDINTNTSSDLIEETTTKNQALPTSKVWSESVDYSLP
                     TGEEPNVDHNIMKKLLNTENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMF
                     ALNGRDISISKSEMTNDIDMGIFSDKKSLVHTPELSPVKSTHVGSPFKVISPKKNTQK
                     DLKDGTTAEKRVSSESEAAQISIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEP
                     IVDKGLLYLHLQGTTKLSLAGINAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKE
                     FEIPIDQSINKLIITLMIKYTRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFVERST
                     VKDEWDYLFARDGSFGRCEILLDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQ
                     EALYDLPRRPAYKVGSLKVKGCFLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGY
                     LLQEGGDLSSQMKNRFFKLNGVELVGYHEVSMKPKIRINMLKVVKVIGKDDVVTGKDN
                     VRNFTTWVLMNDCFQLVFDDGEVITFSDESSLADEQSWYMKLKEVVELNAFHQPWVKR
                     FSENMIINDI"
     gene            <910473..>913802
                     /locus_tag="CAGL0M09108g"
                     /db_xref="GeneID:2891303"
     mRNA            <910473..>913802
                     /locus_tag="CAGL0M09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449741.1"
                     /db_xref="GeneID:2891303"
     CDS             910473..913802
                     /locus_tag="CAGL0M09108g"
                     /inference="similar to AA sequence:UniProtKB:P47135"
                     /note="similar to uniprot|P47135 Saccharomyces cerevisiae
                     YJR091c suppresses the high-temperature lethality of
                     TUB2-150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449741.1"
                     /db_xref="GeneID:2891303"
                     /db_xref="GOA:Q6FJ53"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ53"
                     /translation="MEKKFTNIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAG
                     KFSNTLSNLLPSISAKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNT
                     DQGMPSMTAAVAADMGPPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTEYLISR
                     PRTSNDSFGNNLPRQISRTRNNTMSSQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQ
                     QQQQQQQQQMVPQINTYNAMDMGQQPNYGDTMNQQMGGNNLTVNNAWNSNRPRSHSNA
                     SSIYTDAPQYDTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISN
                     LLPTNTISISNVFPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVE
                     FDSVDSAIRALDALQGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVS
                     QPLLQEQLNNGAVTFHQQGNISIPVFNQNQYSNGQNTNNNASSHPGTSSSSDKEQCPF
                     PLPPPPLSGKKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSN
                     KQFDAPKLRELRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSD
                     IIKDIMLRKTGKYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQ
                     FGNYVIQCVLKFGYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLV
                     LSAMIVIYAEYLTTNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLT
                     ILKILNYRGDDAARKTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLE
                     DDIRIHIIAQVRKILMESNTAQHHRRLMEEVGLMTTGNNNNQTSNNKHRKNSSHTYVQ
                     DNNGHMRGVSVSSVRSGGSRQTGLTPNIPQTFQMPSLPNTSMSTVVSGNMSLNQLPTQ
                     MQQQQQSGVLPQTVQQQQQQPMVGSNQNNAMSYMNYPGVFPMGYPNNNSSYGINDDLV
                     SKLDMLTLGNGTHLSLPQLSVTNHENNTNYSNNNNNNNNNNNNNNNSNGNNNTNGGNP
                     MNLMNSSLNNTQEFGGSSLWN"
     gene            <914811..>918188
                     /locus_tag="CAGL0M09130g"
                     /db_xref="GeneID:2891304"
     mRNA            <914811..>918188
                     /locus_tag="CAGL0M09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449742.1"
                     /db_xref="GeneID:2891304"
     CDS             914811..918188
                     /locus_tag="CAGL0M09130g"
                     /inference="similar to AA sequence:UniProtKB:P24814"
                     /note="similar to uniprot|P24814 Saccharomyces cerevisiae
                     YJR090c required for glucose repression and for glucose
                     and cation transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449742.1"
                     /db_xref="GeneID:2891304"
                     /db_xref="GOA:Q6FJ52"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR006553"
                     /db_xref="InterPro:IPR026940"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ52"
                     /translation="MDITNQNHSIDTPMPDTRPDIEFGFGYNAGTTRGGPSLASMQIQ
                     QGTNTHHQINNDISFNIGNNDTNSNDTNENIHVDSLRNNGNIQRFTAGDRLPNTIGNQ
                     SVAMARSIPGSIESRNGFPQDGEALMDMSNVESIDYNAPAKIFADMDINRLFYDPNLS
                     SLQAEDIIKLHNFKEVVHRKIENFIEVIQKRRERILKEIELGNQRLEGVDLETSVSAM
                     TYLNKLQRIRISALKSETMELQNLRIQIVSIVDEYKKAMAEYSKLNQEGRNAVNPTPY
                     FQRWIKSLNPEDISGLNKELIELQMYSKQLSDIPELASIEYQVSTPQTSQFPLRSLPS
                     EILHLVLDKITQKADIVNLLRVCKLWALIIVKILYYRPHINRKHQLDLFMRTMKLTKD
                     ETVFDYRSMIKRLNFSFVGDHLHDEELYNFVGCRNLERLTLVFCKHITSDPVAAVLKG
                     CKYLQSVDITGIKEIYDNVFDTLAESCKRVQGFYVPQAKLVSYNALTNFVSNAPMLKR
                     IKVTANANVNDEFLDLLAEKCPLLVEVDITLSANVHDSSLTKLFMKLTQLREFRITHN
                     ANVTDKFFLDLSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRI
                     TDLSLFHLSTLGKNLQTVHFGHCFNITDRGVRALIKSCPRIQYVDFACCTNLTNHTLY
                     ELSYLSRLKRIGLVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSNLTIYPIYELLM
                     ACPRLSHLSLTAVPSFLRPDITAFCRPAPSDFSDNQRQIFCVFSGKGVHKLRHYLMSL
                     TTPTDGPQIDVGDTLEQYVISKHLLRPGEYLNDGIRRITSELNQDSAAILAATGLNQM
                     NGMNSDFPFQNIDFERLDEVFNWINMSMDGHSLNSDELNDLISEVDRDFCDDPFDEDY
                     NSRDSIVAPGANTGLNSELCHIVKKFHRLDDQICDFEVNVSSLARVQFQFTGFLLHEM
                     AQAYMNMVEINRQIWHIQKTTLEAGVESDIKALLVWRILFIDKFTALLHKYQISTVVL
                     RLYLKDSITLLTRQRELFLAHQRTPWNPTIVEEAPDSNYWQLVGDRIQLLPEQMRVMP
                     FGLRNPAIANNAQQNAAEAQNDDRSETPEDDVAIEDF"
     gene            <921030..>921911
                     /locus_tag="CAGL0M09185g"
                     /db_xref="GeneID:2891307"
     mRNA            <921030..>921911
                     /locus_tag="CAGL0M09185g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449743.1"
                     /db_xref="GeneID:2891307"
     CDS             921030..921911
                     /locus_tag="CAGL0M09185g"
                     /inference="similar to AA sequence:UniProtKB:P47133"
                     /note="similar to uniprot|P47133 Saccharomyces cerevisiae
                     YJR088c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449743.1"
                     /db_xref="GeneID:2891307"
                     /db_xref="GOA:Q6FJ51"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ51"
                     /translation="MRDLRREKLLTVMTTRAYTRFEPQELVQLYNELLMRMGKLERSS
                     EPNDVSLLEMYFYVCCYLGKDQEMSLVFQRLRDRFGESSPRVAVMKATMMEVEGNDSS
                     AAKQYLEGRLKELEYDADSVSYVMLSKKLLALKMRDLKKNPQQQLKETLALIEKFPLD
                     PELQWVCSELYYSLKDLDKAIYCIEEVLVAMPFNYVAFARLSELLYYKYVREFQDKPA
                     KRRDTAALQQALDNALRSVELSELFLKGWSLVATISKELDKPQLLQLSKKKLQEISEV
                     SNSNDARIAKKFLQKMA"
     gene            complement(<922042..>922308)
                     /locus_tag="CAGL0M09207g"
                     /db_xref="GeneID:2891308"
     mRNA            complement(<922042..>922308)
                     /locus_tag="CAGL0M09207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449744.1"
                     /db_xref="GeneID:2891308"
     CDS             complement(922042..922308)
                     /locus_tag="CAGL0M09207g"
                     /inference="similar to AA sequence:UniProtKB:P18852"
                     /note="similar to uniprot|P18852 Saccharomyces cerevisiae
                     YJR086w GTP-binding protein gamma subunit of the pheromone
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449744.1"
                     /db_xref="GeneID:2891308"
                     /db_xref="GOA:Q6FJ50"
                     /db_xref="InterPro:IPR015898"
                     /translation="MEVSQSQLDLKIKYLKLKRINELNDKLRDELQRERITASNACLQ
                     LIAYTTSTRDYALPTLWGYPPADTNHFRDFQTQHADDATCCTIM"
     gene            <922638..>922955
                     /locus_tag="CAGL0M09229g"
                     /db_xref="GeneID:2891309"
     mRNA            <922638..>922955
                     /locus_tag="CAGL0M09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449745.1"
                     /db_xref="GeneID:2891309"
     CDS             922638..922955
                     /locus_tag="CAGL0M09229g"
                     /inference="similar to AA sequence:UniProtKB:P47131"
                     /note="similar to uniprot|P47131 Saccharomyces cerevisiae
                     YJR085c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449745.1"
                     /db_xref="GeneID:2891309"
                     /db_xref="GOA:Q6FJ49"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ49"
                     /translation="MEHPAFTLSALTTIGGVVGYMRKKSLPSLVAGLTFGGLYAISGY
                     LLHLNRDYGLELALGSSALLTVSGAMRGGVKTPLKPIPFLLTVCGATGSYYYWSKYKE
                     FYP"
     gene            complement(<923094..>924443)
                     /locus_tag="CAGL0M09251g"
                     /db_xref="GeneID:2891310"
     mRNA            complement(<923094..>924443)
                     /locus_tag="CAGL0M09251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449746.1"
                     /db_xref="GeneID:2891310"
     CDS             complement(923094..924443)
                     /locus_tag="CAGL0M09251g"
                     /note="weakly similar to uniprot|P47130 Saccharomyces
                     cerevisiae YJR084w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449746.1"
                     /db_xref="GeneID:2891310"
                     /db_xref="GOA:Q6FJ48"
                     /db_xref="InterPro:IPR000717"
                     /translation="MEYSRFVDCFERRSYTAEFLEFVGFKLSSEPLGATALILGGSQA
                     KQARYGDVNALYDAIVQIKLKESLTSLRELDPNAAVKKNKQRKVHQRVVDVFQALTNE
                     LRILNKILERSDDSVWLVYPVYTVCHDVSTFLRDTGKYMQLESRKQLWEECIRVIHRS
                     FMICLNDKNPNMQENKRGGCILFANLEMMFYKMLRNRDMMKNLIKVLESTGMTDISRQ
                     RDNKVLKRHRSQKIIFNYFIGEYYGCYLFQFNKAQEHLQVCVSEFPVKYTSSKWFKRI
                     IHLYTQFRMLATSNKLIHVELPRETNEKFANAYDSDLMNKCYKNGDTIVFDELIKEHA
                     AQYLIDGTYSAMLLIKELVFLRLVKVCYKVNDKKSILPLDLIAAGYRIHFRNHDNEEN
                     RVTTTNPRKLQKKNEDLLDELECRIANLIANGRIKGYLSHSQRCMVLSKTEPFPLAS"
     gene            <924718..>925602
                     /locus_tag="CAGL0M09273g"
                     /db_xref="GeneID:2891311"
     mRNA            <924718..>925602
                     /locus_tag="CAGL0M09273g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449747.1"
                     /db_xref="GeneID:2891311"
     CDS             924718..925602
                     /locus_tag="CAGL0M09273g"
                     /inference="similar to AA sequence:UniProtKB:P47129"
                     /note="similar to uniprot|P47129 Saccharomyces cerevisiae
                     YJR083c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449747.1"
                     /db_xref="GeneID:2891311"
                     /db_xref="GOA:Q6FJ47"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ47"
                     /translation="MSERIVSNPIELHKLSLVDKQKGDTSGSSGAAGTGSGANDGNSN
                     AGNSNAGNSNAGGAGVTGTPVKQRARPVVPIASPTKVKEEPKSEDGLYKLASKQREIF
                     ELEQKLKQARVELKQLEEEVGKSLGYAGMPQESLRNRLQKRIEEVNRSPNVIRTKQSM
                     SNLIQRGNTLFMDGSSSARGATDRDMRTDQRRSAHAHAAAPAQAQPSAHRQNGPPLPS
                     RPREPQKNFFKSIVDKFHEMTQEEEDFDDQTTSNHKDKYYIGETYGYDQDEEDEDPED
                     HGEPLEHINDIPTTLFKR"
     gene            <925881..>926156
                     /locus_tag="CAGL0M09295g"
                     /db_xref="GeneID:2891312"
     mRNA            <925881..>926156
                     /locus_tag="CAGL0M09295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449748.1"
                     /db_xref="GeneID:2891312"
     CDS             925881..926156
                     /locus_tag="CAGL0M09295g"
                     /note="highly similar to uniprot|P47128 Saccharomyces
                     cerevisiae YJR082c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449748.1"
                     /db_xref="GeneID:2891312"
                     /db_xref="GOA:Q6FJ46"
                     /db_xref="InterPro:IPR015418"
                     /translation="MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVD
                     GGSKSYHNILRGFDGMSRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ"
     gene            <926244..>927407
                     /locus_tag="CAGL0M09317g"
                     /db_xref="GeneID:2891313"
     mRNA            <926244..>927407
                     /locus_tag="CAGL0M09317g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449749.1"
                     /db_xref="GeneID:2891313"
     CDS             926244..927407
                     /locus_tag="CAGL0M09317g"
                     /inference="similar to AA sequence:UniProtKB:P47127"
                     /note="similar to uniprot|P47127 Saccharomyces cerevisiae
                     YJR080c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449749.1"
                     /db_xref="GeneID:2891313"
                     /db_xref="GOA:Q6FJ45"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /translation="MLKSRFKVVGKEALMASLPLEPSVPMCIRKGCLVSVMAGGAHGS
                     GKTASLVIGHKWVNFWTNLARFRSWNSSLYHVLTTSGKENRALVAPNISRGSPWLSAL
                     KLVVSILSKNSKGITITDPQRSIYPLELDGTQDWNVWGRDSLIAFEQNDSLDIKPASL
                     SSSLKRDALFSHSHKYQVVTGRGSVLLGGYGDIYSIDLKNSTDDIVINAQNILAVSGK
                     GQTETMNAIENNPFIISHTAASNIPEFTSNVQELAAFEDPKQQQSQTIVQKTVKEAAR
                     ASKAVWHWISYVYKKTVIFSNNNGHNITSPAFVKIKGPRTIIIQTSHETTQPVSVSTV
                     DILPRTVENAIPEVVETPKAKSDSYINYATVQPDGNVTFRSVSNFNETIAERY"
     gene            complement(<927557..>928153)
                     /locus_tag="CAGL0M09339g"
                     /db_xref="GeneID:2891314"
     mRNA            complement(<927557..>928153)
                     /locus_tag="CAGL0M09339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449750.1"
                     /db_xref="GeneID:2891314"
     CDS             complement(927557..928153)
                     /locus_tag="CAGL0M09339g"
                     /inference="similar to AA sequence:UniProtKB:P38162"
                     /note="similar to uniprot|P38162 Saccharomyces cerevisiae
                     YBL107c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449750.1"
                     /db_xref="GeneID:2891314"
                     /db_xref="GOA:Q6FJ44"
                     /db_xref="InterPro:IPR016805"
                     /db_xref="InterPro:IPR019171"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ44"
                     /translation="MAKQGQEELTVSFSEQLLDPNLSFPDYQQTTRQLTLNRARCVDP
                     TLIDTFLRNLRHGSDDVIKQKLNNYSKQTEHRNDTRLQKCDSLIHREIYPNWQVRDSI
                     IDFCAAQATQLKYELDQQKSSEVIRTTVDTRLDPYSVRDLQHEEEKKYKQWNDLNNWV
                     ENNRTIEGILRGSSDHFLKQNCDQNVDYLRKFWDLSSK"
     gene            complement(<928484..>931918)
                     /locus_tag="CAGL0M09361g"
                     /db_xref="GeneID:2891315"
     mRNA            complement(<928484..>931918)
                     /locus_tag="CAGL0M09361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449751.1"
                     /db_xref="GeneID:2891315"
     CDS             complement(928484..931918)
                     /locus_tag="CAGL0M09361g"
                     /note="highly similar to uniprot|P24583 Saccharomyces
                     cerevisiae YBL105c PKC1 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449751.1"
                     /db_xref="GeneID:2891315"
                     /db_xref="GOA:Q6FJ43"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ43"
                     /translation="MLSQVEQDIRRKIAVEENIIKGSSALKKKTDNVMVIQKCNTNIR
                     EARQNIEYLEETLKKLQLSQSQQGQTDSQQQQANDDSTVTEIDRGQGYRQLSTIAPEE
                     HVFSRLDLVKYDCPSLAQKIQYMLQQLEFKLQVERQYQEANNKLTKLYQIDGDQRSSS
                     AAEGGALESKNRVQLLKKALKKYQAINVDLDQYYKHHNDESLKDMQPKLREKQLTGML
                     TIGITAIRDVDHIQSPLFARNPETFITVKIDDVVKSRTKPSRNDRWNEEFSIEVDKGN
                     EIEITIYDRVNESVTPVAVMWLLLSDIAEEIRKKKVGKTNGQGWVRAASIKSQTVHNS
                     QAVANRTYASDSRTTSLNNSNSDLNQDMSLSPTQVTTNAWFVLEPAGQILLTLGFHKT
                     SQHQRKNLVGGLHRHGAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQC
                     QDCKFLCHKKCYGNVVTKCISKASTETDPSEAKLNHHIPHRFEPVSNRGTKWCCHCGY
                     ILPWGKQKVRKCTECGIMCHTQCAHLVPDFCGMSMEMANKILKTIEDTKRTQEKKKRK
                     PPQTNASALTSTSTMIGSSVHDRLDSSPSKSMNASIPSIPSPRKHPYAANQYHEKAEE
                     HQMQNQNRLNNYIEDNEAYLKFTSGVGVPGASQDVKAQNMNDAYVDQYGHEYQQDNND
                     SQLKASEDELELWKQHRERMERELQQEQQMQMSYDNNAEGQIDLYTKQASGDVNMLPA
                     VDETVSSHNNPFRDMNHETFEQTQNYVANQLQGDVTDIRSSTEIITAAGNNVSPQKRS
                     SGKHKKRGSKRPKVSLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQN
                     HDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRL
                     SVRRAKFYAAEVLLALKFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGN
                     KTSTFCGTPEFMAPELLREQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAIL
                     TDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLR
                     IKPPYIPEIKSAEDTSYFEQEFTSAPPSLTPLPSVLSTTQQEEFRGFSYMPEDLEL"
     gene            complement(<932379..>935324)
                     /locus_tag="CAGL0M09383g"
                     /db_xref="GeneID:2891316"
     mRNA            complement(<932379..>935324)
                     /locus_tag="CAGL0M09383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449752.1"
                     /db_xref="GeneID:2891316"
     CDS             complement(932379..935324)
                     /locus_tag="CAGL0M09383g"
                     /inference="similar to AA sequence:UniProtKB:P38164"
                     /note="similar to uniprot|P38164 Saccharomyces cerevisiae
                     YBL104c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449752.1"
                     /db_xref="GeneID:2891316"
                     /db_xref="GOA:Q6FJ42"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ42"
                     /translation="MALIKKAFNWSYDEFLDYLSVNPTRDEVTHYKVNPDLEGDDSIM
                     KMLTVKDFGSITCLDYSEAEVGLTAVGEKNGYMRLFNIINAEDDGEEHFNLGARAKQQ
                     RTINAVGINTNGLIAIGLDRNRHDPSLQIWDINYQSTESDIINPTFSYCTNESIVSLK
                     FLNDTNILTSSTKFLKEIDVRSPNSIYQHPTRLTYDIKLNPFNDWQFSTYGDDGTLAI
                     WDRRRLVSNVSNGNLTLTTPLLTFEKLVGAGSASRKYMNSCFRWSPIRDKEFSTLYHG
                     DTIKIWRLGSYVNSEVSEDYESFFVSTVHDIETPYDRVATFDYISKNNKDASFLCMRQ
                     SGTVYRMSIDQNYTNSKFNNRNTLLLSNSNGPDIEEIAVAQDKPKSALENLGAIHKNL
                     SFEDLDLRDDYGKSEDDTNDDYEDEDVDDDNHSNVTEHTEGNESKHLLQEGEGNNLYW
                     KAEKLLQEDISVIMRKRAQLGYGLDPMTTVEIVDRSRALQNYSYIRNTWRWIAIAKTS
                     DVDGTMVSGDLDLGYEGILGIWNGLNGISNQNRHSEDVIISDKQLIREMDKIIRLRKK
                     NKDINSYHGAIAKFADSPKFIQRKLCLIISGWDLSPSDYQEKYDIIIKNGNYEKAAAW
                     AMFFGDIPKAIEILGSAKKERLRLIATAISGYLVYKDQPGNNAWRQQCRKMSNDLDDP
                     YLRVIFAFIADNDWCDILYEPAISLRERLGVALRFLNDSDLTRFLERTSSIVINNGEL
                     EGLILTGITPIGIDLLQSYVMKTSDIQSAALIAVYGCPRYFRDQRVDEWIDTYRTMLN
                     SWQLFSMRAKFDVLRAKLSKTSAGNVTVNVTPRQLYIQCLSCKKNINKPISAEASAAK
                     NKYTHKLSHDKEERSVNHSYFCPHCGAPFPRCAICLMPLGTSNLPFVINGIKGNDQDA
                     HTEVHSTEHSDTAEPQETNVYKRKLKLNEWFSFCLTCKHGMHAGHADEWFERHTICPT
                     PGCTCQCNR"
     gene            complement(<935685..>937040)
                     /locus_tag="CAGL0M09405g"
                     /db_xref="GeneID:2891317"
     mRNA            complement(<935685..>937040)
                     /locus_tag="CAGL0M09405g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449753.1"
                     /db_xref="GeneID:2891317"
     CDS             complement(935685..937040)
                     /locus_tag="CAGL0M09405g"
                     /note="weakly similar to uniprot|P38165 Saccharomyces
                     cerevisiae YBL103c bHLH/zip transcription factor that
                     regulates CIT2 gene expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449753.1"
                     /db_xref="GeneID:2891317"
                     /db_xref="GOA:Q6FJ41"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="InterPro:IPR024099"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ41"
                     /translation="MEINNEDHELLAEIMGHGGDGSELFGNDADVFLRNGSGSGETQA
                     GNADGLALYPQATPAHRHEQMAMMNHGNSEMHSFLDDMFTNSSLGHGQPVTESNLTKN
                     MMGNHYEQNLESDIASSLYNSRHPSVSMEHGTAGHPEMLFHQNDNSISSFSESFYGSS
                     LDSSISEVSSINSFMSGNSFPAPLPHQIDENSILVNNNMSPSGFRDSIRPGSFLSTSL
                     RAPSSMSRQMRNPSYNDSGIPMTVGSVPKNATSHMTPDEKLKRKREFHNAVERRRREL
                     IKQKIKELSKLVPPSLLNYDADGNQIKSNRGTILDKSVEYLEYLLYVIDIQKRKREAL
                     QEKIAQLSSLSSRTTDDLGMGPRKMTNLPQRISSQATLKANTFNEEKIIDTRGIPDTR
                     GISASQAHTDNPLEDFNHNHVDFNATHTDFNNNINDDLQQFLSGDLMEAEDNAKLMFN
                     P"
     gene            <937627..>938268
                     /locus_tag="CAGL0M09427g"
                     /db_xref="GeneID:2891318"
     mRNA            <937627..>938268
                     /locus_tag="CAGL0M09427g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449754.1"
                     /db_xref="GeneID:2891318"
     CDS             937627..938268
                     /locus_tag="CAGL0M09427g"
                     /note="highly similar to uniprot|P38166 Saccharomyces
                     cerevisiae YBL102w suppressor of SED5 ts mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449754.1"
                     /db_xref="GeneID:2891318"
                     /db_xref="GOA:Q6FJ40"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="InterPro:IPR011691"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ40"
                     /translation="MTDNNDQVNLLRDSLSRWNQGRAQQSQGFNESAKTLFSSWADSI
                     NERAQDVYSRLPVSRQDLIQDEEPAWFNLSRTERLILFVCFILGSAACFTLCVFLFPV
                     LAIKPRKFGILWSVGSLLFVLAFGIFQGPVAYIKHLTSRERLPFTVFFFGTCALTIYF
                     AAFMKSTILTIPCAVLELIAVLYYAISYFPFGGTGLRMLSSFGINTARGALHI"
     gene            complement(<938424..>941660)
                     /locus_tag="CAGL0M09449g"
                     /db_xref="GeneID:2891319"
     mRNA            complement(<938424..>941660)
                     /locus_tag="CAGL0M09449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449755.1"
                     /db_xref="GeneID:2891319"
     CDS             complement(938424..941660)
                     /locus_tag="CAGL0M09449g"
                     /inference="similar to AA sequence:UniProtKB:P38167"
                     /note="similar to uniprot|P38167 Saccharomyces cerevisiae
                     YBL101c involved in cell wall biogenesis and architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449755.1"
                     /db_xref="GeneID:2891319"
                     /db_xref="GOA:Q6FJ39"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ39"
                     /translation="MVSSSSSRRRSSTIKSALSSLLHGHSNGSGHHGKDSAYARRHST
                     NSISANGSDTSVRSKLSSHGTGSAANARVPSRTPNKSSTMPDVQSNSTGHLNDTMRNT
                     RYDSTRYSRSFATDDENAIEFDDQNTSLNSDPSGLTPLPESFNKEYLAEYLHNRGFLN
                     PKSVETRENFSIGIATSGDVIFLPTVSSNDDEYLARLNGVGSGESNMELDQGAMDDEL
                     TGDDFVIQDGVLQRQQQNQGHSATDNSSSTAVASPSGTQSDVPDSGAYQNRSLEFDAS
                     MVSFSVAVILSVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLN
                     DTNYDVFVPTTVSSNTQIVERHNNTPTKIFRNKPISERYYTDKSKLKRQYLDSLLDCE
                     GHLLEAGDYVYLLPVIFSNHIPESTYLPSARISYKLKIGTRAIGSSIKRAGSTGSSLS
                     IGQQNQPISSHSSTSSLSSLRDMDHEGKANSSASPHKGLSGNLLKKVKNHLHLPHNQV
                     KPGEIEESRELYTEYPIKVIRTPPPISISTANKPIYINRVWSDSLSYEISFASKYVSL
                     NSRVPIKIKLAPIAKNICVKRVRVSITEKITFVSKNLEYEYDQVDPVAKDPYNPYYLD
                     FTSKRRKERNLALLEVRTKPKGSRALREEIVENCVNDNLLSFGEIKEPGKADSIPLVE
                     PVSIETRLDFPSYMDLDKRHAKNIPPYGIDVYTAIANPEEQQSTSHHKSSVIGILTGI
                     KNSTDSGSSPSKANSDKNTNNSSSAETESAARRQTVSRFHQTSIKANSHPNVKFHTRL
                     NKCKRGLYLDSLHYTNVHARHKLEVMLRISKPDPENPSKLRHYEVLIDTPVFLVSDQC
                     NTGNMELPTYDMATTVTSTDLTPIPNATNLAPPPTFEEAISVPASPFQSPAASPIGSP
                     VMSPSYDPELLSIQQLNLSRSTSFSGPSVHLENTNTGTGGSSVGGISLLQPGSSHRPS
                     ISAEASSGRYSNLDRLMFASSQTSPPPPLPMDIMQGRRASDAAAVSSSYTNPEQSPRI
                     PIIVETNPFFKKDYTLTPRSNEPEADDNSTTPGQLPSKDPPTYEEAVS"
     gene            complement(<942333..>942659)
                     /locus_tag="CAGL0M09471g"
                     /db_xref="GeneID:2891320"
     mRNA            complement(<942333..>942659)
                     /locus_tag="CAGL0M09471g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449756.1"
                     /db_xref="GeneID:2891320"
     CDS             complement(942333..942659)
                     /locus_tag="CAGL0M09471g"
                     /note="some similarities with uniprot|Q03818 Saccharomyces
                     cerevisiae YMR159c coiled-coil protein required for
                     autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449756.1"
                     /db_xref="GeneID:2891320"
                     /db_xref="GOA:Q6FJ38"
                     /db_xref="InterPro:IPR013923"
                     /translation="MLAERDTLEKNYCELFEVPVDGRSNDGDAMLLQEALRGKDNEIR
                     MLEERLAVSSKNVERLNDELLGANLEANVLGQKLQDLQQEHDKLLERWMQRVRVEVDK
                     MNAQLE"
     gene            <942904..>945030
                     /locus_tag="CAGL0M09493g"
                     /db_xref="GeneID:2891321"
     mRNA            <942904..>945030
                     /locus_tag="CAGL0M09493g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449757.1"
                     /db_xref="GeneID:2891321"
     CDS             942904..945030
                     /locus_tag="CAGL0M09493g"
                     /inference="similar to AA sequence:UniProtKB:Q03823"
                     /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
                     YMR160w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449757.1"
                     /db_xref="GeneID:2891321"
                     /db_xref="GOA:Q6FJ37"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ37"
                     /translation="MNGENSWWSRNGENRVSDGGDQVGDERWYQSVWNKLPQLRRPNM
                     EVNITAATQYSHLNAEQIQYLENDALEKIRARSNTWCWFQDMNALASAGAAGVVSVAG
                     TGSSILPLPLPAYPGDTFPGHQLYVKNSLLLPESPLEIYHREPLRTQISNAFKEHYNF
                     PNEKHLYLRRPEQTGIVDQKVVVISIVGHLPDKYEKITLGKQPSAYYLTQRFLKTLEH
                     VNPGTVVTFSIEADIDTQPMETAFQSLVKVFNNWKFRLKDASAIYIQSVYHSVPIAIK
                     LAKHLMLNHIDYGFTDKTSIGLLGLESCIEGYRFWDHSIDISSSTEQEIDKLQQAKEK
                     QLYQGCTKQQQTILAQIKEYCDLESEESQNMQNDLDWVLYNWGPARVTLVGKLYDNFM
                     TLSQKLAIDYRHSKIMRSLWCNGSYLGLDPKLPEKISVPNSHLKTIKFDCNVQIPEER
                     LFEVSLLMIVVLALNLGYTSGTSLAKLIGPYFISRSYNSNTVPPNIRKQQTYDNKIWL
                     QEMEEKWKDLNIRESYMDELPKHVSSTHSFLEFSYFQAQRSPDLLQIKSDIYDDDSVY
                     KLFLENTMLTRNPRYKKHLQLHKDEYMPSSIFDRANQYDLVWKFHEFLSNFVTARNLP
                     RQNFPPLISFSISLDYSFWKYMYPESNSFNRDTTESRKKLVQLWECYNSWDPPTRGLQ
                     KLRNILSVLSIYKEPSKFIEDIQRTL"
     gene            <945440..>946045
                     /locus_tag="CAGL0M09515g"
                     /db_xref="GeneID:2891322"
     mRNA            <945440..>946045
                     /locus_tag="CAGL0M09515g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449758.1"
                     /db_xref="GeneID:2891322"
     CDS             945440..946045
                     /locus_tag="CAGL0M09515g"
                     /note="highly similar to uniprot|P25046 Saccharomyces
                     cerevisiae YBL093c transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449758.1"
                     /db_xref="GeneID:2891322"
                     /db_xref="GOA:Q6FJ36"
                     /db_xref="InterPro:IPR013942"
                     /translation="MEMEEFAPSYYYYVEPEMGYQPQQPNPMEDLITVYHLDDISRQV
                     ARTNEDGTKAVKLRKSYKNQITDLSGKFSSIPNRENRKGGEIAHILFQNNPDMMNQVH
                     RSPDMTDEQWREALMNVDASLFQAPNMDWEVCQSVLSQFDRSYPTEFQNDPNFHVDDL
                     AFDLDGTGKSNAKKRKNRSNGSSMATPNSEMQDDVKRRRLE"
     gene            complement(<946553..>947281)
                     /locus_tag="CAGL0M09537g"
                     /db_xref="GeneID:2891323"
     mRNA            complement(<946553..>947281)
                     /locus_tag="CAGL0M09537g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449759.1"
                     /db_xref="GeneID:2891323"
     CDS             complement(946553..947281)
                     /locus_tag="CAGL0M09537g"
                     /inference="similar to AA sequence:UniProtKB:P38172"
                     /note="similar to uniprot|P38172 Saccharomyces cerevisiae
                     YBL095w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449759.1"
                     /db_xref="GeneID:2891323"
                     /db_xref="GOA:Q6FJ35"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ35"
                     /translation="MPPLFRAVTRGILLPTLGFSAGFLTFLKAWPDEAGAITLQKQQG
                     SDMQLLQRADVLQKITQSTLYKQLLRADDVDHTRQSDKIPHGHKPYHVGQGILFGKDK
                     LEIDPLIFLNEEKGQLTVFYHLGKNLGNEKSQVHKGVISLLMDEALCYCGFPRLPSKR
                     GVTAKLNLKFNREIPADSTVILTATVRESKGRKCIIDGELQVFSDKVHTLPSLWGEKE
                     PNVEAECILVEPKWFKYFSRLNMF"
     gene            complement(<947542..>949797)
                     /locus_tag="CAGL0M09559g"
                     /db_xref="GeneID:2891324"
     mRNA            complement(<947542..>949797)
                     /locus_tag="CAGL0M09559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449760.1"
                     /db_xref="GeneID:2891324"
     CDS             complement(947542..949797)
                     /locus_tag="CAGL0M09559g"
                     /inference="similar to AA sequence:UniProtKB:P38170"
                     /note="similar to uniprot|P38170 Saccharomyces cerevisiae
                     YBL097w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449760.1"
                     /db_xref="GeneID:2891324"
                     /db_xref="GOA:Q6FJ34"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ34"
                     /translation="MLANLEEWIKMATDNKINSRNSWNFALIDYFYDLNILKDSENNI
                     NFQKASATLDGCVKIYSSRVDSVTSETGKLLSGLSQRKNEQANSKNNKQPGDGNDGDY
                     DDADSSVQIDALTGLPVGKDSDEYLKRRRVHNRVLETTLVEFDNIRMKELDQELNIDP
                     LFKKALVDFDEGGAKSLLLNTLSIDESGRVVFDAAMKNEPSLLKEKESNEEPLNENNL
                     PLDSSKSMDEDNSHGDRSDKNSTPTPQTPITEPEEEEDSKADITLNKSFSSNFQYSMD
                     DEILALGIDYIKFDDISTSDISPSLQNLRNVIADINKAKGFIDSINNKFDNFLTEDEI
                     KEAVPEEEGPNGNDYDDGINQELEYSMGNNEDVLPFDINDGGDNFGEDNEGGIDDEEG
                     DENGGLDSMLGSILEKDLMAYFDEKMNRNWRGREHWKVANYKKANTIDNKSSEPNNEI
                     EREATESEGTSEENKKSDTKKERKKQIQIDFLNLDPNIESIVFDSKKRSGIDMAIKSR
                     TNDSHYLLPDDYHFSTEKITGLFIKPNTKMSIFNRVKRRKMTAAQVDTTSDNLGNGIP
                     QIADEQFWANNYEEQENENNIGGNNDLESSNIVGADIENPFEEEGIDFNQAFEDMSLD
                     ENDDAGKDIFTQKDEKEDLTKLRQPDKVTYSRVSKKVDVRRLKKNIWMSVKSVVSQLD
                     ETSDILQFRFTDITKNLGKFYSPESLSDISTSFCFICLLHLANEHGLQIKSTENYEDL
                     TVIFDKSVVTV"
     gene            complement(<951054..>952685)
                     /locus_tag="CAGL0M09581g"
                     /db_xref="GeneID:2891325"
     mRNA            complement(<951054..>952685)
                     /locus_tag="CAGL0M09581g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449761.1"
                     /db_xref="GeneID:2891325"
     CDS             complement(951054..952685)
                     /locus_tag="CAGL0M09581g"
                     /note="highly similar to uniprot|P07251 Saccharomyces
                     cerevisiae YBL099w F1F0-ATPase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449761.1"
                     /db_xref="GeneID:2891325"
                     /db_xref="GOA:Q6FJ33"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005294"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ33"
                     /translation="MLSRVVLARNALRAVSRASRASRGSVVRTSARCYAAKAQPTEVS
                     SILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLE
                     PGQVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVG
                     TARAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTI
                     LNQKRWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAP
                     LQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVF
                     YLHSRLLERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELF
                     YKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTK
                     QTLVRGERLTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLK
                     SNHENILNDIRDKGELTKDLLATLKSATESFVATF"
     gene            complement(<955022..>955492)
                     /locus_tag="CAGL0M09603g"
                     /db_xref="GeneID:2891326"
     mRNA            complement(<955022..>955492)
                     /locus_tag="CAGL0M09603g"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_449762.1"
                     /db_xref="GeneID:2891326"
     CDS             complement(955022..955492)
                     /locus_tag="CAGL0M09603g"
                     /note="highly similar to uniprot|Q03799 Saccharomyces
                     cerevisiae YMR158w"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_449762.1"
                     /db_xref="GeneID:2891326"
                     /db_xref="GOA:Q6FJ32"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ32"
                     /translation="MSLVKLANTCAHLQNCSRVRLSLTSLPYTKLQLQFAYNLYKQGF
                     LSSVERGSTRGPDDEFIEVTPDNIATRRLWVGLKYRDNKPVLSQCRLISKPNMRIMMG
                     PDELKKVCSGVSVRQVKPLQPGELMLVRTERNTIVDIHEAIAQRHGGELLCRVK"
     gene            <955675..>956367
                     /locus_tag="CAGL0M09614g"
                     /db_xref="GeneID:2891327"
     mRNA            <955675..>956367
                     /locus_tag="CAGL0M09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449763.1"
                     /db_xref="GeneID:2891327"
     CDS             955675..956367
                     /locus_tag="CAGL0M09614g"
                     /inference="similar to AA sequence:UniProtKB:Q03798"
                     /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
                     YMR157c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449763.1"
                     /db_xref="GeneID:2891327"
                     /db_xref="GOA:Q6FJ31"
                     /translation="MALMRLGLRIPARLGSNLPVAQLGIRAAKHRFYATAPRNDGGEL
                     PSIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVALFPGNQLKV
                     YGVLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVEYFDMLPQ
                     GLMVKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLKDTDIC
                     KYYDAVGKLESV"
     gene            <956604..>957353
                     /locus_tag="CAGL0M09636g"
                     /db_xref="GeneID:2891328"
     mRNA            <956604..>957353
                     /locus_tag="CAGL0M09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449764.1"
                     /db_xref="GeneID:2891328"
     CDS             956604..957353
                     /locus_tag="CAGL0M09636g"
                     /inference="similar to AA sequence:UniProtKB:Q03796"
                     /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
                     YMR156c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449764.1"
                     /db_xref="GeneID:2891328"
                     /db_xref="GOA:Q6FJ30"
                     /db_xref="InterPro:IPR006551"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ30"
                     /translation="MKTHKVTILPHLIKFIPQVDSSIADDSLNLYGFDLDHTIIQPKS
                     GAVFARGSNDWKFMEFGGKQTLQKLIKLVLGESNAFVVVFTNQGGVVTVPTTAKSCLN
                     FTNKIKNLLEHIEGVENGSKFLERLFIYAAPKKPASFGKKKVAGTKSGRVNKSINSML
                     AKTTKEKEQIDNKDIDDQVSIFTKMRKPETGMADAFISDLELIFPKEKYKYNWKLYCG
                     DAAGRKSDFSDADKAFAETLKVPFVIPEEFF"
     gene            complement(<957350..>958915)
                     /locus_tag="CAGL0M09647g"
                     /db_xref="GeneID:2891329"
     mRNA            complement(<957350..>958915)
                     /locus_tag="CAGL0M09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449765.1"
                     /db_xref="GeneID:2891329"
     CDS             complement(957350..958915)
                     /locus_tag="CAGL0M09647g"
                     /inference="similar to AA sequence:UniProtKB:Q03795"
                     /note="similar to uniprot|Q03795 Saccharomyces cerevisiae
                     YMR155w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449765.1"
                     /db_xref="GeneID:2891329"
                     /db_xref="GOA:Q6FJ29"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ29"
                     /translation="MTDSTTSAGLLILSAALVSLGAGTPYLYSFWAPQFISQCHINAG
                     SVSTLSYSLNIGSCILGPMAGYIVDQSPKVACAIGSGATLLAYIVVKICYDRAIGNVP
                     LISFALALIGFGSVAGFYAAVKCCTAMFPRNRGSATAIPIAMYALSAMIYSTIGTTIF
                     KQEESKFFVFLILSCPALIAVGATSFVMPETKYEPIVEDSSGLQAAPVIEGLSNADIW
                     SKNMNLNIELRDTRKTFSPGAHEGVTLSPYKIRDDDDLTQRGLTPSSFDIDTKIEDMH
                     TPSSNQLELTIKQQVLSAQFFSYYLVLMILQGFGQMYIYSVGFLVTSEVEYANSFGAG
                     FNAETIQSIQVTILSLFSFLGRLTSGTISDFLVKRWQLHRLWNIAIAAFLAIIASLIL
                     MKNFDSPAITPGISAAKLGNLQKIYLSSLLIGLMFGIVFGTFPLIVADTFSQKHYSTI
                     WGLLTTGGFVGVRVLSNILSSNMVKNIPLGSTENVCTNSTHCYQDTFKFTASIVSTAL
                     VAIFVIIYKHRRY"
     gene            <959603..>961744
                     /locus_tag="CAGL0M09669g"
                     /db_xref="GeneID:2891330"
     mRNA            <959603..>961744
                     /locus_tag="CAGL0M09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449766.1"
                     /db_xref="GeneID:2891330"
     CDS             959603..961744
                     /locus_tag="CAGL0M09669g"
                     /note="weakly similar to uniprot|Q03792 Saccharomyces
                     cerevisiae YMR154c calpain-like cysteine protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449766.1"
                     /db_xref="GeneID:2891330"
                     /db_xref="GOA:Q6FJ28"
                     /translation="MNVDRCWEQYYKTLKLIYLEENKETCQREIDHLVDTAIELKEKT
                     YSNAVLDLGRQFREVCPKARIMWKTSSIAGNFYPPISISDIYSPVIANVFDQTTRLEC
                     RRQEYSLRMPLQEEPNFTGIQQHAQVSDCSLVVSLININRYKTTMPVVKQVAENLYAT
                     NLYFNGAQRRLVLVSTENIPTMQDDPTKQMSVHSANKINKILELGLLKLTSLSYHSEG
                     SNTAIDTYRLCGWIPDISSINEFNFLKVHKAFSRGECLIAMGTGGFVPKENIFGVKLR
                     KYHDYAVLDIDMINEVVTLRDPLISDTLLTINFDSIRKYFLQVYCNWDSSKLFMFTKD
                     TQIFYSDKKFNPYQTLAGKPTFYLKNNSDRDEYAWVLLEFHLDKNNNTTAYLQEIPDR
                     ISTVRLGYNDNSAETGFQLIKIRLKPKQCIWYFCYSSTDKMLTFHTYSTSSDVVFVRS
                     KMPGCDFDVTECAILPENIVPMQYPNHSETDIYYLASIDFSIEGEPGITIITDMVVCL
                     ETDDDLVNFQMFHWDDLDFNSPIYDEFYMNERMFEKKDLPLTSGERYRIVASTARPPI
                     SKGYQCAVSGINIHADYPCSYKLRESDVRYNSMMFKLPHVFTLASTGITKISLVNRNK
                     YNKVFMRIYPQTQEDYRYNYRVISADTGEDLVKPGNNIQKLYGGIVIKEFLVSDQTNL
                     ELHLSFQDNGRVPVELKCQLYVGSVKIITLS"
     gene            complement(<961939..>963159)
                     /locus_tag="CAGL0M09691g"
                     /db_xref="GeneID:2891331"
     mRNA            complement(<961939..>963159)
                     /locus_tag="CAGL0M09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449767.1"
                     /db_xref="GeneID:2891331"
     CDS             complement(961939..963159)
                     /locus_tag="CAGL0M09691g"
                     /note="weakly similar to uniprot|Q03790 Saccharomyces
                     cerevisiae YMR153w component of the karyopherin docking
                     complex of the nuclear pore complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449767.1"
                     /db_xref="GeneID:2891331"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="PDB:2M4M"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ27"
                     /translation="MFGNSAGFGSVGDNSSGGSGANRDANNRPSWFQETARRTIPNTV
                     LRREVKSSSNSGEDDNGNRGDSTSTGFNTLTFGAKKHMLLGSSNVSTGGNDHMNPLLM
                     DNSEAPPTVSISDWKREEGLFDLRNTRNENTINTIGTPTFISPISREKSEVSLFDSNS
                     QSRSSSASSIGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMR
                     TPGYFFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHE
                     LISELSRDTYNSMNDVKQTNSISTNQLTQHNQSEVPKSNQTFETKPTNETERNQIKTP
                     SAFGSDNKGNGSISSGRTKRRLSIKDGSSLFLSGTDNIFSTLDGQPTKKRMINRDRSL
                     IGKISGWLFGWNDL"
     gene            complement(<963527..>964633)
                     /locus_tag="CAGL0M09713g"
                     /db_xref="GeneID:2891332"
     mRNA            complement(<963527..>964633)
                     /locus_tag="CAGL0M09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449768.1"
                     /db_xref="GeneID:2891332"
     CDS             complement(963527..964633)
                     /locus_tag="CAGL0M09713g"
                     /inference="similar to AA sequence:UniProtKB:P28625"
                     /note="similar to uniprot|P28625 Saccharomyces cerevisiae
                     YMR152w YM27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449768.1"
                     /db_xref="GeneID:2891332"
                     /db_xref="GOA:Q6FJ26"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /translation="MVQQRSITFVDGYSKPAITTTELDLDNCFKDDEIVIKVKCCAIN
                     PIDMVVYGLSTTWLTGCKPKTFGRDFSGVIVRAGSRVDPQWKVDDEVNGQYVHLLGDR
                     GSFSDYLIFNPAKNKSIAHMQKFPRGEGALNYNEGKYDDWVLNASFPLVYGTADSVLA
                     DYIKKWTPESRILVIGASTQVSNCLIQIAKRHYNIGTVVGICNKNSFEYNEKFGWDHL
                     VSYNDGKTIENVTKLMEEKLGGEKFDMIFDSVGNTDFFPVIDKFLKPKSTGSYFLTVV
                     GDNKLDYKNPTFRRAMPLSVAWKKINPFLGFNYSTVLVKPIDRYMKLSTEMIQKNQFE
                     PVIDSVYEFDQYQEAMDKLLTNKAKGKIVIRVNK"
     gene            <964915..>966207
                     /locus_tag="CAGL0M09735g"
                     /db_xref="GeneID:2891333"
     mRNA            <964915..>966207
                     /locus_tag="CAGL0M09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449769.1"
                     /db_xref="GeneID:2891333"
     CDS             964915..966207
                     /locus_tag="CAGL0M09735g"
                     /inference="similar to AA sequence:UniProtKB:Q02574"
                     /note="similar to uniprot|Q02574 Saccharomyces cerevisiae
                     YLR288c G2-specific checkpoint protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449769.1"
                     /db_xref="GeneID:2891333"
                     /db_xref="GOA:Q6FJ25"
                     /db_xref="InterPro:IPR007150"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ25"
                     /translation="MKLKLEINGNDYPENFKLLKTTVTTVASLRSLAVLRFDSDRLVI
                     ISTPRVSNGVVAGHGVVARDSGELWCTIPRDVFSLYHVSAERQNNTIALECNVESLKN
                     AVLRYDKVMTQGSASTLQLKLRQMPEWNAASANGPDSAGNSRIRVAALAVSFEELVNV
                     YSGQGKDDAFMDATQNNTSHAVNKLISHSSKIPVRFLNAQQDERIQEPMMDYNQTMLC
                     RLPSITDEAGGAFLNFLKRIERYTNVNHIKLQGSTSPHISHNRRDAKLRILVDELDWN
                     LVISWNGPLELQERADIDEMAEPTSPERPRSETPLLSRISGDNNFDRIDDSEVNTLQE
                     SGPDTNSHTNGFLEQVQQAEDESSLVQEVIIRSKDLKVCSKLFAAFEEVIMAISHDYA
                     CVFHCSLSRGLRDTQTQEEKENGQIIYYISRSKALEFA"
     gene            <966493..>967554
                     /locus_tag="CAGL0M09757g"
                     /db_xref="GeneID:2891334"
     mRNA            <966493..>967554
                     /locus_tag="CAGL0M09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449770.1"
                     /db_xref="GeneID:2891334"
     CDS             966493..967554
                     /locus_tag="CAGL0M09757g"
                     /inference="similar to AA sequence:UniProtKB:Q05881"
                     /note="similar to uniprot|Q05881 Saccharomyces cerevisiae
                     YLR287c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449770.1"
                     /db_xref="GeneID:2891334"
                     /db_xref="GOA:Q6FJ24"
                     /db_xref="InterPro:IPR026907"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ24"
                     /translation="MGEEVTFAELKELAGSIKEQFVDPYKNDIGALKKISSETKLQGS
                     DPLTELEKLAKILKAYSTKLGIICEPSKLHGNYHAAYTELKNYADSLFYLLSLLPLFT
                     REQGKLYASYLNEDVFTQVLGLLNGTEMLCDEICSSSKENEGDNKDRLISVGIIWASC
                     DELCDIVKGGNYGLLSKRIALSCGLVDDVLEDIHGWLEDPQLEGADDFLGDDLDSIDE
                     LEDGVKKMGIDGDDEEMIEIVKKFLSEWQTKIKMIKLLLSSFSKSITLTTGKNIPNLG
                     SKLDELNKLHKQVILHLDELVSDVFMSGAAFDEDEMGPSIADLNDTLAKMVHIIKEIS
                     KQDPKKSKWIDVWNNKYFE"
     gene            <968440..>969993
                     /locus_tag="CAGL0M09779g"
                     /db_xref="GeneID:2891335"
     mRNA            <968440..>969993
                     /locus_tag="CAGL0M09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449771.1"
                     /db_xref="GeneID:2891335"
     CDS             968440..969993
                     /locus_tag="CAGL0M09779g"
                     /inference="similar to AA sequence:UniProtKB:P29029"
                     /note="similar to uniprot|P29029 Saccharomyces cerevisiae
                     YLR286c endochitinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449771.1"
                     /db_xref="GeneID:2891335"
                     /db_xref="GOA:Q6FJ23"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR005089"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ23"
                     /translation="MIQILLPLLFILSTVFAFDINSKTNVAVYWGQNSAGSQKSLASY
                     CQNTEADIFLLSFMNSFPAIGLNFADACTTTFPDGLLQCSQIAEDIKTCQSLGKKVLL
                     SMGGASGAYGFADDAQAEAFATTLWNTFGEGSDISVERPFGQSIVDGFDFDIENNNGK
                     GYAALVSKLRQLFSNGSKQYYISAAPQCPYPDASVGDLLANADVDFAFIQFYNNYCNV
                     EAQFNWDDWKNFAINTSPNKNIKLYLGLPGAPSAAGSGYISNLDNLSKVIKEISSLAN
                     FGGISLWDASQATSNVIDGADYLSQMKNILKSAAGSTETPTTSSSYSMPSNLITNTGE
                     QSSSVLVSSVERTTTTLEPTSIISSSSFSDSAPTPTNSHITTTLQPNTNTPPAAAQDS
                     SANVQVSVTPSTTTTTPDSPSNHLNDVSPTPSTPAPSSPANPSPDTPAHTIAKQLNAQ
                     YAAGQFNGKSSCQDGELSCSADGKFAMCAHGSWVEMACAAGTTCYAYDSGNSVFTQCN
                     YVDLKASFV"
     gene            complement(<970260..>971030)
                     /locus_tag="CAGL0M09801g"
                     /db_xref="GeneID:2891336"
     mRNA            complement(<970260..>971030)
                     /locus_tag="CAGL0M09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449772.1"
                     /db_xref="GeneID:2891336"
     CDS             complement(970260..971030)
                     /locus_tag="CAGL0M09801g"
                     /inference="similar to AA sequence:UniProtKB:Q05874"
                     /note="similar to uniprot|Q05874 Saccharomyces cerevisiae
                     YLR285w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449772.1"
                     /db_xref="GeneID:2891336"
                     /db_xref="GOA:Q6FJ22"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR025784"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSDTESLNDALGLFDEPEDFRPEKPKEHYANYERIDVPDISKSK
                     ITNLKLQLVGSSPLWGHLLWNAGIYTARHLDKYPELVSNKNVLELGAASALPSLVAGL
                     IGAKRAVVTDYPDADLMANIQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDK
                     KFDLIILSDLVFNHNQHDKLLQTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKE
                     YGLTPEKIEMVNWKPMFEEDEETAEVRSRVYAYYMTHA"
     gene            complement(<971284..>974670)
                     /locus_tag="CAGL0M09823g"
                     /db_xref="GeneID:2891337"
     mRNA            complement(<971284..>974670)
                     /locus_tag="CAGL0M09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449773.1"
                     /db_xref="GeneID:2891337"
     CDS             complement(971284..974670)
                     /locus_tag="CAGL0M09823g"
                     /note="highly similar to uniprot|Q06685 Saccharomyces
                     cerevisiae YLR410w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449773.1"
                     /db_xref="GeneID:2891337"
                     /db_xref="GOA:Q6FJ21"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013651"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ21"
                     /translation="MQEEAKSPSNGQFLNKYTKKAMESIAPILEGFTPKTSSSENMSL
                     KLPPPMLDDKPPMYRSGSSNSHCDLSIDEGRKEGAGKTRSYSATVAAHAVAKMRQLAL
                     ENPPSSDGSGNTSRNDSAVTSPANTPITELPPQSNIPSNTSSRKSSTSQAKPSLPKIG
                     KIGVCAMDAKVLSKPMRHILNRLMEHGEFETIIFGDKVILDETIENWPTCDFLISFFS
                     SGFPLDKAISYVKLRKPFIINDLTMQKVLWDRRLCLSILNASKVPTPRRLEISRDGGP
                     HVDDELHEKLKMLGVEIKPVEEPNWRMVDDDTLEVGGQIMRKPFVEKPVDGEDHNIYI
                     YYHSKNGGGGRRLFRKVGNKSSEFDPALLAPRLEGSYIYEEFMDTDNFEDVKAYTVGE
                     NFCHAETRKSPVVDGIVRRNTHGKEVRYVTELSKEEKQMASRVSKAFSQMICGFDLLR
                     VGGKSYVIDVNGFSFVKDNQEYYDSCARILKETFIQAKKQIDIEKQTLPVIREEKKQK
                     WVFKGLVTVIRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRKVNDLKIVLQALRI
                     ALEEKAGNPTKIKLLANTLEKKLELPGTKIQLKPVLTQNNEVEKVQFILKWGGEPTHS
                     ARYQATELGEQMRQDFDLLNKNILQDIKIFSSSERRVLVSAQYWATALFGADEFSSDE
                     INIRKDLLDDSNAAKDIMDKVKKKLKPLLREGKETPPQFAWPAKMPEPYLVIKRVVEL
                     MNYHKKIMDHNFETKDVSKLQERWCTSEDPGLFKERWNKLFKEFVSVEKADPSKISEL
                     YDTMKYDALHNREFLQNIFDPGELANENISNHSLVDRYPINVLARNNFKIVDSSYAAG
                     TSSSSKTSVGSLGWVLESGKTKVNSESKSASPFDGQKYVQFRELYRLAKVLFDFICPK
                     EYGIEDAEKLDIGLLTSLPLAKQILNDIDIMKNKEAPACVAYFTKESHIYTLLNIIYE
                     SGIPMRIASNALPEFDYLSQINFELYESTDANEVKSHSIRLKMSPGCHTQDPLEVQLD
                     DRHYISCIPKMSLTRHLDMEYVQQKLRNKFNRVNMPSKFTPVNITSPNLTFRRESLTK
                     TTTKRVKSGSVSASATSSPPPVPLSSNSSSTTSIDNTLGK"
     gene            <975007..>977817
                     /locus_tag="CAGL0M09845g"
                     /db_xref="GeneID:2891338"
     mRNA            <975007..>977817
                     /locus_tag="CAGL0M09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449774.1"
                     /db_xref="GeneID:2891338"
     CDS             975007..977817
                     /locus_tag="CAGL0M09845g"
                     /note="highly similar to uniprot|Q06078 Saccharomyces
                     cerevisiae YLR409c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449774.1"
                     /db_xref="GeneID:2891338"
                     /db_xref="GOA:Q6FJ20"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007319"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ20"
                     /translation="MSEVAKRRKLTSTKRYASKIFSPFRVIGNVSNGTPFAVGSLGST
                     FYIVTSVGKSFQIYDANNLHLLFISDRETDEEISCLEAHFHYVYAGFGGKVGIYKRGI
                     LEHTIEVGNGCKVTKLCVFGDYLCVSTDNNEVHIFKKENSTTDKYATKFYTKFEIPEL
                     VGGDIVSVLHMPTYLNKIVVVTKINVLLYNVRSGKLLYSSPDFPDQLTVGEAAPALDI
                     IALGTISGEVILFNLRLGRKVRTIKVPNMRISSISFRTDGSSHICVGSSKGDILFYDL
                     NRRARIHLLKNVHSEEFGGVTRASFLNGQPIIVTSGGDNSLKEYVFDPSLSQSDEDMV
                     VQPPRFLRSRGGHSQPATSIAFADDESHFILSASRDKSVWAFSLRKDAQSQELSQRLH
                     KKNDGNRVAGSTMREKFPEVSSIAIENARIGEWENILTAHNESKAARTWDMRSKRVGR
                     WTFETIDDGMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAV
                     DGMNRKMVSCGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCAFALDDLSIV
                     VVDTVTQKVVRQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIE
                     SVATNLKFSPNGDMLATTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVS
                     GNSQFLEGAFQDGGDDHEPLDINNYQSVEQVNSELVTLSLGPRNKMNTILHLDVIKKR
                     SKPKEAPKKPEKAPFFLQLAGDKVGDEASGREGISFETPEEIRAREEKQKQSEEAQAE
                     LTKFKPGTNRGFQSKFTKLLLHGNKQNQYEEFLEYLVSMSPATLDLEIRSLNSFEPFE
                     EIIAFISALTAGLKTNKNYELYEAIMNLLFKAHGDVIHANNTNCDLQDALSQWETVHG
                     TEQKMDELVKFCSSVLDFVSRS"
     gene            <978062..>978382
                     /locus_tag="CAGL0M09867g"
                     /db_xref="GeneID:2891339"
     mRNA            <978062..>978382
                     /locus_tag="CAGL0M09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449775.1"
                     /db_xref="GeneID:2891339"
     CDS             978062..978382
                     /locus_tag="CAGL0M09867g"
                     /inference="similar to AA sequence:UniProtKB:Q06071"
                     /note="similar to uniprot|Q06071 Saccharomyces cerevisiae
                     YLR408c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449775.1"
                     /db_xref="GeneID:2891339"
                     /db_xref="GOA:Q6FJ19"
                     /translation="MPPSTELDALVDKIVNDHSLSEPGQSLKELGDNGKYIMDVQMKK
                     LLKLHDQSFIERCFTPMEELKNRYAKVKERSGDLQKEAELVDRDIRIIEMAIQDINKN
                     KSHQ"
     gene            complement(<978795..>979652)
                     /locus_tag="CAGL0M09889g"
                     /db_xref="GeneID:2891340"
     mRNA            complement(<978795..>979652)
                     /locus_tag="CAGL0M09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449776.1"
                     /db_xref="GeneID:2891340"
     CDS             complement(978795..979652)
                     /locus_tag="CAGL0M09889g"
                     /inference="similar to AA sequence:UniProtKB:Q06070"
                     /note="similar to uniprot|Q06070 Saccharomyces cerevisiae
                     YLR407w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449776.1"
                     /db_xref="GeneID:2891340"
                     /db_xref="GOA:Q6FJ18"
                     /db_xref="InterPro:IPR025124"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ18"
                     /translation="MIGGKSSPKSMKNSIGSTLRKWRSTLRKVTHDTLNSLDEVTANE
                     EKIDALFDGEGGKTVNWGPVRTSKNGLVQVHEEDMLEEDVTNDLKSSSFGFEKSTTAQ
                     PVGIQGLLKSGSIEQISSGSRSLVGGVGGTSMRLSEESEEGGSTTGTSNKHEQLTIMK
                     SSSGGSQGVSHKEKLTYDNFDAVAECNKLRQRSDKPFVGGPKIWEKRRKLWCEPSVSA
                     EEIAHRRENGRGVFDAIPEAYHTSVYKKLVVDNKPLKEPLNLSHAMKVINAGWIDTKK
                     WANAGKGLP"
     gene            complement(<980073..>981107)
                     /locus_tag="CAGL0M09911g"
                     /db_xref="GeneID:2891341"
     mRNA            complement(<980073..>981107)
                     /locus_tag="CAGL0M09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449777.1"
                     /db_xref="GeneID:2891341"
     CDS             complement(980073..981107)
                     /locus_tag="CAGL0M09911g"
                     /note="highly similar to uniprot|Q06063 Saccharomyces
                     cerevisiae YLR405w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449777.1"
                     /db_xref="GeneID:2891341"
                     /db_xref="GOA:Q6FJ17"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ17"
                     /translation="MIEVPVPKELTKENDPLHIIKTRAQTHGRPATIAGPMVRYSKLP
                     FRQTCRQYDTDIVYTPMILAREFVRNQQARIADLTTNKNDTPLIVQVGVNNVGDLMKF
                     AEMVAPFCDGIGINCGCPIREQIREGIGCALIYNPDLLCEMVKSVKSKYGAKLRLETK
                     IRIHDDWDVTVNLCRRLCDSGVDWITIHGRTRTTRSSQPVNLEAIKYIVDKIKDKNVP
                     VVANGDCFTMKDFKHISDYTGVQGVMAVRGVLANPALFAGHDKCPWGCVEWFWYWTTE
                     YNTLPFALTQHHLYCMLENMGIRRKLLKEMMLQRSYPELLDWFDTNFVMHRHGDKEFG
                     TTIDPQLKTN"
     gene            complement(<981376..>982197)
                     /locus_tag="CAGL0M09933g"
                     /db_xref="GeneID:2891342"
     mRNA            complement(<981376..>982197)
                     /locus_tag="CAGL0M09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449778.1"
                     /db_xref="GeneID:2891342"
     CDS             complement(981376..982197)
                     /locus_tag="CAGL0M09933g"
                     /inference="similar to AA sequence:UniProtKB:Q06058"
                     /note="similar to uniprot|Q06058 Saccharomyces cerevisiae
                     YLR404w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449778.1"
                     /db_xref="GeneID:2891342"
                     /db_xref="GOA:Q6FJ16"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ16"
                     /translation="MKFNLTRPLQIAQWVSYILGVGILQIVVILPLAVLLFHDFYTRL
                     LPSDSSVWVPLDNFNSNASGLNTRFKQGIVCVSPDKQLPGLKPNGLSQPIALRCHTNY
                     KLDMKLEFYCHSLDAIGNSKGTDLQYAVVSLSDDSNLFYRYRQPVICRNQGATNVLEG
                     NNHAKSRMEVLRNEWLNSLSLEDIADISPQLENIEISIDLPNSNGEILLEPTSGILLR
                     RSFEQGLRNWMLRRWRTTYIIGTAVFYISLSFIFVITCMATFLIFTKVYGKHQKQ"
     gene            complement(<982943..>984334)
                     /locus_tag="CAGL0M09955g"
                     /db_xref="GeneID:2891343"
     mRNA            complement(<982943..>984334)
                     /locus_tag="CAGL0M09955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449779.1"
                     /db_xref="GeneID:2891343"
     CDS             complement(982943..984334)
                     /locus_tag="CAGL0M09955g"
                     /note="some similarities with uniprot|P32432 Saccharomyces
                     cerevisiae YLR403w zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449779.1"
                     /db_xref="GeneID:2891343"
                     /db_xref="GOA:Q6FJ15"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ15"
                     /translation="MEYNSLMMDAHDVGEYEMGDAFKATHLNVKDGGGQRMSYSVSPS
                     SRPLMTAGEEVVHHIPTRGPSDAQAARLRRDSIAHSQGIGGVSWGSLSISSWLRDEVM
                     LQHPSSQQSYQNQERKFSINNGLLQIQMNAPIGQGPISASTNTFLPHLEEQYCKDYSC
                     CGISLPGLHDLLRHYEEAHISTSPGTSMSRPVGGSDASMGMSTGTVQTRNLMDRSMGS
                     HGMSPPTPMSSQSKIGSNTSINMHQISGANNNNNIKSKYMVNRGHNSNNIVDTVSTNE
                     VFLNNGRGTTSMETSRGTQPIHKHAHPQALQNMMMPPNNGSTQGLHSSNVDIAIDDDD
                     DDEDDDDDDEDDEEEEEQDKKEFYIDDPARRLYVMDHEEYKPFKCPVIGCDKTYKNQN
                     GLKYHRLHGHQNQTLRENADGTFSVIDPESNEVSTLDAMGNDKDKPYRCEVCGKRYKN
                     LNGLKYHRGHSTH"
     gene            <984997..>986919
                     /locus_tag="CAGL0M09977g"
                     /db_xref="GeneID:2891344"
     mRNA            <984997..>986919
                     /locus_tag="CAGL0M09977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449780.1"
                     /db_xref="GeneID:2891344"
     CDS             984997..986919
                     /locus_tag="CAGL0M09977g"
                     /inference="similar to AA sequence:UniProtKB:Q06053"
                     /note="similar to uniprot|Q06053 Saccharomyces cerevisiae
                     YLR401c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449780.1"
                     /db_xref="GeneID:2891344"
                     /db_xref="GOA:Q6FJ14"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /translation="MKRELEGSYESERKRGVAQVKAEYVVGAASNVRVDEEEAGSERF
                     VQGEFGGKKNKKKRGQNKNRDNRQQKETHALCPKYVLADVTNQVDLCTFGDNCRFVHD
                     IPTYLEHKRPEITDSVFKTCPVFETLGYCPMGFKCRFLSSHMDKETHKLLGEYPSDLA
                     SASHEINHITQDQKYDLIKKRFPFSKSELVLEILDSFQEENREMHREAEKVKEDQQDN
                     EDEQKEKAPQVVQRELEAQKRRQRQKDLYLQYKDTRFFAQEKKPLDLRHKKIVSPLTT
                     VGNLPYRRLMRTLGADVTYSEMALAVPLVQGTNSEWALPKAHESEYPGFGVQVACSKG
                     WQASKAAEALATYIPNGISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYV
                     SGDIPITVKIRTGTKEGHPIADTLVRRLVFETDVAAITLHGRSRQQRYTKVADWDYVS
                     QVAKALRQAEADFMESPQGKESHHDEKTRHTQFVGNGDIFNYTDWYQHLEDPEVDSCM
                     VARGALIKPWIFEEINAQQHLDKTSSERLEILKTYSKFAMDHWGTDEYGIALGRRFFC
                     EFMSFFHRYIPVGILERVPVQLNERPPLWKGRDDMETLLGSSDVKDWIKLSEMFFGPT
                     EDSFVFTPKHKSSSYK"
     gene            <987540..>996914
                     /locus_tag="CAGL0M09999g"
                     /db_xref="GeneID:2891345"
     mRNA            <987540..>996914
                     /locus_tag="CAGL0M09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449781.1"
                     /db_xref="GeneID:2891345"
     CDS             987540..996914
                     /locus_tag="CAGL0M09999g"
                     /inference="similar to AA sequence:UniProtKB:P18963"
                     /note="similar to uniprot|P18963 Saccharomyces cerevisiae
                     YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
                     YOL081w IRA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449781.1"
                     /db_xref="GeneID:2891345"
                     /db_xref="GOA:Q6FJ13"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ13"
                     /translation="MSHFGKSGHRRFSSSGNKPDSRHVSAHHRVPPPRPPRPTTPITN
                     ATPNVLSPESGQSSAGSRGSHRQSLSNPIGKSKMTETLVYHLFFDRILPVLPVESTLT
                     TYREVESDQFFISCRGVIMNVALSRDLNPVIDYSLQLIESLTESRELISDEINEDVAQ
                     SVLVLLRLLSDTLEFCWESKESPEDKVKDEPSFENIPIDDNKEYVNMGEQARAGNMFT
                     GSTIGYSTHKPGFHRVPPPQIDSTLATRLLSVCTRLKYNTRTLRVLKNMSKNLYGNGT
                     ITYSSVLPKFQAWLKYHNYPKYTETVDLTIDYILRFIAAANPADYDKYVDSKVTNPLL
                     ISHTLTELGIVKYLDFFGCVFLTPENVGPFLETLRHLSGFMKRTIFHSLLLYYSSKAF
                     LFWILSRPNEYVQLYYALQNLDSSKSNTFHQGNSNSSIATIPYCVSVLFDDIYSTFNV
                     SSLLTNIYDTRGHNGSTTQPVETEQSQATSPGSTNPVLFSPTLTSNDGIITSPTMGSN
                     QIASPLSPLPMSLDFNSRTQAQGFPLEETASIHSSKRSYNIDESVYSTMGSTHSNINT
                     PTTNASFTHPNEDEIPTSGSGHLQYVLELFSNYEETELSSHTSILRFLLSLILLDTDV
                     FTDINAMTFRYIPDTSKIIQQYSQKQGTRDAGAGTHMQNDDPSKEKEKNQSIKQITHG
                     LKKLTNLSSSKKKTVKFITMLIRNLNGAQMVSDVSLVDSLKTLVALVTLTSSISLIDS
                     NLPSVLFAKRIFSILGHNLDVGKNWESKTNGFIASCTERNPISHRRLQLEFFAAAIQL
                     DSDKLLSHIHLERELAGLNLRRLLLYTEGFKVFFNLLSSDVLRKKVALSSSNFLKSLF
                     CIIADILLKAFPYFDAKVTSIVSSILDGSILEKYDTIKTLAGLEPSNPPVLDRTDSSV
                     KLKLQKKITNWDVHEVLPTLSAVSSSSDINLSDTGKSIAESTERRSNTSTPAHTSTPA
                     NLTHNPLSTIASPPSTPGSIGNYRNNPGMNVLSPHARRLQNVKIDSPQVEGERTRQSP
                     YYFGATSTGEYSNQSVSHSSLPKTTRSSGSQEKSRRSSDDKNKPQLKMQDSDDVIVLK
                     TNENDDARRIMINIFSIFKKMTNYFILPHDQNLNTIWVSKDFRNIMKPIFVAIIDTDT
                     RLQTTAQSFMDVLIRYISKFSSDITARSLNEHYLLCNYTITLFAASLFDLKLDNKKRE
                     IILRIVVKFLNVKSDLSRIAAQKDLQYALYSTELVTFPLLTATVGGGLFISLYCNKGE
                     IPRLLKKGFGEFLFAINCYEKHVGEIDRTCIYNLGFIVAMSRDNYAASGSVAFQRRLR
                     NKILHHIKRPDTILLDAMDVIYRKWSSYMRKENITQEELIDFRSLAGILASMSGILLS
                     FGETSTDNVPHLFEFRGDLIKKMDYFVFKQCQWLNNPDLLTRENSRDILSMELHPLSF
                     NILFDNLRIKIEELRSVNLSQKVHESSFVLLEQIITIVRTVLNRDDDERIMLLFSIRV
                     VSTIDQLSDLVEKIPHSSVKYYKAIIQMAKLFRAIQHSEISLGIKNHFYLKNKWLKLL
                     TNWFKVTISIDYDFDNLSKPLREMDLKKRDLDFLYIDTAIETSKAVAYLTENVPLDIP
                     PSASKDELERASTIVFGNYFTIFLKGLEKSTDIQRFPVSLKHKITILNENVILSLTNL
                     SNANVDASLQFTLPMGYSKDKNIRIAFLKVFINIVTNYPKLKVESERKKLYAVDQLVQ
                     YLIEHPHLAFQAGIICPASDVDAFVAGLVNGFDSRNASHILVTQLIKDEIDRASRYAD
                     VLRRNSCATRALSLYARSKGQSYLVRTLKPVLDEFFESRDSFEIEKILPDDPEAEKNV
                     DMFIHYMSKLINAITESVDYFPPELINICQTIFHSVKEKFPDYSFIAVGSFVFLRFLG
                     PAIVSPDAENIILISQTRDKRPLITLAKVLQNMANGSENLTRWPILNKKLDIFKDFSN
                     RIFEFLSKICTIDSKPNIEIRRDPEPYYFEFNFLHKFLYEHELEIRKMIVESLVSLDD
                     FDYVRKTFLFVDDIMGVLGRPKVELKNEIPPYIVEHMEENPHLYEFMNRNAFKNVSLG
                     DEYEPFMHESMSLDGLPIITITFRKFEAENIEVDAIVYRTIQVYSKMWMTKHYLVLDC
                     TGSDSIDMNYNKLTSLFFSLLPDIAIENCIGAIYFNVSENFMNQWVNVLRGDNPYLVA
                     QVPHHFINSSSDQEQVKTLGLTGKGADVVQDTRVSLHDISLYHEDTKNLENVSLKIGN
                     RYIQILHEATKQYKLHALNQILNIPFNDVYEIVDLATVGVSSITGLPNEFTINFINGK
                     RLVLVSKKYLEIVKMFNYAQLKIEDEYGTESQNRELTSTHEESYVKESQEIICHLSLV
                     ILNGLFNDDNEVKNISYNLLVVTQNAFNLNFGSRFQKAPEVYVPDNTTTFLSTIARAL
                     AESSPELTLHMWTYFLEGLENDVIPHEHIPTIICCLSYWVPNLYRYVYLVDEEEGANN
                     LSKIIRSLIQLTVKDPDFTTVYLQQIWFLLVLDDRLTSVTVEEFVTHALDRDSESRDW
                     KKAVSLLTAFPTVEVACQVIGKLMDIIKSFLPSLKMEVSTHSWSELEILVRISVSLFF
                     ESPLLTQMCLPEVLFIISLLIDIGPTHIRYCLHELLMNICHSLMINSSLPKENSERLD
                     GICAVFARQKLNFMSGFSQEKGRILPNFSASSFSSKFGTLDHFVTNVFKLMEYGSTSE
                     AAQWKTKYKKYLLGCVFNHESFLSARAIMILGIIGKIDTNEILCRDLLAETMKIFAEP
                     VVTDEQLFVGISHIFTYSKIVAGLDPAGQMLPRMFWLATVFVESPHPILFEGGLQFLI
                     NCLKHLYEYHYKINNTEKLISELLIESRSFASELLEELEGYTDCLWTKDNFEHLILGF
                     ITRGLSLAVLRGVALDCLMTAFKYSFREHQMIPRTSHHLNYLFLLYLVSNQETFLNLL
                     DSVGFESDYIELDDNIKIPRALVEWISSDNECSNITLYQGALLFASPASDEPSKLRFE
                     LLTRYLLGISPKCVFRYYFVTRQELRRISSLEQQSDSSTIAFEIAGMLVMHDDFDILD
                     IYNKDSVQLLKSRGLFSLTKVNIFGRSFEDIMNSLQENSDQIYNRKRLTTLIISKIIY
                     QSQLTL"
     gene            <997486..>998997
                     /locus_tag="CAGL0M10021g"
                     /db_xref="GeneID:2891346"
     mRNA            <997486..>998997
                     /locus_tag="CAGL0M10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449782.1"
                     /db_xref="GeneID:2891346"
     CDS             997486..998997
                     /locus_tag="CAGL0M10021g"
                     /inference="similar to AA sequence:UniProtKB:P38277"
                     /note="similar to uniprot|P38277 Saccharomyces cerevisiae
                     YBR138c High-Dosage Reductional segregation defective"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449782.1"
                     /db_xref="GeneID:2891346"
                     /db_xref="GOA:Q6FJ12"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ12"
                     /translation="MDDQTRLRVFEPLDCNSFVSATPNSTHLSKLSVQTPTTSSFIRN
                     PYERDQTALENQSGSELLRWKYDQREFMFNSNSTPSKNSNSQTEKYEFPITEKLVKNK
                     NPGCKRRTNQLIGAKPSRPSGLQNVTSKLELLDETHFTSLPIPAPKGTKIDNSAILSD
                     IIDDNSDDIITADDSVILPSKRSFRTPANEIKVHNNGNKRYISYKYSNRYPERESSPS
                     EQMISSGKDTHPIVIVEDYLLSDSERSFTESTRKRKRYNSNNDGLKPKLSLHNLKTKI
                     RSSNTDHLPVKKKVHYLKECSTVDSSTNEENEAGSSKCIKEVLNEFLPPKSNSADCDL
                     YISNLLSKGTNELKRCVICEKILYEVSSLLYKENDFKELVCGSCTEKYETIAKLLEGC
                     ELESTFEYSLDSSSFEANTLDSSLIQSSHTVCREVTPPHNSSLQHMRRDSFSEDLIKA
                     LQSQLIKNSKQIPENSIFPNKALSWFIDARRKLRWRWRVSGLLPEFTINNNNE"
     gene            complement(<999113..>1001089)
                     /locus_tag="CAGL0M10043g"
                     /db_xref="GeneID:2891347"
     mRNA            complement(<999113..>1001089)
                     /locus_tag="CAGL0M10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449783.1"
                     /db_xref="GeneID:2891347"
     CDS             complement(999113..1001089)
                     /locus_tag="CAGL0M10043g"
                     /inference="similar to AA sequence:UniProtKB:Q04093"
                     /note="similar to uniprot|Q04093 Saccharomyces cerevisiae
                     YDR444w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449783.1"
                     /db_xref="GeneID:2891347"
                     /db_xref="GOA:Q6FJ11"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ11"
                     /translation="MKKDGGLLLVHEKNSLGIGGMCRYILQVDHKKLKEDGIDTQELY
                     LRFKNLESPLLRPVYLTGPYAFYIDVRPCNYDEDKTYIGSEDVAFCSDLKPDEKFKAK
                     LYFNANSRLQTKNARDEIYSWTIDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKV
                     TSVRGLSLKMWDEKSLWNLPPKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMN
                     IEERYNPNVVVRGCMDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHS
                     LGGPTQSMAIHYISVMYPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGA
                     LGLTGRDLNLKYTPLTSNEGLSALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTL
                     YANIVHDGIVPLRTAALLYLDWRSLTQVKDIKKSAGEKSNNKITEDSPTDNESVSTTN
                     KDNKMGEIPSESPNSKNFLQWALPQVIIKGPKMNKFKRGQIMDTKSNESSDTDTESSD
                     SKQEQKFKGPSEASTFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQH
                     YLKRSTMKRVVYPNESVNRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNL
                     YGNVAVSHMVREHFGLEACKKQAGVNNNIKLTKL"
     gene            <1002184..>1002933
                     /locus_tag="CAGL0M10065g"
                     /db_xref="GeneID:2891348"
     mRNA            <1002184..>1002933
                     /locus_tag="CAGL0M10065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449784.1"
                     /db_xref="GeneID:2891348"
     CDS             1002184..1002933
                     /locus_tag="CAGL0M10065g"
                     /note="similar to KLLA0F09251g Kluyveromyces lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449784.1"
                     /db_xref="GeneID:2891348"
                     /db_xref="GOA:Q6FJ10"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ10"
                     /translation="MSHHCEDEHFEHDHDHDHGHDHGHSHEAPIATSAAQSLYEQIDT
                     PKIKCLNGVGKGATGKELYKYFIKPHEEKYNTEIYLESDADCQLIINIPFVNSCKVHS
                     VVLRTNANSSGYSTPRTIKIFNNFKKSLDFDTLSGESKVDFKTEHPNNVGVHKGEASV
                     TEDSSFVEYHLPRAQFQNCESLTLFIEDNWADDEDELSQLFFLEIRGEITGKLRPENA
                     VPLMTVYESAPNPLDHAKLESEVSDGLNLGK"
     gene            <1005238..>1006344
                     /locus_tag="CAGL0M10087g"
                     /db_xref="GeneID:2891349"
     mRNA            <1005238..>1006344
                     /locus_tag="CAGL0M10087g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449785.1"
                     /db_xref="GeneID:2891349"
     CDS             1005238..1006344
                     /locus_tag="CAGL0M10087g"
                     /note="some similarities with uniprot|P38749 Saccharomyces
                     cerevisiae YHL009c transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449785.1"
                     /db_xref="GeneID:2891349"
                     /db_xref="GOA:Q6FJ09"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ09"
                     /translation="MNNEPFDILGLMQGPHFSNSGDDIYTNGRMEVKYPPIGIDDEGQ
                     NISGNGIGLDYAPFTPAGLSGSGQSAMANFQQQNNINSAGFQTQLTPSNIELHNNLQN
                     LRTPPDIIKTEQSISPNLDFSTSINGNFNTNNSISGDSNNDKLNTTARSTFSHHRENS
                     NPGDNIDDKKKAQNRAAQRAFRERKEAKFKELQRKVRESEIDRDQLLKELEKLRKWNM
                     EINAENRKLLQKERLGNNGVYSGNMECSSSQSLPNMEQTTYIFPSTNECFEQSINQKN
                     LRDKNPEQIFERKPVYSAAGRFLQYEDEYPDDVLLTVPETWEYLSQLSENEEFDVHEV
                     MERLVGLEQCHPSGPAYSKQRIDNLVKQSIENNR"
     gene            <1006975..>1008366
                     /locus_tag="CAGL0M10109g"
                     /db_xref="GeneID:2891350"
     mRNA            <1006975..>1008366
                     /locus_tag="CAGL0M10109g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449786.1"
                     /db_xref="GeneID:2891350"
     CDS             1006975..1008366
                     /locus_tag="CAGL0M10109g"
                     /inference="similar to AA sequence:UniProtKB:P36075"
                     /note="similar to uniprot|P36075 Saccharomyces cerevisiae
                     YKL090w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449786.1"
                     /db_xref="GeneID:2891350"
                     /db_xref="GOA:Q6FJ08"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ08"
                     /translation="MAADNNLLMQLAEMFPDHRLETLARCLEDSNNDVNLACSMVISG
                     THISVGEDLHNDNTTLDELYSLFPQIPRDDIQTAYYEHKGNKEKLFDSNEVVLELLSL
                     ESIRNQKLEIDQPVLSSTVKADENTSKWGKTHNNIETIIRYTNVDRERASKYYTNNLF
                     SAPLAIISIIRDGYEQPIISKTNTTNRKTAFRKGAIRGGRVQSSHGIAHRKQNGLDLK
                     TENSFEHLCDVTDNMSDTISTVEAPTYEDVADLKKLLSGEQTLSAFNMEFINKAYRYY
                     HLNLDKLASLINYLKLNSASKLTFITAEKMSAESLQHSTDDVGMRVPYSKTIKKKSTV
                     NTSPALTKNMIQGKENFQIANKMVVEFFNTYKLDFHGFLPQEAVRIADICLTQWWAEE
                     LSNRELNAGKLNMKKSQYMSPVTLITGRGIHSAGGFSKVRIAIVKYLQNNYYIFEEFP
                     SYFIVNGKGKVFG"
     gene            <1008833..>1010461
                     /locus_tag="CAGL0M10131g"
                     /db_xref="GeneID:2891351"
     mRNA            <1008833..>1010461
                     /locus_tag="CAGL0M10131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449787.1"
                     /db_xref="GeneID:2891351"
     CDS             1008833..1010461
                     /locus_tag="CAGL0M10131g"
                     /inference="similar to AA sequence:UniProtKB:P35201"
                     /note="similar to uniprot|P35201 Saccharomyces cerevisiae
                     YKL089w required for normal chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449787.1"
                     /db_xref="GeneID:2891351"
                     /db_xref="GOA:Q6FJ07"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR025974"
                     /db_xref="InterPro:IPR028386"
                     /db_xref="InterPro:IPR028929"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ07"
                     /translation="MDYMNLGLRSRKTGIDVKKNLAKDEYSMENIDDFFKDDDTSFLS
                     RRKSRKSSLLPEADIQNRILPSPLTKQHNVRDTDGFKVPQNINVSHRSTIERAPTEFQ
                     HSVISEDIPEVIPYEGQSATPDRNIEPIDEDELANMPKPRYRSQYNLGAGNDDTDLIN
                     LTPEKDGRGTYNDVPDLIDDEGDTSKDNTTFNTSDHAMLEDEVEDGFVLESEEDRDYM
                     ESDEGSLADDTDDASDSGDDIGTQFAAEINRPGNESPLSSDDEDYISENSTGHNRLED
                     EIDNPSLPTRLSKPYDIVDGVRRSKRVKIPPLEYWRNEKIQYKRRRNEPVLDIDKVIT
                     YNHSESEEESEEEQKKVKKQRKPVTRTRPYNYVPNGRPRGRPRKNISDDPNGNLIRKI
                     ENGEEPKGEWLKHGMLEATVKNLHGEAKTELVAMAPNVSQSEETKASGEDDYSIEILF
                     DKYNEAFASGMLKVPVDGRKSPADSNTAFITFHVLDGIVEVTLDGKNFICTKGSSFQI
                     PAYNEYAFANIGSNEVRMFFVQVSPPSDFYSEHY"
     gene            complement(<1010688..>1013291)
                     /locus_tag="CAGL0M10153g"
                     /db_xref="GeneID:2891352"
     mRNA            complement(<1010688..>1013291)
                     /locus_tag="CAGL0M10153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449788.1"
                     /db_xref="GeneID:2891352"
     CDS             complement(1010688..1013291)
                     /locus_tag="CAGL0M10153g"
                     /note="some similarities with uniprot|Q03497 Saccharomyces
                     cerevisiae YHL007c ser/thr protein kinase of the pheromone
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449788.1"
                     /db_xref="GeneID:2891352"
                     /db_xref="GOA:Q6FJ06"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ06"
                     /translation="MSAELKSHKLDRSIGSNKAGHEHPISRNYVNNVHNANKHKLSDY
                     PMMLTITHIGTSRLSSSSSSSSSSSSNSSSSSSYSRGFISDNLSEYRSMDPKSPNRPV
                     RYRSIHSKYTSIREDTQHELVTDKEEIQNNKEVSINILSKPNKHTSIDYHNQGVDTTY
                     QINSGQISRHKQMSKSLPNTPKPLQYQKSLSLSHSPRKLSLKSPSRNFSFKSNSKLNV
                     GTKHDQEKKRPVKMKEVFSLFVNSIKVSNNSNNSNDRSDQEVPPKHDLKKVKSISKPY
                     NPKHVHHVGFDPVTGDYIGLPEKWQALLESNGITKKEQEKDIKTLLNVVQFYQDVSAS
                     KTTDKLLQTFPLEKGTICVDDTQVSTPSNITSSADDDAAKPSFNESLMPAISIESRHK
                     NEVNQLILKESFSTEDKFIPSRPAPKPPALQELKAIPPKSPNRPKATRVKNNSSKITS
                     VNSLPNNGEPTVQFSNDQKSHKSQRVGTSTDTFRFEKSLSGNKKTISITSTSTSTSKH
                     PTNYRESWGIKGHTDKKENSNVIKRDEGNKKAEKDKRMQVVLSRLSKICTPGTPEDKF
                     ETYLKIGQGASGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQNI
                     VNYIDSYLSGLDLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGV
                     LHRDIKSDNVLLSMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGP
                     KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFIDKC
                     LAVTVSERAESSELLQHKFITEVAENTEGLSALVKFSRMKKAAEQNSDSEGRSSSSSS
                     KAVASVESGIQ"
     gene            complement(<1014414..>1018844)
                     /locus_tag="CAGL0M10175g"
                     /db_xref="GeneID:2891353"
     mRNA            complement(<1014414..>1018844)
                     /locus_tag="CAGL0M10175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449789.1"
                     /db_xref="GeneID:2891353"
     CDS             complement(1014414..1018844)
                     /locus_tag="CAGL0M10175g"
                     /inference="similar to AA sequence:UniProtKB:P33202"
                     /note="similar to uniprot|P33202 Saccharomyces cerevisiae
                     YKL010c Ubiquitin fusion degradation protein 4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449789.1"
                     /db_xref="GeneID:2891353"
                     /db_xref="GOA:Q6FJ05"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ05"
                     /translation="MDDHSTDYEMDDHYTDGEEDEVQYVYPDGEEEDSDDDGLGDDYD
                     GEGDGMFHSLDEDEDHEGVEDDIDEEIDGDGFDVEGAIPAAFGGRRVRVATQPAMNLQ
                     ELLGTLSQHMGQAQQNRRNTTNAGDTSTPPANATFSDFISMFSSRMAREGGTGSRNSR
                     MVKLVENIANASEDSYIAMESLREISENLLMTNQLLLDRIIPMDELLVAVIDILKDPM
                     LSQESELQVQACRCLHNLYEVNIDSMSSSVDQNIIQILQDKLQQIDFIDLAEQVLETL
                     EYLSRIQGKDICRNGEMSIYIRYYDFFTVHAQRKAVYIVTNALTNAIEADFVNIKEVF
                     PSLTQIFMNTNDSNVISHILNAYTGVCRNIKNSDQLVSLFLPSLFDKILQILSNVDSQ
                     LEDKLKCINIMTLLVSQCLDLKRHFLRREEPVQDIMLCLNVYAKNNSTKINDKLMFVP
                     KKLLLSVTRFITALLPSEEDSLLSNNVLTEVEIDGSNIYLDRIFKDLTPLLIELYGNT
                     TDFEMKEYVLVCMARISTHTKQTDVQKLCKHLLPCLASILSHIQNNDLLATSLDNIIS
                     DKQMEQWILCTATLSILRILLNKFGDVVANSMKREGINIMINSISEKVKEFTGLNLRS
                     IELKHVSHDNNEDESSDSDSANNEDNYDISVPDYVKPKAIKFNLLSYPSPEKTLKYLE
                     LYCDELTDIAPLYRTNSNEELDSIKQTINFMADIEVETFDAEKCDKLWRMLYSNIFGN
                     DEELSGFEMISTGLGKAVATLLEQLSNNYQIRKSFEKIFSSKAINLVTLLQSTLNRVE
                     NFPIIDSGISGESGVSLLTKLLKLELVIDENLEELGLPKNLETTNVQIHCIATYTNLK
                     DFIKQRFLKVQFLDNLLPNSSIRNNESNPNSADALDSLLKEKNMEFYFEDYQIDSNDT
                     IFGGLLKAYEKLDKSIRDVWQKSQRIKVKFVSKSDKFEETQGDEKESISRMKSSTPAD
                     HDDPALDILKILKFLHNCSISAENFVNTKLSSKLARQLDEPLIVLSIRLPEWATLLTK
                     EFSFLFPFETRMFALQCISFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRI
                     PRKDMFSTGVKVLKRFGGDSTVMEVEYIDEVGTGLGPTLEFYAIISKEFARKSLNMWH
                     CLDDNMKHVADGTPNDNTMSEVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSL
                     YDNRILDFRFNPVFFMLCHAITKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLRYI
                     YNNRTNTPLIKSLSLTFTLPGYNFELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIA
                     PQLNSFIDGFSRLFPYKNMLLFSPNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSP
                     TIRDLISIISTFDNQEKRMFLQFLTGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDY
                     LPSVMTCANYLKLPKYSSREVMRQQILTAMTEGADSFQLS"
     gene            <1019623..>1020342
                     /locus_tag="CAGL0M10197g"
                     /db_xref="GeneID:2891354"
     mRNA            <1019623..>1020342
                     /locus_tag="CAGL0M10197g"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="XM_449790.1"
                     /db_xref="GeneID:2891354"
     CDS             1019623..1020342
                     /locus_tag="CAGL0M10197g"
                     /note="highly similar to uniprot|P33201 Saccharomyces
                     cerevisiae YKL009w mRNA turnover 4"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="XP_449790.1"
                     /db_xref="GeneID:2891354"
                     /db_xref="GOA:Q6FJ04"
                     /db_xref="InterPro:IPR001790"
                     /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQ
                     LDDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGL
                     LFTNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHS
                     LEPTLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIIS
                     AYYDNESSTVSELNINKKQDA"
     gene            complement(<1020895..>1022088)
                     /locus_tag="CAGL0M10219g"
                     /db_xref="GeneID:2891355"
     mRNA            complement(<1020895..>1022088)
                     /locus_tag="CAGL0M10219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449791.1"
                     /db_xref="GeneID:2891355"
     CDS             complement(1020895..1022088)
                     /locus_tag="CAGL0M10219g"
                     /inference="similar to AA sequence:UniProtKB:P28496"
                     /note="similar to uniprot|P28496 Saccharomyces cerevisiae
                     YKL008c protein required with LAG1 or uniprot|P38703
                     Saccharomyces cerevisiae YHL003c LAG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449791.1"
                     /db_xref="GeneID:2891355"
                     /db_xref="GOA:Q6FJ03"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ03"
                     /translation="MLKVETKQRPRRASSVGNIDLGDTVPGFATMHESKASKVAAKRR
                     HERLATQRNLKMTTKLYLKARDYNYHHMWFLPLCILILTYAAYFGISNKRVKGFLHMF
                     VAISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRITQWLNITSKYKI
                     KRMMEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLFKAFYLIQA
                     AFWAQQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYITMDVSD
                     FFLALSKTLNYIDSPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRTEGPYILNFA
                     TQQYKCWISLPIVFVLIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVRSDEETDSGSD
                     ELKKD"
     gene            complement(<1023374..>1023655)
                     /locus_tag="CAGL0M10235g"
                     /db_xref="GeneID:9488060"
     mRNA            complement(<1023374..>1023655)
                     /locus_tag="CAGL0M10235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999558.1"
                     /db_xref="GeneID:9488060"
     CDS             complement(1023374..1023655)
                     /locus_tag="CAGL0M10235g"
                     /note="highly similar to uniprot|P43682 Saccharomyces
                     cerevisiae YKL006ca SFT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999604.1"
                     /db_xref="GeneID:9488060"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:B4UN61"
                     /translation="MSRYQEADNDKKLESLATKLSTFRNINEDIGRQAQIDSSVIDSI
                     SESFSSLLNDLKNSSSRLTRSMSMGSGVWRMVFIALSVFFIIYTLYKFF"
     gene            <1025157..>1025570
                     /locus_tag="CAGL0M10241g"
                     /db_xref="GeneID:2891356"
     mRNA            <1025157..>1025570
                     /locus_tag="CAGL0M10241g"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_449792.1"
                     /db_xref="GeneID:2891356"
     CDS             1025157..1025570
                     /locus_tag="CAGL0M10241g"
                     /note="highly similar to uniprot|P36105 Saccharomyces
                     cerevisiae YKL006w RPL14A or uniprot|P38754 Saccharomyces
                     cerevisiae YHL001w RPL14B"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_449792.1"
                     /db_xref="GeneID:2891356"
                     /db_xref="GOA:Q6FJ02"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ02"
                     /translation="MSSTTVRNSNWRLVEVGRVVLVKKGQSAGKLAAIVEIIDQKQVL
                     IDGPETGVPRQSINLGQVVLTPLTFTLPRGARTSIVSKKWAAAQVTESWKASSWAKKI
                     AQRERRSALSDFERFQVMVLKKQKRYTVKKALAKA"
     gene            complement(<1027450..>1027902)
                     /locus_tag="CAGL0M10263g"
                     /db_xref="GeneID:2891357"
     mRNA            complement(<1027450..>1027902)
                     /locus_tag="CAGL0M10263g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449793.1"
                     /db_xref="GeneID:2891357"
     CDS             complement(1027450..1027902)
                     /locus_tag="CAGL0M10263g"
                     /inference="similar to AA sequence:UniProtKB:P25565"
                     /note="similar to uniprot|P25565 Saccharomyces cerevisiae
                     YCL002c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449793.1"
                     /db_xref="GeneID:2891357"
                     /db_xref="GOA:Q6FJ01"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6FJ01"
                     /translation="MLAVSSIVFFNCGNTELLETLSNESLLLICIFLMILILSYFTYI
                     CAEYNLPERNNGRFGGYYIEYVNYLWVIGQFLSAVKYLPQISLNWMGISTKGLPPKYL
                     KISIIATSVLQASNLRTFIDNLEFYQWSFNPTPRMVSFLQLIWLGIIY"
     gene            complement(<1029427..>1031250)
                     /locus_tag="CAGL0M10285g"
                     /db_xref="GeneID:2891358"
     mRNA            complement(<1029427..>1031250)
                     /locus_tag="CAGL0M10285g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449794.1"
                     /db_xref="GeneID:2891358"
     CDS             complement(1029427..1031250)
                     /locus_tag="CAGL0M10285g"
                     /inference="similar to AA sequence:UniProtKB:P36106"
                     /note="similar to uniprot|P36106 Saccharomyces cerevisiae
                     YKL005c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449794.1"
                     /db_xref="GeneID:2891358"
                     /db_xref="GOA:Q6FJ00"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /translation="MESLRKSSRSTKGKNTYLEVLRRQEEEEYEQRVNRPKKEKVQEI
                     VHCSPCGTTDANYVEDEDPYGEMIQCDQCDTWQHINCMLQVKDIKVPKELENSDDVDS
                     LSKLLVNSEDKYYCDRCIYKSQLREERRAYKELNKSEMIGDNDILDEPKEHPDEYVDD
                     QDEDQDFILSKDTANIAEVDDDEFVENDDNRVKKDKRKRKPSNSAITTTKTVPKKKAR
                     VITDDQTETETIPSEDSYAKVRTNARKMLVTLFKNYIIPDTLKNNVFEIVKGHDEQSI
                     SDEFAEEMESKLFSHCRSISNYKTLISVYTEKVRVLFSNLKDPKNLSLKEAVINRQLD
                     LEQLVSMSATDLANPDLQSMKKKIDSQKIDSLVIPNQPLDKLKQDNSEDDHNSFEFTN
                     PTFTKTFNPKDIHESNSNNRPYTTDSPTNSYTDEPDSMKSDSNNGVDTNDQNILNVKF
                     KLDYNEVDLNVVGTFKFLGSTLLDENQEHKIYQAVVGDGKLIYEGRLHTKIATEYISE
                     IKTTRAVLAYQLLPSASHREKYEQLVEFMDDLDRVLGMKPRKPYVKNMYILSSLLGKL
                     PDILQILTTDESIAKKRIDLSRINDNDKTLYLVVVVKPEIV"
     gene            <1032001..>1033347
                     /locus_tag="CAGL0M10307g"
                     /db_xref="GeneID:2891359"
     mRNA            <1032001..>1033347
                     /locus_tag="CAGL0M10307g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449795.1"
                     /db_xref="GeneID:2891359"
     CDS             1032001..1033347
                     /locus_tag="CAGL0M10307g"
                     /inference="similar to AA sequence:UniProtKB:P36107"
                     /note="similar to uniprot|P36107 Saccharomyces cerevisiae
                     YKL004w aureobasidin-resistance protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449795.1"
                     /db_xref="GeneID:2891359"
                     /db_xref="GOA:Q6FIZ9"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ9"
                     /translation="MFLKVRDWFLKDRPANHSATDLEYGWNPMESVRYLRSQYRHYKA
                     NPHLLSYKDVCHYTFMGSVWLFVLIMNPAPMVLKLLFYAFLTLLFLVPITSQFFFNAL
                     PILTWLALYFTSSYLKADIRPPITVKALPAIETVLYGDNLSDILATSTNPVLDIFAWI
                     PYGLFHFGAPFVVALILFLFGPPTILKGYAFAFGYMNLIGVMIQNFFPAAPPWYKILY
                     GLESANYTMKGSPGGLARIDELLHINLYSNAFANSSVIFGAFPSLHSGCATMEALFFS
                     YCFPFLRPLFIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYVIFQYTKYYHLPVVNTSY
                     LTRWAYPSVSKYDFKTSDPLNTDSEMHVENIPLRTYDETMSIDSRSNSNGRLELELDM
                     DMDNMRTVSSNTSTPASVFDRMESLSRSSATSNTSLGNLSTTDLTDPPVARKPSAF"
     gene            complement(<1033952..>1034308)
                     /locus_tag="CAGL0M10329g"
                     /db_xref="GeneID:2891360"
     mRNA            complement(<1033952..>1034308)
                     /locus_tag="CAGL0M10329g"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="XM_449796.1"
                     /db_xref="GeneID:2891360"
     CDS             complement(1033952..1034308)
                     /locus_tag="CAGL0M10329g"
                     /inference="similar to AA sequence:UniProtKB:P28778"
                     /note="similar to uniprot|P28778 Saccharomyces cerevisiae
                     YKL003c MRP17"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="XP_449796.1"
                     /db_xref="GeneID:2891360"
                     /db_xref="GOA:Q6FIZ8"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ8"
                     /translation="MLYELIAMVRILQPKHQMQQEAKELATTIGRMIIENRGVVRKIM
                     PMGKTMLPRVITKDQERHFQAFKFLMLFDSSIPVQSQILRTLRKDPRVIRSSIVKINT
                     EKELASLSSIEKSQGL"
     gene            <1035054..>1036229
                     /locus_tag="CAGL0M10351g"
                     /db_xref="GeneID:2891361"
     mRNA            <1035054..>1036229
                     /locus_tag="CAGL0M10351g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449797.1"
                     /db_xref="GeneID:2891361"
     CDS             1035054..1036229
                     /locus_tag="CAGL0M10351g"
                     /inference="similar to AA sequence:UniProtKB:P41910"
                     /note="similar to uniprot|P41910 Saccharomyces cerevisiae
                     YDR005c MAF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449797.1"
                     /db_xref="GeneID:2891361"
                     /db_xref="GOA:Q6FIZ7"
                     /db_xref="InterPro:IPR015257"
                     /translation="MKFIDELDIERVNQVLNFETIDCKIVGGCDIFTTKAVASDRKLY
                     KTIDHHLDTILQDNESYNLALQQQIALDAEDKNERSMSPGGQRRDSSSFWEQKRRMSV
                     SDSPIYLQHINGNLNESNGAQGEIVADLVPPIIKTSKLNDHNLKELVSNYEAGYSSSS
                     SVESLTHKNKERRTSSLSSTGGKVDKLRADSSTANDITARSVLNDTSRTLNLGPFGPI
                     NEPSSRRTFAYLIAILNASYPDHDFSLLEPTDFKRSSIKSFIAKFENSMYSLGRKPEE
                     WIWEVINSHMTLSDCVLYQYCPTQSFLDDEPGHLWSLIGFFFNKKRKRVAYVYLLASR
                     LQLAVNNAIGTPDEMQNEDGTFRNNNTTSFDNNNTQFEGEYDLTYEENAIVDDDDEE"
     gene            complement(<1036696..>1038096)
                     /locus_tag="CAGL0M10373g"
                     /db_xref="GeneID:2891362"
     mRNA            complement(<1036696..>1038096)
                     /locus_tag="CAGL0M10373g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449798.1"
                     /db_xref="GeneID:2891362"
     CDS             complement(1036696..1038096)
                     /locus_tag="CAGL0M10373g"
                     /inference="similar to AA sequence:UniProtKB:P25301"
                     /note="similar to uniprot|P25301 Saccharomyces cerevisiae
                     YDR004w RAD57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449798.1"
                     /db_xref="GeneID:2891362"
                     /db_xref="GOA:Q6FIZ6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ6"
                     /translation="MDLYEELPGSQLLFDPEFETFLEALNANKVTCVDFLTLKAPDLA
                     KLSQRSINEVIRFQQRLIREYDAQYNSNSTKPLAKQIPNKQFTTGDLGIDEVLGGGIS
                     TNCITEIFGESSTGKSQLLMQLCLSVQLPISEGGLNAKCVFITTEGDLPTNRLAGMIE
                     ARKDWHELGISQSNIFTVSCPDLISQEHIVNVQLPVLLERNKGEIKLIIIDSISHHLR
                     VELDTKSFKDSLENKAYITEMAEKLQGIATKHSVAIVVANQVGDKPLNENLDPYNLNV
                     NDLEYQLGWLVGWKNSTILYRQTIQQIGFQKQQVIASNADSILSDDEDYMLVEEQVRR
                     IKREEDGEKFVESGIGGSTSALARGEVEEADNKLTELKPRKNNSVKKTIKRKMDHRVP
                     NLGLTWANYVSTRILLKKSYAASPMIRRGELKKYKGSDTSDFWQVKRLLKVVYSSFCT
                     PEEINFKITKCGVESV"
     gene            <1038860..>1043857
                     /locus_tag="CAGL0M10395g"
                     /db_xref="GeneID:2891363"
     mRNA            <1038860..>1043857
                     /locus_tag="CAGL0M10395g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449799.1"
                     /db_xref="GeneID:2891363"
     CDS             1038860..1043857
                     /locus_tag="CAGL0M10395g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449799.1"
                     /db_xref="GeneID:2891363"
                     /db_xref="GOA:Q6FIZ5"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ5"
                     /translation="MVINCVGKTFEIMAWNYPDNFTLLEAGKLASKIGYRVAKREFKR
                     DWEKYKKGHQKRKAARAIKKKKAKEIKYGKNKDLKENIVQQASNPEKQKEQPKRKRAW
                     YQVLSWSVDDLDDYLKNNPQPPENPIKAMVKSWFEKEPTKLPPRIWMLNKDSSQEFSD
                     STINRKTLTSDTDAKVIEPEAVDGINGNDHCNSDSSLLAMEALVSLDYISNSSTYSIN
                     VKNLQSVTSEKWSIFRSLKKCTSSSTQKINEEQDSSRSKSRWRNFLGKLKIRTSKRSN
                     VLTELSLQSCDRSYEDPKSYQHNKFDFKSSSVPFTSDDEKLFSHKSPSCRGESTTQTE
                     PIGSRELTPGYNPKKVAQTQKTENQCLDLVCSDNKTANVCSASKDLIAGNNELVSKQL
                     ICGDNSNIATNIVSNNASNNAADKLSIDDYMKFSCTKNCENLTSYCENILDQKYMIES
                     DSNISAELQKLFKTLDDEIEYYSENLKKDCNNISISEFDISVVKPLNIEQLSINEEAS
                     ICTEKLKIVEAKVGNSVSENGEISRPNTNTSANSEHNPEQADLQDNVSQEFIRNSIGN
                     EQVSTESSIQKQQIDRGTPSVMQLFSNFVENSINQLKKRADFTQNKGNWEGDLGTLPE
                     QLPNSIEKVCVDNLKQQQQQQQVDLTGNTIESINSSSTSNVFVSAKGTTKVGSDTVVS
                     GSSDHPLNGAKQSADEKTEVMTNVSHECSANESKLNANGNIGLGNAITSIFNETCNKL
                     SSMTFPVLFKKPLQDEPSFTISEIDDKENRECDVITEEKRAEIQEQIKKSTAEFNIFL
                     KEKTKPLEKYENLSYCLPNVIDESKLHPRIQAYQNDNNGFNNENVGYFTLLVASDREW
                     EKERLKKEEATNSLPIQHCTLDGLDKGIQQGLNSYTSSNVVSPNKRIISSCKEKKEVP
                     ECLLEGIKEVDNIIQLQEPLIERKVSEITNESYKSVPSTKSVSFKADCSIHSVSKSKS
                     CTAGTSKSIKGPTDHAAKPLKSCLKKSFISPVSLDNKVNEQSSKEVGVASENVGVISV
                     TSFHDKLPDQFDDVNHRDSRAISKVPSGNCSVDHLPLDPEVVNKVPPGEYDSAVGTNK
                     QLYNEPCSKQDSFRIVESLKIKKNTPPPPPPHGQLKKKPPPPPPQGQLKKKPPPPPPQ
                     GQLKKKPSPLPQPVTVTGCFPSEREYPICTGEQQSTPNKVDDECVTVNSLCSQNFSSK
                     IVDCDEHKYDSVANDSSPDSIIDHPIANLNGLTPEESFDSETESIDYTYELDEFEIAL
                     PEWVREKRATKGESKLVKKLDHRLIKSQVDKNGVFVFGTPHYHDACPVWVVGPHSRLI
                     SEKEKANNKPIYKKKLPKRLKRIRKRIVWHRNRIAKSYSSQPHIRYRVIENAADNPYL
                     AEGEHTFDAGYKKVGVNMYDFDMDEWLQSEQDVDAGDVVKVVPVANLDVNQERFWISL
                     FSDLKTFAKIELNIKQKRPRFLLAVDECEIDQDKCIVDDMKIRGCSYLADEPKDEILL
                     EKLLDDFYLEDFDPLAALKNGFMTKSEAERIMKVQELKKRGLKDTPEFEFLNDIIGET
                     EEMVYSFDKNMPIEDAVAYATKVKSLAIVECRERHKLKLPPIDSEGVVVKFIKNMDKV
                     LANVDTEITEFYIKGDLYDIALEEIVRDVQKGIRRKKMEEYRKRYEWRKKILWDV"
     gene            complement(<1044619..>1045248)
                     /locus_tag="CAGL0M10417g"
                     /db_xref="GeneID:2891364"
     mRNA            complement(<1044619..>1045248)
                     /locus_tag="CAGL0M10417g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449800.1"
                     /db_xref="GeneID:2891364"
     CDS             complement(1044619..1045248)
                     /locus_tag="CAGL0M10417g"
                     /inference="similar to AA sequence:UniProtKB:Q03446"
                     /note="similar to uniprot|Q03446 Saccharomyces cerevisiae
                     YDR003w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449800.1"
                     /db_xref="GeneID:2891364"
                     /db_xref="GOA:Q6FIZ4"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ4"
                     /translation="MIAYKRATGDNNNDGFTDDDPYGRGSWVWGRWILFVIFVVGILL
                     MTLLTFRINRRRTATGRAPIYGTAWMTPPSYRQSERDYNHTQNYVEEYVPTYTETTNA
                     NDLGYYDANGVFHKNAKAEMLQPPALDGEVARPDGPPPGFDGLTQPESAYLRPEDVPQ
                     EDIDLEFRRPAQTNFQRTTAGPSSSLETNDDEDSSVSVQMQQVRTSSKK"
     gene            <1047060..>1049357
                     /locus_tag="CAGL0M10439g"
                     /db_xref="GeneID:2891365"
     mRNA            <1047060..>1049357
                     /locus_tag="CAGL0M10439g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449801.1"
                     /db_xref="GeneID:2891365"
     CDS             1047060..1049357
                     /locus_tag="CAGL0M10439g"
                     /note="highly similar to uniprot|P32356 Saccharomyces
                     cerevisiae YDR001c NTH1 neutral trehalase or
                     uniprot|P35172 Saccharomyces cerevisiae YBR001c NTH2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449801.1"
                     /db_xref="GeneID:2891365"
                     /db_xref="GOA:Q6FIZ3"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ3"
                     /translation="MDEGPLGKGAVATPAMVEKVANESPKKTRPRRLSSLNEFYDPFS
                     TAEVYYGPATDPRKQKKSSTKLNRTRTMSVFDNTSIAKTTASFGQFQLKRRGSEDDSL
                     TASQGNRKFFIEDVDGTLEELLSSEDTDRNYQITIEDTGPKVLKVGTANSGGYKHVNI
                     RGTYMLSNLLQELTIAKSFGRHSIFLDEARINENPVNRLSRLITNQFWNNLTRRIDLN
                     NIGEIASDTKVDTPEAKNPRVYVPYNCPEQYEFYIQASQMNPSMKLEVEYLPKDITPE
                     YVKSLNATPGLLALAMEEHVNPATGEVSLIGYPYAVPGGRFNELYGWDSYMMALGLLE
                     SNKVDVARGMVEHFIFEIEHYGKILNANRSYYLCRSQPPFLTDMALVVFNRIGGDNNP
                     NAIDFLKRSFKAAIKEYKTVWMAHPRLDPETGLSCYHPDGLGIPPETEPTHFDSILTP
                     YAAKYYCTIPEFIAMYNDGSVKEPHLDEFFLHDRGVRESGHDTTYRFEGVCAYLATID
                     LNSLLYKYEVDIANFIEKYHNDEYHDPFDGTVTNSAYWRDLAAKRKENITKYMWDEET
                     GFFYDYNIKVKCRTNYESATTFWSLWAGLATPEQAKKMVELALPKLEMLGGLVACTEE
                     SRGPISIDRPHRQWDYPFGWAPHQILAWEGLNDYGYTSVATRLAYRWLFMMTKAFVDY
                     NGIVVEKYDVTRGTDPHRVDAEYGNQGADFKGVAKEGFGWVNTSYILGLKFMNSHARR
                     ALGACIPPAPFFNSLKDDEKSIYGL"
     misc_feature    1049554..1049664
                     /note="Centromere Cen0M"
     gene            complement(<1049771..>1051069)
                     /locus_tag="CAGL0M10483g"
                     /db_xref="GeneID:2891367"
     mRNA            complement(<1049771..>1051069)
                     /locus_tag="CAGL0M10483g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449802.1"
                     /db_xref="GeneID:2891367"
     CDS             complement(1049771..1051069)
                     /locus_tag="CAGL0M10483g"
                     /note="highly similar to uniprot|Q03441 Saccharomyces
                     cerevisiae YDL001w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449802.1"
                     /db_xref="GeneID:2891367"
                     /db_xref="GOA:Q6FIZ2"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ2"
                     /translation="MSEESDALLNRGSKSNDMGENSQAKYIPRPVNSDRSISDSKDGK
                     LGIIDSKTKGISNIAKVTGRQIRNGAQRTSRTAQKLKLLPEEAFHRDEEVSELRDRDV
                     YSQVNRITDKNARRDAEKLGKAHRHLLPRCTSYCTASSYNMKDLIRWLKDSKKTHHTH
                     PKLFDECLYTPFLYNDWRGDKRFEHEDVIRLDDEGGEINVSDKHPDIFIFEYGVIVLW
                     GFTEREEKAFLNDLEKFEKEKLAEEDIQIEEFNYYVTQSYQPRIYNDFITLRDGSNYM
                     IKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSGKVSMSKEEIMKSIGELFI
                     LRININLHGSVLDSPEIMWSEPQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQML
                     KEQLGHSHEEYLELIVIVLVVVEVVVSLVNIAVDMIANRT"
     gene            <1051487..>1052077
                     /locus_tag="CAGL0M10505g"
                     /db_xref="GeneID:2891368"
     mRNA            <1051487..>1052077
                     /locus_tag="CAGL0M10505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449803.1"
                     /db_xref="GeneID:2891368"
     CDS             1051487..1052077
                     /locus_tag="CAGL0M10505g"
                     /inference="similar to AA sequence:UniProtKB:Q03435"
                     /note="similar to uniprot|Q03435 Saccharomyces cerevisiae
                     YDL002c non-histone protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449803.1"
                     /db_xref="GeneID:2891368"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ1"
                     /translation="MDARNLSDEELKRKVEELKENNEVIGLALQRSRLSVKRLKLEYG
                     VLLERLEARADMDPDVGTFNPLPSLENFQKELMSTPLKKPKTRKQKLKERDPNMPKRP
                     TNAYLLFCEMNKEKIKEGGSVDVTKDLTESWKNLSEQERKPYYRLYNEDRERYQAEME
                     AYNKKSKTEDAGKEDSMSKNSSKQEDSDQTSNEVEN"
     gene            complement(<1052421..>1059914)
                     /locus_tag="CAGL0M10527g"
                     /db_xref="GeneID:2891369"
     mRNA            complement(<1052421..>1059914)
                     /locus_tag="CAGL0M10527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449804.1"
                     /db_xref="GeneID:2891369"
     CDS             complement(1052421..1059914)
                     /locus_tag="CAGL0M10527g"
                     /inference="similar to AA sequence:UniProtKB:P35194"
                     /note="similar to uniprot|P35194 Saccharomyces cerevisiae
                     YBL004w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449804.1"
                     /db_xref="GeneID:2891369"
                     /db_xref="InterPro:IPR011430"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FIZ0"
                     /translation="MKQKTTTKTTKRYRYSSFKSRIDDLRIEPARNLEKRAHDYVESS
                     HLLASFEHWKDINLSASFTALVPQLEPLVQTLPQILFHSKQVCALLIEAIDKHDELSL
                     QPELDMLAQFCHDLGPDFMPFYKPAMDSLIALISDAGSLESPQVLEWAFNCLAYLFKY
                     LSRLLTADLAQTSELLFPLLSHHREYLSRFSAEALSFLIRKTSAKNLPALLNYFFAKL
                     SENEEEGHYYEGLLTLFTESLVSTQGSLHSKSNIILTAFITKVLTPQAVDPVCTTLFC
                     DVWMNISKHTAAENLAPVYQLIFQHITEKLGPENTNTVVQIMATLVFSESGKKIPHWE
                     TVVSITKSILESCNAENCSSSNLAFYSAALFRNADVRSMTQLHKLLFSTYATKFTDDY
                     FAFLRYCMDLCPDKISSYNGDKYANVFLEENWASQGQNLSLFLLELEQNTQLQNRLRI
                     KIPSGLVNSLLDTLRTINDKEITEEQLADLYWMSVILKKCDVQESDPVINVILNLISD
                     ASNPSDMKKDLLGNLILAIPSDENNILINIMEKLVHSFGAYRDSVFFVKSITYLLRKT
                     GNTDSVKTIIDSLLTDNLENFQQNLVLPDSKIRYETLVLISTLYELRSSEVPQLINEC
                     KIIEEIPLSLDNGRALTARIRAMSAPFLKIERGSPEIKLVISHMFGLLTIRFSPIWDG
                     VNDFLSATTGKCPDLVWKLILQFINVLEHPIISSYPQTFMDIDSPVSLWDSRVDRLTN
                     TINNFREIWNRFFNKNESIFELSKDLRGSFQYPGQIRNQTLKVMLLVPHLAEQHFADI
                     ITYFFNQVEYEELFDNDFNGEKTAKNWTEADRNVLLKVLSKFKNIKNVYKSDELHNRL
                     LTLLGSKNTEVQKLALDAIFAYKEPAVNKYKDNLSNLLNDTLFKDEITIFFANKEKNQ
                     LEEQHEIKLMPYILRILYGRAQTPITSGSKKSSKYAVVSVLPNFKRKYIIDFLSLTYN
                     GLAFEKFFDKKYAVDKDDLTQGTLKRMSGFVTLMSGVIGTLGSKFSIELATVLKPLLF
                     VISSSYYICGSDANLKDSDQSHLLKIGSTLRQHSLKCLSEFFDTLGDDLNWDPYIKDI
                     YECAFKPRLANFSVENAQQISSLMRIMVQWSGNESLYRFLYYNSFSCTKALVELLHNP
                     HTKEPVLVSILTACNDVITRPAQDAEYVELVTIISTSTLKSLPTLYERLGNSDSISIA
                     IEVLVNLTENGYVQDDETISYLLSSLTLILESNKNVNNPKIITKMLNVLKTLIPVSTM
                     PFSDLESLFRTLSGFYQTCADKETRLGVNDVLSAFSERFDELEKVASLMKSLNSYSNR
                     RIQEYDFPVMLSAFKKFTEEDYCNYSEIQWFPVVHTCLFLINDKEELAVRTNATHTLT
                     VFVKYINEKSSFEEAKPGITILKSIILPQIKSGLRKYNDEIQTEYIALLEYIVQNSKY
                     YNDMADMQVLSFGDDEEASFFKNIAHVQLHRRQRAIRRLKEVASELSDNSISHYLIPI
                     AEQYVFSDEEKFRNIANESLITIGELANFMSWNQYKALMRRYIHLLKTKDTALKQSVL
                     LITSVSVALKNTLTAKRNSSDEKINSRTMRKFPNNFNDAESFIKHELYPTLSKILGTR
                     NDDTIVARMPLSEGIINILLGLDEDDKITLLPGVLTSICQVLRSKSEELRDAVRQSLS
                     KIVVILGAKYIVFIIKELVSALQRGSQVHVLSYTVHHVLRTIVDDLNHGDLDDSAHLI
                     VRVIMEDVFGAVGEEKDSDNYHTKMKEVKVNRSYDTGEVLAANISLQEFSTILKPIKM
                     LLMERVSFKSQNKLQELLRHYALGINHNTEAAEINSLRLCYEIFNQDVEQKKYNRPKA
                     TVTEQEEFFLVNLNAKKERVVTEYSLLSHTFQKFSLDLLRTVITRHKSLMQAKYLQGF
                     VPLLQQSLTSDDENVLISTLKVLIILVKIDFEMSTENLFKNCVKKALNIVKDSPSTGS
                     ELCQMAIKYLSAAIKHKEMKLKNVALSYVLQRILPDLNEPNKQGLAFNFLKSLISKQV
                     MLPELYDIMTTVREIMITNHSKDIRNVARSVFYHFLMEYDQSKGRLEKQFKFMVDNLQ
                     YPAPDGKQSVMELINLIVTKANPELLSKLASSFFIGLANVSVNDDSPRCREMATIILT
                     NMLPRLDATALRTIVKYISAWLKQLENDAFLNLGLRIYKVYLEGLGIGHSAELDDQAT
                     KAIIKTLHNTDENSKTQWDLIYSALAVFTVFTNKNPEVFNSEYKNIWDSVIKCLLYPH
                     IWVRQASGKLVCDLFNHLEKDNWMYENSDIQIITSKIIHQLRAPSIPEALAETAIKTL
                     LKVSSYWNKNNVSYIPFGETTESINRYSTAIEYVVSSIGGIIRSEENRNDTFFSKKFA
                     IQYFYLLTQMLNAEALESVLEIILFSLYIYLEKSDVSRLTDEESELVTSSQECMKQLE
                     DSVSVSAFSKAYANVKQMVYRRRLERKNKRSVLAVTAPDVAAAKKLKKHARSREKRKH
                     ERDENGYYQRKNKKKRI"
     gene            <1060642..>1061319
                     /locus_tag="CAGL0M10549g"
                     /db_xref="GeneID:2891370"
     mRNA            <1060642..>1061319
                     /locus_tag="CAGL0M10549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449805.1"
                     /db_xref="GeneID:2891370"
     CDS             1060642..1061319
                     /locus_tag="CAGL0M10549g"
                     /note="highly similar to uniprot|P53721 Saccharomyces
                     cerevisiae YNR018w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449805.1"
                     /db_xref="GeneID:2891370"
                     /db_xref="GOA:Q6FIY9"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY9"
                     /translation="MKLLTKEEIEAHRSHTLSGGIQGCVAGLAVSALMFKFLPRRYPS
                     FNPARMTWSIKTALFITPPTLLTAICAEEASNNFDATMYSSGSSSKDAIEEHQRWKNL
                     PLKDKLVEGLSNNKYKIITGAWAASLYGSWVLVDRDPIMTTAQKAVQARMYAQFITVA
                     LLLASVGLSMYEAKLHPDKKKQGEKRRWEKALQYAEQEEREEAEAKARGFVSNEDRVN
                     AKIYKYK"
     gene            <1061770..>1063629
                     /locus_tag="CAGL0M10571g"
                     /db_xref="GeneID:2891371"
     mRNA            <1061770..>1063629
                     /locus_tag="CAGL0M10571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449806.1"
                     /db_xref="GeneID:2891371"
     CDS             1061770..1063629
                     /locus_tag="CAGL0M10571g"
                     /inference="similar to AA sequence:UniProtKB:P53629"
                     /note="similar to uniprot|P53629 Saccharomyces cerevisiae
                     YNR019w ARE2 acyl-CoA sterol acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449806.1"
                     /db_xref="GeneID:2891371"
                     /db_xref="GOA:Q6FIY8"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY8"
                     /translation="MGDELLGDKRFLRIQRLNSPDDGRRHSLQIDSEEHLYEHKEIAV
                     DETHREVEEDIPSETHTPPELRQTIEVTEKPVGDGEVEQTVKINTERMNSNGSGKDME
                     DKNVEKISKKFKTRYQKGTQDFRSYFDDVAFEFRPSIFDVSINEPYQTKFAGPTLEAS
                     IKSKEKELRKLRREQKRQLDSGEGPVSWEETLLSSNFSGIYVAIWMTLALGVLKSIVD
                     YYCETGSLTESEIWKFMTTDLFKVALVDTQMYLATYLSLVVQYLCKWGLLSWEKQAWL
                     IMAVYEFCYVFFFMIYTEHIMKLHWIAKIFLFLHSLVLLMKMHSYSFYNGYLWEIYDE
                     LTYSKKALAKYRETAKSPIIKTLENSIEFCTLEIKSQSKHNEFPKNISIGNYFMFTMF
                     PTLVYQIEYPRTKKVRWSYVLEKVCAIFGTIVVMMTVAQIFMYPVAIRALSIRDSTEQ
                     SLFEKAKEWPRLLIDIVPSFIIMYLLVFYLIWDAILNCIAELTCFGDRYFYGDWWNCV
                     DWAEFSRIWNVPVHKFLVRHVYHSSMSAFRLNRDQATLFTFFLSSVIHEMAMYVIFKR
                     FRLYLFSFQMLQLPLVAISNTKFMRERTVIGNVIFWLGICLGPSVICTIYLTF"
     gene            complement(<1063895..>1064572)
                     /locus_tag="CAGL0M10593g"
                     /db_xref="GeneID:2891372"
     mRNA            complement(<1063895..>1064572)
                     /locus_tag="CAGL0M10593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449807.1"
                     /db_xref="GeneID:2891372"
     CDS             complement(1063895..1064572)
                     /locus_tag="CAGL0M10593g"
                     /note="some similarities with uniprot|P53722 Saccharomyces
                     cerevisiae YNR020c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449807.1"
                     /db_xref="GeneID:2891372"
                     /db_xref="GOA:Q6FIY7"
                     /db_xref="InterPro:IPR019165"
                     /translation="MAGESFEWWRRTMQYQTGLGLTADEKARYEKDYAVYNREKQCKS
                     CYEYRDWMLKYSPTVRFMIQQISKLNGNASDGKVLNFDESKIICDECPDWKSGGFHPE
                     IGILLCQNRLKDKWHLEDTLSHELVHYFDNLKWQIDWLNLKQHACSEIRASALSGECR
                     FSREFARLGFSMNFGRGHQDCAKRRAIISVMGNPNCKDKEHATKVVEEVWDSCFYDTR
                     PFEEIYR"
     gene            <1064930..>1066162
                     /locus_tag="CAGL0M10615g"
                     /db_xref="GeneID:2891373"
     mRNA            <1064930..>1066162
                     /locus_tag="CAGL0M10615g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449808.1"
                     /db_xref="GeneID:2891373"
     CDS             1064930..1066162
                     /locus_tag="CAGL0M10615g"
                     /inference="similar to AA sequence:UniProtKB:P53723"
                     /note="similar to uniprot|P53723 Saccharomyces cerevisiae
                     YNR021w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449808.1"
                     /db_xref="GeneID:2891373"
                     /db_xref="GOA:Q6FIY6"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY6"
                     /translation="MFGALSGMFEYINGLNAHYAALSYEEQKAMTIVERLSIYNWSFE
                     LCALGLLALVVLAYKVGTSINVGKAKKVMTSVNSFLNDELCFAKVGIVDPRFPTRMYN
                     SERQNTWFTTFATGRSAIASIRVNLHLPPLNNPFTLFIEGILAYAFPVLKSKELESFI
                     EVVIRPNGIHFGSTTQELTNDKLKARKDILAKFKFITAVVNKHVMNEVRDDHYFLSLC
                     ATTDNDALPQEYVFMSEMNQLNGFITNYLSKTKTPLNEALKQSNRILEFIAFTDLPSD
                     KPFSVEEWNEETHDPRILIRTAVPNSTAELEALNKLISVAVEVYDNYTAELSTKGFAY
                     VTNDMLKKSNNMRTQELEKLVKAAKMKALEEAKEKKLAEEKERRRQLKGTTEQQKLDQ
                     KMKEKRERRQRNKQKVRM"
     gene            complement(<1066302..>1066718)
                     /locus_tag="CAGL0M10637g"
                     /db_xref="GeneID:2891374"
     mRNA            complement(<1066302..>1066718)
                     /locus_tag="CAGL0M10637g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449809.1"
                     /db_xref="GeneID:2891374"
     CDS             complement(1066302..1066718)
                     /locus_tag="CAGL0M10637g"
                     /inference="similar to AA sequence:UniProtKB:P53724"
                     /note="similar to uniprot|P53724 Saccharomyces cerevisiae
                     YNR022c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449809.1"
                     /db_xref="GeneID:2891374"
                     /db_xref="GOA:Q6FIY5"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY5"
                     /translation="MFKPTSVCLSALSKRTKRVQVQLLKDFPRFHLYKGEVARVKPSL
                     MVNYLHYGNGARYILFEDQVDQGLLEYSKKQAELRKASQPSASKVVSETTASTAATTA
                     GIRADVKEEEPPAEKKKGFLDSDITVNDVKIPGLRI"
     gene            <1066944..>1068665
                     /locus_tag="CAGL0M10659g"
                     /db_xref="GeneID:2891375"
     mRNA            <1066944..>1068665
                     /locus_tag="CAGL0M10659g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449810.1"
                     /db_xref="GeneID:2891375"
     CDS             1066944..1068665
                     /locus_tag="CAGL0M10659g"
                     /inference="similar to AA sequence:UniProtKB:P53628"
                     /note="similar to uniprot|P53628 Saccharomyces cerevisiae
                     YNR023w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449810.1"
                     /db_xref="GeneID:2891375"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY4"
                     /translation="MNNTKRSSNESGGATRKNSETRSGSSASNTSGNGSGETSGAIGH
                     PSDTYISPELSKLIPGLRLYEQLVEEEKKIDTVIKRRKLTMNQTIQRIRSNLIPFREA
                     YNLNGVKQTTYLRVFISSVSENQLWQNPDAKLEDGGWTMRIEGRLVDSKQGGSATRDK
                     FSSFIDGIRVEFKKPKKDEQNSANKDDDNNNSTAGNNNDNDIESNESSAEGFTREPSE
                     SAPQFFADQTPNPLGTDISNPPTVTDMGSASEITTPYESNKLEKEDQIQEIVEWKADP
                     KKPVEFDGFDIKRNGNTNLDAVVTIYPKAVESNRYSYSPALASLVGLSHGSKSDAIFS
                     LYKYINANNLLVSREYSRNTSLAATIVSSRRAQNVKNVVKLDEPLMKLLSRHNSYSSL
                     ESTPATVKLTDIPSIVERNLEQTKPVRLNYTVRVDKASTYGEVVFDMEVPTKEALLQS
                     ISMKGQKRPLITDNLAEESQAILRDYEAHITKTAVKNAELDKKLAILHAQLNSTKMKH
                     QFYKKFAEDPANALKEYIESTSGALKVLSGDEGFLEDTVRRSQFYKENEQILEENISV
                     LFKHERI"
     gene            <1068929..>1069375
                     /locus_tag="CAGL0M10681g"
                     /db_xref="GeneID:2891376"
     mRNA            <1068929..>1069375
                     /locus_tag="CAGL0M10681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449811.1"
                     /db_xref="GeneID:2891376"
     CDS             1068929..1069375
                     /locus_tag="CAGL0M10681g"
                     /inference="similar to AA sequence:UniProtKB:P53725"
                     /note="similar to uniprot|P53725 Saccharomyces cerevisiae
                     YNR024w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449811.1"
                     /db_xref="GeneID:2891376"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY3"
                     /translation="MSGKGELSSRVMNMKFMKFMRPEGQDNKDEGTSKHTHLDASKWD
                     LKSSVNSDSTNKRRVVVKRASKALKIMENVGITSVKAEDDSNKSSALHGRRIFGENKN
                     KRVAEEEEENKTEQEPKQEKDMDELFKESRRNTKPKKKSHKKHKKA"
     gene            complement(<1069787..>1071166)
                     /locus_tag="CAGL0M10703g"
                     /db_xref="GeneID:2891377"
     mRNA            complement(<1069787..>1071166)
                     /locus_tag="CAGL0M10703g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449812.1"
                     /db_xref="GeneID:2891377"
     CDS             complement(1069787..1071166)
                     /locus_tag="CAGL0M10703g"
                     /inference="similar to AA sequence:UniProtKB:P11655"
                     /note="similar to uniprot|P11655 Saccharomyces cerevisiae
                     YNR026c SEC12 GDP/GTP exchange factor for SAR1P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449812.1"
                     /db_xref="GeneID:2891377"
                     /db_xref="GOA:Q6FIY2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /translation="MKFHTKLYKVGYPLYGAKFVCDDQFVVTGGGGEGNNGVDNKLTV
                     LKVGSSEGNGLRVDEVCDATLPANDDSPTALDAVGDTILIGCNENSAKVKSGAGNSHV
                     RKFRYDGKSLKFESAADIDKSTNPEDYTKVIRLSKDGSEAAIASSKNPPSMAIIDPRN
                     YSVKYEIETGRDVKDLHFSPNGKLIGYITESSLEIISTVTGSCVVRKTDFDRKIILSK
                     MKFLDDNNVLIAATWASSKGILLTKISIKSGKTTVFWSRQISSKFKGITAMDVNDQMN
                     LVMLATNDNSVLLVKLRNLSVGKTFTQVHGFAITRVIFSPDSRYAVSISAAETVHVIE
                     IPSDFADSRSLSESTTQWLMNTIMVLFLAFVLNSMYKEDMHKNVLNYFRSVKSIDSSS
                     ILSMEDMEQVTLVGTISTSVRSTTQRFESSKSVSSTSVVARTNVSEKERSQQDPVKKS
                     PEQHQQNQQ"
     gene            <1071524..>1072495
                     /locus_tag="CAGL0M10725g"
                     /db_xref="GeneID:2891378"
     mRNA            <1071524..>1072495
                     /locus_tag="CAGL0M10725g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449813.1"
                     /db_xref="GeneID:2891378"
     CDS             1071524..1072495
                     /locus_tag="CAGL0M10725g"
                     /inference="similar to AA sequence:UniProtKB:P53727"
                     /note="similar to uniprot|P53727 Saccharomyces cerevisiae
                     YNR027w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449813.1"
                     /db_xref="GeneID:2891378"
                     /db_xref="GOA:Q6FIY1"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY1"
                     /translation="MTGEGSVPGGVSVVGKVLAIQSHVVHGYVGNRAATFPLQYRGWD
                     VDALNTVQYSNHLGYGQATGFKYSGEELCSVFRDGLLKAMGNRYDAIITGYTPSAEVL
                     EDISGIIKNQLNQQQDLKWIVDPVLGDNGRLYVSEDIVPVYKRLLSQNKIFLATPNQF
                     EMELLSESELTDLESASTAVSKFFQLYPHVERLVVTSVVLAGSDDYVVIAADRTTSPQ
                     DTIYIRSPRIKCHFSGSGDLFTALLVDALLRDRESTKLSQAVAKSQWMIGSVLQRTYE
                     QALKSGELKDQDSPVIKDLKLIQCRELFRLHDIPEIPITGHINVPQT"
     gene            complement(<1072542..>1073840)
                     /locus_tag="CAGL0M10747g"
                     /db_xref="GeneID:2891379"
     mRNA            complement(<1072542..>1073840)
                     /locus_tag="CAGL0M10747g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449814.1"
                     /db_xref="GeneID:2891379"
     CDS             complement(1072542..1073840)
                     /locus_tag="CAGL0M10747g"
                     /inference="similar to AA sequence:UniProtKB:P53729"
                     /note="similar to uniprot|P53729 Saccharomyces cerevisiae
                     YNR029c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449814.1"
                     /db_xref="GeneID:2891379"
                     /db_xref="GOA:Q6FIY0"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FIY0"
                     /translation="MSLKNYKHDEDDGELPPLVTGRESNLAEILGKVRNDGGHNLVSA
                     DKVDRSNKQVEVPLSSNSGIQTEKKRIPVTIITGYLGSGKSTLLEKIALKGSDRKIAV
                     ILNEFGDSSEIEKAMTIQNGDSKYQEWLDLGNGCLCCSLKNIGVKAIEDMIERSPGSI
                     DYILLETSGIADPAPIAKMFWQDEGLNSSVYIDGIITVLDAEHIVKCLDDVSPDAHWY
                     NQSVVKEENLTIAYFQIAMADRILLNKVDKIEGKRVSISDIEARIKDINGVAPIYHTQ
                     YGEVSLDKLLDLHAYEGTDLNLDGSFKDRILQNEKVMHDHRMGTVTLSFRPLKTEQEF
                     ENFKRNFLQKLLWKNFGLSDDDEIKNLSKLSDDWEIERSKGLVLVADSTYVIQGVRDT
                     FDIFTGHSDDTISDCKLVLIGKYLDKDSIQKLLLRVIDSK"
     gene            <1074047..>1075735
                     /locus_tag="CAGL0M10769g"
                     /db_xref="GeneID:2891380"
     mRNA            <1074047..>1075735
                     /locus_tag="CAGL0M10769g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449815.1"
                     /db_xref="GeneID:2891380"
     CDS             1074047..1075735
                     /locus_tag="CAGL0M10769g"
                     /inference="similar to AA sequence:UniProtKB:P53730"
                     /note="similar to uniprot|P53730 Saccharomyces cerevisiae
                     YNR030w involved in cell wall biogenesis and architecture"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449815.1"
                     /db_xref="GeneID:2891380"
                     /db_xref="GOA:Q6FIX9"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX9"
                     /translation="MFKWSLLDTALLAVIFYHLAQAPYTKVEESFTLQAIHDILEYGV
                     FDISRYDHLQFPGVVPRSFIGPLIVAVLSKPAIMISSMLNLFTDDTQMHAQLIVRGVI
                     GLVNGLSLIMLKNALQSLFDEIEEKKNKKLEKDGETPANTVTMTSVGSWFLLFCMTSF
                     HMMFYSSRTLPNFVGAFPLSNIALSLALKGNLEWAILLLSGSAVIFRLELGGLAAGLT
                     IFGFIFKKVDIFRALKFGFMGAGIAIGISMSIDSYFWGDWGIPEVDAFIFNVVYGKSA
                     QWGTESPLAYFTNYLRMLFLPPTVLVLNYIGYRAAPKNLKIVTLAGYFHILAMSTQPH
                     KEWRFIIYSVPPIIMLGSAGAAYLWENFKVRTMGNAALLALLPLSVAIGGVVSYIFCY
                     ISTMNYPGGEALAMFNDYVMANNVTNSTVFITVPPCMTGVSLFGQLDFDKYGITYDRT
                     EDSKSVQNKWDSYDYMITHESLDIGKSFGIEDPSASKWELIGKSKIFAGVNPAPLTDY
                     IFKEGNNVFSLVKDVIMRESPYDFMFAMLDNCLIRQDLFFIHKRIRNDADENLQ"
     gene            complement(<1076233..>1081236)
                     /locus_tag="CAGL0M10829g"
                     /db_xref="GeneID:9488061"
     mRNA            complement(<1076233..>1081236)
                     /locus_tag="CAGL0M10829g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999559.1"
                     /db_xref="GeneID:9488061"
     CDS             complement(1076233..1081236)
                     /locus_tag="CAGL0M10829g"
                     /note="highly similar to uniprot|P53599 Saccharomyces
                     cerevisiae YNR031c SSK2 MAP kinase or uniprot|P25390
                     Saccharomyces cerevisiae YCR073c SSK22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999605.1"
                     /db_xref="GeneID:9488061"
                     /db_xref="GOA:B4UN62"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:B4UN62"
                     /translation="MSNSDYFSHKPADSTGTPGTGTGTGTGGGTGTGTGTGTGSRRLA
                     KEYLPARSRSSSSDARNPYMYHYNPRDAAGAAGAVTGSGSGSNVGTPPGFHTTSPQSG
                     YMSSRIGGPESLMQHHTGLTFDSMMQNPVLSMGPLSPGISPLTNLNAFGKNSTGVPKQ
                     PSSGNNTISFAPVPSPTSTSARSSRRASVVSNSSQGIHSLPKIATQIHQGQGQQVQQQ
                     SPNKKPYKIYNSQDGNPSITNTASKIRTSSIAMDSSTSTITTPTLVISPDMAAGSLPS
                     NLGSTPSESTLKHSSGKHSAMATPGGTASNAVNMGSVGSLQDMATPGASTRSATIQNG
                     STASLRTFKKQYVLNEQLYLEKMRRNVPDDYYTRGIGPTSVTDEDEEFDIEMDEVFDQ
                     SGSNNKLSELDGNVDIQDDVDFGTKFINPDADRNENLVALSSRFLSRKLDWAFPSKKV
                     REDQSSSTPTESRRSPADINDGNNNNINNNINNNTNDNNNTNSNRNNSNNNNNNNNNN
                     NNNNNNKDSNGTSNTAITTTSTTNNSADVTPRKSTPNNSVSDTPAPQENLSANEHFIS
                     QLLQDPAVVKRFEWQTMLANVLKGDIVKSEKTKIAKEVKGPGFTTQYSDDIWLELKAW
                     MNGRNVDDQKKSLKLLRESADEVFQRVLDFRLPDGLTSDEGEVEIAKLMNKYYRVIKL
                     WSNMKRLYQDKPIAKTEAFRNRIDTLDSWLNFKRNFEEKIHYIRNWVVGTKDPETQVV
                     VDINDDDAIFRHYAHEFADQMIKEKDIEAIFQKRIFFPLAPWILKAKLFFLKNRDTLN
                     ELNLMYLNDQLEMLLMFPMRLVKDIIQLRLSYAKKLQKPTMMMIDQMIDDFNSYIRVA
                     VQMKFTVISYCQGWQFTVNIDPQFDDTVVEAIRHLFILLELKLLDGGGKSTNAFKEPD
                     ILLKYWDGLKNCGHYIDGAGKVIAIEFTKLTLRLVHRLHSYLLQQQNSPPKLTNEAEA
                     EKWLVQLFETLGSMKRKLNRFTNVLMKAFQNSVTYRIDDHAQLMNGLKDTGHFLVYTG
                     GKLEKQGIYLIASPELLGCPENEILKVLYNSDSGCDLIPKLEIENSLTLYNAVAEKWD
                     LSTSIVQGVGKDGLPRYYLQNGNVDAQFRPPNLNSGKSHVAEMYNDDRDPDADILELE
                     MKLNSLGYILVLCPQEPMLWSGEVFNLSEFTTEEINDLDFKTRPDTIKLMCQSSSYAL
                     EYQCDRFLQSASDCVTFLEKRCSFEVVENNLQKLNKAYFRCTYSVLKNYHKIVKTFKK
                     VCPNNDLLNGIFLFARDFGLNFLRINVASNEKKSLIILLLVRLSVGWLQFLSVDCDPT
                     DPRTFRWCVTAMEFAMHMTSGWNILALDENQFSSLKHKISACMSLLISHFDVMGARAV
                     ELEKNSQQPRPNINIEDVFDDDSMLQKNSELRMQSIKALEENVTRGTHRIGKVLDDTD
                     KGNKYISSLASSISNVSIRWQKRNFIGGGTFGSVYSAVDLDNGEILAVKEIRIQDSKA
                     MEKVFPSIKEEMNVLEMLNHPNIVQYYGVEVHRDKVNIFMEYCEGGSMASLLEHGRIE
                     DEMVTQVYTLELLEGLAYLHESGIVHRDIKPENILLDFNGIVKYVDFGAARKISKKGT
                     KRTKMPGADNDMKEDKIVPDSTGLNDLIGTPMYMAPESITGSTNKGHLGSDDIWSLG"
     gene            <1082128..>1083222
                     /locus_tag="CAGL0M10890g"
                     /db_xref="GeneID:2891383"
     mRNA            <1082128..>1083222
                     /locus_tag="CAGL0M10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449816.1"
                     /db_xref="GeneID:2891383"
     CDS             1082128..1083222
                     /locus_tag="CAGL0M10890g"
                     /note="highly similar to uniprot|P32838 Saccharomyces
                     cerevisiae YNR032w PPG phosphoprotein phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449816.1"
                     /db_xref="GeneID:2891383"
                     /db_xref="GOA:Q6FIX8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX8"
                     /translation="MELDECLERLYRGQLLPEVTVQALCFKLKELLVRESNVIHIRTP
                     VTVVGDMHGQFHDMLEIFEIGGRVPDTNYLFLGDYVDRGLYSVETMMLLVVLKLRYPS
                     RIHLLRGNHESRQITQSYGFYTECLNKYGGSPKVWQYITDLFDYLVLCCIIDDEIFCV
                     HGGLSPNVQTIDQIRIIDRFREIPHDGAMADLVWSDPEDDEKILDKSPSDLDYYTAHL
                     SSSQHFQVSPRGAGYTFGRSVVEKFLHSNNMSRIYRAHQLCNEGYQVYFNGLVTTVWS
                     APNYCYRCGNKASILELYSKDNFYFNVFEEAPENKQLNENANQIINTKAIQDYFGSSS
                     NLESEPTQVDLFSDEYQAKYAMSRHVEYFL"
     gene            complement(<1083434..>1083655)
                     /locus_tag="CAGL0M10912g"
                     /db_xref="GeneID:2891384"
     mRNA            complement(<1083434..>1083655)
                     /locus_tag="CAGL0M10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449817.1"
                     /db_xref="GeneID:2891384"
     CDS             complement(1083434..1083655)
                     /locus_tag="CAGL0M10912g"
                     /note="highly similar to uniprot|Q6Q546 Saccharomyces
                     cerevisiae YNR032ca HUB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449817.1"
                     /db_xref="GeneID:2891384"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /translation="MIEVLVNDRLGKKIRVKCLEDDTVGDFKKVLSVQLGMQPSKIVL
                     QKGGSVLKDHITLYDYEVHDNTNLELYYS"
     gene            <1083885..>1086206
                     /locus_tag="CAGL0M10934g"
                     /db_xref="GeneID:2891385"
     mRNA            <1083885..>1086206
                     /locus_tag="CAGL0M10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449818.1"
                     /db_xref="GeneID:2891385"
     CDS             1083885..1086206
                     /locus_tag="CAGL0M10934g"
                     /inference="similar to AA sequence:UniProtKB:P37254"
                     /note="similar to uniprot|P37254 Saccharomyces cerevisiae
                     YNR033w ABZ1 para-aminobenzoate synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449818.1"
                     /db_xref="GeneID:2891385"
                     /db_xref="GOA:Q6FIX6"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR010117"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX6"
                     /translation="MHINVLFIDSYDSFTYNVVRLIEEQSVEGLGVKVTTIHNDKFDL
                     DSLKEYLPLFDCIVVGPGPGNPINGAKDVGVIDALFKNGHDPTINQIPLLGICLGFQA
                     MCLHEGAVIEELHTIKHGQVYPMALADDQQCDIFKGYPQEFKSVRYHSLQVKTVTDSL
                     LPLAYTNDENGKILMAAKVKNREWYGVQYHPESCCSELGQILISNFLDIAHKHNVISG
                     RRATKELLCADNSTLQNIEYLNHTIDLSSIFVSDSLPLDVKSPRLAMEEYDIEETPNV
                     TFKLAELIDSHKFIFASSSLSENRGEWSIIALPDSNSPVFSHYVNYNKTVCHRWRSEH
                     VKKQDILECFRGGSDARVNEHLTVIDEDKDKFWCTLGAFMKDLLVEEHTDMPFIGGLL
                     GILGYEMGNDVENIYDDRELTDIIPRPDAKLIYIENTLLINHKEGKLYLISLRDQFPQ
                     DIKERVSKYVTQSVKEDLHWPDRLPEGINYDIEMPKLEEYKEAFEECQRIMHRGDSYE
                     ICLTTQTRINMETVLEPWRIFQTLVQRNPAPFSSYLEFSDIVDNHDSNLCFISTSPER
                     FLRWDQDSCELRPIKGTVKKGPDMDLEKATAILKTPKEFGENLMILDLIRNDLYQLLP
                     DVKVEEFMSVEEYATVYQLVSVVKARGIQSPTRHNRQYSGMDILRHSLPPGSMTGAPK
                     KITVEYLYRDLERKLNRHVYSGSRGIYSGVTGYWSVNGNGDWSVNIRCMYSYNSGSSW
                     QLGAGGAITVLSTAEGEQEEMFTKLESALQIFT"
     gene            <1086758..>1087729
                     /locus_tag="CAGL0M10956g"
                     /db_xref="GeneID:2891386"
     mRNA            <1086758..>1087729
                     /locus_tag="CAGL0M10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449819.1"
                     /db_xref="GeneID:2891386"
     CDS             1086758..1087729
                     /locus_tag="CAGL0M10956g"
                     /note="highly similar to uniprot|P37262 Saccharomyces
                     cerevisiae YCR073wa SOL2 or uniprot|P50278 Saccharomyces
                     cerevisiae YNR034w SOL1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449819.1"
                     /db_xref="GeneID:2891386"
                     /db_xref="GOA:Q6FIX5"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX5"
                     /translation="MTTTVPKVFAFHEFAGVAEAVADHVVHAQESALAEKPKERKHSL
                     TNLSGTVESLEMSRATSVKSVSSTRENSSGKKNGAPKKERRFKIALSGGSLIQVLHEG
                     LLKRTDVKWGKWDIYFADERLVPFSSQESNYGQAKRKILDQIDTEKYGTPNVFHIDES
                     LIDDPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPNFQENLREK
                     LAWVVPVENAPSGPSNRISLTIPVICHSHRVTFVVEGATKAPVIKTIMERPEKGLPSS
                     IVNEGAAGRVSWFVDDDALTDVFVTKKKYKFHDAEGLGTENNNDNEQ"
     gene            complement(<1088278..>1090119)
                     /locus_tag="CAGL0M10978g"
                     /db_xref="GeneID:2891387"
     mRNA            complement(<1088278..>1090119)
                     /locus_tag="CAGL0M10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449820.1"
                     /db_xref="GeneID:2891387"
     CDS             complement(1088278..1090119)
                     /locus_tag="CAGL0M10978g"
                     /note="similar to KLLA0F27401g Kluyveromyces lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449820.1"
                     /db_xref="GeneID:2891387"
                     /db_xref="GOA:Q6FIX4"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX4"
                     /translation="MLSAVYTVCGLAITSVVSLVVVNRYFNFRIYKSYPFTIVVLVSN
                     LLLLLVTALLLPLDLHDTAAGHPNSLLFKVIWLSIYWLQFAVCWLVIPILISYVSLKY
                     EIPANEITTKISKSIKLNLKFYLICLIALALGLFYLILSTGHGLREVKSLLMALSHLY
                     SLSYTLILLSTGLIILPRDILRDSLELASSDKNMNTLFVNLSKINEDMNESQLNLNES
                     AMLILSTREQENGDIIFNDLLRDCKSEIEYKLEELKSSSLLTSPLVQISNSGNHASSS
                     ITTLEKLNKNYNDFINNYYNFMYDKVKSDEIIHKLAVLQDATLNNSKGKMVVRALSLI
                     CGIFTTLLSLLVYFLELTPTKWFHGWVFVDQKLYNFFLQLAIISYNTLASLYAMSKFK
                     FLDFHLIPNGQSSPSNALYYSLYSSRLLFPLCFNLIALIPKHSNNSEKTPVSSIFEKV
                     LYQNLTVIPMVNFLNKFLPLLFMTIIPLSYKFDIKQKILLKVLGEEYYYQFFGLMLYE
                     PIGEIPSTEQDIESRHRMVPNNNGSGTITGQPRISPISMATAERSPLDEDYQYSLQDG
                     KFLFERASNSLKQSSPQHNNPLTNIQTNSTTSDSGRLNDMPASHTYL"
     gene            <1090961..>1091239
                     /locus_tag="CAGL0M11000g"
                     /db_xref="GeneID:9488062"
     mRNA            <1090961..>1091239
                     /locus_tag="CAGL0M11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999560.1"
                     /db_xref="GeneID:9488062"
     CDS             1090961..1091239
                     /locus_tag="CAGL0M11000g"
                     /inference="similar to AA sequence:UniProtKB:Q3E841"
                     /note="similar to uniprot|Q3E841 Saccharomyces cerevisiae
                     YNR034w-a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999606.1"
                     /db_xref="GeneID:9488062"
                     /db_xref="GOA:B4UN63"
                     /db_xref="InterPro:IPR021591"
                     /db_xref="UniProtKB/TrEMBL:B4UN63"
                     /translation="MPSKITFESLTALGQDTLGTLTFDEKHHLIDTSGIGEKINKSFV
                     ADAVRKSNDELGKLGYQVYEDSKVVGHAFKDGAGKTTVYFHDKKDEKK"
     gene            complement(1091512..1091598)
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0M11000r"
                     /db_xref="GeneID:2891388"
     tRNA            complement(join(1091512..1091548,1091561..1091598))
                     /gene="tRNA-Lys (TTT)"
                     /locus_tag="CAGL0M11000r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2891388"
     gene            <1091979..>1093118
                     /locus_tag="CAGL0M11044g"
                     /db_xref="GeneID:2891389"
     mRNA            <1091979..>1093118
                     /locus_tag="CAGL0M11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449821.1"
                     /db_xref="GeneID:2891389"
     CDS             1091979..1093118
                     /locus_tag="CAGL0M11044g"
                     /note="weakly similar to uniprot|P24869 Saccharomyces
                     cerevisiae YPR119w CLB2 cyclin or uniprot|P24868
                     Saccharomyces cerevisiae YGR108w CLB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449821.1"
                     /db_xref="GeneID:2891389"
                     /db_xref="GOA:Q6FIX3"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX3"
                     /translation="MSLANLYMCSVACAINLNINFTMDSKIIKNYLLPKAIYKPGNKI
                     GATIFNDNRTINNKLPLSLEKNANSLNIMDNTNVLKSVLKNYKCNKSLPYSSLIDKEN
                     ISNESSQIHIAKENSEVDLCNTTLDNAYEYLLKLDEDTYLPDTILNEYSSLRQTRDLL
                     LNWVIKIHQNLKLENETLYMTIDLIDKFLIKKKLPIEKFQLLGLTCLYIASKYEEVLP
                     PSIFQFALESNGIFDSEEIKESEFNILETLNFKIGYPSPIVLLDRQLDGYLNYNEMKF
                     MSLYLLEITFVDFRFLSYRMSMRTKAAALITLKMYNHSIKDLKTRFQKEGLMQTIEKI
                     CRYILQYLLEPTIHTELQRKYSQLASYNVADRATKYVKCLIKKYA"
     gene            complement(<1093298..>1094299)
                     /locus_tag="CAGL0M11066g"
                     /db_xref="GeneID:2891390"
     mRNA            complement(<1093298..>1094299)
                     /locus_tag="CAGL0M11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449822.1"
                     /db_xref="GeneID:2891390"
     CDS             complement(1093298..1094299)
                     /locus_tag="CAGL0M11066g"
                     /inference="similar to AA sequence:UniProtKB:P32943"
                     /note="similar to uniprot|P32943 Saccharomyces cerevisiae
                     YGR109c CLB6 cyclin B-type or uniprot|P30283 Saccharomyces
                     cerevisiae YPR120c CLB5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449822.1"
                     /db_xref="GeneID:2891390"
                     /db_xref="GOA:Q6FIX2"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX2"
                     /translation="MDMDKRVERVPLAEVRASNVLSQPVTISSSKRKLEVYDGEETPA
                     KKVKVVDQVAIRDVATVPEYSTDIFKNLFKSEEDTIPSHNYLLDEKSEYHIRANMRAI
                     LVDWLVDVHRNFKCLPETLLLAINILDRVLSSTKVSVSKLQLVAVTSLFIACKYEEVK
                     LPKIANFAYITDGAATVEDIREAEFNILETLRFNINWPNPLNFLRRLSQIDDYNYELR
                     DIAKFVLEFIMCTHYFVNYKPSFLSAMAIYLSKRICNDESSNHNEGILTTWSATHTEY
                     SGGINPNNDPKFNDSLNVLIDEFKQPSNSTKSLLAKYKANTYHGMFFRVQDWCLNYI"
     gene            complement(<1095254..>1095910)
                     /locus_tag="CAGL0M11088g"
                     /db_xref="GeneID:2891391"
     mRNA            complement(<1095254..>1095910)
                     /locus_tag="CAGL0M11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449823.1"
                     /db_xref="GeneID:2891391"
     CDS             complement(1095254..1095910)
                     /locus_tag="CAGL0M11088g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449823.1"
                     /db_xref="GeneID:2891391"
                     /db_xref="GOA:Q6FIX1"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX1"
                     /translation="MDTNQARDSAGTALTQPSFRVDSQGSQTTSSIEDDVAKIIGPME
                     GGKVTKVDTIFLQQEIDDIKTKERASGFKFQPFKNLKSKFKAKRKRQKEAIDSAKRTL
                     LSDELDLRAANKYDHEYRKFIDKSYFAARNATAQQTEAEMESCFMDVEQAFNKALTNY
                     FKERYNILVTQTIPNAAAEPAKVAKAPPRSIRRPKILGKSDADECTYPFPKPDSPHHL
                     "
     gene            complement(<1096321..>1096539)
                     /locus_tag="CAGL0M11104g"
                     /db_xref="GeneID:9488063"
     mRNA            complement(<1096321..>1096539)
                     /locus_tag="CAGL0M11104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999561.1"
                     /db_xref="GeneID:9488063"
     CDS             complement(1096321..1096539)
                     /locus_tag="CAGL0M11104g"
                     /note="highly similar to uniprot|P35179 Saccharomyces
                     cerevisiae YDR086c SSS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999607.1"
                     /db_xref="GeneID:9488063"
                     /db_xref="GOA:B4UN64"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:B4UN64"
                     /translation="MAKNEKGENKEQILDAPMEFVKEGSQFLSKCKKPDLKEYTKIVK
                     AVGIGFVAVGVIGYAIKLIHIPIRYVIV"
     gene            complement(<1096867..>1097679)
                     /locus_tag="CAGL0M11110g"
                     /db_xref="GeneID:2891392"
     mRNA            complement(<1096867..>1097679)
                     /locus_tag="CAGL0M11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449824.1"
                     /db_xref="GeneID:2891392"
     CDS             complement(1096867..1097679)
                     /locus_tag="CAGL0M11110g"
                     /inference="similar to AA sequence:UniProtKB:P35178"
                     /note="similar to uniprot|P35178 Saccharomyces cerevisiae
                     YDR087c RRP1 involved in processing rRNA precursor species
                     to mature rRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449824.1"
                     /db_xref="GeneID:2891392"
                     /db_xref="GOA:Q6FIX0"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:Q6FIX0"
                     /translation="METSKFVKQLASNNRVVREKALETLEQFIVSAQFKKSKQVQFDK
                     LWKGLYYAMWFCDRPRPQQRLASTLGALHVRFFDERDSGAEELTVNDKAFVRFSKAFW
                     RIMCLEWLGIDRFRLDKYLLLIRRALFNQFKYLQMRQWHAPLVAKYLERVLGAIPLSG
                     DPKVYNGIPIHVMDIMLDEWERLALEDEEEELEEDKKLEIMKEFVSGSPLDQVLDILR
                     NLLKNYDNSKILRDKIKKEVLTDKRLAQWGIVEKKQTEEEKEAQSEEEWKGF"
     gene            complement(1097934..1098006)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0M11132r"
                     /db_xref="GeneID:2891393"
     tRNA            complement(1097934..1098006)
                     /gene="tRNA-Arg (ACG)"
                     /locus_tag="CAGL0M11132r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2891393"
     gene            <1098232..>1101204
                     /locus_tag="CAGL0M11154g"
                     /db_xref="GeneID:2891394"
     mRNA            <1098232..>1101204
                     /locus_tag="CAGL0M11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449825.1"
                     /db_xref="GeneID:2891394"
     CDS             1098232..1101204
                     /locus_tag="CAGL0M11154g"
                     /inference="similar to AA sequence:UniProtKB:Q12176"
                     /note="similar to uniprot|Q12176 Saccharomyces cerevisiae
                     YDR060w MAK21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449825.1"
                     /db_xref="GeneID:2891394"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW9"
                     /translation="MAKGFSLKDQVASKIGQQKKKHDKKQEKNGSKETDEVLKREALE
                     LGASEKDLDLIKDVDVDENDDEVLILDAEDGDDGELGSELKSFIGKLGLDKHAVPDAK
                     EEVAEEAQENDEDDDEDEENDDEEELSSESEEEGQDSEPEEPKEKKDSGFISQTTIIS
                     SDKLIVPYDVPWYQVPLDPQLKQNVLDSQNEEPLTKEQITTLFNRGKETLEADNQTYY
                     DEFTKDSSQRKFMSQILSDGTLSDKISALTLLIQDSPLHNMKSLDMLLSFCSKKSRNS
                     ALQSLNALKDLLLSGLLPNRKLRYFKNQPGLSMMLNKRTLAIFYFEDYLKKLFFKILE
                     TLELLSHDPIIHVRMQVLTHIFDFLIKQPEQEFNLLRLGVNKLGDIDSKVSSKSSYLL
                     LKLQQEHPNMKSIIIDAIVDIALRPNADYHATYYSTITLNQTILTRTEDEIANKLIKT
                     YFTLFEKFLISTEKDNKDDGPEKTKKSYENKRKKNFKRGKKGGKSVKEDVTESEVIKE
                     KNSKLFSSLLTGINRAFPFAQLSASVYETHLETLYKITHSSNFNTSVQALVLINQVTV
                     KAKLNNDRYYRTLYESLLDPRLVNSSKQGIYLNLLYKSLKQDASNISRVEAFVKRILQ
                     VSSHWVNIGTIVGFFFLLIQLVQIVPHIQNLLTNTPVDQEYQADEADEDSSEKAHVRQ
                     YDSRKRDPKFANADVSSLWEIANFTDHYHPTVKAYAEAFVNGKYKEVSKPDLGLYTLT
                     HFLDRFVYRNAKQKPLSRGSSIMQPLFGGAQTRESLLVKASDMVRNIGPVNTKNWIDS
                     KVEEIKPEDRFFYQYFTSKKTAIKSDKKEAQPKEEDEEMDEDEIWNALVKSRPDVEDD
                     SDDSVGFSDEDFGDMSDMSDDEDQDVAPSDDDDEEDSDSNDVNIDEDIFYSFNDDGEG
                     KEQEDEDENEDDDEDEDEDGIDSDTLKRLREDEVSSSEEEEEDNKKNKKQKKSKKKSL
                     PVFAAAEDYAKYLESDSE"
     gene            complement(<1101519..>1102178)
                     /locus_tag="CAGL0M11176g"
                     /db_xref="GeneID:2891395"
     mRNA            complement(<1101519..>1102178)
                     /locus_tag="CAGL0M11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449826.1"
                     /db_xref="GeneID:2891395"
     CDS             complement(1101519..1102178)
                     /locus_tag="CAGL0M11176g"
                     /note="highly similar to uniprot|Q05015 Saccharomyces
                     cerevisiae YMR222c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449826.1"
                     /db_xref="GeneID:2891395"
                     /db_xref="GOA:Q6FIW8"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW8"
                     /translation="MAKKVLMLHGLAQSGEYFASKTKGFAAELEKLDYELYYPTAPNS
                     FPPADLPNGLLDEIDDKVSSQSGVIAWLQNKETGDGYYIPETTINYLHNYIIENGPFD
                     GIVGFSQGAGLAGYLVTDFNGLLNLTEEEQPPLKFLMAFSGFRFRGEEHQKQYKNPIS
                     IKTLHVHGELDTVTEPEKVQALYDSCDSSSRTFLTHKGGHFIPNSRGFLKKVVEWLNE
                     L"
     gene            <1102767..>1104152
                     /locus_tag="CAGL0M11198g"
                     /db_xref="GeneID:2891396"
     mRNA            <1102767..>1104152
                     /locus_tag="CAGL0M11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449827.1"
                     /db_xref="GeneID:2891396"
     CDS             1102767..1104152
                     /locus_tag="CAGL0M11198g"
                     /inference="similar to AA sequence:UniProtKB:P50102"
                     /note="similar to uniprot|P50102 Saccharomyces cerevisiae
                     YMR223w UBP8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449827.1"
                     /db_xref="GeneID:2891396"
                     /db_xref="GOA:Q6FIW7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW7"
                     /translation="MDDCQHIQSIFENPKNRAAWLNALSTTQSVLRHSPIKAKLLHAF
                     RCSTCKEISNGSNFLCLQCGFCGCWNGSHFEQHSKETGHLFGINAQTELVFCFQCMDY
                     VGDFDLFRDAALANRWDYYEEYTNVPTVDQIDGMAGLVNMGSTCYMSSIMQCIIHNPY
                     MIRYFMCQQHSNNCTLKMASNCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFIN
                     LLTCSWKVNENLAGYSQQDAHEYWQFILNHIHQDYKSSMHSHSDDKLCNCVVHSSFQG
                     SLKSSIVCPECNNDSKTTFDPFIDLSLGIKDKHTLTECLDNFHKKEQLHDYDFFCKKC
                     QAQQNPIKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQN
                     PDEDPSILYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKILEKDVLKEQA
                     YLLFYIVKHIS"
     gene            complement(<1104310..>1106280)
                     /locus_tag="CAGL0M11220g"
                     /db_xref="GeneID:2891397"
     mRNA            complement(<1104310..>1106280)
                     /locus_tag="CAGL0M11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449828.1"
                     /db_xref="GeneID:2891397"
     CDS             complement(1104310..1106280)
                     /locus_tag="CAGL0M11220g"
                     /inference="similar to AA sequence:UniProtKB:P32829"
                     /note="similar to uniprot|P32829 Saccharomyces cerevisiae
                     YMR224c MRE11 DNA repair and meiotic recombination
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449828.1"
                     /db_xref="GeneID:2891397"
                     /db_xref="GOA:Q6FIW6"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW6"
                     /translation="MELPDEDTIRILITTDNHVGYNENDPITGDDSWRTFHEIMMLAK
                     ENNADMVLQSGDLFHVNKPSKKSLYQVLKTLRLACMGDKPCELELLSDPSKVFNYDEF
                     TDVNYEDPNFNISIPMFAISGNHDDATGDSLLCPMDVLHATGLVNHFGKVLEADKINI
                     APLLFQKGKTKLALYGLASVREERLFRTFKDGGVTFEVPTVSENEWFNILCVHQNHTG
                     HTNTAFLPEQFLPDFLNLIIWGHEHECIPNFMHNPSKDFDVLQPGSSVATSLCEAECK
                     EKHVFIVELRHETKPKLIPLKLDTVRTFKMKTIHLKDEPTLRPHDKEAISKYLVDIIE
                     EMLDEANRETKEKLFPNIPMDEIESMGSFPLPLIRLRVDYSGPDENPEIIYQVENPRR
                     FSNRFVGKIANTNNIVQFFRAKRKPIAKTRKDGVTTMDIDNELPFNDGSELQVDDLIA
                     DLLKKMNLSLLPENGMNEAMKKFVDKDEKLALKQFIEKEIHHEVDILYNNKDFIHGDD
                     PEEIKKFIKSVKRANTSDQSSSLDINKDEAADLLLNGYDNGINKLPAKSSRNSRPSTR
                     QKKNLSSEIIVSEDELESDHDADLKGYDEDLIEISSDEDNYRERRRVRSTKPTKSPKG
                     SAKSSKRSATTRKSARTPKTDILGSLLAKKRK"
     gene            complement(<1106535..>1106994)
                     /locus_tag="CAGL0M11236g"
                     /db_xref="GeneID:9488064"
     mRNA            complement(join(<1106535..1106773,1106937..>1106994))
                     /locus_tag="CAGL0M11236g"
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /transcript_id="XM_002999562.1"
                     /db_xref="GeneID:9488064"
     CDS             complement(join(1106535..1106773,1106937..1106994))
                     /locus_tag="CAGL0M11236g"
                     /note="highly similar to uniprot|P19956 Saccharomyces
                     cerevisiae YMR225c MRPL44"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /protein_id="XP_002999608.1"
                     /db_xref="GeneID:9488064"
                     /db_xref="GOA:B4UN65"
                     /db_xref="InterPro:IPR019716"
                     /db_xref="UniProtKB/TrEMBL:B4UN65"
                     /translation="MITKYFSKVAVRFNPFGKEAGAVRLLLSSIPPVQRMQSTQITNQ
                     LLTESSTATPLVKITYKDKKELELDPRGHSFEELANYFDRHSRQLQIKETIENQ"
     gene            complement(<1107273..>1108079)
                     /locus_tag="CAGL0M11242g"
                     /db_xref="GeneID:2891398"
     mRNA            complement(<1107273..>1108079)
                     /locus_tag="CAGL0M11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449829.1"
                     /db_xref="GeneID:2891398"
     CDS             complement(1107273..1108079)
                     /locus_tag="CAGL0M11242g"
                     /note="highly similar to uniprot|Q05016 Saccharomyces
                     cerevisiae YMR226c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449829.1"
                     /db_xref="GeneID:2891398"
                     /db_xref="GOA:Q6FIW5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW5"
                     /translation="MSQGRKAAERLQGKIAFITGASAGIGKATAIEYLDASNGSVKLV
                     LGARRMEKLEELKKELLAQYPDAKIHIGKLDVTDFENVKQFLADLPEEFKDIDILINN
                     AGKALGSDKVGDIDPEDIAGMVNTNVLALINLTQLLLPLFKKKNSGDIVNLGSIAGRD
                     AYPTGAIYCATKHAVRAFTQSLRKELINTDIRVIEIAPGMVETEFSVVRYKGDKSKAD
                     DVYRGTTPLYADDIADLIVYSTSRKPNMVVADVLVFPTHQASASHIYRGD"
     gene            complement(<1108462..>1110111)
                     /locus_tag="CAGL0M11264g"
                     /db_xref="GeneID:2891399"
     mRNA            complement(<1108462..>1110111)
                     /locus_tag="CAGL0M11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449830.1"
                     /db_xref="GeneID:2891399"
     CDS             complement(1108462..1110111)
                     /locus_tag="CAGL0M11264g"
                     /inference="similar to AA sequence:UniProtKB:Q05021"
                     /note="similar to uniprot|Q05021 Saccharomyces cerevisiae
                     YMR227c TAF67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449830.1"
                     /db_xref="GeneID:2891399"
                     /db_xref="GOA:Q6FIW4"
                     /db_xref="InterPro:IPR006751"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW4"
                     /translation="MAVIKIKKPKKNEGANESEGPKLKKIRISAGNRKEEKEPKKLKI
                     NLKKTDVKKSGSVVKLKLGSKKEEKQSRTPRLRLKPIRIPGEGYDSEASDLEDDPLIE
                     SGIILRVLPDVQVDFIKNSIESGDYTGISIKWKGERHAILKLNNVTYGAILVDLPTII
                     EVNKSVDRKNLFKTFDVTQMLVCVKPITSEDELFTLEAPETEDLISKHYEEYLDEIND
                     HKVKLFKNANHVNLHSETEAKNLEKLALKKYHYKHGLTPPLYNVRNRRFRRQMHADEF
                     EYAEKIVDMLLKADAQAEDVKFDLIAPSDVPEKGSVSAAPSHVDLSVANKPEVLNEDV
                     TLQDDDEDLDLEEAFQSDEDESESTKRSDALFGDQDEEGGDEVEQDNGEDEDDDDDDE
                     DDDEEEEEEEVGSVAKSGDDNEKRQHTELLADELNELVSTLEHTKDKLEKATNPLLKS
                     RFVDSIKKLEKEVELKKKQLKESENQLSGGTGPVSSTGIVDEDDEDQDDEDDDEDEEE
                     EEEEGEGEGEEDKDDSKEDKEEELDQNDLDMMMLFGGEGDE"
     gene            <1110364..>1111380
                     /locus_tag="CAGL0M11286g"
                     /db_xref="GeneID:2891400"
     mRNA            <1110364..>1111380
                     /locus_tag="CAGL0M11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449831.1"
                     /db_xref="GeneID:2891400"
     CDS             1110364..1111380
                     /locus_tag="CAGL0M11286g"
                     /inference="similar to AA sequence:UniProtKB:P14908"
                     /note="similar to uniprot|P14908 Saccharomyces cerevisiae
                     YMR228w MTF1 RNA polymerase specific factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449831.1"
                     /db_xref="GeneID:2891400"
                     /db_xref="GOA:Q6FIW3"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR016586"
                     /db_xref="InterPro:IPR023165"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW3"
                     /translation="MKVAVPTISQLHIKSYYGFRYLLDPDWHQKVFEKLGLSSNPNMK
                     VLDLYPGPGIHSAVLYNKVQPQQYTMMECRRDFLSNLRNIYTDGPMELVKKDPYKWES
                     YTELIDQEKLFVPKKADYNVVNKDFYIMANLTEKKHEGLLMQWMNCVGNRNWLFRFGR
                     SPMLIWMPTPTASKLLADSGDHSRHKCSLVREAFTDTKLVALSQEEDMKSFNSVCLDK
                     SNPLVIPDGTDYGGKDFPIALVEFTPKKHDIDLDNWEFVTKHLMVLYKTPLIDAIDCL
                     GHGARDYFSANIDKDHIHLLKKCPQDFTNNDFVYLTNLFHLWPFKPDVYMDFLDIYQE
                     ESRE"
     gene            <1111761..>1116119
                     /locus_tag="CAGL0M11308g"
                     /db_xref="GeneID:2891401"
     mRNA            <1111761..>1116119
                     /locus_tag="CAGL0M11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449832.1"
                     /db_xref="GeneID:2891401"
     CDS             1111761..1116119
                     /locus_tag="CAGL0M11308g"
                     /inference="similar to AA sequence:UniProtKB:Q12697"
                     /note="similar to uniprot|Q12697 Saccharomyces cerevisiae
                     YOR291w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449832.1"
                     /db_xref="GeneID:2891401"
                     /db_xref="GOA:Q6FIW2"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW2"
                     /translation="MPYSQHGSSSHAQRTRASFSSARSNATSATLTSSVIIDHNNSES
                     YAGAAFEAVPSSIVSFHRPHSFQSSHMMGSSLNSNMLERTTGAIHETEPLYQGNDHSR
                     SSSNNRNFRFFTDEQVSQAEGIATLENTDYDIDWDAAPAYEQENRAGSYMGSRRSSIR
                     DISRRSSLSTSPYGSIDHRGRSASKSRPRYDQVYQTSTHSSSSLSRYSVRERIPVEVE
                     DQDDNSLDVHSSDQSLASSHSNTSNYGGNEGSVNPHDDTTQRKSQNHHEFLKPQYHDK
                     FYPEFKADRHIQRAYISEEDMVIVIAGYKTSKFMSLVYNLLCIFTLGGLFLIGKWLPK
                     YKVRIVGRKAPLAKAEWLVLENEHGEFTIEEPTREWYNRTLSTILMLDSKTETEEFEH
                     GFQRHHHTSEENPNLPILISFQYRYIKFVYSPLDDIFKTNNNWVDFDWVDLETTSKGL
                     SSGIQEDRVLAFDKNQINLKMKTTSQILFDEVLHPFYIFQVLSIILWSLDEYYYYAGC
                     IFLISLLSILDTLIETKKISRTLAEMSHFNCEVRVLREGFWSSIHSSELVPGDIYEIS
                     DPNLNLLPCDSILLSGDCIVNESMLTGESVPVSKYPASEETILQLFDDFQSTQISTFL
                     SKSFLFNGTTLIRAKIPNGGSVALAMAVRTGFSTTKGSLIRSMVFPKPSGFKFYSDSF
                     KYIGFMAIIAFFGFSISCINFIKLGLDKRTMILRALDIITIVVPPALPATLTIGTSFA
                     LNRLKEKGIFCIAPTRVNIGGKIDVMCFDKTGTLTEDGLDVLGVRVSCAATRNKASFS
                     DLISDTHDIFPKFSLKDCSNPDDYKRRNFLISLLTCHSLRVVDGELLGDPLDFKMFQF
                     TGWSYEEDFQNHQFHSLYEERHEGQNFPENNDIIPAIVHPNDSDERNKFVQNDPNNIL
                     GIIRSFEFLSELRRMSVIVKPNNENVYWAYTKGAPEVIIDICNPATLPSDYDDILNFY
                     THSGYRVIACAGKTLPKNTWLYSQKVRREEVESNMEFLGFIIFQNKLKDATSPTLSKL
                     KTANIRTVMCTGDNVLTAISVGKECQLITEDRVYVPTVAYSDMTVQPVIHWNEISNAE
                     HILDTFTLQPIDDYSGPYTLAITGEVFRIIFSNQDNYSEEYVNEILLKGSIFARMSPD
                     EKHELVEQLQKMDYTVGFCGDGANDCGALKAADVGISLSEAEASVAAPFTSKIFDITC
                     VLDVIKEGRASLVTSFACFQYMSLYSAIQFISITILYSRGSNLGDFQFLYIDLLLIIP
                     IAVTMSWSKPYHELAKKRPSANLVSPKILVPLILDIVFLFLFQFLPWIWIQGRPWYIK
                     PIVGGDDAVQSSDNTVLFYISNFQYILTSVVLSIGPPYREPVHHNVQYVRDIALSVLV
                     SFVIMLVNPDSKLGNLLQLTSIPTGLIILIPIWCMLNYYVLTHVPPKVKQYFRKQRSS
                     KLYKNILRDQSQQYVV"
     gene            complement(<1116253..>1117143)
                     /locus_tag="CAGL0M11330g"
                     /db_xref="GeneID:2891402"
     mRNA            complement(<1116253..>1117143)
                     /locus_tag="CAGL0M11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449833.1"
                     /db_xref="GeneID:2891402"
     CDS             complement(1116253..1117143)
                     /locus_tag="CAGL0M11330g"
                     /inference="similar to AA sequence:UniProtKB:Q08743"
                     /note="similar to uniprot|Q08743 Saccharomyces cerevisiae
                     YOR292c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449833.1"
                     /db_xref="GeneID:2891402"
                     /db_xref="GOA:Q6FIW1"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:Q6FIW1"
                     /translation="MTIALPGVDGSTAYNYAVRQRNVFRTVFTANVFHISLTHWFLMF
                     CWLNLMWRYYFNHYKDLYKYNRLIASQLSNCMLFGLSDILAQCITCYFSREMDPVPRI
                     IDETVQNLIPYNVMPLPGGIFEANEELLDSDNDDNLSVFNDYGEYDNSNDEIEYNHTE
                     KVATFHFRRWLGFMGWGGFISFFQVPWYIILNTIYTEDPTVVQVLERVLTDQLLYSPV
                     SLYFFFMYSNYVIEQGDRYTFSMKIRRLYVTTLGCNYMIWPMMQFINFLVIPKHYQVP
                     FSSSVGVVWNCFLSMRNAAK"
     gene            complement(<1117631..>1118461)
                     /locus_tag="CAGL0M11352g"
                     /db_xref="GeneID:2891403"
     mRNA            complement(<1117631..>1118461)
                     /locus_tag="CAGL0M11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449834.1"
                     /db_xref="GeneID:2891403"
     CDS             complement(1117631..1118461)
                     /locus_tag="CAGL0M11352g"
                     /note="weakly similar to uniprot|P46989 Saccharomyces
                     cerevisiae YJL178c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449834.1"
                     /db_xref="GeneID:2891403"
                     /db_xref="GOA:Q6FIW0"
                     /db_xref="InterPro:IPR018939"
                     /translation="MVMLGQVVALAMASSAVALNCKNHNVLSNYNVANKDILLKNELD
                     TPPSKTSEMWYLAPCEDGSRRQRPSECSSDDLMCAIRHVKVDGSDHLTQKLDVHKSAK
                     YEVEEVESGGFDIRFLGVKWGSNTIDATLSYSCDTNLKTDELVTTIWNSEYVLIEMSG
                     PSGCKRDGNSDSGDNGNGNGNGNDPDNNNNTGKDKKSKKTSWFTWLFVYAILFTVIYL
                     MVVSYLNTKGGSFQDFRNEFVERGTEFITSLPTFVKEVVTKTLGTRDSSASRGGYSAV
                     "
     gene            complement(<1118773..>1121727)
                     /locus_tag="CAGL0M11374g"
                     /db_xref="GeneID:2891404"
     mRNA            complement(<1118773..>1121727)
                     /locus_tag="CAGL0M11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449835.1"
                     /db_xref="GeneID:2891404"
     CDS             complement(1118773..1121727)
                     /locus_tag="CAGL0M11374g"
                     /note="weakly similar to uniprot|P32591 Saccharomyces
                     cerevisiae YJL176c SWI3 transcription regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449835.1"
                     /db_xref="GeneID:2891404"
                     /db_xref="GOA:Q6FIV9"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV9"
                     /translation="MDFDMDVDLFGDNDGNDGNDAQDYSVYESADEKSRIKTSSPGEA
                     EDAHEDAGDAAGDTAGDAAGDAPGILDFEPEHKVSEQESEAPEKEAVDVTEMEAQEPA
                     DVTEPVSSISQPTEVKSDTDPNKDKTDAEQPIEDNLKAEQLTDDKQELEQPIEEKLDA
                     EQSIEDNLNSEQPTDDKQEVEQPIEDSLNAEQPAENKPEVERPTEDKQDSEQPNDNKS
                     DVELQDDATELPTGREISNEQPIEDRADEQPNEERVSGDDGNEFKASDELPNEEKVSD
                     DSIIQEKASDQQITEGIVSDQQISKDKPTDEQAQDEITDGQLQSKVTDDQISQDMTSS
                     EQPSLGHVSHEQHIDGPASTQLPTKEDITQEHTNESTSHVHGITSNEQPKEHSPTEEL
                     PTLEISNGLPIEKPSDEKLSGENPVDEIPGQDKNVQDHTTEDVKMQDGIESPNDLLKE
                     EKDEAQLTGSPATEGEQASNDSEYALIQTHEIVIPSYSKWFDLRKIHEIEKKSLPEFF
                     TNRIPSKTPQVYLKYRNFMVNAYRLNPNEYFTVTAARRNVSGDAAALFRIHKFLTKWG
                     IINYQVDAKVLPKNVEPPFTGDYSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMDVN
                     DSESALYRYLKEEKRKFIEGKIENSVHHKQHTKTEVKKENQDEKNTESTEQQTAPAHH
                     EGQERSSLKRSSEAIFNEEHKLKKPKILDHTDEEWSREDLQKLLDGMQKHGVDWYKVA
                     SEIGNKTPEQCILKFLQLPIEDKFLYNGEGGKDLGPIKFAPHLPFSKSENPILSTIAF
                     LVGMVDPQIVKNMTSRAIQRIEDVHEQNLKNTKSDAKEGSEIAIASLGVRSGVYANNE
                     EKHLHALSHELVQIQLQKLDSNLELLNQMEKSFDLEKRMLEKQQESLLLQRLQIAKNA
                     RSVMEIATKILEDADDKEALKKDLEVIRDHVMDPPTPSLATPGDSKSSTEPKEVKPVS
                     IEVPQYYRYWSA"
     gene            <1122109..>1125687
                     /locus_tag="CAGL0M11396g"
                     /db_xref="GeneID:2891405"
     mRNA            <1122109..>1125687
                     /locus_tag="CAGL0M11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449836.1"
                     /db_xref="GeneID:2891405"
     CDS             1122109..1125687
                     /locus_tag="CAGL0M11396g"
                     /inference="similar to AA sequence:UniProtKB:P13186"
                     /note="similar to uniprot|P13186 Saccharomyces cerevisiae
                     YLR096w KIN2 ser/thr protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449836.1"
                     /db_xref="GeneID:2891405"
                     /db_xref="GOA:Q6FIV8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV8"
                     /translation="MERDYHVNTGFQMGRREEERGIAMAPASLRMMGKSGARELMEPA
                     TVNAGVQDIDANAEMQATDMPGAPASVPAERKSQGQGQSQGQGQGQGQGQGQMKQFHR
                     KSLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQ
                     EIMERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQ
                     LLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDF
                     GLSNVYDTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDD
                     ENSSVLHEKIKRGKVEYPQHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDT
                     PAPSYVPNRIPLTPEMLDSTVLREMFRLEFIEDIEETRKLLATIVSDPTYLTLSNEYW
                     TRLQSITETTGQGKTTHFEIQGVSINFHLTSGVNKIPFEDPTRAFHPLLSIYYLVAEM
                     LQRKMAKLQKKQALIQQQQQQIQKQQQQRVQQQQPQQQKQPLTPKEPEQTEFAYSKTP
                     NTSDKSAGLTVPSRPTDIINEMKAKSDRTDYIMNTPKQDTGSNTTVEKLYTPKEQQSV
                     ERKTAPLHIMVPPKLTMPEQAHTSPTTRKSSDIHDELNTAMSPKVLSKEYEQRPNTQL
                     DSPEKKRFPALFGKLSQKRQPSSQQSPQSNNNPQFQVHAAPNLEPAKRSTKTHTRTVS
                     EYVPGPSNNKEFIETYLPSNYANKNNSPSRSVSTKVANTERFPALPANANTMVEQQLA
                     KDMDNLNVNNNTNRAPDTSSADYDENKPLPPLTVTKGRKLHPSARAKSVGHSRRESLK
                     FTRPPVPTNVQGYDNDDAGFLEYSDDNRNDSAIIRTPNSSKYLSPPTPNTRFGFGSTE
                     ELTDEQILEQASRAPPGTMPSIDYPRSLFLKGFFSVQTTSSKPLPIVRYKIMHLLKKM
                     HVEFKEVKGGFVCTHEGQLSFLNNDNELPEYNPLAETDENNIDNRLTINTNLSPHPSQ
                     NHLQLPTPIENQAVTYRSIRSGSRQNSIRRQGSTKISPNIPTTPMATTEHHRNISEVM
                     SPVAQNINLGSTLSDEHSTTSLDNIANQEDILTTSRVQNMNRPDLDLEQQAIAKASNE
                     KSRVKFEIHIVKVRIVGLAGVHFKKVSGNTWLYKELASHILKNLNL"
     gene            complement(<1125884..>1126939)
                     /locus_tag="CAGL0M11418g"
                     /db_xref="GeneID:2891406"
     mRNA            complement(<1125884..>1126939)
                     /locus_tag="CAGL0M11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449837.1"
                     /db_xref="GeneID:2891406"
     CDS             complement(1125884..1126939)
                     /locus_tag="CAGL0M11418g"
                     /inference="similar to AA sequence:UniProtKB:Q12347"
                     /note="similar to uniprot|Q12347 Saccharomyces cerevisiae
                     YLR097c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449837.1"
                     /db_xref="GeneID:2891406"
                     /db_xref="GOA:Q6FIV7"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV7"
                     /translation="MGGQDAVSCNTEDTNPRADEALQLWEQGAAKEQAGSLMDAINFY
                     RKALKVHDGVEKLYRKKLQEDYMLQQKLEALNLNDKSNDHTENTSDVNGTSEEAGPVD
                     PCWILEMLPDDILLQIIKQVVYMSGESWVNLSKTCASFNKLCFHNSLPYQAFADYIYP
                     KQVYDSETLQMNKVTDMKSFTKEIWGDDAKQMICNRPFIKYHGIYISVVNVVRYGAND
                     EGSLSLMNPIHILTYYRYFRFYPDGSCLRLLTTDEPSFVVKHFSKETPIKDSEICRWS
                     LGFDYDFGLLHITRTSDKYEFHEKFVIKNQGRKKHHQLAWLSSVVIDNEGVEMENSLK
                     NERAFHFSRVKSYENSL"
     gene            complement(<1127298..>1129025)
                     /locus_tag="CAGL0M11440g"
                     /db_xref="GeneID:2891407"
     mRNA            complement(<1127298..>1129025)
                     /locus_tag="CAGL0M11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449838.1"
                     /db_xref="GeneID:2891407"
     CDS             complement(1127298..1129025)
                     /locus_tag="CAGL0M11440g"
                     /inference="similar to AA sequence:UniProtKB:P43634"
                     /note="similar to uniprot|P43634 Saccharomyces cerevisiae
                     YLR098c CHA4 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449838.1"
                     /db_xref="GeneID:2891407"
                     /db_xref="GOA:Q6FIV6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV6"
                     /translation="MSGVRKLACEGCRKRRRRCDKKVPCSNCVKHKIECVMTNNDLRS
                     NRTSVAYVQSLEKRVKDLEMHITQMRGTVDSGIDEVESVGSLNASDGSVENLNSGGLS
                     TNIGIYPSNSLSLKRPRPPITQTSSQRQLLNLSKNPTILKGLSLFFKWLYPGHFMFIH
                     RETFLNSFFGDFNTKSYYCSEELVYAIFALGAQIADRSDDVANMGAEYYRRSKSMVLT
                     KIFQLNEDLNDESTSSSKLAIIQTLLCLAFYDIGHGDNPMAWYLSGLAFRISYEIGLH
                     LNPEAWAHVYEDELSGVDIEVRSRVYWGCYIADHLITLLFGRTTILKLSNSTVPETDE
                     LPEIESGIEDFIFDPKCTLSMAKPLKNLIVVCRITEVFAPKIFGQSEFPMQRREHLSK
                     FNLEMYNWRKDLPKELRWSRSTIKNMHDFNPSRAYIWFHYYLVLISYNKPFLEELKLS
                     RELITEHIDELSLLLEGWEIKFGGFQTTNLYMVYCVILSLQCMKTETISNRHYKQFMA
                     FLKSPSLTYEIAKKFVDNDNEPAGTEPLDLLLGTLSSGTDLKLEYNLDFTLLNEIDLL
                     IGGSNGPML"
     gene            complement(<1129244..>1130404)
                     /locus_tag="CAGL0M11462g"
                     /db_xref="GeneID:2891408"
     mRNA            complement(<1129244..>1130404)
                     /locus_tag="CAGL0M11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449839.1"
                     /db_xref="GeneID:2891408"
     CDS             complement(1129244..1130404)
                     /locus_tag="CAGL0M11462g"
                     /inference="similar to AA sequence:UniProtKB:Q12385"
                     /note="similar to uniprot|Q12385 Saccharomyces cerevisiae
                     YLR099c ICT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449839.1"
                     /db_xref="GeneID:2891408"
                     /db_xref="GOA:Q6FIV5"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV5"
                     /translation="MWCKGDDLETLQYKVMEEVPVEGQRAVLRCGVNQWYFRGGDRVV
                     TPTLLVHGYGASSMAYHRCFAPLSRHIRDLYAIDLPANGLSEAPPLVAEGEAPKAKFK
                     IEENKFTVVQGARRAAEPVTDAQVDQELMLRTHREKRRYLQQYEDYYVESIEQWRKEN
                     NLDKFNLVGHSFGGYLSYKYALKYPESVNKLCLLSPLGMERNIHSINNTFEENVVYEL
                     QESDPSSYLYTRKRKAPKFLFENQFSVLRWMGPIGDKLCLSFINSSYAKVPSQAYKDY
                     LFESFLGKKHFAKQNVHALKHLFTRSLLARDPIMDTIDKLKVPDVSVFYGDHDWMNSY
                     AGYLMVERLKKFRVASTSGGSASYLEVPDAGHNLFLDNPDYFSKKLVQFLSE"
     gene            <1131048..>1135787
                     /locus_tag="CAGL0M11484g"
                     /db_xref="GeneID:2891409"
     mRNA            <1131048..>1135787
                     /locus_tag="CAGL0M11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449840.1"
                     /db_xref="GeneID:2891409"
     CDS             1131048..1135787
                     /locus_tag="CAGL0M11484g"
                     /note="highly similar to uniprot|P08566 Saccharomyces
                     cerevisiae YDR127w ARO1 arom pentafunctional enzyme"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449840.1"
                     /db_xref="GeneID:2891409"
                     /db_xref="GOA:Q6FIV4"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR008289"
                     /db_xref="InterPro:IPR010110"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018508"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLVKVPILGRETIHVGYGVRSHIVETIVGLKSSTYVVINDSNVG
                     RVPYFQELLSDFEAQLPAGSRLLRYVVKPGEANKTRATKEQIEDYLLSEGCTRDTVIV
                     AVGGGIIGDMIGYVAATFMRGVRVVQVPTSLLAMVDSSIGGKTAVDTPLGKNFIGAFW
                     QPEFVLVDIKWLQSLPKREFINGMAEVIKTACIWNADEFQRLETHADEFLHVVNTPKI
                     SEKEGFQLYDTDIESIKEHIFKLVLESIKVKAEVVSSDERESSLRNLLNFGHSIGHAY
                     EAILTPQALHGECVSIGMVKEAELSRYLGILSATQVARLSKILVAYGLPVSKDEKWFR
                     ELTLNKKTPLDTLLKKMSIDKKNDGSKKKVVLLETIGKCYGKSAHVVSDEDLRFVLTD
                     ETLVYPFNNIPRDQNKTVTPPGSKSISNRALVLAALGKGTCRIKNLLHSDDTKHMLTA
                     VQELKGANISWEDNGETVVLEGQGGSTLVACENDLYLGNAGTASRFLTSVAALVNSTS
                     QKDHVILTGNARMQQRPIGPLVDSLRNNGIKIDYVKNEGCLPLKVHTDSVFKGGRIEL
                     AATVSSQYVSSILMCAPYAENPVTLALVGGKPISILYVEMTIKMMEKFGIKVEKSTTE
                     EYTYIIPKGHYVNPAEYVIESDASSATYPLAFAALTGTTVTVPNIGSASLQGDARFAT
                     DVLQPMGCSVTQTATSTTVTGPPVGHLKPLKHVDMEPMTDAFLTACVVAAVAHDNDPT
                     SKNTTTIEGIANQRVKECNRIEAMCTQLAKFGVRTNELPDGIQVHGLHSINDLKVPSI
                     GNEAVGVCTYDDHRVAMSFSLLAGMVNSEQPNSSNPTPVRILERHCTGKTWPGWWDVL
                     HTELGAQLDGAEPLELNSMKNAKKSVVIIGMRAAGKTTISRWCAAALGYKLVDLDTLF
                     EERYGHGMIKDFVSQHGWEKFREEEARIFKEVIENYGDAGYVFSSGGGLVESSESRRI
                     LKSFSKSGGYVLHLHRDIEETIMFLQKDPTRPAYVEEIREVWNRRESWYKDCSNFSFF
                     APHCNSEVEFQNLRRAFTKFIRTITGVTTVDIPTRRSAFVCLTFENLTEYTNSLKAIT
                     YGCDAVEVRVDHLSNMDEDFVSKQISILRASTDGLPIIFTVRTKKQGGKFPDEDYETL
                     QKLLITALKVGVDYIDLELTLPIGIQYKVLNMKRNTKIIGSHHDFASAYPWDHSEWEN
                     RYNQALAMDVDIVKFVGMAKSFEDNLMLERFRDSHTTKPLIAINMGAHGRVSRVLNTI
                     LTPVTSEHLSEVAAPGQLTVAEINRIYTEMGGITKKDFFVVGSPIGHSRSPVLHNTGY
                     SVLGLPHHFDKFETTSAEEVKKHLLDNKANLGGLAVTIPLKLDIIKYMDELTESAKVI
                     GAVNTVIPLGNSKFKGDNTDWLGIRNSLVSNGVPESVSGLSGLVVGAGGTSRAAIFAL
                     HKLGCQKIFIVNRTTEKLEELVKFFPEEYNIVPIKEAEEAEAVNETIGVAVNCVPADK
                     PLDAKLESLLERLLLKSSHTHFVSTLVEAAYKPSVTPVMKLAKDKYQWRVVPGAQMLV
                     HQGVAQFETWNNCRAPFKAIYDAVTEI"
     gene            <1136195..>1137241
                     /locus_tag="CAGL0M11506g"
                     /db_xref="GeneID:2891410"
     mRNA            <1136195..>1137241
                     /locus_tag="CAGL0M11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449841.1"
                     /db_xref="GeneID:2891410"
     CDS             1136195..1137241
                     /locus_tag="CAGL0M11506g"
                     /note="highly similar to uniprot|Q12452 Saccharomyces
                     cerevisiae YLR100w ERG27 3-keto sterol reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449841.1"
                     /db_xref="GeneID:2891410"
                     /db_xref="GOA:Q6FIV3"
                     /db_xref="InterPro:IPR016040"
                     /translation="MTSKTRKVAVITGANSNLGLNIAYRLIERQSADVRLTLVVTSRT
                     LPRVREVVELIKKFVATQEDPCSVDFDYLLVDFTNMVSVLNAYYDLNQKYESINYFFV
                     NAAQGVYDGIDWIGAVKQVLSDPLEAVTNPTYRKQLVGVKSKDEMGLVFQANVFGPYY
                     LIQKILPQLSKGKATVVWISSIMADPKHLSLQDIEMIKSDVTYEGSKRVVDLLHLATY
                     KQMKSQGIHQYVVQPGIFTSYSFAKYLNFFTTFGMLFLFYLARLLGSKWHNIDGYKAA
                     NAPVYVATLINPHFEHQEVKYGSASSRDGMEYIETTDIDKTGSSDVLAYIEKKKLEWD
                     DKLKDQITNSRIPI"
     gene            complement(<1137426..>1138229)
                     /locus_tag="CAGL0M11528g"
                     /db_xref="GeneID:2891411"
     mRNA            complement(<1137426..>1138229)
                     /locus_tag="CAGL0M11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449842.1"
                     /db_xref="GeneID:2891411"
     CDS             complement(1137426..1138229)
                     /locus_tag="CAGL0M11528g"
                     /note="weakly similar to uniprot|Q12107 Saccharomyces
                     cerevisiae YLR102c APC9 subunit of the Anaphase Promoting
                     Complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449842.1"
                     /db_xref="GeneID:2891411"
                     /db_xref="InterPro:IPR024274"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV2"
                     /translation="MSRNIGSNRKSGQRSFQLPTLPPWQTPKFKVANNATPLKRPVRS
                     IRSPGIRISHGNTIHVPKRNIGRVSKKPSINIQEYDYSPFFNRKAIRESQIKSLLECE
                     RAAHCLVFHKDCHINIDEFRPDVDIYCGEFDDYSIENLDPPHQESTIDSALNERQRGV
                     LQHTLPNYTGNSIVNKLRNGGSALGIQDPSRNTELIELSKFWSQDSLAYSLRTEDAHN
                     LFQILRLEKDYIRLSREELNQSPKNAGHILDDDVTKHTQQIRHILRMDI"
     gene            complement(<1138516..>1140444)
                     /locus_tag="CAGL0M11550g"
                     /db_xref="GeneID:2891412"
     mRNA            complement(<1138516..>1140444)
                     /locus_tag="CAGL0M11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449843.1"
                     /db_xref="GeneID:2891412"
     CDS             complement(1138516..1140444)
                     /locus_tag="CAGL0M11550g"
                     /note="highly similar to uniprot|Q08032 Saccharomyces
                     cerevisiae YLR103c CDC45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449843.1"
                     /db_xref="GeneID:2891412"
                     /db_xref="GOA:Q6FIV1"
                     /db_xref="InterPro:IPR003874"
                     /db_xref="UniProtKB/TrEMBL:Q6FIV1"
                     /translation="MYYAVDKYGEAYNTIVRSCSSHSSCQLVLFVSCLNVDALCAAKI
                     LSLLFKKQLIQSQIVPVFGYSELKTHYDQIDDNVNTVMFIGFGGVVDLETFLEIDPEE
                     YITENAKWKKRVSKRYIYVWDAQRPWNLDNLFGSEIVQCFDDGTVDDQLSEVKEAYYK
                     LIQLEKEQDEDQDPDGDDEDDNNEDDVATDQDEDDDDDDDDDDPYSKKRSLSDSTDNN
                     KRKRKMRKQQIHKYESIIDDYYAQGVTVVNSLAAQVYSLLSSIGETTLQNLWLTILGT
                     TSLDTAFTQIYNRLCPLLQDEVRRLSPKSTGVKTPDTLTLNIQPDYYLFLLRHSSLYD
                     SFYFSNYVNAKLSLWNESGKKRLHKMFARMGIPLTTAQESWLYMDHSIKRELGVIFDK
                     NLDRYGLQDIVRDGFVRSFGYRGSISASEYLEALNALLEVGEAIHDDGISSKDEEDET
                     LTEQENKSLKLHKRWLSNFWLSWDALDDKKLDILKLGIQHAQILQRAIFNTGVTVLEK
                     KMIKHLRIYRLCVLREGPDLDLYRNPLTLLRLGNWLMECCAESEAKQLLPMVLASLDE
                     ATDTYLVAGLAPRYPRGLDMLQNRKPILNNFSMAFQQITAQTGAKVKIDNFESSIIEI
                     KKADLSPFLEKLTLSGLI"
     gene            <1140749..>1141108
                     /locus_tag="CAGL0M11572g"
                     /db_xref="GeneID:2891238"
     mRNA            <1140749..>1141108
                     /locus_tag="CAGL0M11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449844.1"
                     /db_xref="GeneID:2891238"
     CDS             1140749..1141108
                     /locus_tag="CAGL0M11572g"
                     /inference="similar to AA sequence:UniProtKB:Q08045"
                     /note="similar to uniprot|Q08045 Saccharomyces cerevisiae
                     YLR104w"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449844.1"
                     /db_xref="GeneID:2891238"
                     /db_xref="GOA:Q6FIV0"
                     /translation="MNLLMVLFVAQAHAFFFGQQQQQQQQQASYEDRVLDSGCAKYLC
                     SDTLECVDSWKDCPCPFPKSQLKCMLPKGSNRPYVCISKPATHDEKLNLIYDDPVQGP
                     KAAIKGMRDCGWVQQNL"
     gene            complement(<1141245..>1142351)
                     /locus_tag="CAGL0M11594g"
                     /db_xref="GeneID:2891239"
     mRNA            complement(<1141245..>1142351)
                     /locus_tag="CAGL0M11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449845.1"
                     /db_xref="GeneID:2891239"
     CDS             complement(1141245..1142351)
                     /locus_tag="CAGL0M11594g"
                     /inference="similar to AA sequence:UniProtKB:P16658"
                     /note="similar to uniprot|P16658 Saccharomyces cerevisiae
                     YLR105c SEN2 tRNA splicing endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449845.1"
                     /db_xref="GeneID:2891239"
                     /db_xref="GOA:Q6FIU9"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="InterPro:IPR016589"
                     /db_xref="UniProtKB/TrEMBL:Q6FIU9"
                     /translation="MAKKQFNTKRYKFPLPIHPIDRNALPVVSQYNPISWLQWLYCLY
                     ANTNLLPKKLTLTIRKDEQGWCHLLVEDEQDMKYLWNNGFFGTGQMSRSEPTWKFRTE
                     KRLKVNDAGDKPSGTMDLEKVTEIRRIQRLAFKKERLRLEGELSESRSQNISAEQETQ
                     IIEEHREKLRVFRSDQLKELNNLKLTAPETRDEDLELYDDSGEIRSLESMELMPVEAI
                     FLTFALPVLDIKINDLIKHFEFQHIEELKVLVRKYAAYHHYRSLKWCVRSGIKFGCDY
                     LLYKRGPPFQHAEFAIMVLDHTESHDYTWYSSVARVASGAKKTLILCYIDDQGLTNET
                     LLDLWHQGNLVKLLQHFKVAEVTYKRWIPGKNRD"
     gene            complement(<1143091..>1157733)
                     /locus_tag="CAGL0M11616g"
                     /db_xref="GeneID:2891240"
     mRNA            complement(<1143091..>1157733)
                     /locus_tag="CAGL0M11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_449846.1"
                     /db_xref="GeneID:2891240"
     CDS             complement(1143091..1157733)
                     /locus_tag="CAGL0M11616g"
                     /inference="similar to AA sequence:UniProtKB:Q12019"
                     /note="similar to uniprot|Q12019 Saccharomyces cerevisiae
                     YLR106c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_449846.1"
                     /db_xref="GeneID:2891240"
                     /db_xref="GOA:Q6FIU8"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6FIU8"
                     /translation="MSIQSADTVVFDLDKAFQRRDEFVKRNPNATIDLFEFSKSNSAQ
                     ISNLEGLTQFILARKYEASAYVYIYEELFPEVVSRWIVSLQHCTDDEAIEILSQLARI
                     ITIFPMSTNLIDNCMSEFADNFTKLLDSPAINMEKKSEILLAYYRILYENQQIFNKYI
                     KMEILYKILATQESSMEMKFLAVRVLCTLLNTNEKHILETTDLYIGNCNNIPGYYEGL
                     SNVNYKFMELNEAHRFSEFFSLPKIGDESNPTSSNIITFGTDCFTDHIVSICGILTPR
                     IVTTKDTRDYDFDYVPTKQTVAVLKKLAKLIQKNEPMMLVGKAGTGKTFLINELSKYM
                     KTHDSVVKIHLGEQTDAKLLIGTYTSGEKPGTFTWKSGVLATAVKEGRWVLIEDIDKA
                     PTEVLSVILSLLEKRELTIPSRGETLKAAKGFQLIATVQTSERNSTKDSEPVINMIGK
                     SAWNIVSLEEPSDKDLEEILSKKFSLLTRLIPQLIETYHNIHSIYQDPKFI