GenomeNet

Database: RefSeq
Entry: NC_006037
LinkDB: NC_006037
Original site: NC_006037 
LOCUS       NC_006037            1062590 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Kluyveromyces lactis strain NRRL Y-1140 chromosome A complete
            sequence.
ACCESSION   NC_006037
VERSION     NC_006037.1
DBLINK      BioProject: PRJNA12377
            BioSample: SAMEA3138170
            Assembly: GCF_000002515.2
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Kluyveromyces lactis
  ORGANISM  Kluyveromyces lactis
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Kluyveromyces.
REFERENCE   1  (bases 1 to 1062590)
  AUTHORS   Dujon,B., Sherman,D., Fischer,G., Durrens,P., Casaregola,S.,
            Lafontaine,I., De Montigny,J., Marck,C., Neuveglise,C., Talla,E.,
            Goffard,N., Frangeul,L., Aigle,M., Anthouard,V., Babour,A.,
            Barbe,V., Barnay,S., Blanchin,S., Beckerich,J.M., Beyne,E.,
            Bleykasten,C., Boisrame,A., Boyer,J., Cattolico,L.,
            Confanioleri,F., De Daruvar,A., Despons,L., Fabre,E., Fairhead,C.,
            Ferry-Dumazet,H., Groppi,A., Hantraye,F., Hennequin,C.,
            Jauniaux,N., Joyet,P., Kachouri,R., Kerrest,A., Koszul,R.,
            Lemaire,M., Lesur,I., Ma,L., Muller,H., Nicaud,J.M., Nikolski,M.,
            Oztas,S., Ozier-Kalogeropoulos,O., Pellenz,S., Potier,S.,
            Richard,G.F., Straub,M.L., Suleau,A., Swennen,D., Tekaia,F.,
            Wesolowski-Louvel,M., Westhof,E., Wirth,B., Zeniou-Meyer,M.,
            Zivanovic,I., Bolotin-Fukuhara,M., Thierry,A., Bouchier,C.,
            Caudron,B., Scarpelli,C., Gaillardin,C., Weissenbach,J., Wincker,P.
            and Souciet,J.L.
  TITLE     Genome evolution in yeasts
  JOURNAL   Nature 430 (6995), 35-44 (2004)
   PUBMED   15229592
REFERENCE   2  (bases 1 to 1062590)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1062590)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2008) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CR382121.
            This is an updated version of the complete genome sequence. The
            Kluyveromyces lactis sequence is made of 6 chromosomes (A to F).
            The sequence was annotated by the Genolevures Consortium. For more
            information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1062590
                     /organism="Kluyveromyces lactis"
                     /mol_type="genomic DNA"
                     /strain="NRRL Y-1140"
                     /db_xref="taxon:28985"
                     /chromosome="A"
     gene            <2788..>3834
                     /locus_tag="KLLA0_A00110g"
                     /db_xref="GeneID:2896440"
     mRNA            <2788..>3834
                     /locus_tag="KLLA0_A00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451004.1"
                     /db_xref="GeneID:2896440"
     CDS             2788..3834
                     /locus_tag="KLLA0_A00110g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451004.1"
                     /db_xref="GeneID:2896440"
                     /db_xref="GOA:Q6CQ36"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:Q6CQ36"
                     /translation="MSSHPFQVIDLCAPAEETSRLLLEAANTQGFLFIDGHSFSQQQV
                     DALFRLSMEYFTNTPHHEKLQYAFDVAKNYGYTDYTREQGDPSKAKDFKECYNFGSIN
                     FSNGTYNGQSRSTSENCMQHGEVPPLFTYHNDLIVDSIKKFHELARNIMGLFTVALGI
                     IQEDFFVSRFSDDKKNGCVMRLLHYPLFRDDGVDGSSGIDPTLRIGPHSDYGALTLLL
                     QKEGEQGLEVQLDPGCDQWTKVPFLTSRYEGSAPPIVVNFGDMLSFWTKGVIRSTKHR
                     VKIDPGETRSSDRYSIVFFTHPDADTTLDPVPSRVIESNSNGIGAPPVTAYEYLSAHL
                     SRVINSIPSHDGMV"
     gene            <4628..>6151
                     /locus_tag="KLLA0_A00132g"
                     /db_xref="GeneID:2896317"
     mRNA            <4628..>6151
                     /locus_tag="KLLA0_A00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451005.1"
                     /db_xref="GeneID:2896317"
     CDS             4628..6151
                     /locus_tag="KLLA0_A00132g"
                     /note="similar to uniprot|P36032 Saccharomyces cerevisiae
                     YKL221W MCH2 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451005.1"
                     /db_xref="GeneID:2896317"
                     /db_xref="GOA:Q6CYI4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CYI4"
                     /translation="MSATLQRIMSENNATFREKGETATSLETSNIPSAGELKDPGRLE
                     KEQTIYEFETVPEDEDDSYNKIKVPDGGYGWVVVFSSFLLNFCTSGASYGYGVYLSYY
                     MDSGKYETGGKLDYAAIGGLSFGVGVLFSPLYNYILINTSPRKLISLGIVIQNVAALL
                     AAFSTKLWQVYLTQGVFISIGTGAICFPNTTIAAPWFRKKRSLALGITVAGTGVGGIV
                     FNLSTQRIIDNYDSKWALISQCIICSVLSTVAVLLIRTRRDEVQKYSDTPTTAVALDM
                     FKYPVIWLLILWVCFTMLGYVVQVYSLFSFTISLGYTSKQASAVSCVICVGIIVGRPL
                     VGLAADKFGAVTTGMFCHLIVAILCYGMWIPCRNYATVVVFGLFEGMLMGSIWLLLTS
                     IITRLVGLPKLEAVYSVVWMFLGACAIVSPVIGISLAKNNVKPGENAYLYTAVYCGTA
                     YLLAALALWCIRGIIIARDKVSLVEKTGYDDGELHLRVNLVDALKGMAHYGKLYRKV"
     gene            complement(<6838..>7056)
                     /locus_tag="KLLA0_A00143g"
                     /db_xref="GeneID:9487514"
     mRNA            complement(<6838..>7056)
                     /locus_tag="KLLA0_A00143g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999298.1"
                     /db_xref="GeneID:9487514"
     CDS             complement(6838..7056)
                     /locus_tag="KLLA0_A00143g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999344.1"
                     /db_xref="GeneID:9487514"
                     /db_xref="UniProtKB/TrEMBL:B5RSI2"
                     /translation="MVSLECLLLASSIPNFRLFDQSLAGDTFTVISSADNSSGYFLNV
                     SAYFENGSFYSWESFATVAATSDFFASH"
     gene            <8139..>8579
                     /locus_tag="KLLA0_A00154g"
                     /db_xref="GeneID:2896494"
     mRNA            <8139..>8579
                     /locus_tag="KLLA0_A00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451006.2"
                     /db_xref="GeneID:2896494"
     CDS             8139..8579
                     /locus_tag="KLLA0_A00154g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451006.2"
                     /db_xref="GeneID:2896494"
                     /db_xref="UniProtKB/TrEMBL:Q6CLV0"
                     /translation="MYISLVYLEVLLSFSLLSPAAAAPLPDANSTAVNSLEFDMVSNS
                     TSVCFNSTNYAIDVSELPLPEWLDDWDSLLLAMPCGDEIFVSVPKDLDSNTTAKILAY
                     SLASGIAVDNWNSELQKRENIQADLDAFWETGTVELDSLSIVQN"
     repeat_region   8591..8991
                     /rpt_type=long_terminal_repeat
     mobile_element  9115..9552
                     /mobile_element_type="retrotransposon"
     repeat_region   9577..9668
                     /rpt_type=long_terminal_repeat
     gene            complement(<10102..>11511)
                     /locus_tag="KLLA0_A00176g"
                     /db_xref="GeneID:2896752"
     mRNA            complement(<10102..>11511)
                     /locus_tag="KLLA0_A00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451007.1"
                     /db_xref="GeneID:2896752"
     CDS             complement(10102..11511)
                     /locus_tag="KLLA0_A00176g"
                     /note="similar to uniprot|P24031 Saccharomyces cerevisiae
                     YBR092C PHO3 Constitutively expressed acid phosphatase
                     similar to Pho5p; brought to the cell surface by transport
                     vesicles; hydrolyzes thiamin phosphates in the periplasmic
                     space, increasing cellular thiamin uptake; expression is
                     repressed by thiamin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451007.1"
                     /db_xref="GeneID:2896752"
                     /db_xref="GOA:Q6CYI2"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:Q6CYI2"
                     /translation="MLSILVTFLSLSSIHAAPISKDNGTVCYALKSSTADASIFPFLN
                     GQGPHYDYPQSFGIPVEVPDQCTVEHVQMLARHGERYPTASKGKLMIALWDKLKVFQG
                     QFDGPLEIFNDYEFFVSDTKYFDQLTNSSDVDPSNPYMGSKTAEILGKYIAFNYGELF
                     GNYTPVFTSSSGRVYQTAKYAVSALEEELNVQLDLQIIQENETAGANSLTPGDSCVSY
                     NGDLGDEYFENVTLSYLTDIKNRWMKKNSNLNLTLEQDDIELLVDWCAFVTNIKGSST
                     VCDLFERNDLIAYSYYSDVTNFYGRGLGNPLVKPIGSVLLNASYNLFTQADDLDNKVW
                     LSFSHDTDIQQFVSALGLFDNGVTEYSLEQVEFQDIQKLSWVTPMGGRIFTEKLKCRN
                     SSYVRYIVNDVVIPVPGCTSGPGFSCPIEDFDDYIADRLNGIDYVSSCEIQQVSNITE
                     LTFYWDYNEVEYNGPVSNK"
     gene            complement(<14237..>15211)
                     /locus_tag="KLLA0_A00198g"
                     /db_xref="GeneID:2896472"
     mRNA            complement(<14237..>15211)
                     /locus_tag="KLLA0_A00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451008.1"
                     /db_xref="GeneID:2896472"
     CDS             complement(14237..15211)
                     /locus_tag="KLLA0_A00198g"
                     /note="highly similar to uniprot|P32318 Saccharomyces
                     cerevisiae YGR144W THI4 Protein required for thiamine
                     biosynthesis and for mitochondrial genome stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451008.1"
                     /db_xref="GeneID:2896472"
                     /db_xref="GOA:Q6CYI1"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="InterPro:IPR027495"
                     /db_xref="UniProtKB/TrEMBL:Q6CYI1"
                     /translation="MSTTQTQTQNKLSVQSQSVEHCLSDVVKQDDWSDFAFAPIREAT
                     VSRAMTSRYFKDLDKFAVSDVVIIGAGSSGLSAAYVIAKNRPDLKIAIIEANVAPGGG
                     CWLGGQLFSAMIMRKPADKFLDELNIPYEDEGHYVVVKHAALFMSTVLSEVLKFPNVK
                     MFNATAVEDLVTRPADDNSQHVNVAGVVTNWTLVTQNHDTQSCMDPNVIELSGYKDNG
                     ERDLSQKHGVILSCCGHDGPFGAFTVKRMASIDSSKSYAGMKGLDMNRAEDAVVKNAG
                     AYDKVGSVYFAGMEVAEHAGLNRMGPTFGAMAVSGIKAAEDILKHFAA"
     gene            <17582..>18067
                     /locus_tag="KLLA0_A00220g"
                     /db_xref="GeneID:2896501"
     mRNA            <17582..>18067
                     /locus_tag="KLLA0_A00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451009.1"
                     /db_xref="GeneID:2896501"
     CDS             17582..18067
                     /locus_tag="KLLA0_A00220g"
                     /note="some similarities with uniprot|Q2S3S7 Salinibacter
                     ruber SRU_1022 Mitochondrial benzodiazepine
                     receptor/sensory transduction protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451009.1"
                     /db_xref="GeneID:2896501"
                     /db_xref="GOA:Q6CYI0"
                     /db_xref="InterPro:IPR004307"
                     /db_xref="UniProtKB/TrEMBL:Q6CYI0"
                     /translation="MFELYSPVKILASVATTLSFGYSSGLVTRTSVNTWYPTLIKPWF
                     TPPNKLFPIAWSSLYLVMGIAAGIVWSHASKGNKLAATGLKHFAVQFGLNMLWSYLFF
                     GLKSPGLGLIEVTALWFSIYKTWSVFTLVDPTAGWLMVPYLSWVSYATVLNASIWWLN
                     R"
     gene            complement(<18272..>19105)
                     /locus_tag="KLLA0_A00242g"
                     /db_xref="GeneID:2896706"
     mRNA            complement(<18272..>19105)
                     /locus_tag="KLLA0_A00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451010.1"
                     /db_xref="GeneID:2896706"
     CDS             complement(18272..19105)
                     /locus_tag="KLLA0_A00242g"
                     /note="similar to uniprot|P25613 Saccharomyces cerevisiae
                     YCR010C ADY2 Accumulation of DYads member of the TC 9.B.33
                     YaaH family of putative transporters Protein involved in
                     Accumulation of DYads or uniprot|P32907 Saccharomyces
                     cerevisiae YNR002c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451010.1"
                     /db_xref="GeneID:2896706"
                     /db_xref="GOA:Q6CYH9"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH9"
                     /translation="MSDQSLNEKSGDHFENQMRMANHDPSESSAYDDLELQKIHTGGD
                     NHEFVFIGRQKFLKEDLFTAFGGTLNPGLAPPSTHKFANPAPLGLSAFALTTFVLSMF
                     NARAMGITIPNVVVGSAAFYGGLVQLIAGIWEIALENTFGGTALSSFGGFWMSFSALY
                     IPFFGVADAYKEHPEQFSSAVGFFLLGWAIFTAGMTVCTMKSTVAFFSLFFFLTITFL
                     LLSIGEFAQNTNVTRAGGVVGVIVAFIAWYDAFAGVATKENSYVTVRPLPLPKPHHTL
                     F"
     gene            <20634..>21338
                     /locus_tag="KLLA0_A00264g"
                     /db_xref="GeneID:2896599"
     mRNA            <20634..>21338
                     /locus_tag="KLLA0_A00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451011.1"
                     /db_xref="GeneID:2896599"
     CDS             20634..21338
                     /locus_tag="KLLA0_A00264g"
                     /note="highly similar to uniprot|P40582 Saccharomyces
                     cerevisiae YIR038C GTT1 ER associated glutathione
                     S-transferase capable of homodimerization expression
                     induced during the diauxic shift and throughout stationary
                     phase functional overlap with Gtt2p Grx1p and Grx2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451011.1"
                     /db_xref="GeneID:2896599"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH8"
                     /translation="MSTNVIKVHWLNQSRAFRVLWLLDHLKLDYEIVPYKRNEQFRAP
                     EELKKIHPLGRAPILEIDYKSSDRKDILAESGYIFQYILENFDKEGILNNADQQKAEK
                     IKYYLHYAEGSLQPPLFIEFLLSKAKEAPVPFPFSYITKKFADKISEKYSRGEVKNQL
                     DFIETEIEQNDGYLVGGKLSAADILLSFPLEMAFERQFARTEEYPNIAKWLETIKREE
                     SYSTSKDKAKANGASF"
     gene            complement(<22024..>25698)
                     /locus_tag="KLLA0_A00286g"
                     /db_xref="GeneID:2896597"
     mRNA            complement(<22024..>25698)
                     /locus_tag="KLLA0_A00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451012.2"
                     /db_xref="GeneID:2896597"
     CDS             complement(22024..25698)
                     /locus_tag="KLLA0_A00286g"
                     /note="similar to uniprot|P47037 Saccharomyces cerevisiae
                     YJL074C SMC3 Subunit of the multiprotein cohesin complex
                     required for sister chromatid cohesion in mitotic cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451012.2"
                     /db_xref="GeneID:2896597"
                     /db_xref="GOA:Q6CYH7"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029685"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH7"
                     /translation="MVHIKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFA
                     AIRFVLSEENSNLKREDRKGFIYQGAGQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI
                     RRTVGLKKDEYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAKDLERL
                     HLLEDVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYN
                     NLNRDRKVLQFCLYDRELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELNK
                     RMNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQAHLESNVKE
                     IGEVKKQIEINCSSIAEVQPKFQKLSNEAEILKVEIEKLTKRQRELLSKKGKYEDFRT
                     VNERNDWIQEQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIEDLADSVNGMG
                     SVAQQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDNDVKRFESDMNETI
                     DRSLALGLQNVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVGGNSLFNVVVDNE
                     ETASLLIKELFATKGGRVTFIPLNKLHVDTNFTYPNNLEKNQCTPLIKKIKYDVKFEK
                     VIKQVFGRTLVVKSLIDGASLAKEYKLNAITLDGDRADSKGVLSGGYLDQYKSNRLDT
                     LRDFKQSKREYKKIQVELQEIKQALQSIEQEIDGLNNVVKDAAAERDAYEAGIEKARS
                     QLKAKLSQKITIDDSIKALKARLNKIDTELEQCRERTNAFAADISKPFVNELDADEKA
                     ELLAISNSIQTKETSLNFNLSTLNELSSKLDELNAELNSKLLPKLHELERKPSSSHSL
                     QISQINNQMELVLMEKQTVTRTKEQVESELSVLDSSIKSLRGEKATLQKDLDKANSQQ
                     RSLVKRITNFQKNAEKVLLKKSTLNSRKEELQQLIREVGLLAEESLKKYKPLASDEIL
                     KKLNTTTGHLSKMTNVNKRASENYTRFEDKRGELTSRAEELDESKQSIENLIDQLKEQ
                     KITAIEKTFNKVADNFSRVFATLVPRGIGKLIINHRKNTDNSEVSTKKRRRGARQEQN
                     SAEALNESKYTGVSIQVSFNSKKDEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYL
                     FDEIDAALDKQYRIAVARTIKNLSDTAQFICTTFRTDMINVADTFFRVKFENKVSTVT
                     EVSRQDAVNFSRGNNKMEEL"
     gene            26345..26444
                     /locus_tag="KLLA0_A00308r"
                     /db_xref="GeneID:2896483"
     tRNA            join(26345..26383,26409..26444)
                     /locus_tag="KLLA0_A00308r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2896483"
     gene            complement(<26582..>27238)
                     /locus_tag="KLLA0_A00352g"
                     /db_xref="GeneID:2896502"
     mRNA            complement(<26582..>27238)
                     /locus_tag="KLLA0_A00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451013.1"
                     /db_xref="GeneID:2896502"
     CDS             complement(26582..27238)
                     /locus_tag="KLLA0_A00352g"
                     /note="similar to uniprot|P43544 Saccharomyces cerevisiae
                     YFL060C SNO3 Protein of unknown function nearly identical
                     to Sno2p expression is induced before the diauxic shift
                     and also in the absence of thiamin and uniprot|P53823
                     Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
                     Saccharomyces cerevisiae YMR095C SNO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451013.1"
                     /db_xref="GeneID:2896502"
                     /db_xref="GOA:Q6CYH6"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH6"
                     /translation="MVLYDTVTMMTKRIGVLALQGAFAEHIALLNKAIEDNKHDIEVI
                     TVKTAPQLSSCDSLIIPGGESTTISLIAKRTGLFDSLIEFVHDPTKTVWGTCAGLIFL
                     AKQLSNESSLVNSLDLLKVKVRRNAFGRQAESFIETCDFSSFIPDCTGFQVYFIRAPI
                     IEEILSQDDVETLYTLKDGSIVAVSQQGRILGTSFHPELSDNDARFHNYFIQKFVLNN
                     "
     gene            <28198..>29091
                     /locus_tag="KLLA0_A00374g"
                     /db_xref="GeneID:2896469"
     mRNA            <28198..>29091
                     /locus_tag="KLLA0_A00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451014.1"
                     /db_xref="GeneID:2896469"
     CDS             28198..29091
                     /locus_tag="KLLA0_A00374g"
                     /note="highly similar to uniprot|P43545 Saccharomyces
                     cerevisiae YFL059W SNZ3 Member of a stationary
                     phase-induced gene family transcription of SNZ2 is induced
                     prior to diauxic shift and also in the absence of thiamin
                     in a Thi2p-dependent manner forms a coregulated gene pair
                     with SNO3 and uniprot|P53824 Saccharomyces cerevisiae
                     YNL333W SNZ2 and YMR096W uniprot|Q03148 Saccharomyces
                     cerevisiae YMR096W SNZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451014.1"
                     /db_xref="GeneID:2896469"
                     /db_xref="GOA:Q6CYH5"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH5"
                     /translation="MADFKVKSGLAQMLKGGVIMDVVTAEQAIIAEKAGACAVMALEQ
                     IPADMRKSGKVCRMSDPKMIKEIMNSVSIPVMAKVRIGHFVEAQILQALEIDYIDESE
                     VLTPADWKGHIKKNDFNVPFVCGAKDLGEALRRIEEGAAMIRTKGEAGTGDVSEAVKH
                     IKKIKSEIKEYQDTLGDDTDFIKQRAESIGVSYELLKYVLDNGKLPVVNFAAGGVATP
                     ADAALLMQLGCEGVFVGSGIFKSSDPEKLARAIVEATTHYDDAETLLKVSTDLGDLMG
                     GLSIESLKNSENPKRLANIGW"
     gene            <29717..>32755
                     /locus_tag="KLLA0_A00396g"
                     /db_xref="GeneID:2896495"
     mRNA            <29717..>32755
                     /locus_tag="KLLA0_A00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451015.1"
                     /db_xref="GeneID:2896495"
     CDS             29717..32755
                     /locus_tag="KLLA0_A00396g"
                     /note="similar to uniprot|P40453 Saccharomyces cerevisiae
                     YIL156W UBP7 Ubiquitin-specific protease that cleaves
                     ubiquitin-protein fusions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451015.1"
                     /db_xref="GeneID:2896495"
                     /db_xref="GOA:Q6CYH4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH4"
                     /translation="MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQA
                     ESLFESYRESLSVEKYEDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQ
                     DELNMSNVLLMVLHKVDSVLNQNMEILAKQHLDPSRKRAFSVEEPIIRYQLHNLQLNN
                     ADQKSVDDDYKSFASTEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQD
                     DTDALDSVSDKLLGSIHKPDLLDRTGIIRKVPRHQSLPTEQHHKLYAQNDSSLMLENM
                     DSFDRSRTHRKDSYHSVYLGDELEDLNNISTGLARHQQENTIDCFALFSLLKDAESRE
                     NLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKI
                     SQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAIPKSLLGGYEQWKAFLNKQLR
                     DSEFDKSLFLFRKSKSAPSDKTASKPSVQTDNIIKSSPSILSKEHNDDTLISSTPPIP
                     KVAPPPLPGSPLSAPTIVYNRPPVPLPINSPAPLLKPSIAKELRTPQRNDWTVQTQHL
                     HVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRDLFLGGKYHRY
                     LNPKRSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRPDFHIPTDQQDTQEFL
                     LFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDEGLKNNGLSPIDDI
                     FQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKIIRLEDCINLYTQ
                     DELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKNFLSVNGDHKSRSKFFKLSS
                     SRSGKRSLSPFKSNSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKN
                     ETMINYPLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKW
                     YYFDDEVVKKEFNHGDFDRGITSISSGDVYVLFYERIHSI"
     gene            complement(<33084..>35012)
                     /locus_tag="KLLA0_A00418g"
                     /db_xref="GeneID:2896315"
     mRNA            complement(<33084..>35012)
                     /locus_tag="KLLA0_A00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451016.1"
                     /db_xref="GeneID:2896315"
     CDS             complement(33084..35012)
                     /locus_tag="KLLA0_A00418g"
                     /note="similar to uniprot|P32191 Saccharomyces cerevisiae
                     YIL155C GUT2 Mitochondrial glycerol-3-phosphate
                     dehydrogenase expression is repressed by both glucose and
                     cAMP and derepressed by non-fermentable carbon sources in
                     a Snf1p Rsf1p Hap2/3/4/5 complex dependent manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451016.1"
                     /db_xref="GeneID:2896315"
                     /db_xref="GOA:Q6CYH3"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH3"
                     /translation="MFAAKRASKVLLGSAVSAAAVFGAVSMVNQSRDTNTLQNDVSVS
                     TIKKSNVDLPSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDF
                     ASGTSSKSTKMAHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIM
                     IPVYNYWQVPYFYVGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYH
                     DGSFNDSRMNSSLAITAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQI
                     KAKVVVNATGPYSDRLLQMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAG
                     VHIVLPSFYCPKEIGLLDAQTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEAD
                     IQDILKELQHYINFPVKREDVLSAWAGIRPLVKDPRKADSGSGSTQQLVRSHFLFTSP
                     SNLVTISGGKWTTYREMAEETIDEVVKVGQFNSKPCVTKKLKLVGGENWNPNLSALLS
                     QKYHLSSAMSEHLANNYGTRAPLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFR
                     YPYTIGELKYSLKYEYARNCLDFLMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSK
                     KRQDEIQQATEYIKTFGV"
     gene            complement(<37134..>38201)
                     /locus_tag="KLLA0_A00440g"
                     /db_xref="GeneID:2896426"
     mRNA            complement(<37134..>38201)
                     /locus_tag="KLLA0_A00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451017.1"
                     /db_xref="GeneID:2896426"
     CDS             complement(37134..38201)
                     /locus_tag="KLLA0_A00440g"
                     /note="similar to uniprot|Q753L8 Ashbya gossypii AFR294W
                     AFR294Wp and weakly similar to YIL154C uniprot|P32351
                     Saccharomyces cerevisiae YIL154C IMP2' Transcriptional
                     activator involved in maintenance of ion homeostasis and
                     protection against DNA damage caused by bleomycin and
                     other oxidants contains a C-terminal leucine-rich repeat"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451017.1"
                     /db_xref="GeneID:2896426"
                     /db_xref="UniProtKB/TrEMBL:Q6CYH2"
                     /translation="MEEPGRGILNKKLTDDKHLAAPPAFPTIKIEEPEQRGRSRSKTR
                     DTGISSSRSISRSASRVSIKDQAYLKWTILNKDPSERLHLKAKKGNTRDSVSPGQENG
                     GDEDEDEDEEEFIEDREDDGEVSEEEQVSDVENEIEIDEHIDYDLGCKVLPNFVTPIT
                     QVLDSMKPWLAKNAEIKTEADKRDIKLEEIQHGIHRAVYHMSKGDNITAATSEKGHSF
                     VVYLDQMDESFAEKIYALVYSFGSVFTNGDTLYIINQCDDDTNDMLFQMNRICDHIDY
                     LFECTNGVGTLDKIDVLICSMYHPYPKQLLTEMAHSLQPSSIIIPLQTVLASLQNFIT
                     SVPMLVIRKKLKRSKRRGIAD"
     gene            <38766..>39827
                     /locus_tag="KLLA0_A00462g"
                     /db_xref="GeneID:2896400"
     mRNA            <38766..>39827
                     /locus_tag="KLLA0_A00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451018.1"
                     /db_xref="GeneID:2896400"
     CDS             38766..39827
                     /locus_tag="KLLA0_A00462g"
                     /note="similar to uniprot|P40454 Saccharomyces cerevisiae
                     YIL153W RRD1 Resistant to Rapamycin Deletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451018.1"
                     /db_xref="GeneID:2896400"
                     /db_xref="GOA:Q6CYH1"
                     /db_xref="InterPro:IPR004327"
                     /translation="MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYIT
                     LCKGQQIPDTIKESFFTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQ
                     LENWLHELLPEKYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKIET
                     IKGPALLYCFNSYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTS
                     LIPKDISNTRLMEQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQ
                     GLIKMYKVEVLNKFPVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNA
                     TTKMPPPLSTSTSRFIHRR"
     gene            complement(<40330..>41961)
                     /locus_tag="KLLA0_A00484g"
                     /db_xref="GeneID:2896341"
     mRNA            complement(<40330..>41961)
                     /locus_tag="KLLA0_A00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451019.1"
                     /db_xref="GeneID:2896341"
     CDS             complement(40330..41961)
                     /locus_tag="KLLA0_A00484g"
                     /note="highly similar to uniprot|P10963 Saccharomyces
                     cerevisiae YKR097W PCK1 Phosphoenolpyruvate carboxykinase
                     key enzyme in gluconeogenesis catalyzes early reaction in
                     carbohydrate biosynthesis glucose represses transcription
                     and accelerates mRNA degradation regulated by Mcm1p and
                     Cat8p located in the cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451019.1"
                     /db_xref="GeneID:2896341"
                     /db_xref="GOA:O43112"
                     /db_xref="InterPro:IPR001272"
                     /db_xref="InterPro:IPR008210"
                     /db_xref="InterPro:IPR013035"
                     /db_xref="InterPro:IPR015994"
                     /translation="MSPTKTQNSAEENIRAELGLSAEVVTIRRNAPAALLYEDALKER
                     DTAISNAGALIAYSGDKTGRSPRDKRIVEEETSKDNVWWGPVNKPCSERTWEINRERA
                     ADYLRTRDHIYIVDAYAGWDPRYRIKVRVVCARAYHALFMTNMLIRPSKEELENFGEP
                     DFTVWNAGQFPANTHTSGMTSKTTVEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMP
                     VNHNVLTLHSSANQGIQDNDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFN
                     IEGGCYAKCLGLSAEKEPEIFNAIKFGSVLENIIYDPNTREVDYEDSTITENTRCAYP
                     IEYIPSAKIPCLADHHPKNIVLLTCDASGVLPPVSKLTPDQVMYHFISGYTSKMAGTE
                     QGVTEPEATFSSCFGQPFLSLHPMKYATMLAEKMAEHNANAWLINTGWTGSSYVAGGK
                     RCPLKYTRAILDAIHDGSLAKEEYEVLPIFNLQIPKAVGDKVPASLLNPSKNWAEGEA
                     KYTSNVKSLANLFVENFKTYQDKATEQVLAAGPQL"
     gene            <43949..>44488
                     /locus_tag="KLLA0_A00506g"
                     /db_xref="GeneID:2896473"
     mRNA            <43949..>44488
                     /locus_tag="KLLA0_A00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451020.1"
                     /db_xref="GeneID:2896473"
     CDS             43949..44488
                     /locus_tag="KLLA0_A00506g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451020.1"
                     /db_xref="GeneID:2896473"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG9"
                     /translation="MTDTKGRTKIGEVSELVDAWFGKKRKLLYAHKKCNASNIGGKGS
                     INKLIQTSKSVVRARASKRQKTYTAPMAASIIPKADFSNDISHSPRTVQAIVFDSSTK
                     IRLMKEHHSDADWLRLVVRQHHKLNDKLTLLKTDHPKFSTVILQGLCSSNVHHVLCHD
                     VSFFSLYRGVFWCLNWKLG"
     gene            complement(<44587..>48276)
                     /locus_tag="KLLA0_A00528g"
                     /db_xref="GeneID:2896526"
     mRNA            complement(<44587..>48276)
                     /locus_tag="KLLA0_A00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451021.1"
                     /db_xref="GeneID:2896526"
     CDS             complement(44587..48276)
                     /locus_tag="KLLA0_A00528g"
                     /note="similar to uniprot|P36168 Saccharomyces cerevisiae
                     YKR096W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451021.1"
                     /db_xref="GeneID:2896526"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG8"
                     /translation="MDPGSASMAGHSGLHQKRHNSNSVDYYDSNIIKRRTGDGVPENV
                     DISVAEIPQEPCQYLDTSLLTSPSKIRHHEKTPSITKPHTLQMEQTPQPRGVDTSGEF
                     PQSPFYLPTTSQTNFEAATTVNENSSIRRSDSVTRLTTVGNNTQLASNGNNYIKPQHY
                     QEDGVERTQKVTYNGQSSLGQPDNRQQMAFGSNQSSNNHSPAKNNSDNEMNLPSGSNA
                     GSGQNHDHNNSNPNDHNNSISDDHNNEDNNHNNNNNNNNNNNNNNNSYSNTNTSNSSS
                     KASSQQQLVEKLQEIYKSIVKQETELQERCSNLTTQQTTDLKNLWLAYKINAELIDNY
                     ILFITTALLPSQSESSLAIGQEIVDVYRIERRLWVYGTITFLDVLKNFSNFMDPEVCC
                     QFIAYVFIALSNMLEDLPPKYSIPWLERLGDLSRMAIALYPSGFVDWKLSAEHWYRES
                     LKFTFGHGKLYYHMSTVQQNTLEAFVNLGKSVFCEDIFVPSPQYMQLVIDNIYQRAFA
                     ERDSSGNRTNHIVDYLKHTEVMLLPSFLESSELQNVVIHYFQHKFGVSSSGNFFDPNL
                     IFIQDAERLKHFFRHSSLFSQSHILQLCGFGDPKNPFAMLFELSKHLKSRKERKERKK
                     STKSTSEGSLDPVEFSSQQQASTEDFFSTIDSPKVPYEFPLDLGVWKRSLHYINVTSM
                     KCGMIVLRRFLYGPIVTALPHVLPWLLFIISIQIRLDQVNDLTLKKFWIVFIRRIFPW
                     DSLITFMNTLIHYCMVTGTKNFDIDAHMSTYLPMNREELLTSICENENLPECWSCWGS
                     LWFNTISKKSDLDVTTLESTGLSDTLFLDSPTEGICFDDDDEFGRKYWQRICRTLLLF
                     NIITEWEACDGYGHGCKKLNPEATSWKNLVFRFNDDTNDQLSVELYPEENESFPFEKF
                     EIISNLNCSDNLQDGSKSMIPGVSIENLQGFKLMYPDYFCFNKNGDLITASLYTKGPL
                     ETANIQGGDDFNANKILDNGRLVVQDRLEYSSAIDKLEQPWLEAFMNPDFRQRELLNR
                     SFLGNLNCQADTNVTFFVLDATTWLRHFAHIYKLATSSVLKFAICLTTFQELRFLRKS
                     KDESVLEAATRAVIAVRQLYYERKLLALRFTGNVAGHLEEHLEIEEQMTWKSHVDEFV
                     IDAIAKAQDKFNVLNNDAIEKGKDCIPLSEDGQSTQRFNFVSLVTDDFNMRNKAQQLG
                     IRTFSTRFVFAICRELGRETGVCTN"
     gene            complement(<49433..>49774)
                     /locus_tag="KLLA0_A00539g"
                     /db_xref="GeneID:9487336"
     mRNA            complement(join(<49433..49661,49740..>49774))
                     /locus_tag="KLLA0_A00539g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999299.1"
                     /db_xref="GeneID:9487336"
     CDS             complement(join(49433..49661,49740..49774))
                     /locus_tag="KLLA0_A00539g"
                     /note="highly similar to uniprot|Q3E833 Saccharomyces
                     cerevisiae YKR095W-A PCC1 Protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999345.1"
                     /db_xref="GeneID:9487336"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:B5RSI3"
                     /translation="MNKGDTSFEHSLHLEIPFESIKQADVARKVLLPDPIMKPEDFQV
                     TYSTQDTKLICDFESVDERILRVGVNSVIESIKTIVETIDELC"
     gene            <50099..>51241
                     /locus_tag="KLLA0_A00550g"
                     /db_xref="GeneID:2896444"
     mRNA            <50099..>51241
                     /locus_tag="KLLA0_A00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451022.1"
                     /db_xref="GeneID:2896444"
     CDS             50099..51241
                     /locus_tag="KLLA0_A00550g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451022.1"
                     /db_xref="GeneID:2896444"
                     /db_xref="GOA:Q6CYG7"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG7"
                     /translation="MARMPDESNVTKQELGIYNGVSFTIVTKLLAEGAKSYQLGSKLL
                     DDEKLLANKKFEYSGELLIVDSVFSGSGRDKDCDFATNVIAQFFEQVIVPYRLIKTTS
                     KSSVIELASSIDSTRQYTVLFLSGDTSISEFVNNLPLNHDCISVLPFPMGTGNAWASS
                     LKLMDPAVIFSQFVNGKLSCNDFPLYRATFDNGYVLKFFIILSLGFHANLLHLCEEDE
                     YQKMGIERFRVASQRILREYKLESRVSIPDILEGSFSYFALINTTNLEPTYMPSPDSD
                     PLESQLHVLAYQSSLDRVEFQKRVFMGYSNTKHSNILQNGTFYRPLPFCFNVEVLDDP
                     SQKSNFEVCCDGQLLNLLELEGKNTPPSTIRIETCTEPSLKVLHSL"
     gene            complement(<51265..>53081)
                     /locus_tag="KLLA0_A00572g"
                     /db_xref="GeneID:2896570"
     mRNA            complement(join(<51265..52910,52994..>53081))
                     /locus_tag="KLLA0_A00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451023.1"
                     /db_xref="GeneID:2896570"
     CDS             complement(join(51265..52910,52994..53081))
                     /locus_tag="KLLA0_A00572g"
                     /note="similar to uniprot|P32354 Saccharomyces cerevisiae
                     YIL150C MCM10 Essential chromatin-associated protein
                     involved in the initiation of DNA replication"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451023.1"
                     /db_xref="GeneID:2896570"
                     /db_xref="GOA:Q6CYG6"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG6"
                     /translation="MSYDLTDPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDL
                     TNRLLELEKKRNLKDPNFDSIDVPESPKKSDNATKGIEDIKHIAPVADIEEATFNVNE
                     DYVREKVKKLGTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITV
                     DEKDDLSGLVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGI
                     ISKKTEPRMTNSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPE
                     IMPSKKLEAGASPSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINK
                     LHDNYCAYHKEAKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIRYQQ
                     NPDKPFVREPAAAETNRFLFSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRN
                     LEKKLKGLSDKLLSKKEDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYS
                     TENKAPKNDKQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIMKGSQERLDK
                     DEGSSDDLEII"
     gene            complement(<53304..>58550)
                     /locus_tag="KLLA0_A00594g"
                     /db_xref="GeneID:2896790"
     mRNA            complement(<53304..>58550)
                     /locus_tag="KLLA0_A00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451024.1"
                     /db_xref="GeneID:2896790"
     CDS             complement(53304..58550)
                     /locus_tag="KLLA0_A00594g"
                     /note="similar to uniprot|Q02455 Saccharomyces cerevisiae
                     YKR095W MLP1 Myosin-like protein associated with the
                     nuclear envelope connects the nuclear pore complex with
                     the nuclear interior involved in the Tel1p pathway that
                     controls telomere length involved in the retention of
                     unspliced mRNAs in the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451024.1"
                     /db_xref="GeneID:2896790"
                     /db_xref="GOA:Q6CYG5"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG5"
                     /translation="MSVEPIASRVADFLQVDQQLIQDINNDVLGRIEEKLEDLRKQKS
                     ENLRITATLDQLKSQSENKLESFKIHISQLAKALEDGKDERLHFEEEKRRLIEGNSQV
                     TKRIIELEQEIEVERQQKELADASKQDIAESLNEKIEELSSTKAKLNEAQGANKELRQ
                     KVVNTETELQTQQALELRSKSEILRMEQEITLLRENNDWLTNQLNTKTVQLNEFREST
                     ISELQDSQLKVSNMESELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQ
                     ELTKEMSLKQRMIDALEKHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRL
                     DASESNCIKLKETIDELTSNIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVI
                     EKRQKDELKMQVEAFVVELEHKIPVLNSFKERSEMLERELNEVTILLESTGKDRDQKS
                     SQLDYLKATVKSYETQIASLSKQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKN
                     LTNSQEITKTSDTQGIITDRLVEFRSVVELQQKNSELLSTIRNLADELERREAENKSQ
                     IQVLEDETVREAKETILTLHDHAQNLENQLVILSKERDAYKALSVNASSGTNTPKAIT
                     YPSPDNDDKVKDLETRLTAVIQEAENNAKEWSSENSNLRKKLYEISLNFESEKTSRTL
                     AEDRLNLLQSTLELSKRQCEELQKRSSDLQDILTKQDKRTQETVDSLIKTKSTLSSIQ
                     SELSILKSEKQFMAKVQKELKAENERFSKESVEYKVLIAQLQTLQREREMLLKETQNS
                     YKEKLRKLEIELSGSLERLEEIEKNTTGIASNKEHQYNWFQEKIDKLTSEAAQQKTTL
                     EEKEAQLQKMQSTINEQSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQL
                     SDSYSQIEHHKTLAEQSVQSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILND
                     QVKDLNNEIFHQKSEYQTERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQ
                     TQYANESQRSYELELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEK
                     LWNEQKTEYEDKLSVLEQRVQELSTQNKLLYDQIELLNKTEDRDNSHDSSDLLISLRR
                     ERDMLETKLEVALSEQTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIM
                     KELDQLHLLRESNVTLRSENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIK
                     EQELIQSKEEAERWKSRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVI
                     AEKDDWESKFQRIRLQARDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKE
                     LEERLQVVTQEAETKEQTFNSQLSKLQEDLHSIQVQMENASKTEQNNADSDEKIKSLT
                     ETVEMLNSKIQELEAEASNAQKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDK
                     EKELRSKFEAEKESAWNSREEELRKQFEEREKRIREECEKTTVQSPSQPTLDIDIDAL
                     KNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKA
                     QKLAGEIGNDAITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFL
                     ESKIRNLEQQKSTIKPVENDTSNMSAAFQAPVFGSHSTFTSPFSTSEISPNKRPIDDT
                     ATEQPEKRHKEPESDTEDGQEA"
     gene            <59180..>60105
                     /locus_tag="KLLA0_A00616g"
                     /db_xref="GeneID:2896556"
     mRNA            join(<59180..59187,59727..>60105)
                     /locus_tag="KLLA0_A00616g"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_451025.2"
                     /db_xref="GeneID:2896556"
     CDS             join(59180..59187,59727..60105)
                     /locus_tag="KLLA0_A00616g"
                     /note="highly similar to uniprot|P04838 Saccharomyces
                     cerevisiae YKR094C RPL40B Fusion protein, identical to
                     Rpl40Ap, that is cleaved to yield ubiquitin and a
                     ribosomal protein of the large (60S) ribosomal subunit
                     with similarity to rat L40; ubiquitin may facilitate
                     assembly of the ribosomal protein into ribosomes"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="XP_451025.2"
                     /db_xref="GeneID:2896556"
                     /db_xref="GOA:F2Z6I9"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:F2Z6I9"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRKCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            complement(<60378..>63845)
                     /locus_tag="KLLA0_A00638g"
                     /db_xref="GeneID:2896600"
     mRNA            complement(<60378..>63845)
                     /locus_tag="KLLA0_A00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451026.1"
                     /db_xref="GeneID:2896600"
     CDS             complement(60378..63845)
                     /locus_tag="KLLA0_A00638g"
                     /note="similar to uniprot|P39928 Saccharomyces cerevisiae
                     YIL147C SLN1 Histidine kinase osmosensor that regulates a
                     MAP kinase cascade; transmembrane protein with an
                     intracellular kinase domain that signals to Ypd1p and
                     Ssk1p, thereby forming a phosphorelay system similar to
                     bacterial two-component regulators"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451026.1"
                     /db_xref="GeneID:2896600"
                     /db_xref="GOA:Q6CYG3"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG3"
                     /translation="MLAGLKRRCSLKALRERFTPPFNVGLRTQLIILVCSICVLSLTI
                     ITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQNLNYLYYQIYWLSTRDTLQDALVN
                     FRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTSFNTVINSTNNGSGDNIPENVL
                     AELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLPVSTNPSIILNTNEIAGYIT
                     VIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHFVFPPHGTSSFSSKVTFP
                     IKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVNWVAVVTQPEQVFLSP
                     TIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIITSGRDLKHYSNTGN
                     SDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVFPPSRTDSPSVSAR
                     NSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNLVEAYVPVYRRFFQDELS
                     ELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANEAKTVFIANISHELRT
                     PLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLEER
                     DFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRIIQIVMNLVSNA
                     LKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNLTSTTPMRLP
                     FNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESKHEENEDE
                     KEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPKTWVISMEVEDT
                     GSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDSKVGVGS
                     KFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKSKSSID
                     GHSDNNVSERKASNSTENSVGNVRVDRPFLQSTGTATSTRSISSVASEVTRHRVLVAE
                     DNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMIFMDVQMPRVDG
                     LLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPLLKKIIAQYC
                     SKKEKQREE"
     gene            complement(<64397..>65971)
                     /locus_tag="KLLA0_A00660g"
                     /db_xref="GeneID:2896568"
     mRNA            complement(<64397..>65971)
                     /locus_tag="KLLA0_A00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451027.1"
                     /db_xref="GeneID:2896568"
     CDS             complement(64397..65971)
                     /locus_tag="KLLA0_A00660g"
                     /note="weakly similar to uniprot|P40458 Saccharomyces
                     cerevisiae YIL146C ECM37 Non-essential protein of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451027.1"
                     /db_xref="GeneID:2896568"
                     /db_xref="GOA:Q6CYG2"
                     /translation="MSGSKGVWGAPPGNNNRQLYSLDAGSSGSGVSASSAQRHSILDP
                     HDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQAID
                     RDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHNQ
                     FLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLG
                     HSWAGSFFVMPKLSLSESMKRFKILILSDGDSANSFYNRLSRYHRLMFDVGKLNEASK
                     EEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKVKTFANSN
                     KIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYETDIPKKTKPRKGAKKKPAPHLA
                     KRWWFWPISIALGVGIGCCVTFYFSKFETSSYNSSVGVIQTADKEIDAIVDAIEGNSP
                     SILEESSPQSISDFLGQVCKLVKDTAIQINELLKQFLSAHLMTSAWIQSIGKEFMQPD
                     SQSTISKVTALDLVMF"
     gene            <67685..>69811
                     /locus_tag="KLLA0_A00682g"
                     /db_xref="GeneID:2896553"
     mRNA            <67685..>69811
                     /locus_tag="KLLA0_A00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451028.1"
                     /db_xref="GeneID:2896553"
     CDS             67685..69811
                     /locus_tag="KLLA0_A00682g"
                     /note="highly similar to uniprot|P46655 Saccharomyces
                     cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
                     forms a complex with methionyl-tRNA synthetase (Mes1p) and
                     Arc1p complex formation increases the catalytic efficiency
                     of both tRNA synthetases and ensures their correct
                     localization to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451028.1"
                     /db_xref="GeneID:2896553"
                     /db_xref="GOA:Q6CYG1"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:Q6CYG1"
                     /translation="MSASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKA
                     AAASFNGETEDVLTKLSAAYPDILNDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLN
                     AHLNLRTYILNTLEPSLADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFG
                     QAHEFLTKSLQELKKASNVNKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGH
                     AKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDY
                     FQEMYDYCVQMIKEGKAYCDDTPTERMREERTEGIPSSRRERTVEENLKIFTEEMKNG
                     TEEGLKNCVRAKIDYEALNKAMRDPVIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSL
                     EGVTHALRTIEYRDRNPQYDWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWLVDKD
                     IVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQGPSRNVINLEWNLIWSFNKKVIDPV
                     APRHTAIVSPVKVHLEGDDVPQTPNVEMKLKHKKNPAIGEKKVIYYKDIVIDEEDAKL
                     LSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEGDFKTTKFKLTWLADTDDKVEADLV
                     DFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLNVKDMKVGDIIQFERKGYFRLDS
                     LPKDGKPYVFFTIPDGKSVNKYGAKK"
     gene            complement(<69861..>71636)
                     /locus_tag="KLLA0_A00715g"
                     /db_xref="GeneID:2896602"
     mRNA            complement(<69861..>71636)
                     /locus_tag="KLLA0_A00715g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451030.1"
                     /db_xref="GeneID:2896602"
     CDS             complement(69861..71636)
                     /locus_tag="KLLA0_A00715g"
                     /note="weakly similar to uniprot|P43620 Saccharomyces
                     cerevisiae YFR048W RMD8 Cytosolic protein required for
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451030.1"
                     /db_xref="GeneID:2896602"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF9"
                     /translation="MSVIDDRNTAVPMSRSLSRRSPSILVTDARSNKNRPSAPFAGHA
                     AGMRNVSSVPRSAASSGGKTDSKGSRVRRRGYDMHGDKKSISSRFSDVSMDNLLLDVS
                     DVPSGRRQERLSTSSYDMFPRNRQRGTHITKMINPLPTRTSKTSQKLVLIPDEAHDSR
                     NINQFRKRANKTQRAKSSSKTKMDKEVDLPRITAYNVAEGFNLSLTSTFMKQTHDVLP
                     RLYDECLYVPYTLPLLPGKDGFRIKSNISKKTQGGKSIIDYLIDTSERRDHHYEYFSG
                     VETLEDVNNNYELDEGGVTNNLNAENTPDHLPNPPVNTSVSFDPSEPQYFAEENNAEA
                     ELEAFNEINGKTSLFQQQHAEIFIFSYGVVVFWNFTEIQEKNILGDISFSSYKNMVLK
                     PLDEQDIEIESFHFEYDMDTERPRIFNDIVTLRSGDHLTALTLSHAIAQSVKLSRFEA
                     RIVPIFGSVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWS
                     FEPSLHSLYQAMREYLEIDPRVQVLNDRCKVFLEFFDICVDSIAERNMARITWWFITI
                     IFISVLISIVEILVRYFIIKKHTGT"
     gene            <72233..>73981
                     /locus_tag="KLLA0_A00737g"
                     /db_xref="GeneID:2896582"
     mRNA            <72233..>73981
                     /locus_tag="KLLA0_A00737g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451031.1"
                     /db_xref="GeneID:2896582"
     CDS             72233..73981
                     /locus_tag="KLLA0_A00737g"
                     /note="similar to uniprot|P53064 Saccharomyces cerevisiae
                     YGL244W RTF1 Subunit of the RNA polymerase II-associated
                     Paf1 complex directly or indirectly regulates DNA-binding
                     properties of Spt15p (TATA box-binding protein) and
                     relative activities of different TATA elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451031.1"
                     /db_xref="GeneID:2896582"
                     /db_xref="GOA:Q6CYF8"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF8"
                     /translation="MSDLDDDLLALAGAGTDEEEEDEFLSTSKKHASKESSGSKRRRI
                     MKDDEDEDEDEDDNDEEDDDGYMPADSFDNDEEEEEEEEETDSIPFPLEGKYKDEKDR
                     EKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQREGSKSTRASTRS
                     SRTTGHSDLKQSKLSELKKQRAKKSGNYEFSDNESEDDYRSEDDSRGRRRRGDYDDEE
                     EEESEYDEEEDDYDLGYEKSKTRGRERADIHEVEWAEDDNLDRESSLDDYNKIQIGRS
                     FVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFLQKPYNMGKFFTNQ
                     YFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNNKSKAVNEF
                     VCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESESKYANQ
                     LKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVNKVDAK
                     SDPFSRLKTRTKIYYQEIQQEENEKAREEAKRQLEVDQEAEEQKKKELLLAKFRRLGG
                     LEEIIGSLDLKLHIDI"
     gene            <74187..>75329
                     /locus_tag="KLLA0_A00759g"
                     /db_xref="GeneID:2896665"
     mRNA            <74187..>75329
                     /locus_tag="KLLA0_A00759g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451032.1"
                     /db_xref="GeneID:2896665"
     CDS             74187..75329
                     /locus_tag="KLLA0_A00759g"
                     /note="similar to uniprot|P53065 Saccharomyces cerevisiae
                     YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
                     adenosine-37 to inosine in tRNA-Ala"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451032.1"
                     /db_xref="GeneID:2896665"
                     /db_xref="GOA:Q6CYF7"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF7"
                     /translation="MAVIADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAF
                     DELNDRYEPISLGTGVKATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQN
                     GQKSFLIEKSADGYKVKDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFI
                     NGQYVHPEIDTIIRGRANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNAL
                     TWSLLQSPVYLEWIVLPKQYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTN
                     LSQQPSLSSCVSLYGSNEAVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFK
                     KIKAMPSDTDYYGFKSSVVDRNHIISKAKATLSASGWISTCRDNCI"
     gene            complement(<75435..>75950)
                     /locus_tag="KLLA0_A00781g"
                     /db_xref="GeneID:2896370"
     mRNA            complement(<75435..>75950)
                     /locus_tag="KLLA0_A00781g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451033.1"
                     /db_xref="GeneID:2896370"
     CDS             complement(75435..75950)
                     /locus_tag="KLLA0_A00781g"
                     /note="similar to uniprot|P53066 Saccharomyces cerevisiae
                     YGL242C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451033.1"
                     /db_xref="GeneID:2896370"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF6"
                     /translation="MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDS
                     KDPLGNTAIHLCSKYGSWDVLDVLLDQEGVDVNQQNSIDGDTALHLCVNYSHDEPEYG
                     TFIAENLIEVGADPRIRNKRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEED
                     AEEIDDGPEDD"
     gene            <76350..>79208
                     /locus_tag="KLLA0_A00803g"
                     /db_xref="GeneID:2896560"
     mRNA            <76350..>79208
                     /locus_tag="KLLA0_A00803g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451034.1"
                     /db_xref="GeneID:2896560"
     CDS             76350..79208
                     /locus_tag="KLLA0_A00803g"
                     /note="similar to uniprot|P53067 Saccharomyces cerevisiae
                     YGL241W KAP114 Karyopherin, responsible for nuclear import
                     of Spt15p, histones H2A and H2B, and Nap1p; amino terminus
                     shows similarity to those of other importins, particularly
                     Cse1p; localization is primarily nuclear"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451034.1"
                     /db_xref="GeneID:2896560"
                     /db_xref="GOA:Q6CYF5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF5"
                     /translation="MSIPYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTA
                     TNNNASASTRQLALLCLRKFTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANED
                     TEKKVISTVTYCIVQICAVDFPDEWPGLLDYLNENILNYHSENAISLLTELVQDIITN
                     EMFFDNHSGAKIVNTVLLALNDDTLRLQAKSKLLQLYHHCISQLRNVSMFVTSELMSE
                     WLIPHLKAMNDCIDKLLESYGNNMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSY
                     RLRITLDAIKSNANSYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDF
                     TEDFIKLCLLPEDYFKLSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDS
                     VLQKCLQVTSNEAQYQEACLFLFQELCSNETSMNVPRYQDFLSLAVMILDDDACPTFV
                     KSRTILTIPKFFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTS
                     FAELGSILDYQTSMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHT
                     KQEILNLLLKLSSSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMST
                     FLQSQQTYSPLVVLALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAE
                     TALQAFVYLACNSNPKFWKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHEN
                     RFIGQIMEYTISKLVDPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPN
                     KLIRELFDCFEENRSKNMLKEVALSLSELFFSNDQRLTRSSYHDESDGVVRPFKEYIV
                     KMFADELTRQTDIEEEEEEEEEEENDITPKDYEEDYVSQLNDDVVLLTGRVIDMELKE
                     ILVQFFKSTQQSNDNSLGRVLKNLDEQERLKILSALFE"
     gene            <79588..>80595
                     /locus_tag="KLLA0_A00825g"
                     /db_xref="GeneID:2896561"
     mRNA            <79588..>80595
                     /locus_tag="KLLA0_A00825g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451035.1"
                     /db_xref="GeneID:2896561"
     CDS             79588..80595
                     /locus_tag="KLLA0_A00825g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451035.1"
                     /db_xref="GeneID:2896561"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF4"
                     /translation="MVKSFYHKPDASLEQKVISNRHKFMNLLQNKSVVFFISTPSHSN
                     VSQYAELLHNISTKNYAYDTQWNSLLRKYDAENLKDCIFCILITDVPDWNSVTDWRRD
                     MVLASELLPTCIPLKDPLKFSFVSDLNACSYFPTDFDFKDIAFASGCSTSVVIDVNDI
                     EDLTRCTQNIRTPNLFITVDEDCNPTIAHTTGNNDMLLLMDLTLATSVVFRDDFGTED
                     MKLPIIIRADTESKDAIKEFIGAGNVMPRVSGFEIPLNLAHLPSVLPGTSYSYRSDTE
                     TEYTYSNCQPKMNKEKTNWLSSLFGIRRDGTVQQPLANTSLEELEQFLNLVFELNNLL
                     T"
     gene            <80886..>81668
                     /locus_tag="KLLA0_A00847g"
                     /db_xref="GeneID:2896488"
     mRNA            <80886..>81668
                     /locus_tag="KLLA0_A00847g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451036.1"
                     /db_xref="GeneID:2896488"
     CDS             80886..81668
                     /locus_tag="KLLA0_A00847g"
                     /note="weakly similar to uniprot|P53068 Saccharomyces
                     cerevisiae YGL240W DOC1 Processivity factor required for
                     the ubiquitination activity of the anaphase promoting
                     complex (APC) mediates the activity of the APC by
                     contributing to substrate recognition involved in cyclin
                     proteolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451036.1"
                     /db_xref="GeneID:2896488"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF3"
                     /translation="MVATPMSTDKELFKRLQNILPRWENPYEVFPINQHVILDADAEE
                     STDENVQYVSNVYNPDDPEDQEESLESYLKSYTTELELIEQQNLVNLTKLAFWKASSF
                     KVGNPIANAIDDDPTTFWQSDGLQPHRIDINFSKRVDVVQLAMYFCLVTDESYTPELF
                     KVYAGYSPSDASLYRTFEVKNVNGWVVITFKGNRPHDNLLRCRFIQIQILSNHENGKD
                     SHLRGIKIFGNSTASRHTVKDPNTLALDNFENSSLFTYQSIR"
     gene            <81975..>84857
                     /locus_tag="KLLA0_A00869g"
                     /db_xref="GeneID:2896506"
     mRNA            <81975..>84857
                     /locus_tag="KLLA0_A00869g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451037.1"
                     /db_xref="GeneID:2896506"
     CDS             81975..84857
                     /locus_tag="KLLA0_A00869g"
                     /note="highly similar to uniprot|P33307 Saccharomyces
                     cerevisiae YGL238W CSE1 Nuclear envelope protein that
                     mediates the nuclear export of importin alpha (Srp1p)
                     homolog of metazoan CAS protein required for accurate
                     chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451037.1"
                     /db_xref="GeneID:2896506"
                     /db_xref="GOA:Q6CYF2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF2"
                     /translation="MADLENIANILSLSVVASSARTAEQQLKELESQEGFALTLLHTV
                     ASTNLPLSTRLAGALFFKNFIKRRWIDENGNYLISANDVELVKKEVIPLMIQLPGNLQ
                     VQIGEAISVIAESDFPQRWSTLMDDLISKLSADDMVTNAGVLSVAHSICKRWRPLFRS
                     DELFLEIQMVLDKFAVPFLTMLQTVDKQIDEYSSDKARMVILFDVLLLLVKLYYDLNC
                     QDIPAFFEDNMSVGMSIMHKYLNYQNPLLEDNTEDEEASVLSKVKASIAELIQLYISR
                     YQEEFDPMVDNFIQTTWNLLVSLTPQPKYDILVSKCMTFVTAVARVPKYFELFNTESA
                     MNSIIKEIVLPNVTLRESDEELFEDDPIEYIRRDLEGSDSDTRRRACTDFLKELKEKN
                     ESLVTNVVMVHIKSFFEEYNNNQILNWKHKDLCMYLFTSLAINGKVTNAGVTSTNVML
                     DVVEFFKSDVVPDLLNQQAHPILRVDAIKYVYVFRNQLSKEQLIEILPVMAKFLQDKE
                     YVVYTYAAITIERVFSMRQSAISNQLVFSKSDIASSSELLLTNLFSLTLKQGTTPEKL
                     AENEFLMKAVHRVLLTTENSLGAFALTVLNQLMEILKIISKNPSNPIFTHYCFESIAV
                     VIKYYHDSLSTLIDIIIPVFLSILGDDIQEFIPYVFQVMAYILELLPAGSMIPPSIKQ
                     INEALLAPAVWELGGVIPAATRLLKDFVKLEQSVYPDLVPVLGVFQRLISSKSYDVHG
                     FELLEYIFTFIPAERLQPFLKNIAVLLLQRLQNSRTEKYLKKFVVFLGVISCKLGSDF
                     VVQFIDEVQEGLFQQIWNNFVIDTISKVGNLLDRKIVLAGSLNTVVSGNLFSSKYGNL
                     IVPTLDIIVKTACSESIANVNSEFVDYDATEEISTFGSSYSRLSSITEKPYDPLPTVD
                     VHNGLRKYTGEVLLEFNQKAGGNFLPQIQTQLSEEGKNALTKLCTT"
     gene            complement(<85013..>85915)
                     /locus_tag="KLLA0_A00891g"
                     /db_xref="GeneID:2896304"
     mRNA            complement(<85013..>85915)
                     /locus_tag="KLLA0_A00891g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451038.1"
                     /db_xref="GeneID:2896304"
     CDS             complement(85013..85915)
                     /locus_tag="KLLA0_A00891g"
                     /note="uniprot|P53768 Kluyveromyces lactis KLLA0A00891g
                     HAP2 Transcriptional activator HAP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451038.1"
                     /db_xref="GeneID:2896304"
                     /db_xref="GOA:P53768"
                     /db_xref="InterPro:IPR001289"
                     /db_xref="InterPro:IPR018362"
                     /translation="MPTELITYEQNFSSGVDAENDYPPLDSGMGSFQVSELERQGDSH
                     KRSNDEISELRDETLNGREKKLRQSESISRNSTGNAQVEAIPHHSINVDQSDNLLSEQ
                     ENPTKVYLYDDPHLENDPQQRQEESDANGIMEKLTDDNSMKQVSNAKTSLETAQFLET
                     SNSMELQRTKPHDMNIISPSEPLEQPFYVNAKQYYRILKRRYARAKLEENLKISRERR
                     PYLHESRHKHAMRRPRGQGGRFLTAAEMAEMKRKEEEGTDNDSFLQEHVPKMNVLPQQ
                     LPGPVKDNNNEKSDEKPVAKEASN"
     gene            <86295..>87059
                     /locus_tag="KLLA0_A00913g"
                     /db_xref="GeneID:2896591"
     mRNA            <86295..>87059
                     /locus_tag="KLLA0_A00913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451039.1"
                     /db_xref="GeneID:2896591"
     CDS             86295..87059
                     /locus_tag="KLLA0_A00913g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451039.1"
                     /db_xref="GeneID:2896591"
                     /db_xref="UniProtKB/TrEMBL:Q6CYF0"
                     /translation="MMESKRRLEGLKGVLSELSSVLVHEEANDSEVQIKSSGQQGNLT
                     EINTYNFSQDVFNKLSESNRTKKRKLRVTEDVSIVAEKEDLNVNKSALSEDENERDGI
                     PLFVQDSSIFSDIVDEEVDTANATPLYDRKQKLTSVEETLNTTNCNFPSHELRHLMTT
                     FLYQSSHSKKFTLPSKSAEELKAIINDFIDSLARSISSMIANKETNSVDRPTILRLFS
                     KFGTVNKKTTNQELFEICRRYLNLEDLNELEISLFS"
     gene            complement(<87118..>89178)
                     /locus_tag="KLLA0_A00935g"
                     /db_xref="GeneID:2896836"
     mRNA            complement(<87118..>89178)
                     /locus_tag="KLLA0_A00935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451040.1"
                     /db_xref="GeneID:2896836"
     CDS             complement(87118..89178)
                     /locus_tag="KLLA0_A00935g"
                     /note="similar to uniprot|P53070 Saccharomyces cerevisiae
                     YGL236C MTO1 Mitochondrial protein required for
                     respiration in paromomycin-resistant 15S rRNA mutants
                     forms a heterodimer complex with Mss1p that plays a role
                     in optimizing mitochondrial protein synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451040.1"
                     /db_xref="GeneID:2896836"
                     /db_xref="GOA:Q6CYE9"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE9"
                     /translation="MLSSQFKGRLSPCRHVARRVVVRLPRRSISINHDLEQALKIATS
                     VDVVVVGAGHAGCEAAAGSARSGAETMLITPFLDKIGTCSCNPSMGGVGKGTLLREVD
                     ALDGVAAKVTDKAGIQFKMLNQSRGAAVWGPRAQIDRELYLKEMQNALQNYPNLTLFS
                     GKVKDVIIDHTLKVSFANDVNNRNFGDVRGVVLDNDEVIKCSKVVISTGTFLSAEIHI
                     GLKTIPAGRIGEAPTYGISHTLKAAGFKLGRLKTGTPARLDGRTIDFTNLEKQYGDDP
                     PYPMSYMNNEVSIKDQILCYGTRTTSELHDYLKLNLHQSIHIRETVKGPRYCPSLEAK
                     IIRFSDKDSHRIWLEPEGLNTDVIYPNGISNSMPEDVQEIMMRMIPGLENVKILQPAY
                     GVEYDYVDPRELKQTLETKLIDGLYLAGQINGTTGYEEACAQGVVAGINAGLSARGRP
                     PLILSRSDSYTGVLIDDLITKGVEEPYRMFTSRSEFRVTVRADNADFRLTEKGKKLGV
                     VSEERWQRFLLDKTIYRELENTLKSYVLSNHKWDQLLDVAVGSTHKSQNAWDMFKFNG
                     VTLDSLIKAIPDLSIDSSEIPVHILLKINVEAKYAPYLKRQNQFIKAFQADENMLLPL
                     NYDYTKIPSISSECKTILNTVQPATIGQARRIQGMTPASIFELYKLVRSQQSVIKNDR
                     IQQS"
     gene            <89999..>92377
                     /locus_tag="KLLA0_A00957g"
                     /db_xref="GeneID:2896609"
     mRNA            <89999..>92377
                     /locus_tag="KLLA0_A00957g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451041.1"
                     /db_xref="GeneID:2896609"
     CDS             89999..92377
                     /locus_tag="KLLA0_A00957g"
                     /note="uniprot|Q9HG45 Kluyveromyces lactis Purine
                     biosynthetic pathway protein ADE5,7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451041.1"
                     /db_xref="GeneID:2896609"
                     /db_xref="GOA:Q6CYE8"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR004733"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR020559"
                     /db_xref="InterPro:IPR020560"
                     /db_xref="InterPro:IPR020561"
                     /db_xref="InterPro:IPR020562"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE8"
                     /translation="MSLNILVLGNGGREHALVWKLAQSASVSTIYVAPGNGGTATVEN
                     VVNVPELSPSPENFSALKEFVLEKNIGLVVPGPEQPLVDGITQVFQSIGIPVFGPSAK
                     AAIFEGSKTFSKDFMQKHNIPTARYANFDDYEAAKAYLEKVDYQVVLKADGIAAGKGV
                     LIPTTQEEAQEALKIIMVERQFGDAGKSVVIEEFLEGDEISILTISDGYSYFNLPPAQ
                     DHKRIGENDTGLNTGGMGAYAPAPVATPKLLEQIDKTIVKPSIDGMRKDKLPFVGVLF
                     TGIILTKNGPKVLEYNVRFGDPETQTVLPLLTEDTDLAQVFLAAAEHRLDSVDIKIKD
                     NCYATTVVLAAGGYPESYKKGDEITVDSSKIPTDTYIFHAGTKSDNGKVYTNGGRVIA
                     SSAVAPTLKEAVDKAYEGVESVQFSNRYFRKDIAHRAFKNSAASAGKSITYAEAGVSV
                     DNGNLLVQKIKATVKSTSRPGTDSDIGGFGGLFDLKAAGYNTDETLLVAATDGVGTKL
                     MIAQETDIHNTVGIDLVAMNVNDLVVQGAEPLLFLDYFATGALDIKVASDFVSGVATG
                     CIQAGCALVGGETSEMPGMYPPGHYDTNGTAVGAVNKTQILPKVEEMGSGNVLLGLSS
                     DGVHSNGLSLVRKIIEHTGLPWEAECPWDASKTLGEAILVPTRIYVKQLLPSIKEQLL
                     LGLAHITGGGLVENVPRALPKHLQAKINMNTWEVPEVFKWFGKAGNVPLEDILKTFNM
                     GIGMVLIVKKENVERVTELLKQSGETVYEIGVLVERPSNEAGCIVQNASGLY"
     gene            complement(<92561..>93592)
                     /locus_tag="KLLA0_A00979g"
                     /db_xref="GeneID:2896314"
     mRNA            complement(<92561..>93592)
                     /locus_tag="KLLA0_A00979g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451042.1"
                     /db_xref="GeneID:2896314"
     CDS             complement(92561..93592)
                     /locus_tag="KLLA0_A00979g"
                     /note="some similarities with uniprot|P38152 Saccharomyces
                     cerevisiae YBR291C CTP1 Mitochondrial inner membrane
                     citrate transporter, member of the mitochondrial carrier
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451042.1"
                     /db_xref="GeneID:2896314"
                     /db_xref="GOA:Q6CYE7"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE7"
                     /translation="MSDTNPSLYSNLLAGSAAAVFQTTLSHPFEFLKTGQQLHRSLPN
                     AEAFNMFHHVKSYFAGCSALNIGILLKTATRFATFDKACQLLKDPENPEAPVSGLRLI
                     AAGSITGFMESMLIIPFENIKTRMIENALILSNRYQEEVETGGKDKPRSKSVNNMETK
                     EQIRPKLYKQVKKEINPRYEKFLYYEKHPSTNIFTTVREMVQTRGFTTFFQGSMPTIF
                     RQVGNSAVRFTTYTTLKQMISPNKPLSEYYAFGIGVFSSCAVVALTQPIDVVKTRMQS
                     KYTWSLYRNSLNCVYRTFIEEGLTSLWKGWVPRLFKVGLSGGVSFGVYQYVDNLMLSM
                     QYERSLGHD"
     gene            <94392..>95993
                     /locus_tag="KLLA0_A01001g"
                     /db_xref="GeneID:2896515"
     mRNA            <94392..>95993
                     /locus_tag="KLLA0_A01001g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451043.1"
                     /db_xref="GeneID:2896515"
     CDS             94392..95993
                     /locus_tag="KLLA0_A01001g"
                     /note="highly similar to uniprot|P43616 Saccharomyces
                     cerevisiae YFR044C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451043.1"
                     /db_xref="GeneID:2896515"
                     /db_xref="GOA:Q6CYE6"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE6"
                     /translation="MLARVFPKRSSFAANHTIKTTVTVKTRRSSRFYSKLSIDNNNLR
                     KIKMSSSVAEKNFESLFQKIDELKPRFIERLAKAIEIPAVSGDETLRPQVIKKAHYLA
                     GELKKLGFSDIQMKELGTQPPPVADPNLQLPPVILARYGNDPDKKTVLVYGHYDVQPA
                     SLEDGWNTDPFKLVVNEEKQIMYGRGVSDDSGPVKGWLNVVEAHRELGLDLPVNLITC
                     LEGMEESGSIGLDKLIAEEAEGYFRTVDTVCISDNYWLGTQKPVLTYGLRGCNYYQII
                     IEGPGADLHSGIFGGSISEPMIDLVQVMSTLVDTKGNILIDGIKEMVAPVLETEDALY
                     DKIDYSVDEFNAASGSKTALYDNKKDILMHRWRYPSLSIHGVEGAFHGSGAKTVIPSK
                     VIGKFSIRTVPNIESAKLDQFVIDHCNKAFAKLQSPNKFKAELIHDGNYWVSDPFNAS
                     FSAAAKATKVVWGVEPDFTREGGSIPITLTFEQELKSNVLLLPMGRGDDGAHSINEKL
                     DLSNYFGGMKTMAAYLHYYAASEEK"
     gene            <96383..>98968
                     /locus_tag="KLLA0_A01023g"
                     /db_xref="GeneID:2896305"
     mRNA            <96383..>98968
                     /locus_tag="KLLA0_A01023g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451044.1"
                     /db_xref="GeneID:2896305"
     CDS             96383..98968
                     /locus_tag="KLLA0_A01023g"
                     /note="similar to uniprot|P22224 Saccharomyces cerevisiae
                     YGL233W SEC15 Essential 113kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which mediates polarized targeting of vesicles to
                     active sites of exocytosis Sec15p associates with Sec4p
                     and vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451044.1"
                     /db_xref="GeneID:2896305"
                     /db_xref="GOA:Q6CYE5"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE5"
                     /translation="MDQDPQLAVSQDLQRALLTAEFVSKSGSSNQDQGEDELFELDPQ
                     IFDRWVPLLRQTIDEGQLNTVIDDLYASIDDHFENLETQILQDSQINNNLVTSINEIQ
                     KVQQIIDGSLQNDIKNLQSQVRHSTLNLVSRKQILIDNTKTSSKITESSILIQKVLQI
                     LELFNRCRELIEEKDFFKALQTIETFETIYLQDFKQYNFEFLNQIYTSIPMLKSQIKD
                     ESINLIKKSLNYNLEKTFSVIGEKYYDVYETQILQDWLKTKQSMKLHNYKFNSPVEIS
                     LRDTSKLDSLQLQNFCQLHEFHDSILIFQSLNEMDFFIDEFRKEYEFRKSKLIHPLFL
                     KDFSTVSHSNGKIDAFAEKLDLSFFKEYILKILGFLVYDKELHKSTDYVLSNNNNPNS
                     TDIFWTSIMNKLYPYLITMVKEKLTTEQLLTEFKDFLGVLIAILENLKLNVELLYKVQ
                     VETFSQYCELLVFLFQKEFTNLLQDDDFMPLAITDKALYEKILKICWLADQGSDTSNT
                     TNDNFSATFPFSPLYPMTCTLVKKTYSSLHSFISIFYKHDISHLNLIVIKAIDNIFDR
                     VVNDNIKSKLDTTSREEIAQILVNLDYFVIAAKEFSLILTRENLTNNPDVEIRLSSIK
                     KLIETRKEAETKLITLIDSKVIDLMEFIEFDWNSTEVRTEPDMTIVDIAQFLEMMFTS
                     TLAIIPYNIKMLLIFREFDVITRRFLEKLLNETPDRISPQSVQNFETDMLYLEKTITK
                     IFPNDVSSVPTSPSIPATPTDVPSTAGNRSSTQVENNIKSLLSTFTDLKQHIGLMKIN
                     HWDEYKDNDIRLKKYSRVKPEVAQSLLSKLQPPSSEQSNLVSDEGSSAESRANSRFAK
                     LFSRG"
     gene            <99292..>100221
                     /locus_tag="KLLA0_A01045g"
                     /db_xref="GeneID:2896661"
     mRNA            <99292..>100221
                     /locus_tag="KLLA0_A01045g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451045.1"
                     /db_xref="GeneID:2896661"
     CDS             99292..100221
                     /locus_tag="KLLA0_A01045g"
                     /note="similar to uniprot|P53072 Saccharomyces cerevisiae
                     YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
                     protein required for the formation of the modified
                     nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
                     but not required for the same modification in 18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451045.1"
                     /db_xref="GeneID:2896661"
                     /db_xref="GOA:Q6CYE4"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE4"
                     /translation="MAKRSRKDSKGGIVKRYKVVKSTLDPNTSGIYITCARNKEKAAA
                     SEILSIFEEKVEEYYSDELNAMNSASPDGSGSIEIESKEPVTTESKKEISIEEELQQE
                     LEGLKNHKTTIVDTKKNKPILEQLDLQTECLVFVKTRKPIVPEKFVHRIIRDLADPHD
                     LRKRTRFVQKLTPITDSCHASMEELAKLCERVLPQHFHKEEMVPVKFAVEINKRNFST
                     MDKMEMIKYIAGFVGKQGSLEHKVDLKNYDKLVLLQCFKNNIGMCVVDKDYRTDYKKY
                     NVQELFEMKHKNKETTPTTAESAPASTQSNTSK"
     gene            complement(<100259..>100867)
                     /locus_tag="KLLA0_A01067g"
                     /db_xref="GeneID:2896413"
     mRNA            complement(<100259..>100867)
                     /locus_tag="KLLA0_A01067g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451046.1"
                     /db_xref="GeneID:2896413"
     CDS             complement(100259..100867)
                     /locus_tag="KLLA0_A01067g"
                     /note="similar to uniprot|P53073 Saccharomyces cerevisiae
                     YGL231C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451046.1"
                     /db_xref="GeneID:2896413"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE3"
                     /translation="MVKIYDFLKSEIGLIDKLQEGIMSEDIPQWAKDLKVDKVMRRNS
                     VNGGKLPDPFGIKKLEIEGQKPPKVIDHDAQNRIAKLTAERAWQISSEPLKSVPMNII
                     MSYMSGNSLQIIPIMTAVMLVSNPIKSILGVKSKFQHLINKDNDVTPPVVAAMIMYVI
                     YQLILMGIGLHKLNSMGLFPTTSSDWLAWQQPTEYLYRTLSI"
     gene            <102036..>102737
                     /locus_tag="KLLA0_A01089g"
                     /db_xref="GeneID:2896605"
     mRNA            <102036..>102737
                     /locus_tag="KLLA0_A01089g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451047.1"
                     /db_xref="GeneID:2896605"
     CDS             102036..102737
                     /locus_tag="KLLA0_A01089g"
                     /note="weakly similar to uniprot|P43615 Saccharomyces
                     cerevisiae YFR043C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451047.1"
                     /db_xref="GeneID:2896605"
                     /translation="MDNHKVLILLPESLEIQEHIAFISTIFQKQYDETESIARDVQWK
                     TKYYETTLDLYIDTYDVLQEWVNDFVSDECKELRDVISGIIFVFKDEDHKPPVECLKN
                     LIDERIEDFTAKFFIGCYFNENVIEEDELYELNSDLLVQNFEIVNWFDKPDPSMDKVG
                     SERIKEIIDVHPWLSHPETLKKNQGQINISPIDLDSFMTKLEQAKERYQTFDDSKEAE
                     LFIEKIIDELSDMIV"
     gene            complement(<102802..>103431)
                     /locus_tag="KLLA0_A01111g"
                     /db_xref="GeneID:2896543"
     mRNA            complement(<102802..>103431)
                     /locus_tag="KLLA0_A01111g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451048.1"
                     /db_xref="GeneID:2896543"
     CDS             complement(102802..103431)
                     /locus_tag="KLLA0_A01111g"
                     /note="similar to uniprot|P43614 Saccharomyces cerevisiae
                     YFR042W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451048.1"
                     /db_xref="GeneID:2896543"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE1"
                     /translation="MNATRRQQPRRLVVKLYQFFHISSAFLYCALLVRWLVLLPLVSR
                     KYLPGGIHRFLCCLMVYSAVGNILWWIKMRGLAWSIFNRHNLKNINLIYLVAILHFYD
                     DFEHSPLLKNTSYSSFIVGLSFTQMYYHWNRIFKGPSPEPRSSKSLASRLNAFIMIPL
                     LYLSEFYLLLLNTEIDNYHNGPKTVLFNKFVLVVFIPLCLHLYKGFLYK"
     gene            <103746..>104579
                     /locus_tag="KLLA0_A01133g"
                     /db_xref="GeneID:2896646"
     mRNA            <103746..>104579
                     /locus_tag="KLLA0_A01133g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451049.1"
                     /db_xref="GeneID:2896646"
     CDS             103746..104579
                     /locus_tag="KLLA0_A01133g"
                     /note="similar to uniprot|P43613 Saccharomyces cerevisiae
                     YFR041C ERJ5 Endoplasmic reticulum protein that may
                     function as a cochaperone as suggested by the presence of
                     a DnaJ-like domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451049.1"
                     /db_xref="GeneID:2896646"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:Q6CYE0"
                     /translation="MLSSSRPVTYALFLSLFAAVAYCFTRDEIEIFQLQQELHTKYGS
                     NMDFYQFLKLPKLKQSTSAEITKNFKKLAKKYHPDKNPKYRKLYERINLITKLLSDEG
                     HRKTYDYYLKNGFPKYDYKKGGFFFNRVTPSVWFTFFFLYVLAGVIHLVLLKLHNNAN
                     KKRIENFVAKVREQDTTNSLGESKLVFKESEDSEDKQLLVRFGEVFVIQPDESLAKIS
                     TDDIIDPGINDTLLVKLPKWIWNKTLGKFINIGTSKSQQPNKGSPNKNKRNSKINSKA
                     Q"
     gene            complement(<104687..>107668)
                     /locus_tag="KLLA0_A01155g"
                     /db_xref="GeneID:2896619"
     mRNA            complement(<104687..>107668)
                     /locus_tag="KLLA0_A01155g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451050.1"
                     /db_xref="GeneID:2896619"
     CDS             complement(104687..107668)
                     /locus_tag="KLLA0_A01155g"
                     /note="similar to uniprot|P43612 Saccharomyces cerevisiae
                     YFR040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451050.1"
                     /db_xref="GeneID:2896619"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD9"
                     /translation="MSFWPFGQNFNSSNINGILEEYFHVMHGLENQTQKIAGSKSNNS
                     STVGTLGATAGAAAPVAVTDDNDLNETKTTTTTYNNDTKRINDNHEKKENAKKKKRQG
                     FAMGFEDRDKDSDVIIGDSNDSDRLEHNVDSHTTDFIDSSKNTIDTSPGSSQHNPRPS
                     LIPTPRRFNGTSDIESTPLKSAASSHPDSLSTTTTSSSSASHLSDEEGPIPLQALSHK
                     FMDEILEETELLNELTRQNNTLLDFVCFGYFYTETGDKVENIAYLIDRLLDCIDKIDD
                     DNDSANLDTVGGNDNVNELDDDDNINEEHRIENRDGSINDEGNNNAVQNIRESATIGS
                     NDSGRGETHNQGDDNEDEDIDTFGNSKGSFENPHEFTSSPHDDSIIPMLDSKLKKKST
                     FLNKANIISEIFALDIWLISESLVKNTEYLNKIWSILYHPKFTQEKSPLIPIFLKINQ
                     NLLLTRQDQYLNFIRTRDNLVIDMLKHIDISLLMDFFLKIVATDKQEAPTGIIELVSE
                     QKLIDHLFAFLVNEKYSADIQACAGDFIKSIIAVSANAPLDEMSIGPNALTREIASEK
                     CIDYLLGCIINERGPALMTAVSITIELIRKNNSDYDQVNLLTTTIKSHPPSMRDPVYL
                     GVMLRKFSENLVNLKQILFDIENDASIPIIKNQMGESYKPLGFERFKVVELIAELLHC
                     SNMGLMNSKKAERIVKERDQVRTELVQQLEDALTDLNIKSKLTADNHNSDSPTELSLD
                     DDIDESFEVPYVNDNQNAKLRSNPTIGDLFKIELYNSQLLPIIIQLFIKYPWNNFWHN
                     VIFDIIQQIFNGRMDFSYNSFLVYALFSNKNAERFATDKTLDDAPIDFQITRDLVLLG
                     YRNSHKFYEKHNTTLGFMGHLVLIAEEIVKFSKVYKVDLISPDIHEVLLDEDWDFYSN
                     DILNDTRIMYSKILGGGDYIEDGNLNGGDIVMGNDQDPTSFSTQMDLHDKLREKLIEK
                     SRQEVDEKNEKNGVIILPAGP"
     gene            <108738..>110648
                     /locus_tag="KLLA0_A01177g"
                     /db_xref="GeneID:2896462"
     mRNA            <108738..>110648
                     /locus_tag="KLLA0_A01177g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451051.1"
                     /db_xref="GeneID:2896462"
     CDS             108738..110648
                     /locus_tag="KLLA0_A01177g"
                     /note="weakly similar to uniprot|P53075 Saccharomyces
                     cerevisiae YGL228W SHE10 Putative
                     glycosylphosphatidylinositol (GPI)-anchored protein of
                     unknown function overexpression causes growth arrest"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451051.1"
                     /db_xref="GeneID:2896462"
                     /db_xref="GOA:Q6CYD8"
                     /translation="MRLVSKLLKALLVLLLAFGSVRYSCDNYTSGELQICKYTAPQHY
                     RAIIGGRFPQVIKYSDSLVAKYETVVVPRVGSAVIHVKDTVEQKVVPSVIRTSRSSLS
                     LVYTKVYPRVVKYAFIAESSLCRWYLQLCHQYTVYVKPVVINLYYKTMIKYPFLEHAI
                     YSVQAQYKIMETHVFKYYNIISYNVQVWNDKYGYGRLSRNKIFIRMKSTVVEHLIIWY
                     RYVNNRCRKMWRENLCPIINKSRERFAYHGGVRPESATTDPDDESIFYEDDDVDEYTE
                     TSTIVLTVTQTANSALDLKATPSASGLIVDECDMSMEEMLRNDFMSWKITIENKLSNT
                     MKDFENDINEFAQEKLDHIQPTLADLLKRASNTSQTNFQIITKAIMDVNCTESVDPKT
                     NKTIWFDQNNTQLPKYMTRELMREYFSAAHSQFDALSQEIRAHLRKLADEVNDHVEVL
                     RQENVELFEEWADVMITEWSKNLAYVDVAVNEEKLADLEKEQRKNWKDFMKLKRQVIK
                     TRDTLMEHPVKLDSLQSFVNTVQQSLKTLSHENGEYLYILRSKANLEFQAREALERQQ
                     REKEKAESASMKASTEFELSSSSFSSSSPSTASSCTASSTSTASLLAVEKTIALEDLQ
                     SYYQNVSSTDSL"
     gene            <111159..>112508
                     /locus_tag="KLLA0_A01199g"
                     /db_xref="GeneID:2896612"
     mRNA            <111159..>112508
                     /locus_tag="KLLA0_A01199g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451052.1"
                     /db_xref="GeneID:2896612"
     CDS             111159..112508
                     /locus_tag="KLLA0_A01199g"
                     /note="highly similar to uniprot|P39954 Saccharomyces
                     cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine
                     hydrolase catabolizes S-adenosyl-L-homocysteine which is
                     formed after donation of the activated methyl group of
                     S-adenosyl-L-methionine (AdoMet) to an acceptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451052.1"
                     /db_xref="GeneID:2896612"
                     /db_xref="GOA:Q6CYD7"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD7"
                     /translation="MSAPAHNYKVADISLAAFGRKEIELAEHEMPGLIAIREAYGAEQ
                     PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFA
                     WKGETEEEYLWCIEQQLFAFKDDKKLNLILDDGGDLTSLVHDKYPDMLMDCFGLSEET
                     TTGVHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKV
                     AVVAGYGDVGKGCAAALRGFGARVIVTEIDPINALQAAMEGYQVIPMEEAVSSGQVFV
                     TTTGCRDIITKEHFLQMPEDAIVCNIGHFDIEIDVAWLKANATEVINIKPQVDRYLLP
                     SGKHVILLADGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKAQDKAFREKYIEFQK
                     TGPFDIGVHVLPKILDEAVAKFHLDNLGVKLTKLSDVQSEYLGIPEEGPYKADHYRY"
     gene            <113308..>115926
                     /locus_tag="KLLA0_A01221g"
                     /db_xref="GeneID:2896654"
     mRNA            <113308..>115926
                     /locus_tag="KLLA0_A01221g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451053.1"
                     /db_xref="GeneID:2896654"
     CDS             113308..115926
                     /locus_tag="KLLA0_A01221g"
                     /note="weakly similar to uniprot|P53076 Saccharomyces
                     cerevisiae YGL227W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451053.1"
                     /db_xref="GeneID:2896654"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD6"
                     /translation="MSNSKMDLIDHEYMISMFPKYLLKQPIGHDLWKLYYQHKKLFHK
                     LKTKDELLSADADCSGSVSFQSLKTPNRLSAATRKEIWEKLSQLGVLGTIPYDSVSDD
                     YLIQVHKYFYARDDISNTTDGDGDVDMRKSVMTEEDFLGSMLPDSEADEEDDEIDDDN
                     DLEDDDDDEDGNDPEDDDDDELDDEDEDENDEQDSPDHPRRLNESTVQIEQSRGSTTG
                     FENPIGTSDAENIENAEVDRSKHKHKIVYYPESKESKHTVQLKSNPVPGEIYKTLGYP
                     LPHKWLLQSDNSILLSQDGCAVLRVNPNWHALSSYGRASPIMNSRLRVNINSKKKQQW
                     ATTWANNGVNHTKCAIFYFEIRVLSVTSSQAGRNSHVLVGFKNWAKINDKLSTSEQDT
                     TESGSAPSSENFNMLRNVLDGNRNVLNSPSSPSQTIHGDVETYSYSGLDGNKFDASGS
                     QKYSRPFGNDDIVGCGVNFIEGSIFFTKNGIFLGNAFEDCFDIDLVPFVSIKSGNSLR
                     TNFGLTEEFLFDIDQYQLQWKYKTYSHIFKAVDYDSGLNLVSDESDNEDLGKLGDEIN
                     DTLEPEFQEVASEENDLATDGFEDDQPDGFLLTRDRRFSGDKLWKPTTPKLNNINSNN
                     DSIPCQLNSMINDYLIHEGYIDVAKGFLKDLQRDCIPNNSDERARFVIRHNERQIVKE
                     EQNLQVRQTIRRYIHDGEILKCMNYIEQQFPGLLEKYLELTFEMKCADYLLCLSQQSP
                     ENDMIDSILSKGQDISEQFLQNRAISDDTREIFKAKFDEISPLMAYSNPSKECANDCS
                     FFLTPAYLQERLFQTINSHILQYLDKKSQSSLESMIGYTRAMVTTLMENESYNPREKE
                     PAYHKLVNIDEDLLKL"
     gene            complement(<115966..>116340)
                     /locus_tag="KLLA0_A01287g"
                     /db_xref="GeneID:2896451"
     mRNA            complement(join(<115966..116235,116320..>116340))
                     /locus_tag="KLLA0_A01287g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451054.2"
                     /db_xref="GeneID:2896451"
     CDS             complement(join(115966..116235,116320..116340))
                     /locus_tag="KLLA0_A01287g"
                     /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
                     YGL226C-A OST5 Zeta subunit of the
                     oligosaccharyltransferase complex of the ER lumen, which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451054.2"
                     /db_xref="GeneID:2896451"
                     /db_xref="InterPro:IPR020294"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD5"
                     /translation="MSYETLFKLHKSSAQFQSLVPLEKQPYFAAISLLLAIAFISPLL
                     LSSALPEEYEEKNKVKPFSVYELLKVIMLGGIGSLFFGISIVFLTNSFGVYV"
     gene            <116612..>117037
                     /locus_tag="KLLA0_A01297g"
                     /db_xref="GeneID:2896603"
     mRNA            <116612..>117037
                     /locus_tag="KLLA0_A01297g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451055.1"
                     /db_xref="GeneID:2896603"
     CDS             116612..117037
                     /locus_tag="KLLA0_A01297g"
                     /note="similar to uniprot|P53077 Saccharomyces cerevisiae
                     YGL226W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451055.1"
                     /db_xref="GeneID:2896603"
                     /db_xref="GOA:Q6CYD4"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD4"
                     /translation="MFSNSLRLSGRVLAHGRRFNSGCCEVYSPPDMSKLVQGGWLHMN
                     RDTREEINEYLDWRMEEPWKNLDLNDKRCAYYIAYGEWGPRAKKGSKEDQIEMNGPEL
                     ILKAMFSLTLFLALGFAFPNYKKDKTLQENLDKLRKSAE"
     gene            complement(<117215..>117769)
                     /locus_tag="KLLA0_A01309g"
                     /db_xref="GeneID:2896795"
     mRNA            complement(<117215..>117769)
                     /locus_tag="KLLA0_A01309g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451056.1"
                     /db_xref="GeneID:2896795"
     CDS             complement(117215..117769)
                     /locus_tag="KLLA0_A01309g"
                     /note="highly similar to uniprot|P40029 Saccharomyces
                     cerevisiae YER042W MXR1 Peptide methionine sulfoxide
                     reductase reverses the oxidation of methionine residues
                     involved in oxidative damage repair providing resistance
                     to oxidative stress and regulation of lifespan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451056.1"
                     /db_xref="GeneID:2896795"
                     /db_xref="GOA:Q6CYD3"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD3"
                     /translation="MATGISKTLKYNAQTDKLITFAAGCFWGTQHIFLKHFGDKIIDG
                     KVGYSNGSESLKDKPDTVSYERVKKGDTGFAEVYQISYNPKLVSLKELVDFFFRIHDP
                     TTVNAQGPDQGSQYRSAIFAHSEADLNELKKLKEQWQPKWNNKIVTDISLIDNFYDAE
                     EYHQLYLDKNPAGYACPTHYIRDL"
     gene            complement(<118369..>120123)
                     /locus_tag="KLLA0_A01320g"
                     /db_xref="GeneID:2896639"
     mRNA            complement(<118369..>120123)
                     /locus_tag="KLLA0_A01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451057.1"
                     /db_xref="GeneID:2896639"
     CDS             complement(118369..120123)
                     /locus_tag="KLLA0_A01320g"
                     /note="weakly similar to uniprot|P40028 Saccharomyces
                     cerevisiae YER041W YEN1 Protein of unknown function has
                     similarity to endonuclease Rth1p potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451057.1"
                     /db_xref="GeneID:2896639"
                     /db_xref="GOA:Q6CYD2"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD2"
                     /translation="MGSSELWNQISQYNVPRVAFKQFVAEFVEKNGRFPRIAIDGYLW
                     LFECGYFDEPQNKSKTLLNWLRKLKEMLHLQCFIVIIFDGTFKLDGKRRKKRKVATLW
                     DSYWLMRSMNRFNHDSVSYVDDYIIECCKLFNIQTINAPGEGEAQCAFLQLVGQVDFV
                     LSNDADVLSFGASKVLKNYSKHGWQDLPNSSNSPVKSKQNERFVTFVDLDIIKDWDRD
                     RFVLFNLLVGSDYNGGVKGLGGKRAAILSKSREPDISKKLPAVLADAKFEEKAKIQHK
                     WEEFGEDILRTIKKNGKTLFGMNLKSMNSLSRFKDWPDVTVGLFYRDPIVQNFDLSSK
                     PTHADVKFEEVEAFMKLNGIPRFLMNFDKWFHEFLHQCFIVSYIWKHPDPFNGNYRLT
                     EYHEVSLCDGMHQYKEVCVRFKSFLFTEIQKEVEGTPKLQNAELPSRARFAKIDSANS
                     PRKSPAKSTILRQKYPYYMWIPTGVIPKSLLIHLDKEIAAAKTSQALRLSSKKSSPKK
                     TRGRSLSPQKNTLDRFLNKRQRTEGPMRDLISALLQEQTNESGIEQKEDREIINPNKA
                     GIKILNIDLIDTESEEDL"
     gene            complement(<120385..>122730)
                     /locus_tag="KLLA0_A01342g"
                     /db_xref="GeneID:2896630"
     mRNA            complement(<120385..>122730)
                     /locus_tag="KLLA0_A01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451058.1"
                     /db_xref="GeneID:2896630"
     CDS             complement(120385..122730)
                     /locus_tag="KLLA0_A01342g"
                     /note="some similarities with uniprot|P18494 Saccharomyces
                     cerevisiae YER040W GLN3 Transcriptional activator of genes
                     regulated by nitrogen catabolite repression (NCR)
                     localization and activity regulated by quality of nitrogen
                     source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451058.1"
                     /db_xref="GeneID:2896630"
                     /db_xref="GOA:Q6CYD1"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:Q6CYD1"
                     /translation="MSDRGLHDPFELFASTDSGVSHEPSWNHTQFDAMLEILPENLNL
                     DVGGLQQDTSSPVATTLKFESNTTTTTITNASMKDDGSPDVIGEEDDEGGWKTPVAEI
                     SSHNGLKSRPIDIVQSVTPSTTAGQLIGNDLNLQNGEIAQLWDFNVHEFMMTPSDHSD
                     SATISAPSSFNSEQFTPGTTTPGFNPASSTASITNNNYNNGNNNGNNNNNNNTNSNSH
                     FQNSWNHLLHQQHDNGPNSSSLAYQHPRLFQNNNSSQSTIKADEYQHKQPQLPRRSSS
                     RNLLIKNDMNEDGALPLLTHTTTNLVKKNSSVKNLPTTTLPQYRRCSSSTNMQVMNGP
                     PVNNGAKANKPPTQCYNCKTLKTPLWRRDPDGNTLCNACGLFQKLHGTMRPLSLKSDI
                     IKKRNTKKRTKKDDKPASNMELQGQNDHSTNRGSQSPEKFQRKLSAKHTSIQPAANIY
                     NQSALSQNSLNNLNKKTATKSRRSSTSSSTSSKSSSSRSVVPILPKPSPGSRENTLQQ
                     FQYQIQMQVSQPNSAASSPRYSNSPRFYPTSPSTGLGVSIPRRKSSRTQISQSSSFMA
                     QSLQQLQHQQHNSSSNHTSAGISTNGSNSQASTATSQNANNLSSSTNSSSNATISAPN
                     SWANHSLSQPQNIASPNSSRSPFELFSNPNSQPKKSHKSLLSQQLQNSSNSSSSSSSF
                     VENASSGQQLSQTPPSHHSQTQQNFGSSVPAASPRSSYVDTLQQQRGILQYEQQQVAR
                     RKTPSTRQSNPSLFESSGSSLSKPKKENNVMDDLDWLKFGM"
     gene            <124161..>125153
                     /locus_tag="KLLA0_A01364g"
                     /db_xref="GeneID:2896624"
     mRNA            <124161..>125153
                     /locus_tag="KLLA0_A01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451059.1"
                     /db_xref="GeneID:2896624"
     CDS             124161..125153
                     /locus_tag="KLLA0_A01364g"
                     /note="similar to uniprot|P40107 Saccharomyces cerevisiae
                     YGL225W VRG4 May regulate Golgi function and glycosylation
                     in Golgi Golgi GDP-mannose transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451059.1"
                     /db_xref="GeneID:2896624"
                     /db_xref="GOA:Q6CYD0"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /translation="MSQLKVDNGPLSHVANSGPISIGAYCFSSIMMTVTNKFVVNLKG
                     FNMNFVMLFVQAAVCVNLLFFLRLLGYAKFRPLNRTDAKNWFPITIFLVLMIYTSSKS
                     LQYLAVPIYTIFKNLTIILIAYGEVLFFGGSVTAMELSSFLLMVLSSVVATLGDQQAL
                     KKTADAGASLFNIGYMWMFINCLSSAAFVLVMRKRIKLTNFKDFDTMFYNNILSMPVL
                     LALSFLMEDWSTENLTKNLSRDSVTAMIISGMTAVCISYCSGWCVRVTSSTTYSMVGA
                     LNKLPIALSGLIFFDAPKNFLSIFSIFLGFLSGIVYAVAKQKKQQNPQPSAPIK"
     gene            <125585..>126721
                     /locus_tag="KLLA0_A01386g"
                     /db_xref="GeneID:2896455"
     mRNA            <125585..>126721
                     /locus_tag="KLLA0_A01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451060.1"
                     /db_xref="GeneID:2896455"
     CDS             125585..126721
                     /locus_tag="KLLA0_A01386g"
                     /note="weakly similar to uniprot|P40026 Saccharomyces
                     cerevisiae YER038C KRE29 Essential protein of unknown
                     function heterozygous mutant shows haploinsufficiency in
                     K1 killer toxin resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451060.1"
                     /db_xref="GeneID:2896455"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC9"
                     /translation="MLSNDEDEVVASSDDGLYAKIWDIRDEELDDNGKNSDHFSDPGE
                     SFLLSSDDAMLPTDRVLNNIMSSNAHIGTKRRRSTDREKLWEEWHKSLKSSMEINNMT
                     MELKSFTDKRPDVQASQRKNSPHYDRQKQIAYSIKRNIPTSLLTELAADVSDSTVDWY
                     FLREDPDFSVVPSRYSTFLGKRLSIPLDDLYKKFGADLRANIEYTNCPYGKLIPVETM
                     CGLIESNNSDSVQAFKHFIKFILDRKISGNLKTKWVINMWNRFTCDKLSVYFEVTPRN
                     FYLMHYRLTRLIPIESEIVSKLFPNDNDVITEFENLLDSQEWTSLLYFIILVLGTSAL
                     PFGPSPRMTYIKDCILDLNSQNSSKIQLSIIKAYLTVCSKITQR"
     gene            complement(<126900..>127760)
                     /locus_tag="KLLA0_A01408g"
                     /db_xref="GeneID:2896637"
     mRNA            complement(<126900..>127760)
                     /locus_tag="KLLA0_A01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451061.1"
                     /db_xref="GeneID:2896637"
     CDS             complement(126900..127760)
                     /locus_tag="KLLA0_A01408g"
                     /note="similar to uniprot|P53078 Saccharomyces cerevisiae
                     YGL224C SDT1 Pyrimidine nucleotidase overexpression
                     suppresses the 6-AU sensitivity of transcription
                     elongation factor S-II as well as resistance to other
                     pyrimidine derivatives and to uniprot|P40025 Saccharomyces
                     cerevisiae YER037W PHM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451061.1"
                     /db_xref="GeneID:2896637"
                     /db_xref="GOA:Q6CYC8"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC8"
                     /translation="MQRRLDRVFRMTYSTLSEYTLQTKDKLRINRQHLESLTYPGSKV
                     TFDPDQPIPKPDPNLKVFFFDIDNCLYKKSLRIHDLMEQSIHQYFQMKFNLDNETARE
                     LRENYYRTYGLAIKGLVDHHEIDAVEYNELVDDSLPLQDILKPDPEQRKILQRIRESG
                     CFDKMWLFTNAYKNHGLRCVRLLGIADLFDGITYCDYSQSDLVCKPDVRAFEKAKLQS
                     GLGEYSNAYFIDDSGSNIRTSIKLGLRKSIHLVEAGFDDFFSTSPSEATIIKAITDLP
                     KACPEIFAKE"
     gene            complement(<128139..>129287)
                     /locus_tag="KLLA0_A01430g"
                     /db_xref="GeneID:2896622"
     mRNA            complement(<128139..>129287)
                     /locus_tag="KLLA0_A01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451062.1"
                     /db_xref="GeneID:2896622"
     CDS             complement(128139..129287)
                     /locus_tag="KLLA0_A01430g"
                     /note="weakly similar to uniprot|P53079 Saccharomyces
                     cerevisiae YGL223C COG1 Essential component of the
                     conserved oligomeric Golgi complex (Cog1p through Cog8p) a
                     cytosolic tethering complex that functions in protein
                     trafficking to mediate fusion of transport vesicles to
                     Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451062.1"
                     /db_xref="GeneID:2896622"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC7"
                     /translation="MSASLFREKSVAEVRDISVQLSRDVVKLREEFGKALKSNYQAVV
                     DTNEQIHSLYENIQDLDSDLLQLCFGDEDLLPRMNDTELPSMKVAKRRGSDGTYGRES
                     SFSSSVQKQHLEESYDFNIDEVQNTLKVSSWVVALTKFKRDPSVSDSLDKLLSSFSDL
                     PITGNVLDYCEKLGEWVITEKPSLTLDQYLSLLSLTEESKYQFDSRVHTWLFDQIVQH
                     PDILSGSVSPKVAQFMKTESFREAMSNRLISQYEAELKNWNAHKDDEIKEPELIDPYD
                     TDKKTSTLVKDITMYELGLTDSRRILLHDCKEKVSELLVHLKSFTSETQYRQITDKLS
                     QMLEKERIRILEDNNGDKPSYSASNMNTLVDALLLERNNSHYVTYLSM"
     gene            <130078..>131901
                     /locus_tag="KLLA0_A01452g"
                     /db_xref="GeneID:2896453"
     mRNA            <130078..>131901
                     /locus_tag="KLLA0_A01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451063.1"
                     /db_xref="GeneID:2896453"
     CDS             130078..131901
                     /locus_tag="KLLA0_A01452g"
                     /note="highly similar to uniprot|P40024 Saccharomyces
                     cerevisiae YER036C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451063.1"
                     /db_xref="GeneID:2896453"
                     /db_xref="GOA:Q6CYC6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC6"
                     /translation="MAPVSASKAKRDAKKAERDAKRVAAGKTTRRSKKEDETVDEAAA
                     AADKIAQLKLQQDKDGISDRVVTGVLDSLETSRDIKLSSVSLLFHGKVLIQDSQLELN
                     YGRRYGLLGENGCGKSTFLKAVASREYPIPENIDIYLLDEPAEPSEYSALEYVVREAQ
                     GELKRLEDLVEKILLEDGPESDLLEPLYERMDDMDPSTFESRAAIILIGLGFNSKTIN
                     KKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTLVLV
                     SHSQDFLNGVCTNMLDMRLQKLMAYGGNYDSYVKTRSELETNQMKQYTKQQEEIAHIK
                     KFIASAGTYANLVKQAKSRQKILDKMEADGLIQPVAADKVFSFRFPEVERLPPPVLAF
                     DDISFSYDGNSENNLYEHLDFGVDMDSRIALVGPNGVGKSTLLKIMTGQLTTQSGRVS
                     RHSHVKLGVYSQHSQDQLDLTKSALEFVRDKYPHVSQDFQYWRGQLGRYGLTGEGQTV
                     QMGTLSEGQRSRVVFALLALEQPNVLLLDEPTNGLDIPTIDSLADAINEFNGGVVVVS
                     HDFRLLDKIAKDIFVVEHKTATRWDGSILDYKNKLAKNVVL"
     gene            complement(<132423..>133565)
                     /locus_tag="KLLA0_A01474g"
                     /db_xref="GeneID:2896657"
     mRNA            complement(<132423..>133565)
                     /locus_tag="KLLA0_A01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451064.1"
                     /db_xref="GeneID:2896657"
     CDS             complement(132423..133565)
                     /locus_tag="KLLA0_A01474g"
                     /note="some similarities with uniprot|P53080 Saccharomyces
                     cerevisiae YGL222C EDC1 RNA-binding protein activates mRNA
                     decapping directly by binding to the mRNA substrate and
                     enhancing the activity of the decapping proteins Dcp1p and
                     Dcp2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451064.1"
                     /db_xref="GeneID:2896657"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC5"
                     /translation="MMSTDTMYFNSSRSMPSHRGRHQKQTRLQKPDRRMENQIKLRKQ
                     QSAEPPVVSNQDHETAMSQFAYSGYGNQGTSLTTASSEAMDTMGFVSDDLKQLLSMTD
                     SNKKENSSPQLNHNQQQQQPLPVSNSPRLSPSGTYQQSPLPPNQGLYGPMMVPPPFLM
                     SNVPKLGPHPYAGIANGPGMLPMYVPMNAGRPINQPPAYPQAMYNATHQQGIAFPPQQ
                     LFQHQQLHSSQPQPQQVQQVQQQKLQSPAPNNAQITKSSVEPQTVVGNTEQTKQPASD
                     NKQISKSPKEESRQQRSENSSSHSKTKSSKKRNARKNDSIPPQQVPVSFSSPSAPSSR
                     SSKSSNKKSNHMRSESRSDDHSKCYAGATFATEAPQVTTLPKPSFV"
     gene            complement(<134214..>134804)
                     /locus_tag="KLLA0_A01496g"
                     /db_xref="GeneID:2896652"
     mRNA            complement(<134214..>134804)
                     /locus_tag="KLLA0_A01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451065.1"
                     /db_xref="GeneID:2896652"
     CDS             complement(134214..134804)
                     /locus_tag="KLLA0_A01496g"
                     /note="some similarities with uniprot|P40022 Saccharomyces
                     cerevisiae YER034W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451065.1"
                     /db_xref="GeneID:2896652"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC4"
                     /translation="MDAFSLKKDNRKKFQDKEKLKRKHATPSDRKYRSLNKKAEAEAQ
                     AAEEEKQSMTLESNEHRYTSELLEEPDTGSGDEQIADVTAKIKEILLTKGDEQPFLKS
                     ATPQDTTRRFTKKQLENMSVSELNELLLNRTVNANELPSKSKIAPLLGSKSFESSYGG
                     SSSDDKNPVTTTHNNLPLSHIPTPLKEDESFLDSII"
     gene            complement(<135063..>135920)
                     /locus_tag="KLLA0_A01518g"
                     /db_xref="GeneID:2896503"
     mRNA            complement(<135063..>135920)
                     /locus_tag="KLLA0_A01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451066.1"
                     /db_xref="GeneID:2896503"
     CDS             complement(135063..135920)
                     /locus_tag="KLLA0_A01518g"
                     /note="similar to uniprot|P53081 Saccharomyces cerevisiae
                     YGL221C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451066.1"
                     /db_xref="GeneID:2896503"
                     /db_xref="GOA:Q6CYC3"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC3"
                     /translation="MSRALSRAQLKSVIKKISQLYPESYADSAWDNTGLLIDCSVDTE
                     QSHAKTQPKVLLTIDLTESVAKEALAKECNLIVAYHPFIFPSWKKLTPHSNPQHASAI
                     KLIQRGISVYSPHTAIDAAKNGVNDWLVSSLGGSVSSSVSIERVTPVQDEEEHEVGYG
                     RVVDLNEPLSLKDIVNNVKDTLDLSFVQVATKNELSDHKIKKVALCAGSGSGVFKSLR
                     EDVDLYYTGELSHHEVLRYKESGKAVIVCNHSNTERGFLRKVMHPSLTKSGIDCIVSE
                     TDIDPLQVI"
     gene            <136238..>136495
                     /locus_tag="KLLA0_A01551g"
                     /db_xref="GeneID:2896576"
     mRNA            <136238..>136495
                     /locus_tag="KLLA0_A01551g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451067.1"
                     /db_xref="GeneID:2896576"
     CDS             136238..136495
                     /locus_tag="KLLA0_A01551g"
                     /note="similar to uniprot|P53082 Saccharomyces cerevisiae
                     YGL220W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451067.1"
                     /db_xref="GeneID:2896576"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q6CYC2"
                     /translation="MLTQDDLKAKLEKEIPNFYHALITDTSNGCGQSFDVVVVSDVFV
                     GKNKLSRCRIVNKALAEEVAQIHAFGCKCYTTNEWNEILGN"
     gene            complement(<136823..>138445)
                     /locus_tag="KLLA0_A01573g"
                     /db_xref="GeneID:2896711"
     mRNA            complement(<136823..>138445)
                     /locus_tag="KLLA0_A01573g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451068.1"
                     /db_xref="GeneID:2896711"
     CDS             complement(136823..138445)
                     /locus_tag="KLLA0_A01573g"
                     /note="similar to uniprot|P53083 Saccharomyces cerevisiae
                     YGL219C MDM34 Mitochondrial outer membrane protein
                     colocalizes with mtDNA nucleids required for mitochondria
                     shape"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451068.1"
                     /db_xref="GeneID:2896711"
                     /db_xref="GOA:Q6CYC1"
                     /db_xref="InterPro:IPR027536"
                     /translation="MSFKFNSGTFEDNTFNEQIRDRLTRALNPSRFENPESTSGQDGS
                     DSQKKPKKLDILKSGVTVRQVDFRTIPQLEILDLDVSAQSKSLLKGICKISCKDAMIQ
                     ITTEIEANLLLLYEAVSPEFTTPKLISNDSFTVPITMTFDHIELEAITNIFVKNTGVG
                     ISFNDVNLDFRFECSMKLLQTSIEKRLKNSMETIFKDVLPSVIFNMSQRWFTHGPELV
                     EDPSLIATDSALSEVTPMTILDDSDLQDLSPATMLRLSTLISSRQSLALNPISSHTVA
                     TIPGCIERQNLRRFSSRIPSLNNYYAQEVGKHRPSKILPTRENSNSIIANKMASDFIQ
                     NSLPTEVLESGSYNIREIANIQQRIYERNNEENVIRRRRIRLGKRSKSVQDTAAKMHP
                     VPESGSLHPIIQPSTTPAATVTPLLSPQPVVAKSPPESMTPNTLPEQSPYTSNIAIDK
                     IPDLTLPQAQLQKDKVPMRLNLLEESYFKSDLKDLRNSLYSPMRNQRFYVQSEDGARP
                     SLLDGKRFSFVGLANQQMKWGNDDLPPPYKAN"
     gene            <139355..>141664
                     /locus_tag="KLLA0_A01606g"
                     /db_xref="GeneID:2896695"
     mRNA            <139355..>141664
                     /locus_tag="KLLA0_A01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451070.1"
                     /db_xref="GeneID:2896695"
     CDS             139355..141664
                     /locus_tag="KLLA0_A01606g"
                     /note="similar to uniprot|P53086 Saccharomyces cerevisiae
                     YGL216W KIP3 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451070.1"
                     /db_xref="GeneID:2896695"
                     /db_xref="GOA:Q6CYB9"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB9"
                     /translation="MHNIVPETRQSSILVAVRVRPFTDEESTRLVHEENGNMVYLKDT
                     VLNIPLSAPSLGIDDKSTLLRTQSKFRPIGIRKIIDCVDDKMLIFDPSKSNPLNELNE
                     NLVHSSSNENRRRLRRFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVF
                     AYGATGCGKTFTISGTSEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIH
                     DLLDPNISSKKLVIREDSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANE
                     TSSRSHAVLQIHVAQMNRTADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANI
                     NRSLLALGNCINALCVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSS
                     GHYDETLNTLKYANRAKEIKTKVIRNKQSLDRHVGSYLKLITEQKSEIEELRSREQKM
                     IEIQLSQFRNGREKVNMLIKESVREMRIHLSDSEKIQDAKLIKSLMLVKRHYLKLVHF
                     ELSNVLQYLNNLNDERAVFLTDNIHIIQEQILLKMNELEVQFDDPNDIDRTLEYMKTI
                     QLKKMRDCEYWQEAIDFEQYEILISGLSESVRNEILVNGTRLMEKVIEDPILRSHFQI
                     ISKSIVDENENTDGSNTTMVGTIERELNKLNKLDQEFDQFAQQLNVSTQRKRSSPMQK
                     QQPTWRQKLMKQGMMGEGSPDVTPSKVMKSLSFAEGPPTIWNEPQDVSMMLDDPDPLP
                     IERKLNTTVNKISTPNPKPKLSLTATQLK"
     gene            <143922..>145160
                     /locus_tag="KLLA0_A01628g"
                     /db_xref="GeneID:2896587"
     mRNA            <143922..>145160
                     /locus_tag="KLLA0_A01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451071.1"
                     /db_xref="GeneID:2896587"
     CDS             143922..145160
                     /locus_tag="KLLA0_A01628g"
                     /note="weakly similar to uniprot|P35190 Saccharomyces
                     cerevisiae YGL215W CLG1 cyclin-like protein that interacts
                     with Pho85p in affinity chromatography cyclin-like protein
                     that interacts with Pho85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451071.1"
                     /db_xref="GeneID:2896587"
                     /db_xref="GOA:Q6CYB8"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB8"
                     /translation="MASFMYYPNYPAMSVQSNSMATPYHHRSGSMNPSMVSSINGYGC
                     PAVNPTTITPHQIDGMFQPGHGQSNSFYFPPPGLSYMQPPAAPVVGHVPGLVQNHGHP
                     VMPGHSMMMNQPQVMVPPANNQVIPEKEQNVNGGVCEVLDYELNTMSDFVTKNSCLSF
                     GSFDVPADVMELFSSSVSSVLGSTRLPSVTIFLALDYLIKYLDLIDCDFQSIGGKSVD
                     IIYQNLVVALVLANKFNDDKTFTNKSWSQATGMDLLTINQYEKSWLKAFEWRLFEDKF
                     DTYESFQESYNAFVREQRLSAYQQQQQQQQHQLSPSSVPTHQRQYSSASSMAYGYQTP
                     NCGHSSMAYSSPVYSDLRSYSYNNGYQKQFNCSPPSQYSPRPKNYDNVNYYEQPQQPF
                     WNDHHQQQQVNQNYYCFSAY"
     gene            complement(<146030..>147235)
                     /locus_tag="KLLA0_A01650g"
                     /db_xref="GeneID:2896410"
     mRNA            complement(<146030..>147235)
                     /locus_tag="KLLA0_A01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451072.1"
                     /db_xref="GeneID:2896410"
     CDS             complement(146030..147235)
                     /locus_tag="KLLA0_A01650g"
                     /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
                     YGL213C SKI8 essential for protection against viral
                     cytopathology dispensable for mitotic but required for
                     meiotic recombination and spore viability antiviral
                     protein mRNA is induced early in meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451072.1"
                     /db_xref="GeneID:2896410"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB7"
                     /translation="MSKLFIPTTNCGKAHETDIYGLVITNPYTVSCSGDGYLKLWNNK
                     LTEDQLAKDHVIKEFVTPMGLHHVSAFESVESNGETVIILSAISFDGKIYFYQIDLKE
                     GKLVKLSLLNADDSKHSYWACQWYISTNPKNPHKFIATTVQGTTKVWNFIIFQEPELD
                     TETGEPLSNSLVYEPHFNFQGKINSQTPRFATAVDVSSTQLIATGFSDGSVVVSQLST
                     LRPVYNFEGFGLKGVEESSSTIRDIKFSPAGSLLAVAHDSGSYGCVSLYETEFGERIG
                     NFTVPTHGNQTTIASYAHNGWVFSVSFNSTGEYLASAGYDGKIRIWDTKSRERVSTLN
                     VNTTDIEIEEDIVLEDEHGDSLEVPPVLAVSFFDKCVRSGMGGSTNEGICCVCSDRSI
                     RWYREAGGI"
     gene            <147876..>148916
                     /locus_tag="KLLA0_A01672g"
                     /db_xref="GeneID:2896577"
     mRNA            <147876..>148916
                     /locus_tag="KLLA0_A01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451073.1"
                     /db_xref="GeneID:2896577"
     CDS             147876..148916
                     /locus_tag="KLLA0_A01672g"
                     /note="similar to uniprot|Q755T0 Ashbya gossypii AER438C
                     AER438Cp and weakly similar to YGL212W uniprot|P32912
                     Saccharomyces cerevisiae YGL212W VAM7 Regulator of
                     vacuolar morphogenesis hydrophilic protein heptad repeat
                     motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451073.1"
                     /db_xref="GeneID:2896577"
                     /db_xref="GOA:Q6CYB6"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB6"
                     /translation="MDRGMRCEVSINDVTIVEKRYALYHIIVNVIRSKEDYSEYKSER
                     RFKDFLQLKKQLEYECSGELPYELPGRRLLWSRTANSCDPDVVEERRVKLRQFLSDLL
                     NDSFETKWRNSSLVAQFLNLPEGWYIKSSTKSGNSFTKETIKDGTNPDDALDPSKWLV
                     VLRESKSEFYNGAHDTRTVMKQRLVLDNLEQGLKVIEKEELVSKMECERRKQLLATFK
                     NDLNETIQPASWNKHNNDREELLYKDYQNKFEEPKIGKGRKLGETSETSDLNNQQILQ
                     LHKDTINDQDEQLHKLHEIVQQQKNISLVLNQELEAQNELLDMFQDETQASANKLRTA
                     NRNAVKFNQGQR"
     gene            complement(<149587..>151293)
                     /locus_tag="KLLA0_A01694g"
                     /db_xref="GeneID:2896653"
     mRNA            complement(<149587..>151293)
                     /locus_tag="KLLA0_A01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451074.1"
                     /db_xref="GeneID:2896653"
     CDS             complement(149587..151293)
                     /locus_tag="KLLA0_A01694g"
                     /note="weakly similar to uniprot|P25346 YCR098C
                     Saccharomyces cerevisiae GIT1 Plasma membrane permease,
                     mediates uptake of the phosphatidylinositol metabolite
                     glycerophosphoinositol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451074.1"
                     /db_xref="GeneID:2896653"
                     /db_xref="GOA:Q6CYB5"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB5"
                     /translation="MTYDRNHLEHPGTRDLPKSFSGYAHHLVSQINKEITWNKTYDVT
                     EESEEISENDGVVGVNEFDSTGESLVAKADDSGKKSGSKTSFRSNLHIYWPIFTTGSG
                     LFSDGYINASIGTVSTCLAQIYGDQYSNSNAIQNVSSIAFVGIVLGQLSFGYIADYYS
                     RRLAMLMGNIILIVFSILAAGAWGVGTTTTQAGGIFAAITAYRFFLGVGIGSEYPAGS
                     TAAAEASALLPAKRRNRWFVWFTNFMIDWGFVIAAVVPLVLICIFGEHRLQWVWRLTM
                     GLGAIPPFSLFLMRLKFKENKSFTSTKFNKMMPYGLIFKFYWFRTIIISIIWFLYNFS
                     SYAFGIYSSLIIKNLLTNDSDEQVGLKESFAWNVLFNAFYLPGSFAGAIFADYIGPRL
                     TLSLGLFVQAMFGIGMTCGFKSLEKNIAAFTVVFGIFTSLGEFSVGDNIGLIASKSYA
                     TPVRGTLYSISAAFAKVGAFVGTYAFPQIIKNAGGSDTTNGMRAPFWVATALCLVSCF
                     LALFFLPELDPNAIVDEDRKFAEYLAQSGYDMSTLGTESDNTVEVEYSQEILKSDSID
                     KN"
     gene            complement(<152383..>153498)
                     /locus_tag="KLLA0_A01738g"
                     /db_xref="GeneID:2896594"
     mRNA            complement(<152383..>153498)
                     /locus_tag="KLLA0_A01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451076.1"
                     /db_xref="GeneID:2896594"
     CDS             complement(152383..153498)
                     /locus_tag="KLLA0_A01738g"
                     /note="highly similar to uniprot|P25087 Saccharomyces
                     cerevisiae YML008C ERG6 Delta(24)-sterol
                     C-methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451076.1"
                     /db_xref="GeneID:2896594"
                     /db_xref="GOA:Q6CYB3"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSESNELRKRQAEFTKELHGNNVTKSGFSALVSKNKSAQTEAVA
                     KYLKHWDGKTDADAERRRLEDYNESTHSYYNVVTDFYEYGWGSSFHFSRFFKGESFSA
                     SVARHEHYLAYKAGIKENDLILDVGCGVGGPARTISRFTGCNIIGLNNNDYQIQKANY
                     YAKRDHLDSKLSFVKGDFMKMEFDENTFDSVYAIEATCHAPTFEGVYGEIYKVLKPGG
                     TFAVYEWVMTDKYDETNPEHRKIAYEIELGDGIPKMYSVDAARDALSKVGFEILEEND
                     LADNDDEIPWYAPLTGEWKYVNSVADLATFFRTSRLGRAFTTSMVTVFEKLGLAPKGS
                     VSVTNALEEAAVGLVAGGEKKLFTPMMLFVAKKPEQK"
     gene            <154859..>156610
                     /locus_tag="KLLA0_A01760g"
                     /db_xref="GeneID:2896569"
     mRNA            <154859..>156610
                     /locus_tag="KLLA0_A01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451077.1"
                     /db_xref="GeneID:2896569"
     CDS             154859..156610
                     /locus_tag="KLLA0_A01760g"
                     /note="uniprot|P56095 Kluyveromyces lactis KLLA0A01760g
                     YAP1 AP- 1-like transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451077.1"
                     /db_xref="GeneID:2896569"
                     /db_xref="GOA:P56095"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR013910"
                     /db_xref="InterPro:IPR023167"
                     /translation="MSTSTAKRPFDNKRAGSPDDGTDSDSGGNNSGSSPASKRRERKP
                     GRKPLETEAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRN
                     QVTNLLSELKRYNPELPKKRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDSSTA
                     ISSSNFQFEFPWKMDPSKIPSPSSDSTSPSASTSILDNANNKSVSSTNLNHSRSSISN
                     SSSSPSNVNGLSSRKHSNTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKS
                     NPIPKASPVSTPSSSDLLKPKSNSNVNITNHNNNKINSKDLSSSAPLHDSASASALNN
                     HDSVNAVSNQFSVDKQYNDSSHSQATPNGLDNDSSVSAWQQPSFGQLGFRTDQLFDLD
                     LDSASPITKQKDNNYSTTTNNTNSPAKADGMYWNFNTPLSNMVSRNMQNPEIPFIDTG
                     LAFPDYDDPLLDILKEEQENEQVEGDSDPIQALINEEPSMPLCHDPAANAGASVSETD
                     KLSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKG
                     VVVNAEDVQKALISHMQ"
     gene            complement(<157216..>158802)
                     /locus_tag="KLLA0_A01782g"
                     /db_xref="GeneID:2896395"
     mRNA            complement(<157216..>158802)
                     /locus_tag="KLLA0_A01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451078.1"
                     /db_xref="GeneID:2896395"
     CDS             complement(157216..158802)
                     /locus_tag="KLLA0_A01782g"
                     /note="some similarities with uniprot|Q04233 Saccharomyces
                     cerevisiae YML006C GIS4 CAAX box containing protein of
                     unknown function proposed to be involved in the RAS/cAMP
                     signaling pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451078.1"
                     /db_xref="GeneID:2896395"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB1"
                     /translation="MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLL
                     KRFLRDQFQATGPLNKKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTR
                     GTVYKHENHYLIQDKLTNFNDEWFLEMKKDVSISGNSSKDATDSAENCGQEMEDDSPR
                     RDSDSSDSYSILTGDTFDTESHSIVLNFKHPEVMVKPITKTTQRIVRISPGNNIGSPA
                     ESQVSIVTHGDDLESYRGEALVQTVTRAIDEDEEDEDDDDHHHDVESADDMKSKDISI
                     PPSISISDNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFN
                     LGNLQMLSLYDILDFSKFLPKILFYSMIHVKDSVDDNTELSLQHLITVNNTLTNGNMY
                     SPHEVDDSMSELSSDNSIECYTGNSNDSIADEPVIGLYSPATAATAGHRSIRTVESIG
                     AWALNRSNTKKSMETVQNTVSRDSRGNFMNRIKSQPMPVLLQTLNSNIDEEAIKIKKN
                     LAKVRARQRKKSTSHNCSIM"
     gene            complement(<159689..>162526)
                     /locus_tag="KLLA0_A01804g"
                     /db_xref="GeneID:2896589"
     mRNA            complement(<159689..>162526)
                     /locus_tag="KLLA0_A01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451079.1"
                     /db_xref="GeneID:2896589"
     CDS             complement(159689..162526)
                     /locus_tag="KLLA0_A01804g"
                     /note="similar to uniprot|Q04052 Saccharomyces cerevisiae
                     YDR421W ARO80 Zinc finger transcriptional activator of the
                     Zn2Cys6 family activates transcription of aromatic amino
                     acid catabolic genes in the presence of aromatic amino
                     acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451079.1"
                     /db_xref="GeneID:2896589"
                     /db_xref="GOA:Q6CYB0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CYB0"
                     /translation="MVSNGNESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHG
                     PPCVRCKRESRECMFTETKRGGFRVAKQSLVSLKEESAGKSMADVITSVIQGQTLKKE
                     LDTDLDRLQTHTKDDISINTDPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIE
                     PTDAVSRQPSVSSYGNKQATGSMEPSSIPKMLTDSYVTSFVEPEGQKPGTIPLIEKLS
                     SVRPKPSMKLGDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARY
                     PLLLCTILTISARYHTLHDLGLNEIDNTVHVELHERLWIYCQRLVSQTVWAEASTRSI
                     GTILAFLIFTEWNPRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRR
                     SDRMSWLLTGNAVRLAQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEVRL
                     NGFEDNDLDNEQFFLERILQNDKSKERWARFLERVGERSKKGSLTDIEREFLNDEYLL
                     YHYNTENPNTQSDPEFRLKFSKIQRGKVELLKIVSLGYENVYNGKLSSHDRHQRLSML
                     SVLSPLIEGWYNIYKSLLVPCGGAACSIAKSSNKSFVFEMTEKVEHESLISDYYYCQL
                     YIYSLALQWDHQDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLKMLKYMP
                     VRWVMRIVRSIVFMIKCYLTLTGNGITQNPEANTILTMSVLPTDEIIQTIQRTAIILR
                     AAAPDELHLCSRYSTILMYLCTEMKHRCKPNMQPPVPRSISNDYLDKTSNRSENVADN
                     SARHFSVGGYQVSDTANVSSSPFINKGTNVRFGSTEYKQQETTNDEQQRPDTFTVDSA
                     LGVASINSAPPAPVPEPAPDTNPASAINTGPNSSGGYLPPQLVDWFNDNNEIGLDFVG
                     PWTEMVEKQFVNKVDDSSYENWFNDFYTPPK"
     gene            complement(<163010..>167404)
                     /locus_tag="KLLA0_A01826g"
                     /db_xref="GeneID:2896555"
     mRNA            complement(<163010..>167404)
                     /locus_tag="KLLA0_A01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451080.1"
                     /db_xref="GeneID:2896555"
     CDS             complement(163010..167404)
                     /locus_tag="KLLA0_A01826g"
                     /note="some similarities with uniprot|P41809 Saccharomyces
                     cerevisiae YDR420W HKR1 Serine/threonine rich cell surface
                     protein that contains an EF hand motif involved in the
                     regulation of cell wall beta-1 3 glucan synthesis and bud
                     site selection overexpression confers resistance to
                     Hansenula mrakii killer toxin HM-1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451080.1"
                     /db_xref="GeneID:2896555"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA9"
                     /translation="MHVRRNTYHYPLLWLFALIICCEGRILPSWFWHSSSISKHFGTT
                     SAANEQTQAAELIFTSKPIIAVRRRDVTVNSTQSDLELASSSFPDDYSTTEVTSTDLS
                     DTDVDTSTEVPTSTDLSDTDVDTSIEDSSISTTELSTSSELYANVADLSSEDFGTQTT
                     PLLEFFSFHLETSTSSPDTTTSSSPFIGSDMKIVTTSSNGNLISDFLQSSDVSASSDE
                     HTSSEVLTSSEAEDTTPITSSIEEITSSAPSAGASFDSQDAVSSSDSVSVSPSPSQSE
                     SFFTDTSSEDVPSLSATVASTVDVDTTISYTPSPSPSPSPSPSPSPSPSPSPSPSPSP
                     SPSPSPSPSPSPSPSPSPSPSPSESHLTETSTEPGSSSSFVGVPIDNDTSTPDDIISP
                     DTTLPETSSPVTTTPETTPPDTTTSITTAPVTTTPVTTTPDTTTPVVTTPITTTPETT
                     SPEATTSSTTDTAQAAVSSTSSYSTTLSTADTVPVTIETTPSTSQLDTIPTTATSSEV
                     NDTPTTTTSQVNTNPFTTLSTNILPSETGTTSESLLILVSTVESTPESTIIMDVSTSS
                     PDMVSPTSGEISSIVPVSTSVILQDTDVSSSTSTEMVVISSEAPGASSILQESTTFTD
                     ITSGSDIQLERSTTSIIASSVTSGTTASESTNVFTVFSSTESASTHHSLASSSIITQT
                     INSGASASFISETRQPMATSVSATLDGSIVNSGLTSNNNWLPTTLVIEPTAAHATSAA
                     TSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYPFLIANPLASAQIFNFLP
                     KVLVRPFQLTTTGAAPVYRRSWNIFKKGINTHLLSSSLPTYDDVQVKSIVPLVIQNVS
                     YIVSIAEVYFPTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAIPLTGLTYSGS
                     SGSSSGNGSGGDSDGNGNGSGEGTGGNGAEKDNSSNNAALWGSLDAGLTSGFPNHDTV
                     IRFVCMVTVLTAFILCLVGLILVFLKNLYKRTNCAQRMHLTEKNWPEIPTFYSHHMNG
                     STDSPMRNMFYSGSQFSDSDTTEEDSHSAEYIDDDLIITGENTVYSISQGITYYVDED
                     GNFFFAGVGKDVHTSEPEKLEKIIHDKTETVTVEPILPYYNEKDDDLTDETEPFDMGE
                     LEVDEDGNIALPESDLENTILQVASDREEIRSRSPIGTNDGSYLQHQIPNIFPSVTSN
                     SAHVNSDTMATAVTQTLLSSNGSGGILDLTGNNGTYDEYLYDATQDEIDDPPIITNSG
                     LEEFSSGHISSIDLDDEIDIDIEDYDDDVSDVNVGDYDEFDEEMYRHLSRSDILQNFG
                     SGSSTGLASRLASLQGTSTDSGTSFNMHNVGSYIGAHTSTLSSNGRNPSDNSYGGVPP
                     KRPERSSLVFDFNGLYDETPLLNRSASMVSPSQTPEKHTGSKRTSRNLSKEFAAELGI
                     TEEQLKTMERHPSAVPSYNSQSRTSNKK"
     gene            complement(<167886..>169823)
                     /locus_tag="KLLA0_A01848g"
                     /db_xref="GeneID:2896756"
     mRNA            complement(<167886..>169823)
                     /locus_tag="KLLA0_A01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451081.1"
                     /db_xref="GeneID:2896756"
     CDS             complement(167886..169823)
                     /locus_tag="KLLA0_A01848g"
                     /note="similar to uniprot|Q04049 YDR419W Saccharomyces
                     cerevisiae RAD30 DNA polymerase eta involved in the
                     predominantly error-free bypass replication of DNA
                     lesions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451081.1"
                     /db_xref="GeneID:2896756"
                     /db_xref="GOA:Q6CYA8"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA8"
                     /translation="MSKYRWRDLIDLNDKEKSFLSPLACIAHIDVNAFFAQVEQVRCG
                     FSRDDPVVAVQWTSILAVSYAARKYNVSRMESILDAIKKCDKIIPIHTAVFRKGEDYW
                     QYHDGCGSWVEDESKKLSPTNYKVALEPYRRESRKLIKLFQDEYDLVEKASVDEAFIE
                     LGRKLFYELLMDDSYTDFADIRGIFQDGRYDLNDHLPSLPTKLSIQFSGEVFNSQNRP
                     LFEDWDDVLMCLASNSTNTIRNQIDDMLGYTTSCGISMTKNLSKLASNYKKPNAQTIV
                     KNNCIDDFLDCGKFEINSFWTLGGIRGKELIDLMELPKEHSIKFIRDSWPVSSDDIRK
                     FMLKKIICRDIQRSREYNINEADVAKISAKIYQLVRGQFRLPVEPRPLPKSMMSKKNL
                     RNDDCASVIDCIEWLEIFCSELNYRVHDLEQEYEKVIMPRTIVIMIKGKAGMKYTQTR
                     RITTASSSITSRELFINATKLINEIDKQHGKLAGVYPLRELSLTLSNFDIIDKGKTVL
                     DMFGNRAISKSSSTDNNVVKIEGEDIHSDSKGGPYDASVSETLEGEPPSASSPPTMAE
                     NLTCKQCGETLQDKKLFQEHVDYHLSVQLSEQINGVSENSTMLTHAERILLFGKKAKK
                     NAASVQKPKKKDGGIMKFFKK"
     gene            complement(<170104..>170985)
                     /locus_tag="KLLA0_A01870g"
                     /db_xref="GeneID:2896366"
     mRNA            complement(<170104..>170985)
                     /locus_tag="KLLA0_A01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451082.1"
                     /db_xref="GeneID:2896366"
     CDS             complement(170104..170985)
                     /locus_tag="KLLA0_A01870g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451082.1"
                     /db_xref="GeneID:2896366"
                     /db_xref="GOA:Q6CYA7"
                     /db_xref="InterPro:IPR000582"
                     /db_xref="InterPro:IPR014352"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA7"
                     /translation="MPLPLQESTMSDDSVDRVFEKAIVTIQTLSSQKGYHSLPRPPAN
                     VRIQLYALFKQSTEGDVSHILDKPDGNPTSPDYNLALRKWEAWKSKEGLSKTEAKRAY
                     IELLIHTMKTYAMGTIVARELLSELEFMWWQISHSNTFDGNEGPEYQDETNSVLMLTN
                     DNDMDNGSEKIRREVYETLATLRPNSIQNGISLAPIGSGLSDKSEEFYAIWITLKRIL
                     TKLLTISRGIVTYLGKRIMSQSLILLFMLFVVKYSDKSIDLALDKVDSRHSSWISKLI
                     QLLSQFTGISKVSLQVQ"
     gene            complement(<172232..>172729)
                     /locus_tag="KLLA0_A01903g"
                     /db_xref="GeneID:2896418"
     mRNA            complement(<172232..>172729)
                     /locus_tag="KLLA0_A01903g"
                     /product="60S ribosomal protein L12"
                     /transcript_id="XM_451084.1"
                     /db_xref="GeneID:2896418"
     CDS             complement(172232..172729)
                     /locus_tag="KLLA0_A01903g"
                     /note="highly similar to uniprot|P17079 YEL054C
                     Saccharomyces cerevisiae RPL12A or uniprot|P17079
                     Saccharomyces cerevisiae YDR418w RPL12A Protein component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L12"
                     /protein_id="XP_451084.1"
                     /db_xref="GeneID:2896418"
                     /db_xref="GOA:Q6CYA5"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="InterPro:IPR020785"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA5"
                     /translation="MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKDKNVKHSG
                     NLQLEDIIEVAKQMREKSFGKNLASVTKEILGTAQSVGCRVNYKNPHDIIEAINAGEI
                     EIPEN"
     gene            complement(<173617..>175977)
                     /locus_tag="KLLA0_A01925g"
                     /db_xref="GeneID:2896466"
     mRNA            complement(<173617..>175977)
                     /locus_tag="KLLA0_A01925g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451085.1"
                     /db_xref="GeneID:2896466"
     CDS             complement(173617..175977)
                     /locus_tag="KLLA0_A01925g"
                     /note="similar to uniprot|Q02197 Saccharomyces cerevisiae
                     YEL053C MAK10 Non-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451085.1"
                     /db_xref="GeneID:2896466"
                     /db_xref="InterPro:IPR007244"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA4"
                     /translation="MVVENNIAELANLTLDHRMDPKNEAQFIDITDHLKALAAKLAPE
                     TVVKEATFNLFEGTYALEVCNVKLDTSLIELCPEELEFDCNVPYGDSNNGERLDYVTA
                     VCDRLCRSLMNWLHDYQTLPTTVLSCRYVEFLMELYTSNPVSSLQSFQGLRTRDPLYD
                     QVLCSFVIGVCSFIKFTSKVLKDGGVYEEEDLNCNVMSLDMLSGVDTKEVIDLLNSSL
                     QLLVQSYSESTHLQKLVDLVKHLLHLPNYHYPSCQSSVSSDLLPLQKSLDIISSLVQD
                     DYTTKQHSYPPGCFSKGIQKRRDNNFPPKDLFEPKGDEYVSYTEFMRDIIAALSVKDC
                     NTAFEIRQYVWFFNRIRQRTVMARALLQSYLIREDTILDKFRFNTFKDMHLYEFSLAG
                     TALYDVISSREQTTDRDNMIEALNELSYCLLRWYQNMPQNSCRHRQGFNRLLLDWDSV
                     QAQFEQYETQWQSMGIVDSITNMGNIPLMPVSTWIYTTKLLMMIEFTLEGFHLEVYKP
                     WESFTQYWFCYYLSSHLESNLKRLHEFLLQKISYILNYNKRIKKLKAGEKKENAKARY
                     RHLTDNVLPQLRLNERTVNFFFMKCTIFKSLSLAQVFQFALLKSFNVIDSKNDVSTRF
                     SSDRLIHKLRFKTFSSIGIPEIPTFEQFQKSLNDFVIEPPSIHSKIPKLLNFMNTELE
                     SAKSALSTIIQTIETGETDDSPVSTGTKHVKEPALQWYKSMLNSTVALSVNASVLKTK
                     LSEDLKSHDLHATYDVELKFTPNGCYYFPLLTISPKKARNALPHTT"
     gene            <176815..>178338
                     /locus_tag="KLLA0_A01947g"
                     /db_xref="GeneID:2896478"
     mRNA            <176815..>178338
                     /locus_tag="KLLA0_A01947g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451086.1"
                     /db_xref="GeneID:2896478"
     CDS             176815..178338
                     /locus_tag="KLLA0_A01947g"
                     /note="similar to uniprot|P32317 YEL052W Saccharomyces
                     cerevisiae AFG1 Putative ATPase of the CDC48/PAS1/SEC18
                     (AAA) family localized to mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451086.1"
                     /db_xref="GeneID:2896478"
                     /db_xref="GOA:Q6CYA3"
                     /db_xref="InterPro:IPR005654"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA3"
                     /translation="MLIFSQGCKKVLVSRVGSGLVERPGYTFGLFQQVLAQRWVSQSA
                     DVTETPLSKYDELVKLGKLRDDPYQRSIIKSLGHLHDSLVSYNPEPVQPPSVLDQVGW
                     KTGFLGKLFARKEKYSTEGVPKGIYLYGDVGCGKTMLMELFYLTVPPALSKKRIHFHQ
                     FMQYVHKRSHDIISEQNFDALGEAKGRDIDPIPFLAAEIANTSRVLCFDEFQVTDVAD
                     AMILRRLITTLLSKEYGVVLFATSNRKPDDLYINGVQRESFVPCIELIKERTEVVLLD
                     SPTDYRKIPRPISSVYYYPSHNLSYFSKECELARKLHVQQWYSYFAQLHRPSKSENGH
                     DIVYNYPLTIWGRQLLVPKCTPGRVAQFTFKQLCGEPLAAGDYLTLANSFKSFVVTDL
                     PYLTIYVRDEVRRFITFLDAVYDNGGKLATTGADDFTSLFVEPEDIVNDYELKPADQM
                     KHEDEPEVEDELVSKHGFSKDIAKKAQIFALDEERFAFARALSRLSHMSSTDWVEKQ"
     gene            complement(<178458..>180854)
                     /locus_tag="KLLA0_A01969g"
                     /db_xref="GeneID:2896491"
     mRNA            complement(<178458..>180854)
                     /locus_tag="KLLA0_A01969g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451087.1"
                     /db_xref="GeneID:2896491"
     CDS             complement(178458..180854)
                     /locus_tag="KLLA0_A01969g"
                     /note="similar to uniprot|Q04048 Saccharomyces cerevisiae
                     YDR416w SYF1 synthetic lethal with CDC40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451087.1"
                     /db_xref="GeneID:2896491"
                     /db_xref="GOA:Q6CYA2"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /translation="MEIDKFVKEEDIPFEYGVVRERDNAVSWSRYLATKRSAGDELNL
                     DWLYERCLKEIKDDWHLWKEFLKWRIELLNDCDIFRHKDEYNKISLLFEQCLTSCGKV
                     GDAWIMYMEWVIQFKDLKRIRELLGKALRSMSWEYHEAIWRVVIDFIINELLIDNKRY
                     ELSLEDSIYYFVHGEHSTNFDTDLWSSSILQRYSLICDDIEPLLIYIFKTHDWSTIVR
                     VFEKHLSPNLKPSQTSLFELYVSYITSMILVDNSAGVAAVVDQCIELFPFKKGELKTY
                     LIFNLIRQGKITEAELYLEKVISETKDIIEFSVLYDFWIRMEELLTQELIQKMKDDNS
                     EKQRLFANIRLHADTLTSLIKNHTIRLNDLELRREPNNIKLWLERVKLFDTISDKAKV
                     YADAVLTVDYRLQTTPGLLGELWCQYCRLFEEDIEKSEVLLDKATNVPFKFLVDLENV
                     WLYWCEYRLKRSIDDAIKVLSVVLEIPDNHELLLQKFEKGESPAQAAIFSSKRLWAMY
                     LDLLEVKGNYGTAVNAYETAILIKAATPAMFINYALLNESSGHQAEALAVFERSVEIF
                     PPSVSKSIWDIYLDVALKADITKEQKRDIFESAIKLAASGVACVSFFEKYSDFELNLG
                     FHERSVEILHKGAKNISDLESKCTLWEECINRSEKQLDVNHTRKLYEECIETLPNSKA
                     IKFLLPFAILEESRNEVARCRALLDYGSKLLKPAQNEELWDFWRNFETMHGTKDSFKN
                     MLKARRFLEDTMKVNTEEVSRHADSIEFRASTAKISGSGPPSAEDKGYSNTAEIDLGL
                     "
     gene            <181274..>182104
                     /locus_tag="KLLA0_A01991g"
                     /db_xref="GeneID:2896714"
     mRNA            <181274..>182104
                     /locus_tag="KLLA0_A01991g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451088.1"
                     /db_xref="GeneID:2896714"
     CDS             181274..182104
                     /locus_tag="KLLA0_A01991g"
                     /note="highly similar to uniprot|P32610 YEL051W
                     Saccharomyces cerevisiae VMA8 vacuolar ATPase V1 domain
                     subunit D"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451088.1"
                     /db_xref="GeneID:2896714"
                     /db_xref="GOA:Q6CYA1"
                     /db_xref="InterPro:IPR002699"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA1"
                     /translation="MSSNREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFR
                     DITKRIDDSKQKMGRVMQTAAFSLAEVTYATGENIGYQVQENVANARFKVRATQENVS
                     GVYLPQFESFIDSNINDFKMTGLGRGGQQVQRAKEIYSRAVETLVELASLQTAFIILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQIQTAQLD
                     AEMKQKKLDEANAESEGKPDSQEATKTGVEAADTQEQEEQSGPQVEALITEQEEDVIF
                     "
     gene            <182326..>183447
                     /locus_tag="KLLA0_A02013g"
                     /db_xref="GeneID:2896471"
     mRNA            <182326..>183447
                     /locus_tag="KLLA0_A02013g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451089.1"
                     /db_xref="GeneID:2896471"
     CDS             182326..183447
                     /locus_tag="KLLA0_A02013g"
                     /note="similar to uniprot|Q04033 Saccharomyces cerevisiae
                     YDR415C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451089.1"
                     /db_xref="GeneID:2896471"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:Q6CYA0"
                     /translation="MKFGWFLLAASVAALPFDSLHVLEIEEGKTIMVRETEKWSLKRK
                     GVQFMDITNFPKLLKSKDEKAVVPVYRYPKETQCDEIVNSLSKGVDKVSMHDNLAKFT
                     SFYTRYYKSDTGYESAVWLSEKLSNITSPLNNDVVIEHVQHKGWKQFSIIVSIKGAQT
                     PENIVVMGSHQDSMNLLLPSILAAPGADDDGSGTVTNLEALRLYVEHLSTTGYRPNNT
                     IEFHFYSAEEGGLLGSLDVFTRYAEENKKVVAMLQQDMTGYVEDPENEHVGVITDYTT
                     PGLTEFIKLIIRRFLDIPYVETECGYACSDHGSATKNGFPASFVIESEFNKSNKYIHS
                     TMDTLDRLSFDHMAQHVRLVVGSLFELGNWEFKLEEETK"
     gene            complement(<183620..>184825)
                     /locus_tag="KLLA0_A02035g"
                     /db_xref="GeneID:2896496"
     mRNA            complement(<183620..>184825)
                     /locus_tag="KLLA0_A02035g"
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /transcript_id="XM_451090.1"
                     /db_xref="GeneID:2896496"
     CDS             complement(183620..184825)
                     /locus_tag="KLLA0_A02035g"
                     /note="similar to uniprot|P32611 YEL050C Saccharomyces
                     cerevisiae RML2 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein RML2"
                     /protein_id="XP_451090.1"
                     /db_xref="GeneID:2896496"
                     /db_xref="GOA:Q6CY99"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR005880"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:Q6CY99"
                     /translation="MFKQFNLRCLTPLASGVSSRVQVPWNVSMIMSLNNTSLGGIRSM
                     ASITPTGNEEQSSVDDVNVHMLKIVPNNTDVVALEKQDELLRRRRKLAKEVTQMKKLK
                     PVSPGLRWYRAPIYPYLHKGRPVKSLTLAKRGNGGRNHSGKITVRHRGGGHKRRLRTV
                     DFSRFESGMQTVERIEYDPGRSAHIALIKHNDTGALSYILACDGLRAGDTIESYRKGI
                     PPSFLKEMGGKIDPAILSVRTAQRGNCLPISMIPIGSIVHNIGITPTGPGKFCRAAGS
                     YARILSKIPEKNKAVVRLQSGEHRYVSLEAAATMGVVSNIDHQNRSLGKAGRSRWLGI
                     RPTVRGVAMNKCDHPHGGGRGKSKSKKLSMSPWGQLAKGYKTRRGKHQNKMKVKDRPR
                     GKAGRKARQ"
     gene            185546..185668
                     /gene="SNR67"
                     /locus_tag="KLLA0_A02042r"
                     /db_xref="GeneID:9487446"
     ncRNA           185546..185668
                     /ncRNA_class="snoRNA"
                     /gene="SNR67"
                     /locus_tag="KLLA0_A02042r"
                     /product="snR67"
                     /note="C/D snoRNA polycistronic Cluster 4 SNR67"
                     /transcript_id="XR_002633555.1"
                     /db_xref="GeneID:9487446"
     gene            185795..185926
                     /gene="SNR53"
                     /locus_tag="KLLA0_A02049r"
                     /db_xref="GeneID:9487459"
     ncRNA           185795..185926
                     /ncRNA_class="snoRNA"
                     /gene="SNR53"
                     /locus_tag="KLLA0_A02049r"
                     /product="snR53"
                     /note="C/D snoRNA polycistronic Cluster 4 SNR53"
                     /transcript_id="XR_002633556.1"
                     /db_xref="GeneID:9487459"
     gene            <186220..>187374
                     /locus_tag="KLLA0_A02057g"
                     /db_xref="GeneID:2896854"
     mRNA            <186220..>187374
                     /locus_tag="KLLA0_A02057g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451091.1"
                     /db_xref="GeneID:2896854"
     CDS             186220..187374
                     /locus_tag="KLLA0_A02057g"
                     /note="uniprot|P41771 Kluyveromyces lactis KLLA0A02057g
                     ERD1 Protein ERD1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451091.1"
                     /db_xref="GeneID:2896854"
                     /db_xref="GOA:P41771"
                     /db_xref="InterPro:IPR004342"
                     /translation="MDAESVEPFLVYLPIPQRVVVLVLLGLWLWTWFLKVSVSYYDVS
                     KVIVSNESTGLPYFNTSTKIHQSSLKLFKSISRVIIPWQLVCIILFQYSFTNNVSNKL
                     LWFFLNVSPLLELFYIFAMILRSSAMVARCFKRILWVADIEPKPYRNNYIIISDTLTS
                     YSKPLVDLAIYATFLFHDPTNVKCQVERYENAISLNIDVLVGVLPSLVRMIQSLREFT
                     RGRSQKKDGSQLFNAFKYAGNIPIMLVTVYTRYYNLGPLGMMYWFMFWNSAYSFWWDV
                     TMDWKLELFDFVNGDTSVNNNNSSNKADGLLRSILLYRKNAWYYSAMALDFILRFVWF
                     WEYISGHSVFYGELNIFWLQILEIIRRWIWLFFKVEVEYIATTEGGKMDE"
     gene            complement(<187421..>188152)
                     /locus_tag="KLLA0_A02079g"
                     /db_xref="GeneID:2896558"
     mRNA            complement(<187421..>188152)
                     /locus_tag="KLLA0_A02079g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451092.1"
                     /db_xref="GeneID:2896558"
     CDS             complement(187421..188152)
                     /locus_tag="KLLA0_A02079g"
                     /note="similar to uniprot|Q04031 YDR412W Saccharomyces
                     cerevisiae RRP17 Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451092.1"
                     /db_xref="GeneID:2896558"
                     /db_xref="InterPro:IPR019186"
                     /db_xref="UniProtKB/TrEMBL:Q6CY97"
                     /translation="MVAKSNREILTGGKSYKQKAAKKFGADEVKFDKDSRLEYLTGFH
                     KRKLDRQKKAKEFIQEQERKARLEERAKIRADKKKALEKQLEDFKQAMKDVGDYVGVE
                     DDDEEAENGKQGSDEEAEEWTGFSDDNGDATEEEEEDSDSVSVKPILKKYVQTYLDDT
                     TVDIEPLEPNDNFEYLAELNNVKLEKSEQILDQSIERAKKYAKFLGVEEKSGNKSKKN
                     KKFRYLTKNERRQNQRKANNNKRRK"
     gene            <188671..>189519
                     /locus_tag="KLLA0_A02101g"
                     /db_xref="GeneID:2896642"
     mRNA            <188671..>189519
                     /locus_tag="KLLA0_A02101g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451093.1"
                     /db_xref="GeneID:2896642"
     CDS             188671..189519
                     /locus_tag="KLLA0_A02101g"
                     /note="similar to uniprot|Q7LIJ5 Saccharomyces cerevisiae
                     YDR411C DFM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451093.1"
                     /db_xref="GeneID:2896642"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:Q6CY96"
                     /translation="MTMRNELIQFVGQIPPVTRGICLLMVLICLIQRLNVLPYYFSDF
                     KWSLRGVLFKFQIWRLFTSFLILPNDAMKACFDLYAVYSKSLHLELVHFSNKSIDYLF
                     YICFNFALIVVLVEACQISYPVFTNAFIGMILYTWTLDNSNVKVMFYGLFPILGKYLS
                     LVHLFVSFLFDDGTDGYSRFCVTMVGFCAGYVYSCLDTWTYGPLYGYLMGKDPAYGFS
                     GRGHFRSPRWFSSIILWIGRVLSITSKPVSSSNRTDPVTRRRLRTPLKKSTFAGTGNR
                     LGTKID"
     gene            <190132..>192165
                     /locus_tag="KLLA0_A02123g"
                     /db_xref="GeneID:2896578"
     mRNA            <190132..>192165
                     /locus_tag="KLLA0_A02123g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451094.1"
                     /db_xref="GeneID:2896578"
     CDS             190132..192165
                     /locus_tag="KLLA0_A02123g"
                     /note="similar to uniprot|P32796 YML042W Saccharomyces
                     cerevisiae CAT2 Carnitine acetyl-CoA transferase present
                     in both mitochondria and peroxisomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451094.1"
                     /db_xref="GeneID:2896578"
                     /db_xref="GOA:Q6CY95"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:Q6CY95"
                     /translation="MRSMAFRSSAGISMGMRRMGQGNKKSSILRQMSGKMQYSGYQKF
                     PFETGTNDEYIAERPNSYYQEKRPGFKGATYSKQQDMPSLPIPELKSTLDKYLKSIKP
                     FCQTDAEYEKQIQLCYSFLSDQGPALQERLLSYSQERRNWMQELWDSQIYLGDRSPVV
                     PFVSYFYGHKPLPTSHRAIDGDMLVKATAIISSVVKFVESLKDEALPAEVVKGKPFCM
                     NGFQYMFNNSRVPQFNIDTNHFYSIYEHGYLTVAYKDNFFKVYTHDKAGAVLSNAVIY
                     QQLNQIVNHLGSQGSLINANAGIGALTTLPRDEWAGAYQQLQLEPVSSSSLETIHKSS
                     FVLCLDQDTAPITLEDKSRVCWHGDGTNRFFDKPLQFFVTGNGFSGFLAEHSKMDGTP
                     TLFLNHYVVDQLTKLNPSAFVESLHSNVSAYPSVNSEHLPFIITPTLRNTIESAKLQF
                     ITTVEREDLRVWHYNRYGKRIVKTFKVSPDAYIQQVIQLAVFKYLKKQLPTYEAASTR
                     AFFQGRTETGRPVTESSSKFVKTWESPTSTTEEKIAAFYDAAKDHVEYLKMASNGEAV
                     DRHFFGLKNMVHESDEPVPLFQDALFKYSSTWLISTSQLSSENFECYGWSQVYDNGFG
                     LAYMINNEFLHINITNKPEASGFSVDELHYYLTKAADEMYETLSLHNSAKAKL"
     gene            <192493..>193242
                     /locus_tag="KLLA0_A02145g"
                     /db_xref="GeneID:2896620"
     mRNA            <192493..>193242
                     /locus_tag="KLLA0_A02145g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451095.1"
                     /db_xref="GeneID:2896620"
     CDS             192493..193242
                     /locus_tag="KLLA0_A02145g"
                     /note="similar to uniprot|Q03433 Saccharomyces cerevisiae
                     YML041C VPS71 Protein of unknown function component of the
                     Swr1p complex that incorporates Htz1p into chromatin
                     required for vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451095.1"
                     /db_xref="GeneID:2896620"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:Q6CY94"
                     /translation="MRSVEEINVRTYNPNIYFSSLNQTHQSARVSKQSQTSARNKRVN
                     YSLADLEAKIYNQPKGSDKDDINQLTGSDKHALPDLLRSNKRFMELDTENYQDLREVT
                     TLLSNITGLNKDKIDQTSTGILSEQQSGSGSSRQRMAKFDLPKSMNLLYKSSKPPRKS
                     KKSSNRISALRKVLSSRRSLHSYLETLDQVNHTLIYSNVQNKKFFRVLPMIVTCSMCG
                     GYSSISNCVVCNDKICSLRCYELHSETRCNN"
     gene            <193623..>194369
                     /locus_tag="KLLA0_A02167g"
                     /db_xref="GeneID:2896574"
     mRNA            <193623..>194369
                     /locus_tag="KLLA0_A02167g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451096.1"
                     /db_xref="GeneID:2896574"
     CDS             193623..194369
                     /locus_tag="KLLA0_A02167g"
                     /note="similar to uniprot|P32584 Saccharomyces cerevisiae
                     YDR410C STE14 Farnesyl cysteine-carboxyl methyltransferase
                     mediates the carboxyl methylation step during C-terminal
                     CAAX motif processing of a-factor and RAS proteins in the
                     endoplasmic reticulum localizes to the ER membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451096.1"
                     /db_xref="GeneID:2896574"
                     /db_xref="GOA:Q6CY93"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:Q6CY93"
                     /translation="MSSRDDESEDVLVIIDGKTFPNIQKNELDEISLTAFMLGVIFGV
                     SLITLCLSPFWNFNIYMISLSIFHLLEFWITAKYNPGKLNTNSFLINNGVGYFLAHSV
                     ALIETIIERLLFPSFKSTTYSFYNEFIVTVGVVLLLLGQYVRSSAMITAGQSFSHVVK
                     VTKNSDHTLVTSGIYSKSRHPSYFGFFWWSVGSQLMLLNPVSLVIFIVVLWKFFNSRI
                     AFEERYLVQFFGNQYITYRETVGVGIPFIK"
     gene            complement(<194500..>196848)
                     /locus_tag="KLLA0_A02189g"
                     /db_xref="GeneID:2896632"
     mRNA            complement(<194500..>196848)
                     /locus_tag="KLLA0_A02189g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451097.1"
                     /db_xref="GeneID:2896632"
     CDS             complement(194500..196848)
                     /locus_tag="KLLA0_A02189g"
                     /note="some similarities with uniprot|Q04195 YDR409W
                     Saccharomyces cerevisiae SIZ1 SUMO ligase that promotes
                     the attachment of sumo (Smt3p small ubiquitin-related
                     modifier) to proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451097.1"
                     /db_xref="GeneID:2896632"
                     /db_xref="GOA:Q6CY92"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:Q6CY92"
                     /translation="MQHLLDDTSIDSVKQEIMLLKVAELKNVCRSIGLPISGRKTELQ
                     DRLSSFLMAPSRAGMNDPFRIPAVNILVKKAGAGDPVPKFETLLHALATGSFMHPVAT
                     GHQDASALIGNNRLAGKPHLRFQQSPFYNLKRLVGSESAPEAPSKRGVANISFKLVEE
                     EMKLLKSSPKIKLYVFCGINNSFGASNDIPIQFPLRNEIKFNGIQIKDNVHGLKNKIG
                     TAKPADLTPYINWPPKSNLLQLVYAFTKDDHMVYVYLVELIETEELLQKTLSSPKIVR
                     PATLQYIKQTLSEEEDEDMMTTSTVMSLQCPISYSRMKYPVKSIHCRHLQCFDAQWFI
                     ESQRQIPTWQCPVCQKQIRIEDLAICEFVQEIISSTDEEVEQVEISKDGSWVIKDETE
                     NHNQEASTAPNIKQEATPDIKPEDSHAVEQHDEHPPPEHVIISLDSDEEDEIEQATSK
                     TNPPNRQSTSQNSDNTSSSTDLNQDNDLLDDEDMAFIEELANSIIDRVPRRSQHENNV
                     TSTSNLNVNGLIDPNTRNEVPERRTSLDPRMNDYDLLNLAAEQPTNFRQMRGRLLSEN
                     NQENSRPPVPNLLGKAPLNTDSHKVGPQLPNMSQLTNADSMLFNGNGQAHPQAPSGSF
                     SDSNSRIVVQPMGSSPRGQTSDKVTQVSIQPTEPPSMGVPVLPPLPTLPVRSTTSTMS
                     PNLPQPPPIHDPRRRKPEVSPFLPKKNFKNVLPKKRAHSNGNAQNVHSEINGNHDSGT
                     LPAPSPISNVQVSPSPAIMNSNNVPPPNDSLNSDDLIDLTSD"
     gene            <197863..>198510
                     /locus_tag="KLLA0_A02211g"
                     /db_xref="GeneID:2896631"
     mRNA            <197863..>198510
                     /locus_tag="KLLA0_A02211g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451098.1"
                     /db_xref="GeneID:2896631"
     CDS             197863..198510
                     /locus_tag="KLLA0_A02211g"
                     /note="similar to uniprot|P04161 YDR408C Saccharomyces
                     cerevisiae ADE8 Phosphoribosyl-glycinamide transformylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451098.1"
                     /db_xref="GeneID:2896631"
                     /db_xref="GOA:Q6CY91"
                     /db_xref="InterPro:IPR001555"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="UniProtKB/TrEMBL:Q6CY91"
                     /translation="MAPKVVVLISGSGSNLQALIDAKKEGKLPIDICRVISSSKKAYG
                     LTRSSDNGIPTIVQSLYSYTKDLSKDDKKGRAEARNKFEADLADLILKDSPDLVVCAG
                     WLLILGPTFLKRLNGLPIINLHPALPGAFDGTTHAIEMAWNKCQEQKRPLIAGCMVHY
                     VIEEVDRGESLVIKELEIVPGKESLEEYGTRVHAAEHVAIVEATIIALKESNKLI"
     gene            complement(<198766..>199554)
                     /locus_tag="KLLA0_A02233g"
                     /db_xref="GeneID:2896710"
     mRNA            complement(<198766..>199554)
                     /locus_tag="KLLA0_A02233g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451099.1"
                     /db_xref="GeneID:2896710"
     CDS             complement(198766..199554)
                     /locus_tag="KLLA0_A02233g"
                     /note="highly similar to uniprot|P25043 YOR157C
                     Saccharomyces cerevisiae PUP1 Endopeptidase with
                     trypsin-like activity that cleaves after basic residues"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451099.1"
                     /db_xref="GeneID:2896710"
                     /db_xref="GOA:Q6CY90"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CY90"
                     /translation="MSGGLSFENYQRNVHLAEKSHKQPNATSTGTTIVGVKFNGGVII
                     AADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISSNIELHSLYTGR
                     EPRVVSSLQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYQSLGSG
                     SLAAMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVDVCVMEVGKDAQLLR
                     NYLCPNVREPKQQSYKFARGTTGVLKESILKVCDIDEETVNITA"
     gene            <199863..>203495
                     /locus_tag="KLLA0_A02255g"
                     /db_xref="GeneID:2896610"
     mRNA            <199863..>203495
                     /locus_tag="KLLA0_A02255g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451100.1"
                     /db_xref="GeneID:2896610"
     CDS             199863..203495
                     /locus_tag="KLLA0_A02255g"
                     /note="similar to uniprot|Q04183 YDR407C Saccharomyces
                     cerevisiae TRS120 Component of the targeting complex
                     (TRAPP) involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451100.1"
                     /db_xref="GeneID:2896610"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:Q6CY89"
                     /translation="MESTIEPCKVRTLVVPVGTWKKDAYLAAVDELERHGEIRLVDVT
                     PLPDCTFNPQLFPHGRVLYSFLTREHDSNSMMFLHDFEPYRKLFVVIGLCNDGLISTE
                     ACVNELRERYGSAISYAVIYNDRSKVVEQSTKYGFSRSEEPLETIMCDITRNFLESLH
                     VYYSSYKHVTLRSPGAIGGPSVLKTTLTKKSQTTAPITNPRSKKGSSLSSKDDSSSSS
                     LSISDDSIKDKSKRYSSLNALSGGTSDKSMQRSKARQLKLLANLQLLAGQYLLSMNNF
                     AEAARILHKIHDYIWLGSSLEGILTCIILISYLQLPFQVPPIIHSLCSLSQNSNSILS
                     PTTSRRSSMQSVASPRNSVSTITAASLDHTNIDIPKLVKKIADKALYYYDYSLSYSVE
                     FTPQVVYCKSILRTLTFMSLCYKANGFDQRALQEMIFSDMSSSAVQNQDSLQDECIFT
                     KSEIYQYSTKIFELQLKSMDLSSQIQIYLTLCMVYDNLNMFRKKSFVLRILFISILSQ
                     LTNDYLSENYHSLIDDLMKNYRISGWEPEHKLQDASSYNWVTLQKNVLMLIIKISAHF
                     KNYKNVVEHSQLLLKRFSHTLTKLEQIDLLNQYILPHQNEYPVEYMDPFLIRDICFSR
                     TRSEEMPMLKVLRDEESRTFNDPHQIFNPFASVHHKTKENETENSNYFLVAETVQMVI
                     TFQNPFKFDVRINSINFTEDDAQFMKIADLDLTSCTIPASSKKQFCVGVTFVRSTLTL
                     HQLKGLSVSVLGLPSKFWGICKQPGKFNTQERCTLYSVPITIIDQQPTLCFLSTTLVD
                     NRVMLLDGTETEFKVFLRNSSLSSPINYCSVSWITNVETELKENYWTSLAPDDLYDVD
                     SQLKWLRENFISISSIPNEVGINESFHFSVNLDVTKAPFTLKWARITIQYGYKKSPED
                     LAVYVKSLTIPIEITLQRVLEVSNVNFIPIPEAFEAASDIGWIKYLRSHQSVQSDYVL
                     MLIDMRNSWLLPVSFSFHYDEYVSERESLDSNETRRFVVPIRKIANYDDSPNFKDKLI
                     PRIDESKQYLTSGLTLTQENEMREKFWCREHILNRLKCTWDTALNEHTEGSVEFRQFV
                     EKLDKQVISLVYPPSNVFDIKVSASETTVKVGTPVRLNVTVNTTLHTDLVPIRYYILD
                     YFTGKSVLSDHPKSIVFQGQTSTLVRPRITTEFNILPLKKAKFQIEIEVPGNILTREP
                     IIITAG"
     gene            <203818..>204732
                     /locus_tag="KLLA0_A02277g"
                     /db_xref="GeneID:2896687"
     mRNA            <203818..>204732
                     /locus_tag="KLLA0_A02277g"
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /transcript_id="XM_451101.1"
                     /db_xref="GeneID:2896687"
     CDS             203818..204732
                     /locus_tag="KLLA0_A02277g"
                     /note="similar to uniprot|P17558 Saccharomyces cerevisiae
                     YOR158W PET123 Mitochondrial ribosomal protein of the
                     small subunit PET123 exhibits genetic interactions with
                     PET122 which encodes a COX3 mRNA-specific translational
                     activator"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein PET123"
                     /protein_id="XP_451101.1"
                     /db_xref="GeneID:2896687"
                     /db_xref="UniProtKB/TrEMBL:Q6CY88"
                     /translation="MGKGAAKYGYKSGILPSTRRILKNPTVNQTGILERVKEAKPKGI
                     NGVGYAKGIKHPKGSHRNPPPLKFIDVEEVIYNTVKPKSENTTAASEQQLLKQNQAEL
                     RRKYLSESLRNEEQRLLKQEELLKKKERVLQEQREAELKELNKERSSNLTIPTLEGIM
                     NQPLMRQRTAEEQEILDLKRKHNKELIEFKAKERKLANLVQLCHAADHFIVTEEQLVA
                     SVEKAFASDNQDVLRNKLSLSTSQQTARNEGEISDALFGTLGNGKYVGLPIVKEFLSG
                     EMEQFNQEINTKLDELTKQAEERKDSVL"
     gene            complement(<205013..>205294)
                     /locus_tag="KLLA0_A02299g"
                     /db_xref="GeneID:2896689"
     mRNA            complement(<205013..>205294)
                     /locus_tag="KLLA0_A02299g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451102.1"
                     /db_xref="GeneID:2896689"
     CDS             complement(205013..205294)
                     /locus_tag="KLLA0_A02299g"
                     /note="similar to uniprot|Q12330 YOR159C Saccharomyces
                     cerevisiae SME1 Required for pre-mRNA splicing, cap
                     modification and U1 U2 U4 and U5 snRNA stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451102.1"
                     /db_xref="GeneID:2896689"
                     /db_xref="GOA:Q6CY87"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:Q6CY87"
                     /translation="MSGSKVGAPMVPPINCIYNYLHHQTTVTFWLYEQVQTRIRGKIR
                     GFDEFMNVVIDDAFEIAVDPKSGKESDDKAVFLGRIMLKGDNITLVVAN"
     gene            <205567..>208452
                     /locus_tag="KLLA0_A02321g"
                     /db_xref="GeneID:2896817"
     mRNA            <205567..>208452
                     /locus_tag="KLLA0_A02321g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451103.1"
                     /db_xref="GeneID:2896817"
     CDS             205567..208452
                     /locus_tag="KLLA0_A02321g"
                     /note="similar to uniprot|Q99189 Saccharomyces cerevisiae
                     YOR160W MTR10 Nuclear import receptor mediates the nuclear
                     localization of proteins involved in mRNA-nucleus export"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451103.1"
                     /db_xref="GeneID:2896817"
                     /db_xref="GOA:Q6CY86"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CY86"
                     /translation="MLYQIPDIKSALICTQSVSEQEKKIQALQFLEQFQKSIEAWQIC
                     FEVLSKHEADNLQLQMFACQTLVNKVTYDLNQVNTELESFKGKLFEFIAMYEEKIIVT
                     QLNVALARFTIQYLDWRNPLVEIINTLNGLPGKLLLFLKILPEETLDIKSTPLSQDEF
                     ECRTHELIDNIGEDVLKFLISCLDRVGTEGISASKIISCFGSWCYEFPIEQVLQVTPL
                     INTVFQVLHTSYDTDSDSFEAAVECLCVLLRETRDAANDTIIHALYEQLLALQQKLLP
                     ITTISDWEEYEEIMDPLTRLFVEAGEAWCVFLAKNPALFKPLVEVILVLTCKNTDLDI
                     VSYTFPFWFNLRQMLVLQRYAQQRKEYQDVFINLTNGLITHLHYPETVFENKEDEDKF
                     KDFRYNIGDVLKSCAAVLGSTVALQQPYNLINQYLQKEDPNTVWQPLEAALFAVRTMA
                     HEISHTENVVLPQLFKQLCIHPLTHPKLVYSTILVFSRYTEWTSKHEDLLEIQLNYIF
                     NGFEAGQSNHDLSVAASNALMYFCQDCSSLLVNYCGQLVDFIWKIERAVDNYSMFEMC
                     QGLSSVINEQETAKIGGIFNSFTSQHNKRFDIIIQQFISNPSDPDLSAKVAHYIDLLY
                     AILENIVPKFEYPEQGVEEPLIASISEHITKLINLLDAYAISNVIIVDRTMKFFRRVF
                     EKYHLFTQPILPAVSEFVAKGYSTSGLGAYLWFSGSIIYVYGDDEYYPVDVQVKEAVW
                     QFACQQCSTFFNNFKSMQTLDKFFEMVHDFFLMCNDLLMFFPEHMMNTPVLISSLIQW
                     DLESLPKLDNFEAYMTLIRFLDDLSSWGFKTPPISVTSITEVPDAWRCTILEQVVSKN
                     GSNIVTALINGLVTNFDSRAHQEIISLIVKIFRLATENNNNDPSVCLEWLDSALRKMG
                     TIESNERSKLMSIGNALIQRDYRRCRGNIKDFIDWYLRKHISSRMYT"
     gene            complement(<208673..>210334)
                     /locus_tag="KLLA0_A02343g"
                     /db_xref="GeneID:2896692"
     mRNA            complement(<208673..>210334)
                     /locus_tag="KLLA0_A02343g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451104.1"
                     /db_xref="GeneID:2896692"
     CDS             complement(208673..210334)
                     /locus_tag="KLLA0_A02343g"
                     /note="similar to uniprot|Q12412 YOR161C Saccharomyces
                     cerevisiae PNS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451104.1"
                     /db_xref="GeneID:2896692"
                     /db_xref="GOA:Q6CY85"
                     /db_xref="InterPro:IPR007603"
                     /translation="MFGEGNKPTEPVPAYDAGQDPFQGPNASKNQYQGSAADYNGAPP
                     PPASQPGNQYQFRQDQYYNLNAEGEGAPIGSFEEKFPVEGEDSKPKWNDWPFTIFFAG
                     CVIAFIVVAAITLRAWSQNSSSQGSGVYDGANTGTLTTNSAIMLAISCIIAFVFSIIG
                     IVLARMFPKFFIIAGILFNIIAGLATAIMYLSLKYYSAGIVFLVFTAICALFYWRMRH
                     RIPFTVAVLKTVMDVMKSYPQTWFVTLIGSIIATAFSILFSAVIVATYMKYDDKANNP
                     GCSTNGGSCSNAKLIGLLVLVFFCGYYIAEVIRNVIHCTVSGIFGAWYYFSKSDQGMP
                     KWPGFGALKRSLTYSFGSICFGSLIVTIIETLKAVLRLAVDGVMGGGGADNGWMQCLA
                     LIANWIFSFLEWLARYFNHYAYVFIALYGKPYLRAAKETWYMLREKGIDALINDNLVN
                     VALSFFTLFTCYITTLFAYLYLRYTDPNYNDNNNFTPALMAFAFVIAMEICNVITETI
                     RSGTATFFVALGNDPEVFHLSYPERFDEIFRAYPEVLKKLSHQNV"
     gene            <211300..>212568
                     /locus_tag="KLLA0_A02365g"
                     /db_xref="GeneID:2896792"
     mRNA            <211300..>212568
                     /locus_tag="KLLA0_A02365g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451105.1"
                     /db_xref="GeneID:2896792"
     CDS             211300..212568
                     /locus_tag="KLLA0_A02365g"
                     /note="similar to uniprot|Q99312 YOR155C Saccharomyces
                     cerevisiae ISN1 Inosine 5'-monophosphate (IMP)-specific
                     5'-nucleotidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451105.1"
                     /db_xref="GeneID:2896792"
                     /db_xref="GOA:Q6CY84"
                     /db_xref="InterPro:IPR009453"
                     /db_xref="InterPro:IPR023214"
                     /translation="MSSRYRVEYNLKVHKKDAFIEWIKGLLAVPFVLQAGTDSGAERT
                     YKQYCSIFSDIENLVSQKIEIQNRRRQLGSLEEARLDQLVPQVGTFFTHLPLVEAFEV
                     QNRRRAICSRKMVSPSFNDIRHILNSAQILALLKSKELKLVTFDGDVTLYEDGGSIER
                     GGKIVTRIITLLKRGINVGVVTAAGYDDPDKYKERLYGLCFALFSDKSMSLEQKSKLT
                     VMGGESNYLFQYFETSEQFGFKSIDDDEWVPSSVKAWSDDDIDATLDVAQTCFGELSH
                     LLALPSKCQIIRKKRAVGFVPGFIFDDELEVNVKIKIPREALEEMVLVVQKKLESYPP
                     AQNIQFSCFDGGSDVWCDIGGKDLGVSILQNFYQTDSPITAAQTLHIGDQFAPKGSAN
                     DFKARSAGCTLWISSPRETIEVLDDLLPYL"
     gene            <213276..>213779
                     /locus_tag="KLLA0_A02387g"
                     /db_xref="GeneID:2896789"
     mRNA            <213276..>213779
                     /locus_tag="KLLA0_A02387g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451106.1"
                     /db_xref="GeneID:2896789"
     CDS             213276..213779
                     /locus_tag="KLLA0_A02387g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451106.1"
                     /db_xref="GeneID:2896789"
                     /db_xref="UniProtKB/TrEMBL:Q6CY83"
                     /translation="MYPILLRYWCSVALFKALRPVWYFIPFGFVIFPLGLLSLSKEAY
                     LQLKIYQLQKSELDSRTVASAFLSRYNWFWNSAPVLNTDKYIFGDLSLRIASLLETLS
                     LLPEIMEPLYGSIESLVNFTSTNSAKMTESRQDKADKKSESSFYKDYDLLEDILFEFK
                     TNTPEGT"
     gene            complement(214096..214177)
                     /locus_tag="KLLA0_A02409r"
                     /db_xref="GeneID:2896566"
     tRNA            complement(214096..214177)
                     /locus_tag="KLLA0_A02409r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2896566"
     gene            complement(<214580..>215095)
                     /locus_tag="KLLA0_A02431g"
                     /db_xref="GeneID:2896794"
     mRNA            complement(<214580..>215095)
                     /locus_tag="KLLA0_A02431g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451107.1"
                     /db_xref="GeneID:2896794"
     CDS             complement(214580..215095)
                     /locus_tag="KLLA0_A02431g"
                     /note="weakly similar to uniprot|Q2ZX20 Shewanella
                     putrefaciens CN-32 Sputcn32DRAFT_3504 Hypothetical
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451107.1"
                     /db_xref="GeneID:2896794"
                     /db_xref="InterPro:IPR025409"
                     /db_xref="UniProtKB/TrEMBL:Q6CY82"
                     /translation="MDIDWESAHHELLQFLIHEVKEYLSFDPNSTFYALALDIEFDHL
                     RVSIALNTIAKHERILKQYYLGDETNSEEKFDIKYNTGDWEDGIFANKFLVDSETFDN
                     FTRVASDEQVESVNAKFRATAWSVLKKFVDTNEYESIPKVRPFVAFVIDHDEEVEDAL
                     RLAKEAGTSEL"
     gene            complement(<215305..>216177)
                     /locus_tag="KLLA0_A02453g"
                     /db_xref="GeneID:2896851"
     mRNA            complement(<215305..>216177)
                     /locus_tag="KLLA0_A02453g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451108.1"
                     /db_xref="GeneID:2896851"
     CDS             complement(215305..216177)
                     /locus_tag="KLLA0_A02453g"
                     /note="similar to uniprot|P49954 Saccharomyces cerevisiae
                     YLR351C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451108.1"
                     /db_xref="GeneID:2896851"
                     /db_xref="GOA:Q6CY81"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:Q6CY81"
                     /translation="MSAVLKSKLKVALVQLAGSSPDKSANLSRAAQFVAKAMDAQPDT
                     KLVVLPEFFNAPYAVDKFREYAEVITPDATSVKALSEIARKWKVTLVGGSIPELEPST
                     DKIYNTSLIFNEDGEIIGTHRKAHLFDIDIPNGITFKESVTLSGGNKNTLIDDPKIGK
                     FGVGICYDMRFPELAMVSARKGAFAMIYPSAFNTTTGPMHWHLLARSRSIDNEIYTIL
                     CSPARSGGSGYQAYGHSLVVNPRGEIIAEAGEGEEIVYAELDPQLIKEVRQAIPVTFQ
                     RRFDIYPDVSKTDK"
     gene            complement(<216566..>217687)
                     /locus_tag="KLLA0_A02475g"
                     /db_xref="GeneID:2896688"
     mRNA            complement(<216566..>217687)
                     /locus_tag="KLLA0_A02475g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451109.1"
                     /db_xref="GeneID:2896688"
     CDS             complement(216566..217687)
                     /locus_tag="KLLA0_A02475g"
                     /note="similar to uniprot|Q9HGY3 Candida boidinii DAO1
                     D-amino acid oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451109.1"
                     /db_xref="GeneID:2896688"
                     /db_xref="GOA:Q6CY80"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:Q6CY80"
                     /translation="MSNKSQPLITVVGAGISGLYVTYCLTELYGVPGENICIVADYLP
                     GDQSPTGYTSPWAGGVWSCISPDDKNVMWYDRFTYENLPTLSEKLLDFYKGKDAEWLG
                     LARRPSTELWDYQPPKAKINSLSQYLEEYKVLSKEELAKFKPEGAQFGIAFNSWNFNC
                     PVFIVNLANFLKQKHNVRFLKQKLTHIAQAKSFANKASKTDNGTHVVFNCTGLGSKKL
                     SGVADHNLYPTRGQVAVISAPHIAESCLRYGKDYVTYIIPRPGKVHELVLGGFLQVDN
                     WNAQDTSKEETDDILKRTTTLLPKIGNPENLPILKIAAGLRPSRYGGPRVEKEIKEES
                     EHLVVVHNYGASGYGYQSGLGMAFKAVSLAFDKQRPSKL"
     gene            <218592..>219680
                     /locus_tag="KLLA0_A02497g"
                     /db_xref="GeneID:2896550"
     mRNA            <218592..>219680
                     /locus_tag="KLLA0_A02497g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451110.1"
                     /db_xref="GeneID:2896550"
     CDS             218592..219680
                     /locus_tag="KLLA0_A02497g"
                     /note="highly similar to uniprot|P14681 Saccharomyces
                     cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
                     (MAPK) involved in signal transduction pathways that
                     control filamentous growth and pheromone response"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451110.1"
                     /db_xref="GeneID:2896550"
                     /db_xref="GOA:Q6CY79"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CY79"
                     /translation="MPRTITYDIPSHYQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKI
                     QPFSRSMFVTRTLRELKLLKFFHSHENIISVLDIVRPTSWHKFEAVYLVQELMETDLQ
                     KIINQQNLSEDHIQYFVYQILRALKSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLA
                     RCLASSDQSRENMVGFMTEYVATRWYRAPEIMLSFQEYTTAMDIWSCGCILAEMIMGK
                     PLFPGKDYHHQLWIILEVLGSPTLEDFEQIKSKRAKEYISQLPMKKGIPWANVLNKEV
                     NPLAIDLLSKMLTFNPDKRISAVEALEHPYLATYHDPDDEPDYPQLNLEDNFWKIDNE
                     ARDKNEEDDIPLELLKKMLYGEVMKPLN"
     gene            <220146..>222500
                     /locus_tag="KLLA0_A02519g"
                     /db_xref="GeneID:2896348"
     mRNA            <220146..>222500
                     /locus_tag="KLLA0_A02519g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451111.1"
                     /db_xref="GeneID:2896348"
     CDS             220146..222500
                     /locus_tag="KLLA0_A02519g"
                     /note="similar to uniprot|Q06479 Saccharomyces cerevisiae
                     YLR352W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451111.1"
                     /db_xref="GeneID:2896348"
                     /db_xref="UniProtKB/TrEMBL:Q6CY78"
                     /translation="MISETSTMRLPSEIVYEILSYQFKDLMSNDHSATSEKYHSNIKT
                     FLGSNSTVNRTFHHVCRVLIYRYLNFTTARSFHKLLNTLKEDDPGLRKLVEVADFQEL
                     TSIGLGRTGEMNRMIKNLTNETLWEFLLLTKNTLREFLASEHIQGDIDERIVHFLLSP
                     GTVLSVVDFCGCSGSVFTKQFVTAVEKMAAHPSSRENFQITCLGLNDCTDIPDNTLSK
                     LLNLLPELQKLDLTHTAIDDGTLINNLPHWKNLTHLSFGECLQLTPRGILEFFSYHPA
                     VTDENNNSTLQWLNVQVHPHTSTWTDTQTLFLLKKLCQYGHNKTLEYLNIGGLPLHYS
                     DDRTLIKTPHYYQCHDSLQFIKLNFPALKSLNIKDTNVPYDRIIQFLSPVHDSDIEVE
                     QKLKFLNISNNSYINRWTIQDPALFTCSDSLVSLELSFDSWQQIENLNDRHELNCFKN
                     KTGRTSIIQDIKNMESVKWKCYIDSSYGRRYWLYKCDPYLNRENIDQAASLTRYDSDG
                     RKIIEIVKQPDFLKFAQNKIMLGCGIVPMNSARRRLIYKDMKPPISRFFNRDGRFATP
                     GTHAMPILSPRLPPGGWRLIRNDDEDTTTEDDASTIEENSPIIHNSFQSLTSIPETRP
                     PLVRENTRDAIYWDRSATSADPTLTESEYENAETDYDYLNDPELQRRRSQMSLFNSYH
                     RSSSKNNLNNNNNGNTSNLTNAFKQHSQSQSQSQTSLPHYLSTPSSEHYKKNDKNKLS
                     ADYVYDPNEPEMNKRYRIHYEQLQEYKVFGTVERGMYRYYSLKT"
     gene            <223318..>224913
                     /locus_tag="KLLA0_A02541g"
                     /db_xref="GeneID:2896539"
     mRNA            <223318..>224913
                     /locus_tag="KLLA0_A02541g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451112.1"
                     /db_xref="GeneID:2896539"
     CDS             223318..224913
                     /locus_tag="KLLA0_A02541g"
                     /note="some similarities with uniprot|P41698 Saccharomyces
                     cerevisiae YLR353W BUD8 Protein involved in bud-site
                     selection diploid mutants display a unipolar budding
                     pattern instead of the wild-type bipolar pattern and bud
                     at the proximal pole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451112.1"
                     /db_xref="GeneID:2896539"
                     /db_xref="UniProtKB/TrEMBL:Q6CY77"
                     /translation="MVSLSENEDVSSSSGGSVEDEILRRPLRQDSFFKEEHLISTGSR
                     TGTEFSVILNDTYIPESSDESKDRSISMEGPSVAYSKVSHSFSNSNSNSNSSTSSKQR
                     KLANNRNSQYMRLSLNSTSSGSAHSTPLIGVNLQSDKFSSANTSRDTVNTEALLDPRR
                     SFSNTPLVHSTQTESPQLSTSNDVGNATFPQDSSRDNAENMKRSSKAVSTPALGSSDQ
                     VLDERIVEETESDETSDKKNRTSSFYPAHTESLQADETHDIIDDYEYGDTKPAIEEAV
                     KLFKMEARRANLLELNHGDNKNLHRRQTSLLSSILVPPPKSASKSSPAEGNSQEPKTL
                     IPALRKVSGSSTPTARQGQFQPYEEQTANVNPFIAPIPAQPTSVPIEREISNHDYESD
                     ALHYIRASRKRLDEFNDMERNLPMQRVDVSSVNSEKSKISAWSQFSDLFSITRLLCLF
                     LTCLIVPPLFFFIGFGEVTGFDDEKLMKFIMHSQHRYGLMPGFIWAVDLSWIRRIFII
                     SGFLETVVLFACIGVGFGVGLSR"
     gene            <225343..>226095
                     /locus_tag="KLLA0_A02563g"
                     /db_xref="GeneID:2896608"
     mRNA            <225343..>226095
                     /locus_tag="KLLA0_A02563g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451113.1"
                     /db_xref="GeneID:2896608"
     CDS             225343..226095
                     /locus_tag="KLLA0_A02563g"
                     /note="similar to uniprot|Q75CW0 Ashbya gossypii ACL194C
                     ACL194Cp and some similarites with YGR042W uniprot|P53227
                     Saccharomyces cerevisiae YGR042W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451113.1"
                     /db_xref="GeneID:2896608"
                     /db_xref="InterPro:IPR018838"
                     /db_xref="UniProtKB/TrEMBL:Q6CY76"
                     /translation="MSFVIKEFTCQYSDQIRKKHKTWHDGKLKYSEFNNRFQLFTEDG
                     VQLSSKLLTNSKQVADILNDEGYGIEEHRIFGSYFVIILELSSEYIRDESKSANSAII
                     KSEYGNRNKTPIGSVKQSQHIELNQKRASKTIASVSDTAKKPFKRPIILSHSQSNLQN
                     THIKADPDRRLTEDTRLRQEASDKASAERITAISQECFRSSLNVSQTTELNEVSAASL
                     DPVEYIRQTNSILKTGRLRQKNYVIRNSPIVL"
     gene            complement(<226562..>227674)
                     /locus_tag="KLLA0_A02585g"
                     /db_xref="GeneID:2896358"
     mRNA            complement(<226562..>227674)
                     /locus_tag="KLLA0_A02585g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451114.1"
                     /db_xref="GeneID:2896358"
     CDS             complement(226562..227674)
                     /locus_tag="KLLA0_A02585g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451114.1"
                     /db_xref="GeneID:2896358"
                     /db_xref="GOA:Q6CY75"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CY75"
                     /translation="MVNGSRSSAELPTIKRRVSKACDACRKSKTKCDGERPCSRCLKE
                     NKLCTYSNSNIGYAESKCKKLYNQEYVDLLETRNSLLTKALSYLFRQFDRCVDSGLVQ
                     IHPERFSEFRQLQMQSMILNQRSDMDDLDSDEYDEWEQVGSSQNPELSVRDGPAAAWM
                     NLRKNKNLFINKETGKLNVNEVVYSIIPTNVDMAVKSLNYIHGGREQIDRAALEAGSN
                     NKTSSHVYDKLLARGYVDSETLFTSDHSKEGIPEDANIELPKRKRRKMLSPNEARGIP
                     NSSQIQQSDSMVQILPIPAMADTVTMKQDVDGRVPTDYNSNSRMIQRSGNISLDNAAN
                     QLSYSNQAQQWYPKLEYGQFDLLESFSSDYKKQSTK"
     gene            complement(<231111..>232115)
                     /locus_tag="KLLA0_A02607g"
                     /db_xref="GeneID:2896669"
     mRNA            complement(<231111..>232115)
                     /locus_tag="KLLA0_A02607g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451115.1"
                     /db_xref="GeneID:2896669"
     CDS             complement(231111..232115)
                     /locus_tag="KLLA0_A02607g"
                     /note="highly similar to uniprot|P15019 Saccharomyces
                     cerevisiae YLR354C TAL1 Transaldolase enzyme in the
                     pentose phosphate pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451115.1"
                     /db_xref="GeneID:2896669"
                     /db_xref="GOA:P34214"
                     /db_xref="InterPro:IPR001585"
                     /db_xref="InterPro:IPR004730"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018225"
                     /translation="MSEPSAKKQKFANSLEALKATGTTVVADTGDFESIAKFTPQDAT
                     TNPSLILAAAKQQAYAKLIDSAVQYGKKQGQNIDEQVEIAVDKLLVEFGTAILKVVPG
                     RVSTEVDARLSFDKDATVKKALEIIKLYEAEGISKDRVLIKIASTWEGIQAAQELEKE
                     HDIHVNLTLLFSFAQAVAAAEANVTLISPFVGRILDWYKASTGETYTAETDPGVISVK
                     SIYNYYKKHGYNTIVMGASFRNVGEIKALAGVDFLTISPKLLDELLSSDEPVAKILDP
                     ESAKAEGSERVSFINDEPKFRFELNEDAMATEKLSEGIRKFSADIVTLFDLIKAKIQA
                     "
     gene            complement(<233822..>235501)
                     /locus_tag="KLLA0_A02629g"
                     /db_xref="GeneID:2896598"
     mRNA            complement(<233822..>235501)
                     /locus_tag="KLLA0_A02629g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451116.1"
                     /db_xref="GeneID:2896598"
     CDS             complement(233822..235501)
                     /locus_tag="KLLA0_A02629g"
                     /note="some similarities with uniprot|P32338 Saccharomyces
                     cerevisiae YGR044C RME1 mediates cell type control of
                     sporulation negatively regulates IME1 and sporulation zinc
                     finger protein negative regulator of meiosis directly
                     repressed by a1-a2 regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451116.1"
                     /db_xref="GeneID:2896598"
                     /db_xref="GOA:Q6CY73"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CY73"
                     /translation="MVTIYSPVAEEENTSNDSHLYSTVDSNYGISRVLGLESSLRNSD
                     RFTSRNEKRIDRNLNTEEFGFNYFEHAFRENVNQPHFSTTRGSVYQVSPEYENIHKER
                     GVQDVKVSSIPNWYDFDLAENGNAFEHSNYSTSDRNSFFINEKGGRKKHARSVDGFER
                     DNAIVSHVFESRASMPQVITPITPNHPKSFKEYQSLMAMNMHMNNGMNHFISENMNFN
                     NSSMEHLEIQQPRVKSYRSYQNTANLAYANARSKFNSVPNLSLSSFEQTPASLHQEHH
                     YVLQNHQHHNNFIPDFEVDHFHDHKHEEVHESAHDHMHKVEHFRSCSNDHEPSSSDLD
                     STSLSYEELRNSIIEKFTFNTAEEHTNNDVILNVHGCGSHYAEASTMNPDGTKKSVLQ
                     QILDDKPLMEAISKKQKRGAYKCAHCPEMFNTIFEFAKHIDEYQVERKYKCPFPLCPW
                     KILGLPKLQELKRHCLNQHIDELTPEQQYLIHGKSGAVSEVYHCESPYCDKAFHRKDS
                     YRRHVKMVHKNPKSRFNIRLVKAMKSCPEYLNKDLVAKERFLVEKMNSRRR"
     gene            complement(<238735..>239409)
                     /locus_tag="KLLA0_A02651g"
                     /db_xref="GeneID:2896538"
     mRNA            complement(<238735..>239409)
                     /locus_tag="KLLA0_A02651g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451117.1"
                     /db_xref="GeneID:2896538"
     CDS             complement(238735..239409)
                     /locus_tag="KLLA0_A02651g"
                     /note="similar to uniprot|P34227 Saccharomyces cerevisiae
                     YBL064C PRX1 Mitochondrial peroxiredoxin (1-Cys Prx) with
                     thioredoxin peroxidase activity, has a role in reduction
                     of hydroperoxides; induced during respiratory growth and
                     under conditions of oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451117.1"
                     /db_xref="GeneID:2896538"
                     /db_xref="GOA:Q6CY72"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:Q6CY72"
                     /translation="MRNILPKQAIYIGAKAPNFQAMTSLGPMDFYQYTQGKWCVFFSH
                     PADFTPICTTEIGAFGALQDEFTNRDCVLLGLSTNNRASHLRWIQDIEAITGVKINFP
                     IICDEEKKVATQFSMIDVNALTNGEPALTPLRAVYIIDPNKIVRLIQLYPLSTGRNTA
                     EVLRCLDSLQLVYKTDGKIMTPINWIPGDDIVVVPDLENCSMFPHRRTIRDYLQLSPL
                     DPNSLD"
     gene            complement(<240153..>241346)
                     /locus_tag="KLLA0_A02673g"
                     /db_xref="GeneID:2896586"
     mRNA            complement(<240153..>241346)
                     /locus_tag="KLLA0_A02673g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451118.1"
                     /db_xref="GeneID:2896586"
     CDS             complement(240153..241346)
                     /locus_tag="KLLA0_A02673g"
                     /note="highly similar to uniprot|P06168 Saccharomyces
                     cerevisiae YLR355C ILV5 Acetohydroxyacid reductoisomerase
                     mitochondrial protein involved in branched-chain amino
                     acid biosynthesis also required for maintenance of wild-
                     type mitochondrial DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451118.1"
                     /db_xref="GeneID:2896586"
                     /db_xref="GOA:Q6CY71"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016207"
                     /db_xref="UniProtKB/TrEMBL:Q6CY71"
                     /translation="MFRQAARQLIANSRVITAKRAISFAARQSTVSGLRSTAFASKPL
                     VATRGIKQINFGGVEETVYERADWPTEKLLQYFKDDTLALIGYGSQGYGQGLNLRDNG
                     LNVIVGVRKNGASWKAAIEDGWVPGENLFDVNEAVQKGTIVMNLLSDAAQSETWSSLK
                     PLLTKGKTLYFSHGFSPVFKDLTHVEPPTDIDVILVAPKGSGRTVRSLFKEGRGINSS
                     YAVWNDVTGKAHEKAQALAVAVGSGYVYQTTFEKEVNSDLYGERGCLMGGIHGMFLAQ
                     YEVLRENGHSPSEAFNETVEEATQSLYPLIGKYGMDYMYDACSTTARRGALDWYPIFK
                     DALKPVFQDLYESTKNGSETKRSLEFNSQPDYREKLEAELQIIRNMEIWKVGKEVRKL
                     RPENN"
     gene            <242521..>243228
                     /locus_tag="KLLA0_A02695g"
                     /db_xref="GeneID:2896540"
     mRNA            <242521..>243228
                     /locus_tag="KLLA0_A02695g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451119.1"
                     /db_xref="GeneID:2896540"
     CDS             242521..243228
                     /locus_tag="KLLA0_A02695g"
                     /note="weakly similar to uniprot|Q06485 Saccharomyces
                     cerevisiae YLR356W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451119.1"
                     /db_xref="GeneID:2896540"
                     /db_xref="UniProtKB/TrEMBL:Q6CY70"
                     /translation="MSVCLTATKSIALVSAGLNSGLCFGGVLSPEPTDVTAKRTTNNF
                     DLNREIAIGVLSSLSTGFYAASYFGAPTQWKHPYLLYTGALALISTGITAFKLIRRMV
                     WPIVYKRIRCHSKESHVDEKSSAHINQDITDSVQEQDNDESDHGQDDSVVLVSESSNH
                     SIDSGANDAPSTLPLLPTHTENKSSRLSTTDQCGWSSLLSAFTSDAVLDTVRTISSVG
                     LLLLGTVGGLGEPLALI"
     gene            <245082..>246380
                     /locus_tag="KLLA0_A02717g"
                     /db_xref="GeneID:2896797"
     mRNA            <245082..>246380
                     /locus_tag="KLLA0_A02717g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451120.1"
                     /db_xref="GeneID:2896797"
     CDS             245082..246380
                     /locus_tag="KLLA0_A02717g"
                     /note="weakly similar to uniprot|P53233 Saccharomyces
                     cerevisiae YGR052W FMP48 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451120.1"
                     /db_xref="GeneID:2896797"
                     /db_xref="GOA:Q6CY69"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:Q6CY69"
                     /translation="MHKYQPIDVIQTGSFSTVYRAYDSKTGSYVAMKVVSKPADPVKL
                     EAISKLVRNEYRVLKKLGNRHPNICAMLDFYQDHEKFVFVLEYCHNGDLYDYMKRIKE
                     SGGTDKNSKNARNSKSSSKSPPKLHFHSLMFQLCSALKYCHTLGIAHRDFKPENILVT
                     NTGKIKLTDFGLSYFGEVASDHGIGTEKYLAPETFSHNDTYNTYSADLWSLGISVLYI
                     VFGSCPFKSANIDSPTKNTNFIVFNDNPVKFVKQYYLPNLLEGSNRSNNCSESSRHAI
                     VGSQDYWLELVPNLSHPEHLLLLISRLVIAHLLCPPTHRNIDTFYANIDYFTNDVQMI
                     KCCPEITPPLSSSSSSSSASLSAQKYNQKQCATYPPSPASLKSTSFSFLNFEPAAESI
                     SFEDWIPRDNSRNSWTYDWDANTTWPIDSESFAVLSSNSV"
     gene            complement(<246644..>247255)
                     /locus_tag="KLLA0_A02739g"
                     /db_xref="GeneID:2896544"
     mRNA            complement(<246644..>247255)
                     /locus_tag="KLLA0_A02739g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451121.1"
                     /db_xref="GeneID:2896544"
     CDS             complement(246644..247255)
                     /locus_tag="KLLA0_A02739g"
                     /note="some similarities with uniprot|Q45U33 Saccharomyces
                     cerevisiae YGR053c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451121.1"
                     /db_xref="GeneID:2896544"
                     /db_xref="UniProtKB/TrEMBL:Q6CY68"
                     /translation="MSTTIRRLGFLRSVRRYSGTSGCADIGNNGKMSTENIRRVNLGC
                     TITYLQSNVPHLLQTSLHEPRLSKDIELKIMPITHPYLPSFSGITKYYAVWNSIRFLL
                     NTFAFSVENRVRIKSLDVEKHEVIMRWETHPLAADNLGSIKKAESETKISGIFIFGLN
                     ENCDKITSHLIDDVEIIEKDKKIDFSSKVQNGAIAYFKTWSGP"
     gene            <247871..>249628
                     /locus_tag="KLLA0_A02761g"
                     /db_xref="GeneID:2896306"
     mRNA            <247871..>249628
                     /locus_tag="KLLA0_A02761g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451122.1"
                     /db_xref="GeneID:2896306"
     CDS             247871..249628
                     /locus_tag="KLLA0_A02761g"
                     /note="similar to uniprot|P53235 Saccharomyces cerevisiae
                     YGR054W yeast homolog of mammalian eIF2A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451122.1"
                     /db_xref="GeneID:2896306"
                     /db_xref="GOA:Q6CY67"
                     /db_xref="InterPro:IPR011387"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CY67"
                     /translation="MSFQLFAKTNSTVEVFQGYPSFEEISSSKSGNDGTEGKVIQSLL
                     SPCGRFMAKSYESKVVLLIGETWEITLVELPLKNVYDLKFSPSGNFLSTWERPLVDDT
                     EHLNCKIWNLNESPLSTEPKYSYKASTQSSWTLQFSKLDDYAIKSFGKELRIIKLSGE
                     DTFKFDKPFATLTPDQPFTTYQISPAEHPTICTFTKEKSGKPAQLTIWPITTGKITKQ
                     IVTKQFFKADSCHLKWSDLGNAILCLTTTDFDHSNKSYYGENNLYLLSFQGVNGALGG
                     ESVRVSLGKEGPIHDFNWSPTSRQFGVIYGFMPATITFFDLKGNAIHSLNEQRKNTLE
                     FSPNGKYILVGGFGNLQGSVDILDRHDKFRCISKFSATNTSVCKWSPGGEFILTATTS
                     PRLRVDNGLKIWHYSGTLVFVKEYKELLKVDWRTNCPFRIIKDGYVTNGNKLKDEELK
                     QDPKIRKHQLEIHPVVTQFNLKNPNKSSTNLGAKKTTGAYKPPHARKATVVPGTTKTR
                     APQSTPTPPLQQSAASQTSPEEKKIRSLLKKLRAIESLKVKQTEGVKLENTQVTKIQS
                     EPKILKELELLGWKGELDS"
     gene            complement(249870..249975)
                     /locus_tag="KLLA0_A02783r"
                     /db_xref="GeneID:2896546"
     tRNA            complement(join(249870..249905,249938..249975))
                     /locus_tag="KLLA0_A02783r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2896546"
     gene            <250872..>252191
                     /locus_tag="KLLA0_A02827g"
                     /db_xref="GeneID:2896542"
     mRNA            <250872..>252191
                     /locus_tag="KLLA0_A02827g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451123.1"
                     /db_xref="GeneID:2896542"
     CDS             250872..252191
                     /locus_tag="KLLA0_A02827g"
                     /note="highly similar to uniprot|P38755 Saccharomyces
                     cerevisiae YHR001W OSH7 Member of an oxysterol-binding
                     protein family with seven members in S. cerevisiae family
                     members have overlapping redundant functions in sterol
                     metabolism and collectively perform a function essential
                     for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451123.1"
                     /db_xref="GeneID:2896542"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:Q6CY66"
                     /translation="MPFKLKSKISASTGDISSTAHPQVADPNIVEDTDDIDENDDAGQ
                     SILMGIITQLKPGCDLSRITLPTFILEKKSMLERIANQLQFPDLLLEAHKEKDELERF
                     IKVVKWYLSGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAFYIAEQTSHHPPKSSY
                     FYMIPESNIRVDGTTIPKSRFLGNSTAAMMEGLSVLQFLDITDPKTGKPEKYTLTQPN
                     MYARGILFGKMKLELGDHMLIKGPKYQIDIEFKTKGFISGTYDAIEGIIKDYNEKEYY
                     EITGKWNDLIYYKDLREKHSKKAVLFDTNTAVPLKPSVRPLEEQGEFESRRLWKKVTD
                     ALAKRDHVEATDEKFKIENNQRILAKKRIEDGVEFHPKLFRTASPGDDLEFYVYKSIP
                     PGTDHESHEDQIKSILEIAPIVPGQKFTEKFSIPAYQKHDIQQKELN"
     gene            complement(<252275..>253204)
                     /locus_tag="KLLA0_A02849g"
                     /db_xref="GeneID:2896347"
     mRNA            complement(<252275..>253204)
                     /locus_tag="KLLA0_A02849g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451124.1"
                     /db_xref="GeneID:2896347"
     CDS             complement(252275..253204)
                     /locus_tag="KLLA0_A02849g"
                     /note="weakly similar to uniprot|Q02202 Saccharomyces
                     cerevisiae YKR004C ECM9 Non-essential protein of unknown
                     function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451124.1"
                     /db_xref="GeneID:2896347"
                     /db_xref="UniProtKB/TrEMBL:Q6CY65"
                     /translation="MVRSLTQKVINALQADYDTSEVQFLIYPTTPPEVKDELIVVQHE
                     QRTEVVCFKKTMMKIFIECHKLFYQLDSLDDDEKLLVISGLLLTTTENRTALNMFLAK
                     LNKLRANEINREILFVERLLSCNSARLNKSSSLWDLYKKLYTAYGSNLKFKVWDTVTI
                     SCERHFANYYCCNFIRWFHSQLNDSHRQNFVDNFLRFSKKHVNDPSIWSALGIMIGKT
                     DFDQVIIFIDSLPVTTWSPFLAVLEFGSRNTQIIPSLMKHWTKDDTISFYNGTPIIPD
                     YIENDLNSKSKFMSNAWKTHLLEKLQRLQLDAT"
     gene            complement(<253619..>255511)
                     /locus_tag="KLLA0_A02871g"
                     /db_xref="GeneID:2896535"
     mRNA            complement(<253619..>255511)
                     /locus_tag="KLLA0_A02871g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451125.1"
                     /db_xref="GeneID:2896535"
     CDS             complement(253619..255511)
                     /locus_tag="KLLA0_A02871g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451125.1"
                     /db_xref="GeneID:2896535"
                     /db_xref="UniProtKB/TrEMBL:Q6CY64"
                     /translation="MLKRICSGIAIWAALGAAQFEQQISQCKDLESSISALDLSQCSP
                     GLEQCLLATMGVGNENCAACVQVSGDLQLESNCACIECIISNLNSKCFTAYCSSSGTN
                     HAVLQKLNEELGKDSKLTIPVIAENHELQYYVDNNEEIHRPLLDLEKQRLVHNFLTFA
                     KYQLGNTFAGLGKRDFPCDQVDCERLDALIDEHGDEHSDEVQDAKFWKKLKKLKEKKG
                     KKGGDDDDDDDDDDDESGKPPCSEKECTTTFVSTSYKPKKRIMTSWKPIKITITETLT
                     GKDCKGKVITKTLWDTETQTETETDWATTTKWKWKKEHTVTATKTEQTPVTKVIYKHD
                     KLTVTETEFEVSTRTKYKHDKATITETELEEVTKTKRVATDTTTIVKWKTDTEWDTTT
                     KIKKKTIPTTETETETETETETETATTTATTTSLTTVTTTASKVKMPLLSGLGFDLLN
                     ANNIQNVSVTDYVLGYTTSKTATPGNKSSSVIATPSSEPLPNSVSGHEKTMRYSNDSN
                     SSNSDTFESSSSTSTDVTKSWIISSIAALAGIVFIYTMSEQRVRPENPGGNQGQEPAS
                     NDDGDSENSSVTISKVSDFEMDTEDLIDSDIRKLLNNSIPHAGSTKENLASQLVEDPL
                     GIIEVA"
     gene            <256320..>258233
                     /locus_tag="KLLA0_A02893g"
                     /db_xref="GeneID:2896343"
     mRNA            <256320..>258233
                     /locus_tag="KLLA0_A02893g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451126.1"
                     /db_xref="GeneID:2896343"
     CDS             256320..258233
                     /locus_tag="KLLA0_A02893g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451126.1"
                     /db_xref="GeneID:2896343"
                     /db_xref="GOA:Q6CY63"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="UniProtKB/TrEMBL:Q6CY63"
                     /translation="MTTKSPVKRQQQDTLFSSSPSVSESRKRQSKRDEAIRRKLENDL
                     SKKKAGKSSTKKGQNSGKKNRNASSPGTVLSLSPSEPVVCKPSATVYEAAQLMSAKRE
                     NCILVVDYDDDTNLEDDSSISGALLGIFTAKDLAFRVVGTGLKASSVTIDQIMTPHPL
                     CATSDTLASDALNLMVERGFRHLPVIDEDTHAIISVLDITKCYQEAMEKLERMYEHSK
                     KLHDAFNSISNEIGGLSGGSQPFEVVKYFEHMKSVMNGPTLESVLHDETTVPSYVNVK
                     TSVHEAALTMKDNHTTAVLVKNEVNEVSGIFTSKDVVLRVIAAGLDPKTVSVIRVMTP
                     QPDVAPKTLSIQQALRKMFEGHYLNLPVVDDGEIVGIVEVLKLTYATLSQINLISDAE
                     SHNSQSQRSSVPTTPSKNAAPGPAWNKFWNGFDLMNDSSSVHSESVFSNGPPEISQTE
                     LNQFQLDNGMHLNDSVSFVNGETSSLMGSSHITSQEDIRTCLHSFKFKTLTNNKTHRV
                     SLRPIEGVSKLVELIGEKLGGSDDVEILYVDDENDLVSITHDQDLIDCVLVHKNMNLD
                     KIDLLVHYRYETVPQDAVNRLIQNRFKKNVPSHPKPSNQLIPGIPNETLLPAVIVALG
                     ASIAVIFSLSRKH"
     gene            complement(<258504..>259265)
                     /locus_tag="KLLA0_A02915g"
                     /db_xref="GeneID:2896349"
     mRNA            complement(<258504..>259265)
                     /locus_tag="KLLA0_A02915g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451127.1"
                     /db_xref="GeneID:2896349"
     CDS             complement(258504..259265)
                     /locus_tag="KLLA0_A02915g"
                     /note="similar to uniprot|Q758P2 Ashbya gossypii AEL289W
                     AEL289Wp and weakly similar to YKR006C uniprot|Q02204
                     Saccharomyces cerevisiae YKR006C MRPL13 Mitochondrial
                     ribosomal protein of the large subunit not essential for
                     mitochondrial translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451127.1"
                     /db_xref="GeneID:2896349"
                     /db_xref="GOA:Q6CY62"
                     /db_xref="InterPro:IPR018305"
                     /db_xref="UniProtKB/TrEMBL:Q6CY62"
                     /translation="MMLASRYVPVVRSSRQFTSSAVRSDFLSWFRRNKNKDAGVVSTQ
                     PELQRDTKEVINEIESGKTTVVKSSTVTRLELTDDDFVGIDSSRREELIRLQKLDVVP
                     FNEWLSQDKLSTEQQLEQVVLESYQETFGDVPTEEQLGKPFENLVNKFKFSKLLQCKS
                     GHIIPDYELTRLQTPLEFKSWFEIKVLSGQLGKFKESEPNAIDLSNIKFPPNVYVVPD
                     VKPSVKKQKVKKILEEVAALEAQYERDAIEKAKRD"
     gene            <259865..>260296
                     /locus_tag="KLLA0_A02937g"
                     /db_xref="GeneID:2896530"
     mRNA            <259865..>260296
                     /locus_tag="KLLA0_A02937g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451128.1"
                     /db_xref="GeneID:2896530"
     CDS             259865..260296
                     /locus_tag="KLLA0_A02937g"
                     /note="some similarities with uniprot|Q02205 Saccharomyces
                     cerevisiae YKR007W MEH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451128.1"
                     /db_xref="GeneID:2896530"
                     /db_xref="GOA:Q6CY61"
                     /db_xref="InterPro:IPR028209"
                     /db_xref="UniProtKB/TrEMBL:Q6CY61"
                     /translation="MGNVLSCCFRQDSDENDPLLQEQDRYGSQAQLDYNEMEQRQKER
                     VLARELELTEIVNNTNDKLIDIGMISNSGIVASSHDLGSSYVQDQREILHDVPLTVLP
                     SSKIKQDTRKAIQEFHKKYFANLVKNLTVEYNKPLVANIES"
     gene            <260627..>262306
                     /locus_tag="KLLA0_A02959g"
                     /db_xref="GeneID:2896532"
     mRNA            <260627..>262306
                     /locus_tag="KLLA0_A02959g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451129.1"
                     /db_xref="GeneID:2896532"
     CDS             260627..262306
                     /locus_tag="KLLA0_A02959g"
                     /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
                     YKR008W RSC4 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex found in close
                     proximity to nucleosomal DNA displaced from the surface of
                     nucleosomal DNA after chromatin remodeling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451129.1"
                     /db_xref="GeneID:2896532"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:Q6CY60"
                     /translation="MAVKRSRSEDPSEEPEQKHSKQNYVPRYTPGKRPRSGALPKVDY
                     VHPLDPTEELIVDLDWTIPKLNLFIAFTLDNLVEAHKALFKHFIKLPSRKFHPQYYYK
                     IDQPISINEIKSRDYEYSGGETKFLLDCELIYKNCLAYNDPDSLIVKNAKQVVYFIKN
                     EVLKVKNATRNFLVNDDVKTRFIAIFDTLLNVTDKQMAEILAEDDDVKLEAASNNNLD
                     DTLNICQPFLELVDKDEYPEYEEVIRLPNSLNLVKNNLELGYYHKIYDFITDVNLTFQ
                     NALVFNDEDTTIYSDALKLMKCFSVLIQRRFFPELETAREKGEITLEYDKIEYKQFVQ
                     EEEEEEPILSDDDETNEEYNYIEGLGNGYNRGPMSRDYLLGPSKTSKTADSKVENNEP
                     DKPLPLKFNILPVIKKHNIEPKTEPVPYKVIEKIQISSSRSFYEQSIRPLKGLYQNSD
                     NITWFEYIFADGALTQTSHEYAITLPPKQNSITVVSQLSSPVSEDSPAVLIANKDKVN
                     PIPVLDGDKFDESKARYDIKLAEGLNTVTFSVRDSENDRLETAKFWISVLP"
     gene            complement(<262440..>264356)
                     /locus_tag="KLLA0_A02981g"
                     /db_xref="GeneID:2896310"
     mRNA            complement(<262440..>264356)
                     /locus_tag="KLLA0_A02981g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451130.1"
                     /db_xref="GeneID:2896310"
     CDS             complement(262440..264356)
                     /locus_tag="KLLA0_A02981g"
                     /note="weakly similar to uniprot|Q12188 Saccharomyces
                     cerevisiae YPR007C REC8 Meiosis-specific component of
                     sister chromatid cohesion complex maintains cohesion
                     between sister chromatids during meiosis I maintains
                     cohesion between centromeres of sister chromatids until
                     meiosis II homolog of S. pombe Rec8p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451130.1"
                     /db_xref="GeneID:2896310"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="UniProtKB/TrEMBL:Q6CY59"
                     /translation="MAEVGVRIAQDQNIATVWLLSSLGASHSVNVKKREIVKVSIPHA
                     CQILASGQVSMPLRHTGQLLYGVTVCYERKTGFILADVTSLRDALQRQWIGLKPLGKS
                     TGGSGGHNKTKMVQNQVITETGDNFLQDDPNFDMMMQLKMDNNLDFLLNGNNNTNDRQ
                     ILTNSTRAPVLADKQAIRQDDMWREMEIGNEPYLNARSRGNTVNSGHDFHINGDADEY
                     EDDDLAPIDVELNFRLDEVLTDNEAETANLSSVHSDLGLNYDNDATHGIDLGMPVLDE
                     TETSNPHLQQMKRRLGLDNEDEDEDGNTLNEVEVNAKSTKNKKRRTVANWFQKIKVDS
                     TIGLLTDTLRYNHENYKDIMRDLHARRSSKSKPMISDWKELFTDEDRPRQMLNFYSEL
                     FQPLSSINFPQGRRGRVMHSAGDTSRSSSVLSLEHGRRMDFSNVSSSGDSNRIHLHNL
                     PEQINEYPEYMDMPMDDPQFMELDIPPSSFGRSTNRNYTANSDNLENLRGYPNRRRGA
                     IRGDSGSADYLSGSDSIPQTFNENQQQLIVHDKQTEKFFQYIVERGQHIGKRTAAFPG
                     YSRKFLFEDIIPSKLSQEEDEEIIPVTKRIACNAFLSLLQLATSSKLKIDLYNVEPEK
                     VFRVLNGDDIIVYC"
     gene            <264785..>265393
                     /locus_tag="KLLA0_A03003g"
                     /db_xref="GeneID:2896524"
     mRNA            <264785..>265393
                     /locus_tag="KLLA0_A03003g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451131.1"
                     /db_xref="GeneID:2896524"
     CDS             264785..265393
                     /locus_tag="KLLA0_A03003g"
                     /note="weakly similar to uniprot|P43592 Saccharomyces
                     cerevisiae YFR008W FAR7 Protein involved in G1 cell cycle
                     arrest in response to pheromone in a pathway different
                     from the Far1p-dependent pathway interacts with Far3p
                     Far8p Far9p Far10p and Far11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451131.1"
                     /db_xref="GeneID:2896524"
                     /db_xref="UniProtKB/TrEMBL:Q6CY58"
                     /translation="MESGKDAENQPVLFMGAQTENLDYMYELVHELSAQLKTNENMRD
                     AVLQDVDLLSRQLNHGNVDVSPDINVTKQFIYKRLKDEELSIQDEEEEDGNEEDNMLH
                     HVTKQNEQLKEILKNQQRRNAVALQALRHHDEGLEICVTMLRNEIYSYHVTVLSRSRD
                     LIENQLYKAEDSQFNQYLESVTDLQQLLDLCKLYRTLLRAHP"
     gene            <266917..>268077
                     /locus_tag="KLLA0_A03025g"
                     /db_xref="GeneID:2896356"
     mRNA            <266917..>268077
                     /locus_tag="KLLA0_A03025g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451132.1"
                     /db_xref="GeneID:2896356"
     CDS             266917..268077
                     /locus_tag="KLLA0_A03025g"
                     /note="similar to uniprot|P40088 Saccharomyces cerevisiae
                     YER145C FTR1 High affinity iron permease involved in the
                     transport of iron across the plasma membrane forms complex
                     with Fet3p expression is regulated by iron"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451132.1"
                     /db_xref="GeneID:2896356"
                     /db_xref="GOA:Q6CY57"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="InterPro:IPR005217"
                     /db_xref="UniProtKB/TrEMBL:Q6CY57"
                     /translation="MAANKVFNVAVFFVVFRECLEAAVIVSVLLSFLKQSIGSNDMAT
                     YKRLRMHVWIGVVAGFIICMAIGGGFIGAYYRYENDIFGSAEDLWEGVFCIIATLMIS
                     VMGIAMLRVNKMQAKWRVKIAKAMLEVPKDRRKKWSLKYWATRYSMFLLPFITVLREG
                     LEAVVFVAGAGITTKDSKATAYPLPVVIGLIAGIIVGTLLYYGTSKSSLQIFLVISTC
                     VLYLIASGLFSRGVWYFDNYYFNKKTGGDASESGDGNGSYNILRTVYHVNCCNPELDN
                     GWDIFNSLLGWQNTGYLSSILAYNLYWLVLMIVIGLMMYEERNGHLPFCKNLKLRQLK
                     PSYYLKRKQNEELTAAEQEELFKQVNNLGVDEEGNVVVNKGDTTKVNVELVK"
     gene            <269553..>271256
                     /locus_tag="KLLA0_A03047g"
                     /db_xref="GeneID:2896819"
     mRNA            <269553..>271256
                     /locus_tag="KLLA0_A03047g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451133.1"
                     /db_xref="GeneID:2896819"
     CDS             269553..271256
                     /locus_tag="KLLA0_A03047g"
                     /note="similar to uniprot|Q758P8 Ashbya gossypii AEL295C
                     AEL295Cp and some similarites with YPR008W uniprot|Q12753
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451133.1"
                     /db_xref="GeneID:2896819"
                     /db_xref="GOA:Q6CY56"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:Q6CY56"
                     /translation="MVLINGVKYACERCIRGHRVTTCNHTDQPLTMIKPKGRPSTTCA
                     HCKELRKNRNANPSGQCTCGRQEKKRIAQKAREESGCVCKNDPDHCPCHKKRAPRRKK
                     QSHQGNSAVGLDINGKISKHTNSGYSHQSLHSLDSSHSVDQDLSNFLASPISMNTSFS
                     TGWDNASLSSSNRSPPGNGPDSKNTIGLEPLSTMKPITPKTRTKVGEVFIPLTEYVPT
                     NIASSEDQADHINPLLMGEHVSIYNDVSADAPNVTYFADTSKSLSYNQLKEQRKALSE
                     QHLRNNVDNISKSGSTQRVPLSVAGRSSSFVSNISSHDSVASSNNDFISSLNSSDSLS
                     SMLHSGNAHHYQDMLHHSNNGRGYLNPVQVDQSQNVYGFDTDSVRSVEVLSITPSFMD
                     IPESKPPSIGSNSSTNPFISWKSVNSRRERSVSIHKNHRYDNENKRKRHPKNVPNTST
                     PQIKSMVSPAETNSTALPASGNHFNSPADSTNTVLSANTQYGDPSVFSIEKVGVAPSF
                     VEPSFTTDFNQALKQSNMVNQNIIDNNSLFSGTSEGNNPSPNDLFPVEFADIDDLMTH
                     L"
     gene            complement(<271516..>274203)
                     /locus_tag="KLLA0_A03069g"
                     /db_xref="GeneID:2896840"
     mRNA            complement(<271516..>274203)
                     /locus_tag="KLLA0_A03069g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451134.1"
                     /db_xref="GeneID:2896840"
     CDS             complement(271516..274203)
                     /locus_tag="KLLA0_A03069g"
                     /note="highly similar to uniprot|P32863 Saccharomyces
                     cerevisiae YGL163C RAD54 DNA-dependent ATPase stimulates
                     strand exchange by modifying the topology of
                     double-stranded DNA involved in the recombinational repair
                     of double-strand breaks in DNA during vegetative growth
                     and meiosis member of the SWI/SNF family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451134.1"
                     /db_xref="GeneID:2896840"
                     /db_xref="GOA:Q6CY55"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CY55"
                     /translation="MARRRLPDRPPNGIGAGARPNLRPRRLDTNQALETLTKPFKVPF
                     KVNKTDHAKRYGVRSSRRSQTTYANMDSSLDSDLHVKRKDALSLSRLNAEPSRLDTIY
                     STLRRSFTVPIKGYVPRHNIPMALGTKAKVVIPPRPLHDPTDELAIVLYDPTVDGDIP
                     EQHEDLESFRQNAVDTKKSQKGKDSESQDQKAKESSPNSAPSIHHPKMLSNGVKNKTL
                     KELLGSSEDNTSKKFPNVPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDAKT
                     VLDSSSQSMEKADTQADSNITGSKSPVETDVSSLKDVIKINENSRNRGAYGCIMADEM
                     GLGKTLQCLALMWTMLKQGPQGRRSIDKCIIVCPSSLVNNWANEIDKWLGPGSLSSLA
                     IDGKKSSLNNGNVADSVSHWASAQGRNIVKPVLIISYDTLRRNVEQLKNCEVGLMLAD
                     EGHRLKNADSLTFTALDSIRCPRRVILSGTPIQNDLSEYFALLNFSNPGLLGSRNDFR
                     KNFELPILQSRDSLATDEEVTLGKDRLRQLSNIVSKFIIRRTNNILAKYLPCKYEHVI
                     FINLTPFQQSLYQHFIESRAVKKIVKGDSNQPLKAIGLLKKLCNHPDLLELSEDIPGS
                     EELIPDDYQSSVDSRTSRNRSVIQTAFSSKFSVLARFLYKIKTESNDKIVLISNYTQT
                     LDLIEKMCFSNHYGVLRLDGTMNINKRQKLVDRFNDPEGQEFIFLLSSKAGGCGINLI
                     GANRLILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGTIEEKIFQRQSMKMSL
                     SSCVVDEKEDVERLFSSDNLKQLFKLDTKTICDTHETYNCKRCKNGKQILKAPVMLYG
                     DATSWNHLNHDALAKTNDHLLKNEFNHKDISFAFQYISH"
     gene            <276333..>277484
                     /locus_tag="KLLA0_A03091g"
                     /db_xref="GeneID:2896583"
     mRNA            <276333..>277484
                     /locus_tag="KLLA0_A03091g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451135.1"
                     /db_xref="GeneID:2896583"
     CDS             276333..277484
                     /locus_tag="KLLA0_A03091g"
                     /note="some similarities with uniprot|Q12286 Saccharomyces
                     cerevisiae YPR009W SUT2 Involved in sterol uptake
                     homologous to SUT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451135.1"
                     /db_xref="GeneID:2896583"
                     /db_xref="GOA:Q6CY54"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CY54"
                     /translation="MSSIIIDNCNNTSLPPLLLPAVVHHDERNTYLNKLSASNFKQDK
                     SVSGLNLISNSSSWSKPSANYTTSKTAVLLTPPNSNINSSTATASSSLDDLASLASVA
                     AATNNVALPKDTIGSSYNSHQHPLIHDCLQRKRSNSSADEESLAAPVAFKKRGRKNSR
                     KNSMRMSSNTSFTLSSAVSSNTTSSTTSRSSSRSKSPLSRAQSVSNSPSSVEEDAGVT
                     RGFDDNQLLANISGAKVITSSKCKRQRTGPSCDVCRSKKIKCDATVLVISQDPSLLFN
                     CKEDESLHCPLSIDTCRPDILMKIPTEVRKQLAERKDMSLVRHVDKLIAFSSCSSCQK
                     KKDRDCSFSKGFTRNDIAVFSTLNKKLGKRNSLGDFTVKDYLNVGYSLD"
     gene            complement(<277880..>278677)
                     /locus_tag="KLLA0_A03113g"
                     /db_xref="GeneID:2896353"
     mRNA            complement(<277880..>278677)
                     /locus_tag="KLLA0_A03113g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451136.1"
                     /db_xref="GeneID:2896353"
     CDS             complement(277880..278677)
                     /locus_tag="KLLA0_A03113g"
                     /note="weakly similar to uniprot|P53108 Saccharomyces
                     cerevisiae YGL161C YIP5 Protein that interacts with Rab
                     GTPases computational analysis of large-scale
                     protein-protein interaction data suggests a possible role
                     in vesicle-mediated transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451136.1"
                     /db_xref="GeneID:2896353"
                     /db_xref="UniProtKB/TrEMBL:Q6CY53"
                     /translation="MSAKKDLIDRDDDDINPFEDDSFVPQVTPGLKPFEPELQDITLE
                     TTREAPQPAITTGKASIFSKLSPYFQVDETTLKQKLITALKLGELKSLRDPESQADAQ
                     LDLYSTVWITATVIMVLFLSYSGKSVIGSLITNSFSDVIDFQIMINCLFLFYIYVLGV
                     PILAFLICKFVFKEPFDVITAIDTYGVSNVVWVPIGFISVVTGLVGPFENIIEWVLVA
                     IGGAYSGGIIYIQLKNVVTELQNGKVLLLAMIGVHILFTLLVRWIIL"
     gene            <279951..>281165
                     /locus_tag="KLLA0_A03135g"
                     /db_xref="GeneID:2896590"
     mRNA            <279951..>281165
                     /locus_tag="KLLA0_A03135g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451137.1"
                     /db_xref="GeneID:2896590"
     CDS             279951..281165
                     /locus_tag="KLLA0_A03135g"
                     /note="similar to uniprot|P32579 Saccharomyces cerevisiae
                     YGL169W SUA5 Protein required for respiratory growth null
                     mutation suppresses the Cyc1p translation defect caused by
                     the presence of an aberrant ATG codon upstream of the
                     correct start"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451137.1"
                     /db_xref="GeneID:2896590"
                     /db_xref="GOA:Q6CY52"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:Q6CY52"
                     /translation="MLRSVMKLTTRILKVDPAAIHFSDSAHIDGSLPTFTCAETEKNL
                     LEAAGIIRDTSETVAFPTETVYGLGGSALNDESVKNIYKAKNRPSDNPLITHISSLSQ
                     LNRVIYSDISDDCKPLSHVPEIYHPLVEKLWPGPLTILLSIPDGSNRNTLSKLTTANQ
                     PTFACRIPANPIARALIALSDTPIAAPSANASTRPSPTTAEHVFHDLNGRIPLILDGG
                     KCSVGVESTVVDGLVTPPMLLRPGGFTYENILNIGGPLWKECLVETKVNIKDDEKVKT
                     PGMKYRHYSPKAKVILLVPEGDSQIISSERLGRLKSLVDKEIIQQGAKKVAFLNSLHL
                     NKHFIDGKCIHESLGTTGKEIQANLFALLRKVDEEDNVDLIVVEGTEANEEGLAIMNR
                     LRKAASNNIINF"
     gene            complement(<281313..>284129)
                     /locus_tag="KLLA0_A03157g"
                     /db_xref="GeneID:2896793"
     mRNA            complement(<281313..>284129)
                     /locus_tag="KLLA0_A03157g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451138.1"
                     /db_xref="GeneID:2896793"
     CDS             complement(281313..284129)
                     /locus_tag="KLLA0_A03157g"
                     /note="uniprot|O74296 Kluyveromyces lactis KlPMR1 Ca++
                     ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451138.1"
                     /db_xref="GeneID:2896793"
                     /db_xref="GOA:Q6CY51"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6CY51"
                     /translation="MSDNPFESYLARDQQPPQPAVDVLSQPNASLEYCTVSVEDTIAQ
                     LGTDFDNGLSNPSEIAYRKSIWGSNEVLPDEKVSLWKKFLSTFIEDPLILLLIGSAVI
                     SFLMGNIDDSISIALAIIIVVTVGFVQEYKSEKSLEALNKLVPAECHLTRSGQLSHVL
                     ASNLVPGDLVRFKVGDRIPADLRIVESIDLCVDESNLTGENEPVHKSSGAVDPKNYSH
                     IPGSIIPVGDRNCIGFMGTLVREGHGKGIVIATGKHTVFGSVFEMMSGIDKPKTPLQT
                     AMDKLGQDLSYMSFVLIGIICLIGIIQGRSWLEMFQIAVSLAVAAIPEGLPIIVTVTL
                     ALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTANHMTVSKIWCLGSMENKTN
                     CLALSKVKERPIKMEQDVATTLRIGNICNNGTYSQEHLKYLGNPTDIAILESLQHFGI
                     NDCRNSVNKINEIPFNSKRKFMAVKTIDANDKVVVYVKGAFEKIVEKSINYIGRDGKV
                     HKLKPNDKAIINDAAVALASEGLRTLAFAELEVSATHGDKEFNEDMVEGLTFTGLIAM
                     NDPPRPTVRSAIEELLQGSVHVIMITGDAENTAVSIARQIGIPVINPEYSVLSGDKLD
                     QMTDDQLASVIDHVNVFARATPEHKLNIVRALQKRGDIVAMTGDGVNDAPALKLADIG
                     VSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSVAALSL
                     VAISTSLKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMRKPPRKRTDKILTDA
                     VLKRVLISACFIIVGTIYVFVKEMAEDGQVTSRDTTMTFTCFVFFDMFNALSCRHATK
                     SIFEIGFFANKMFNYAVSLSLLGQLCAIYIPFFQGIFKTESLSLGDLLFLLTLSSSVF
                     IGDEIRKYYVKKNRYLDSYSSSIV"
     gene            complement(<285228..>286244)
                     /locus_tag="KLLA0_A03179g"
                     /db_xref="GeneID:2896338"
     mRNA            complement(<285228..>286244)
                     /locus_tag="KLLA0_A03179g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451139.1"
                     /db_xref="GeneID:2896338"
     CDS             complement(285228..286244)
                     /locus_tag="KLLA0_A03179g"
                     /note="weakly similar to uniprot|P36027 Saccharomyces
                     cerevisiae YLR332W MID2 Protein required for mating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451139.1"
                     /db_xref="GeneID:2896338"
                     /db_xref="InterPro:IPR007567"
                     /db_xref="UniProtKB/TrEMBL:Q6CY50"
                     /translation="MQFVIPLLLLVSAIKPVLGQQSAAENDGGITASNGTTSTLSPSS
                     SLASSSEEQSTFTVITSSSDGEVSSTEEPFVSSSEAPEETSMSEVSTSFISTDISSSS
                     ELPSNTTTSSSSSSSSESSTSSSSTSSSTSSSTSTSSDLDETTTSSEEETTSTSVESS
                     SDPTTTHPPTTITSVINGVTILSDRYTTVTFTPTSTSDPDSREGQHTGLSDKNKRIVI
                     GVVVGLGVPILLVLLALIYIFCIKPKRTNFLNSEGKVVTAYTSGKVSKWWKAFMGKQT
                     DDYVTESPESGIDEPSVLAPTRNNTVGRNNTDGHRKSHSNELMLDEEKYYDDDGNELN
                     GRNY"
     gene            complement(<287031..>288167)
                     /locus_tag="KLLA0_A03201g"
                     /db_xref="GeneID:2896829"
     mRNA            complement(<287031..>288167)
                     /locus_tag="KLLA0_A03201g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451140.1"
                     /db_xref="GeneID:2896829"
     CDS             complement(287031..288167)
                     /locus_tag="KLLA0_A03201g"
                     /note="some similarities with uniprot|Q04951 Saccharomyces
                     cerevisiae YMR305C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451140.1"
                     /db_xref="GeneID:2896829"
                     /db_xref="GOA:Q6CY49"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:Q6CY49"
                     /translation="MRLNYVLSKTLALASVVSAAAVHKHHAAEEKRDVTVVVTNFVDQ
                     NGQVLVDGQTSATDATTTLQPVTDIGGGKSVETTTVTSSSGSSSSLSGSSTSSSGGTS
                     SSSSSTSSSSDASSSSSGEYGGALGITYSPYTSSGSCKSSDTIKSDIQNLSQFSVIRI
                     YDTDCDAMEAILSQLQSGQKIFVGIYDIDNIASSVSAIESAFNGDFSKVYAISVGNEL
                     INAGTSTVSQLSSAVESAKSKLSAIGYTGDVVTVDTLVATENNSGLCSMSDFIAVNCH
                     PYWDGNVEPSNCGPWVKQQLDNLSSTCNNGKKIIVTETGWPTKGDTYGSCVPSKSNQE
                     TCVQSIIDTLGSQAILFTTYNDYWKDAGAQGVEQYWGIFGDSSV"
     gene            <290002..>292035
                     /locus_tag="KLLA0_A03223g"
                     /db_xref="GeneID:2896463"
     mRNA            <290002..>292035
                     /locus_tag="KLLA0_A03223g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451141.1"
                     /db_xref="GeneID:2896463"
     CDS             290002..292035
                     /locus_tag="KLLA0_A03223g"
                     /note="similar to uniprot|P39932 Saccharomyces cerevisiae
                     YDR536W STL1 Glycerol proton symporter of the plasma
                     membrane, subject to glucose-induced inactivation,
                     strongly but transiently induced when cells are subjected
                     to osmotic shock"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451141.1"
                     /db_xref="GeneID:2896463"
                     /db_xref="GOA:Q6CY48"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CY48"
                     /translation="MSDSTDKDRHNKNSSRGIVNTDIEDDNSPSPLDTTDKKGAPELQ
                     KPGNPSLFKESALKNSDQLQFRNSFNIPNAVGGTNGIVIPPNVQPLDQQRIPPSYTDH
                     LQVKDTYLTGRTLLYFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGT
                     MVSILEIGALVSSLLVSNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRII
                     SGIGVGLLSTIVPIYQSEISPPHNRGKLACIEFTGNIVGYASSVWVDYACSYIESDTS
                     WRLPLFIQCVMGLLLFLGSFVIVETPRWLLNHDHDIEGLVVIADLHSDGDVLHSKAHE
                     EYKLIKETVLISRLEGEKKSLRFAFKRYRTRMLIAMSSQMFAQLNGINVISYYAPLVF
                     EQAGWVGREALLMTGINSIIYILSTILPWKLVDKWGRKPILLSGALVMGTSLLAIAMS
                     LWANVAATPRLVVVFVIIFNAFFGYSWGPIPWLYPVEIAPAMARSAMASASTATNWLF
                     NWLVGIMTPILQEKIHWRMYLIHTVSCYLSFWCVLKVYPETAGLRLEDMDSVFDDRSS
                     TFSFQSGTSAEIEQQSHLVSGGGEVAPSTRSRKSVYSNAQSMFNKDEIQPPTLTQVLQ
                     WKEERTQTKPLKKFIRRGSETVCLIYNKVRNLRSTNDTNQIEYGAVSNNQPPN"
     gene            complement(<292179..>293015)
                     /locus_tag="KLLA0_A03245g"
                     /db_xref="GeneID:2896541"
     mRNA            complement(<292179..>293015)
                     /locus_tag="KLLA0_A03245g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451142.1"
                     /db_xref="GeneID:2896541"
     CDS             complement(292179..293015)
                     /locus_tag="KLLA0_A03245g"
                     /note="highly similar to uniprot|Q12009 Saccharomyces
                     cerevisiae YDL201W TRM8 Subunit of a tRNA
                     methyltransferase complex composed of Trm8p and Trm82p
                     that catalyzes 7-methylguanosine modification of tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451142.1"
                     /db_xref="GeneID:2896541"
                     /db_xref="GOA:Q6CY47"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /translation="MSFSTRRQAYRAEKQDHRKELKHVKIDESVIEKVDKLSLPKKKF
                     YRQRAHSNPFSDHQLEYPISPAHMDWSKLYPHFYDSEKKKMTKDVTIADIGCGYGGLM
                     IDLSPEFPDEMILGMEIRVQVTNYVEDRIIALRTNHAKENGYQNINVLRGNAMKFLPN
                     FFNKGQLSKIFFCFPDPHFKQRKHKARIVTDTLLSEYAYVLKEGGIIYTITDVLDLHE
                     WMVKHLEEHPLFERLSEEWEAQDKCVSIMRNATEEGKKVERNKGDKYIACFVRLPTPD
                     II"
     gene            complement(<293329..>294066)
                     /locus_tag="KLLA0_A03267g"
                     /db_xref="GeneID:2896857"
     mRNA            complement(<293329..>294066)
                     /locus_tag="KLLA0_A03267g"
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /transcript_id="XM_451143.2"
                     /db_xref="GeneID:2896857"
     CDS             complement(293329..294066)
                     /locus_tag="KLLA0_A03267g"
                     /note="similar to uniprot|P36521 Saccharomyces cerevisiae
                     YDL202W MRPL11 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /protein_id="XP_451143.2"
                     /db_xref="GeneID:2896857"
                     /db_xref="GOA:Q6CY46"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:Q6CY46"
                     /translation="MLSLLLRSPVVVSRVSYASPFLVRRFASTQIERTVSDAVRRTVK
                     PLDSRKTFLIDSYKNLMETSPVMLFCHHNNLMKGENAHFREEINKVGGKLTILRNNLF
                     QVYLRNSRKNDPAAPAKRSEQDWKHPLLPLFKGPTAAISFPETDPAKVKKVMKLLEKA
                     QDKLFVIGAKVENDAYDLRQLDSFKDLPTKSQLQSELLGLLHVLSGAGLVQTLEAGSN
                     MLYLTLKSHEDNINPDKQKNENDSEGN"
     gene            complement(<294825..>295898)
                     /locus_tag="KLLA0_A03289g"
                     /db_xref="GeneID:2896801"
     mRNA            complement(<294825..>295898)
                     /locus_tag="KLLA0_A03289g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451144.1"
                     /db_xref="GeneID:2896801"
     CDS             complement(294825..295898)
                     /locus_tag="KLLA0_A03289g"
                     /note="weakly similar to uniprot|P47177 Saccharomyces
                     cerevisiae YJR149W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451144.1"
                     /db_xref="GeneID:2896801"
                     /db_xref="GOA:Q6CY45"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:Q6CY45"
                     /translation="MSTKKALTEILGIKYPILVAPMAGVSTPELAAAVSNSGGLGSLG
                     LGASSVEKARNAIIATQKLTKSPFQVNFFCHEPEELNVEVARNWIEYLKPIFARFHTK
                     PEKELTKIYNSFLEDPEMLAVVLELKPKVVSFHFGVPSASTLKSLKQAGVVTMASVTQ
                     LSEAELAIGHGIDILIAQGVEAGGHRGMFNASLDPAISTRDLVKLLKAKLGTTIPIVA
                     AGGIMSGQDIKGMMEVGASGAQLGTAFVQCKESAASENYRKLLFDKTRNDITQITSSI
                     SGRPARALLNSWHTEVDIPTRVIHPGYPFTYDVGKQLNAVSIPDHDGTANSFAAHWAG
                     SNVSRIRDMDARQLMQTLVDEMR"
     gene            <296290..>297294
                     /locus_tag="KLLA0_A03311g"
                     /db_xref="GeneID:2896606"
     mRNA            <296290..>297294
                     /locus_tag="KLLA0_A03311g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451145.1"
                     /db_xref="GeneID:2896606"
     CDS             296290..297294
                     /locus_tag="KLLA0_A03311g"
                     /note="uniprot|O60012 Kluyveromyces lactis Putative
                     sulfate transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451145.1"
                     /db_xref="GeneID:2896606"
                     /db_xref="UniProtKB/TrEMBL:Q6CY44"
                     /translation="MLTDLFSALFSIEDGTTESVTPKYGHGVQEDDIDLQLRALIYCY
                     QRLKVKEMSPFYPVDSTTEDGETLGDGSVALDKVYNLEQFIAMLQEDPHHILVDWCKN
                     KARLMCILSSTPVRTVNKLPKGFSYLILEPDSSEDLYFQRLVYDSKLYHEHDVPLSWK
                     IQCLREIIKKQYTLVPTRRKSFNKQDRWQIMIRYLSKLAEHVQIERVYKAYRSQPPAT
                     RRLSNSSDGSEQSMLTRGLKSKPSMTILRLDRSVTSRSTTHTSALSRNQPNSPLILSR
                     SPSPKKSSNYNAFTNTHNSTNNDSLLYQQSRNCVIKRLEREKQRRESESEQALISTSL
                     "
     gene            complement(<297542..>299665)
                     /locus_tag="KLLA0_A03333g"
                     /db_xref="GeneID:2896335"
     mRNA            complement(<297542..>299665)
                     /locus_tag="KLLA0_A03333g"
                     /product="acetate--CoA ligase"
                     /transcript_id="XM_451146.1"
                     /db_xref="GeneID:2896335"
     CDS             complement(297542..299665)
                     /locus_tag="KLLA0_A03333g"
                     /note="highly similar to uniprot|Q01574 Saccharomyces
                     cerevisiae YAL054C ACS1 Acetyl-coA synthetase isoform
                     expressed during growth on nonfermentable carbon sources
                     and under aerobic conditions"
                     /codon_start=1
                     /product="acetate--CoA ligase"
                     /protein_id="XP_451146.1"
                     /db_xref="GeneID:2896335"
                     /db_xref="GOA:O60011"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /translation="MSPAVDTASTAKDPISVMKSNASAAAADQIKTHEYEHLTSVPIV
                     QPLPITDRLSSEAAQKYKPNLPGGFEEYKSLHKESLENPAKFYHERAQLLNWFKPYDQ
                     VFIPDTEGKPTFENNAWFTNGQLNACYNLVDRHAFTQPNKVAILYEADEPGQGYSLTY
                     AELLEQVCKVAQILQYSMNVKKGDTVAVYMPMIPQALITLLAITRIGAIHSVVFAGFS
                     SNSLRDRINDAYSKTVITTDESKRGGKTIETKRIVDEALKDTPQVTNVLVFKRTHNEN
                     IKYIPGRDLDWDEEVKKYKSYTPCEPVDSEHPLFLLYTSGSTGAPKGVQHSTAGYLLQ
                     ALLSMKYTFDIQNDDIFFTAGDIGWITGHTYCVYGPLLQGCTTLVFEGTPAYPNFSRY
                     WEIVDKYQVTQFYVAPTALRLLKRAGDSFTEGFSLKSLRSLGSVGEPIAAEVWEWYSE
                     KIGKNELPIVDTYWQTESGSHLVTPLAGGATPMKPGAAAFPFFGIDLAVLDPTTGIEQ
                     TGEHAEGVLAIKRPWPSFARTIWKNNDRFLDTYLKPYPGYYFTGDGVARDKDGFFWIL
                     GRVDDVVNVSGHRLSTAEIEAAIIEDDMVAECAVVGFNDELTGQAVAAFVVLKNKSSL
                     TAASESELQDIKKHLIITVRKDIGPFAAPKLIVLVDDLPKTRSGKIMRRILRKILAGE
                     SDQLGDVSTLSNPGIVKHLIDSVKL"
     gene            <301465..>303819
                     /locus_tag="KLLA0_A03355g"
                     /db_xref="GeneID:2896803"
     mRNA            <301465..>303819
                     /locus_tag="KLLA0_A03355g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451147.1"
                     /db_xref="GeneID:2896803"
     CDS             301465..303819
                     /locus_tag="KLLA0_A03355g"
                     /note="similar to uniprot|P39719 Saccharomyces cerevisiae
                     YAL053W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451147.1"
                     /db_xref="GeneID:2896803"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:Q6CY42"
                     /translation="MRAFSLLVGFLTTLVILPFTNGLKHIKTSSLLTCMEDSQFSASF
                     FEVTFFPDNKTAVFDIDATTTISENVTAKIELIIYGLNVLNEEFNLCDLDQASMCPLS
                     AGRIEVKSTYSLDEDNDMVGNIPGVAYTVPDIDAQVRVIVYSTNDTSFEEPLACVQAA
                     LSNGKTVQTKYAAWPIAAISGLGVITSAIVSVIGHSTTAAHIASNSISLFVYFQNLAI
                     TSMMGVARVPPIAAAWTQNFQWSMGMIKVGFMQNIFDWYVTATGGTPVVVVANKDILS
                     ISVQKRGFTTQFNDFAKRSLDSLTTGLYKRISADDGYDFTKLLSESDLYTSDERNIDD
                     ISSKVIVFTGIKRVAYLAGIELSNVFLTGIVFTLFFVFCMVIGMAVFKAVIELLMRAG
                     YMKQTSKFYEYRRSWASIIKGTLFRICIIAFPQVSILSIWEFTQIDSVAVVIAAVVIL
                     IVVSGLLLYGVVRVIIRGRESTRLYKTPAYMLYGDAPFLNRFGFLYVQFKAEMYWWLM
                     PLLAYMFFRSLFVAVLQEHGKPQAMIIFVIELAYFIALCWLRPYLDKRTNAFNIVIHA
                     VNLFNSILFLFFSNLFRQPTVVSSVMAVILFVVNAIFALFLMIFTIVTCVLALVHKNP
                     DARYQPMKDDRVSFIPKVQTKGETGELFDLGRAAMHTNEPPLKDEFEMKQSNNSARLL
                     FDEDIDDSNTTYDTSSRIRRFDSSSGNEPLQPSSAVMGDNTTSYNRVPTAPSTTNLRK
                     PENSFSANTQYQGFSGSNPYLNENPSYNSFTRQTNNKSDNVPYL"
     gene            complement(<304117..>304863)
                     /locus_tag="KLLA0_A03377g"
                     /db_xref="GeneID:2896686"
     mRNA            complement(<304117..>304863)
                     /locus_tag="KLLA0_A03377g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451148.1"
                     /db_xref="GeneID:2896686"
     CDS             complement(304117..304863)
                     /locus_tag="KLLA0_A03377g"
                     /note="similar to uniprot|P39721 Saccharomyces cerevisiae
                     YAL049C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451148.1"
                     /db_xref="GeneID:2896686"
                     /db_xref="GOA:Q6CY41"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CY41"
                     /translation="MASNPPGKCCAQGFYHEGTPAGTTTSLYGFETYVAGPESLKNEH
                     VLVIVTDIYGIKVNNVLLIADQLAAAGFRVYVPDFLFNDEVVALDGSFDFKSWLERHS
                     AEKTHGLVQDFLTKLKEDTNPKKIGVIGHCFGAKYALLQINEKVGLADAAALAHPSFV
                     EIEEVEAVGKKPVLISAAETDNIFPEELRYKTEEALKKQGSYYQINVFGGVSHGFAVR
                     GDLSIPAVRYAQDKTIEDQISFFKFFFNCI"
     gene            <305616..>308153
                     /locus_tag="KLLA0_A03399g"
                     /db_xref="GeneID:2896533"
     mRNA            <305616..>308153
                     /locus_tag="KLLA0_A03399g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451149.1"
                     /db_xref="GeneID:2896533"
     CDS             305616..308153
                     /locus_tag="KLLA0_A03399g"
                     /note="weakly similar to uniprot|P39720 Saccharomyces
                     cerevisiae YAL051W OAF1 Oleate-activated transcription
                     factor acts alone and as a heterodimer with Pip2p
                     activates genes involved in beta-oxidation of fatty acids
                     and peroxisome organization and biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451149.1"
                     /db_xref="GeneID:2896533"
                     /db_xref="UniProtKB/TrEMBL:Q6CY40"
                     /translation="MGTNATLKELEKEVEYWRNLALGIEPEQDPVSNVSTTIRTSVAR
                     LSATKDLAKTDGIRLNFYESFPHLVTKGIIREDIGPFAVNYMLFPDPYISIFIKFVFQ
                     TPYRKTLNTYLGTPDSYQEFNVSSILKILKLNPSAFEKLNPLKKKKVSAFIEQILAQN
                     QPASENSNSELFLATLNTMTAPRFIEDKCLYGQYSPILLAYIGRIQNDLPSLPNIRLL
                     LDNFYHHIYPIWPCIDIDLFEENLNEVIHMDSHNPERIIVNPGTTNIKMKLVNISILY
                     LILQLSISHWKLRLFDQRAMEQDVQHKYDGDRAWIEGFAELEKKLTSSAAELVSILNI
                     YQSRTEEVISWHMLLWNILAHQPDLCSIFYDSTSEGVIGMMGPLVSDLGLDRDPSQFL
                     EPTGNMRIDPRYKNYRRRLWLCYCLISRFEITVKGRTPQKSTANVQAIPGIMDQKNGW
                     EEYSCLYKKDMLKQNEAELELLGLFYRHLQFMTLFLPYDKLLKDNLNSLTLTEVEQVY
                     EGLERYLEKDVNGTFTHSQKWARHSTIDYSYNLNDVDNVFNMAKQLIARSVRLTICDL
                     LIRFFNSRKVHNSFDMEQSLLYCQKALADNCEGIGYLIKYFALVYNENIRTTGKFFTN
                     RISQILLSRCTLHTTLTILRVDHMLGLSKRRSNQESFLYEDQSAFSRLSGINEQRQQC
                     VRIRMQLFSLLENLCSASSEELRYNYISGFRYALLTDCAMHFLKQNGKRFLMRDILMS
                     NIGTNEDSAGFMETSFHLLSSEEKENILLSANEFVHFDEAGFRLLLDTVNTFCTNSGS
                     PNNRNTMPEQLFGYTATSSNVLINQFSVDLAGLSANFDFVFDGGNLP"
     gene            <308414..>311056
                     /locus_tag="KLLA0_A03421g"
                     /db_xref="GeneID:2896351"
     mRNA            <308414..>311056
                     /locus_tag="KLLA0_A03421g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451150.1"
                     /db_xref="GeneID:2896351"
     CDS             308414..311056
                     /locus_tag="KLLA0_A03421g"
                     /note="weakly similar to uniprot|P39720 Saccharomyces
                     cerevisiae YAL051W OAF1 Oleate-activated transcription
                     factor acts alone and as a heterodimer with Pip2p
                     activates genes involved in beta-oxidation of fatty acids
                     and peroxisome organization and biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451150.1"
                     /db_xref="GeneID:2896351"
                     /db_xref="GOA:Q6CY39"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CY39"
                     /translation="METNQEANLKAKKRYKLSFVCQLCRKSKTKCDRKKPSCARCQRL
                     NKPCIYDLEYQPLPRKPNKDAALARLQKELEYWKYFANARLSEMKKMDSTGSEALSET
                     SSDYLPKHKINLSAFKPQLVYQEFRFMELKVFTNMSQIKHDCFLSTFLGTFFASASKE
                     ELLHNVSPYLSYHANNDNSKYIDRVLHLRQNLLMRFTTEAQSNRIQDFTDRLLTGREV
                     LVNYRTAFFVTMLRNVFFQGKFEDSKKQEDPCPPLLERLVSEANILLPKKDALLLYKS
                     YFYRRLYHIYPYFDIGMFEETLDKILVDDSERPDRMIFDIGIENFRYKLTNIALLMLV
                     LKISYGALQAVIDTDYNAEICDSDFIKQNPVVDQCIVFAEICLAKMCIFSGTNEVQIS
                     CMLFIWNFFCVGNGDDDSVFGRATDIVTEMVFTLAMNNGLGRDATQYQQYQMHPSVQI
                     ELQNLRRKLSLNVISTSVFSGILTGNFPTNIWSNAKNFLNLNGGRDEFMGLVKRSMKE
                     IDPFELKIHNVLFKTYKILVLLMDLEDLVKKGSPGMDLIRIDFITNAITEALNLNFSM
                     DFDFIGGPKSYKVELSNGKILECDVIDSYHNVQTQIIVRNLMIHLNKTLFLYFEDLCV
                     KGNMDNLIYYKKYLIESTRHTLELAKLSILILEGDFDRVLTDGFNMEKCKMSTEIVFP
                     TILYSLLAFGIRLAHAELSLTETIETFDASIIDVSALQNRLKLLTNLRKNTLYAIGRL
                     ADAMSASFQYKNFCTFRSLLFIDAVIKLDMSRGLMDMMFYALNPQNGVFDKLNSEMKE
                     LLTHTLGVNHEKLREELDNLERAQFLSIVDEKFLLEIQSMMQALRFSYVDISNEADPE
                     ILPMTRPPSMPHGVSVLNDYFKQP"
     gene            <311628..>314555
                     /locus_tag="KLLA0_A03443g"
                     /db_xref="GeneID:2896551"
     mRNA            <311628..>314555
                     /locus_tag="KLLA0_A03443g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451151.1"
                     /db_xref="GeneID:2896551"
     CDS             311628..314555
                     /locus_tag="KLLA0_A03443g"
                     /note="similar to uniprot|Q758X5 Ashbya gossypii ADR403C
                     ADR403Cp and weakly similar to YAL051W uniprot|P39720
                     Saccharomyces cerevisiae YAL051W OAF1 Oleate-activated
                     transcription factor acts alone and as a heterodimer with
                     Pip2p activates genes involved in beta-oxidation of fatty
                     acids and peroxisome organization and biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451151.1"
                     /db_xref="GeneID:2896551"
                     /db_xref="GOA:Q6CY38"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:Q6CY38"
                     /translation="MAMKEESIEPADDEKSREDQTSNGACKRQRISFVCQACRKNKTK
                     CDREKPRCGRCVKYHLKCVYDVEQQKPPRVPSKDAIIKRLTSEVEYWKSKAEGFQVSS
                     NVSTTSPSDVESLHTSKRQRTGDGAPLLADVSVLSPTPVISKNSSFLVPDPQDLQFNF
                     YKEFPQLTMKYAMKRDIKPVSAFAHVYRDKLLSLFVASIFSSASKSALIHSISSDEIN
                     PFQKSQIQFRQNAIFLRDSMVQLCETSMEKQKVHEFTERIMGEQIEQKEQSTLFVSLL
                     KARLENKHVEDSCSHGVVSPELTRLKDSLEKALPSREDIDLYKMHFYQYIYPIIPFLD
                     IELFEEGLDELLNPSDGTDGRKVTICFGTRNIRSKICLLSALINILRISYLCMLFTLN
                     SSKEDVFDDSTLKVLTTSPITPSLVMLSQECISSVNILSWTTENGLLALMYHWAVFVF
                     TPEEGDCYLGQTTDALISLVSNLAVNIGLHRDPNEYKVLQDPTICDPRVFNLRKRLWL
                     CIYIMCRHETTLKARYHQNTHMSSFAYASPECETKNFWCYDFGDPNRLGPYNVNMIDK
                     IKKRHQIFLLLSETDAVTMNLDTHMTLSDLDAWFKKVKSFLDEEFPLDGLINGVNTPQ
                     FYDLVLKNGKRVSVNFTYFGNALCFQTHLIARMSMLRISACLMVHFENRLSDMTHDYS
                     QYFTKYFIESFKSLLEIAKIYQSYLTGDYNASLSPCMLFATDKICEVCLPSILLTFLG
                     MLIRITHTESFLIKQTVDRKGLYGLSSYIPEELKENENKLVAVTAIRKGLEVVMQNWL
                     TLITKRLRFAFFSTFKVSIFFDYVLQIIKKQDILNVLKRVFDLNFSPKVRREIYMGTG
                     IDINDKHAVLLSLEKGNRVSVVSAESFEEILAMMDALQICNHYPEISTEHNDPNGVLP
                     EEPNSVNVTEKIAHKPSPIPMPNDNTEPTENELLEPTNMTSLLNGATFDFFDYDFLLG
                     PTE"
     gene            complement(<314573..>316552)
                     /locus_tag="KLLA0_A03465g"
                     /db_xref="GeneID:2896350"
     mRNA            complement(<314573..>316552)
                     /locus_tag="KLLA0_A03465g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451152.1"
                     /db_xref="GeneID:2896350"
     CDS             complement(314573..316552)
                     /locus_tag="KLLA0_A03465g"
                     /note="highly similar to uniprot|P39722 Saccharomyces
                     cerevisiae YAL048C GEM1 Evolutionarily-conserved
                     tail-anchored outer mitochondrial membrane GTPase which
                     regulates mitochondrial morphology cells lacking Gem1p
                     contain collapsed globular or grape-like mitochondria not
                     required for pheromone-induced cell death"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451152.1"
                     /db_xref="GeneID:2896350"
                     /db_xref="GOA:Q6CY37"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013566"
                     /db_xref="InterPro:IPR013567"
                     /db_xref="InterPro:IPR013684"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR020860"
                     /db_xref="InterPro:IPR021181"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTKTRIRIVVCGDSGVGKTSLIACLVKDQFISWLQDVLPPITIP
                     KDFSSSRYSPENTVVVDTGNSDLATLHKELKNADVIWLVYSDHDSYERIALYWMMMFR
                     SLGVNLPVVLCRNKCDDEVEFLSSANIMDSDDDQLDNKIEDEEFIPILREFKEVETCI
                     KASAKFKFNVNQAFYLCQRTITNPVAPLFDARIGELKPLGVLALKRVFVLSDMDQDGF
                     LNDDEITKLQKKCFSKAVDVNELQFLKDTLTSISSPNQEYEDYILNVPGKGITKDGFL
                     VLNKIYAEKGRHETTWGILRAFHYTDTLTINEKILRPKIDIPQSSSVELSPLGYRFFV
                     DTFLKYDKDNDGGLNNDELHLLFKTTPGLPHLWIETNFPFLTVVNNSACITLQGWLAL
                     WSMTTFIDYSVTTEYLIYLGFDKDAKNALQITKPRRKRRRNGVYYRAPVFDRKVLNCY
                     MLGKGNSGKSSLLESFLGRSFSEAYSPTIRPKISVNSLELKGGKQYYLILQELGEQET
                     PILENKGKLDECDVLCLCYDSSDPESFSYIVSLIDKFDYLKELPIVFVALKADLDKQQ
                     QRCHIQPDDFADQLFIDHPLHISSTWPSSLNELFIKLTEVALEPITSTAGLGPAVLTN
                     DIDYRQTIVAISSVVGFASLFTFTALKIYSSFKNT"
     gene            <316951..>317940
                     /locus_tag="KLLA0_A03487g"
                     /db_xref="GeneID:2896346"
     mRNA            join(<316951..316953,317116..>317940)
                     /locus_tag="KLLA0_A03487g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451153.2"
                     /db_xref="GeneID:2896346"
     CDS             join(316951..316953,317116..317940)
                     /locus_tag="KLLA0_A03487g"
                     /note="similar to uniprot|P21242 Saccharomyces cerevisiae
                     YOR362C PRE10 20S proteasome alpha-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451153.2"
                     /db_xref="GeneID:2896346"
                     /db_xref="GOA:Q6CY36"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CY36"
                     /translation="MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCED
                     GVVLAVEKLITSKLLVPGKNKKIQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKM
                     YSTPIPIPAFADRVGQYVQAHTLYNSVRPFGVTAIFGGVDSDGAHLYMLEPSGTYWGY
                     KSAATGKGRQSAKAELEKLSNKNPNLTAREAVKEAARIIYAAHEDNKEKEFELELSWC
                     SLSETNGLHKEVPKDLFDEAVDYAKKELGDDSDSDSDDSDGDDTKEKKDEEGDIEIS"
     gene            complement(<318067..>320397)
                     /locus_tag="KLLA0_A03509g"
                     /db_xref="GeneID:2896552"
     mRNA            complement(<318067..>320397)
                     /locus_tag="KLLA0_A03509g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451154.1"
                     /db_xref="GeneID:2896552"
     CDS             complement(318067..320397)
                     /locus_tag="KLLA0_A03509g"
                     /note="weakly similar to uniprot|P39723 Saccharomyces
                     cerevisiae YAL047C SPC72 Component of the cytoplasmic
                     Tub4p (gamma-tubulin) complex binds spindle pole bodies
                     and links them to microtubules has roles in astral
                     microtubule formation and stabilization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451154.1"
                     /db_xref="GeneID:2896552"
                     /db_xref="UniProtKB/TrEMBL:Q6CY35"
                     /translation="MSDSDSVIIETKLRSGSDLDEGIRNLSLLDTDDNLKFELESGKK
                     ERQQEYDGSCNQIAIDTSKDDYVNKYYCNVPRRINSAVSEEDEEETTTDNTTSETDTV
                     ISSGDIFQLISSDNRWIKEDGRVPAVIGRNNDTHEKYRFPNDSRKVSTQRLQRGTIND
                     FYPPNIADSHLMTSETDVLKRQLVQYRVKVKALTEILKQVNFNNDQKLQATQNTENIT
                     NDFESHANTNIEEVEDSPLLREQNVKLVITLEDKNKELIRLKEELVRNKDEYETMLEE
                     VNDYLQHNENISNDVSNILKFLLDNMDLTAEERDNLIKAAGFESTFIDIKIKALSVNV
                     DKIVRELRTIKNSDQSSGNLLADQGTISPLNDSRLDNSEVLDSKLELAIETMHEKYHD
                     FLQSIQLKLEKNDNLEKALKDKFQQQKLLLESMSNIEHERTSQQIPPLYLQRSQSDLF
                     SSIDDLSKRASIELSKSYQDHVDALNSMLQNYKRELEDKEKQLGELRSQLRNSYNTNT
                     ELDLANKIKEQSLTLEENSARWHTQRIEYESRIEVLQDEKKDLSQKLIDAQAQMQMLE
                     ARTEEDVMELRKKLKTALRKSTYYMDDNQLLQEQLEELGNDHHILQDEIIKLREHVNK
                     FSDADKGSQQLTIIKSKLLDHLRAIFGSFEKVLQKESIDQAFNKLHNLEQLDSAKFFK
                     KTIAKLDSVFFFIESAIESIVTEHVDLLLNEKEEWSGSSQNDEVEKQSKLKIDELRKK
                     WIGERERRKLESEAATNRINMLQLENQRLREQLGIQ"
     gene            <320828..>323026
                     /locus_tag="KLLA0_A03531g"
                     /db_xref="GeneID:2896595"
     mRNA            <320828..>323026
                     /locus_tag="KLLA0_A03531g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451155.1"
                     /db_xref="GeneID:2896595"
     CDS             320828..323026
                     /locus_tag="KLLA0_A03531g"
                     /note="similar to uniprot|P06103 Saccharomyces cerevisiae
                     YOR361C PRT1 Subunit of the core complex of translation
                     initiation factor 3(eIF3) essential for translation part
                     of a subcomplex (Prt1p-Rpg1p-Nip1p) that stimulates
                     binding of mRNA and tRNA(i)Met to ribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451155.1"
                     /db_xref="GeneID:2896595"
                     /db_xref="GOA:Q6CY34"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR011400"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013979"
                     /translation="MTTLESLKIEDIPVDDIDFSDLEREFQIQDGGVNFDNFLVVDGA
                     PVAPEAKVPVLEKVLTKLFSQAGKVLDMQIPVEDGKTKGHLFIEMESVSAAKEAIQLF
                     NGKKLDAKHRLLVNSLNDMEKYGSDDFESQSHEPVVPDFAPTDFLRSWLQNQDGRDQF
                     VLQKGDMTRVFWNRLAHQPDGVGEARKNWSNDVVKFSPKGTYLLSFHDQGVTSWGGPN
                     FDRLKRFFHPDVSRLDVSPTEKFLITFSMNPIKPGEDTPFGPESEGHQICVWDLATGF
                     LMKTFGIPPNAKLQWPLIRFSYDDKYCGRLGPNALAIYDIENNFQLLDGKLHKVEGIQ
                     DFSFAPKGVQLTYNRRKSDPTTLLAYWTPETNNQSCKAFLMTLPNKRIVKTVNLVQVS
                     NVSIHWHEQADFVCFQVDRHTKSKKTFFTNLEICKLNESEIPVEKIEMKDRVLELAWE
                     PKGTRFVTISKMDNGGEENPMYPKNFVKFFAPEKKDNKDKDLAVLPDQLKWKLVKTVD
                     QQFANCISWSPAGRFVAVCTIVNGKEIKKASLDFYDFDFTGEKTLNEVQDVKASLQAV
                     AHIDNQFFTDLEWDSSGRFLTAWSSYSKHKLENGYTIYNCCGEAVRKEIVDQFRNFVW
                     RPRPESLLSNAEKKKARKNLKQWSVKFEEQDAMESDSALRDLILKRRAELSAWVSYRE
                     QSKERLESEDSYTIFDNFESDKADETQYVTVEEVKEEILEETQEEVESFE"
     gene            complement(<323382..>323657)
                     /locus_tag="KLLA0_A03553g"
                     /db_xref="GeneID:2896572"
     mRNA            complement(<323382..>323657)
                     /locus_tag="KLLA0_A03553g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451156.1"
                     /db_xref="GeneID:2896572"
     CDS             complement(323382..323657)
                     /locus_tag="KLLA0_A03553g"
                     /note="similar to uniprot|P39724 Saccharomyces cerevisiae
                     YAL046C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451156.1"
                     /db_xref="GeneID:2896572"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q6CY33"
                     /translation="MFRKTLTTLGRRLYSLTPEEKLITDKLSKELNPSSISVNDISGG
                     CGSMFSINITSDKFKGLSIVKQHKLVNEILKDDIKRWHGLQLRTKKE"
     gene            <323999..>324361
                     /locus_tag="KLLA0_A03575g"
                     /db_xref="GeneID:2896799"
     mRNA            <323999..>324361
                     /locus_tag="KLLA0_A03575g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451157.1"
                     /db_xref="GeneID:2896799"
     CDS             323999..324361
                     /locus_tag="KLLA0_A03575g"
                     /note="similar to uniprot|Q3E793 Saccharomyces cerevisiae
                     YAL044W-A Similar to pombe uvi31 putative DNA repair
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451157.1"
                     /db_xref="GeneID:2896799"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:Q6CY32"
                     /translation="MSFRSIFRQMSSVAANRSIDGPIAQRITKKVKDTFPDLSHFAIF
                     NDSYKHSGHHGIQDAANKIESHFRLEIVSGLFKGKSLPMRHRMVYGMLNEEFDDGVHA
                     LQLTTKTPEEYAKKHAEN"
     gene            complement(<324491..>325018)
                     /locus_tag="KLLA0_A03597g"
                     /db_xref="GeneID:2896641"
     mRNA            complement(<324491..>325018)
                     /locus_tag="KLLA0_A03597g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451158.1"
                     /db_xref="GeneID:2896641"
     CDS             complement(324491..325018)
                     /locus_tag="KLLA0_A03597g"
                     /note="similar to uniprot|P39726 Saccharomyces cerevisiae
                     YAL044C GCV3 H subunit of the mitochondrial glycine
                     decarboxylase complex required for the catabolism of
                     glycine to 5 10-methylene-THF expression is regulated by
                     levels of levels of 5 10-methylene-THF in the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451158.1"
                     /db_xref="GeneID:2896641"
                     /db_xref="GOA:Q6CY31"
                     /db_xref="InterPro:IPR002930"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR017453"
                     /db_xref="UniProtKB/TrEMBL:Q6CY31"
                     /translation="MFSSSISRTAFVSSRIAKSTVSRLFLRAQSTNALNQSQLPFTFS
                     QTGPKTVKYTTQHEWVAAHPDGSAFIGITKYAADALGDATYVELPDVDTELEAGDSFG
                     SVESVKSASEIYSPVAGTVVEVNEALSDSPQLINSDPAGEGWIIKIKINDEADLQSDE
                     LLSLEQYEAHLKEDH"
     gene            <326530..>328080
                     /locus_tag="KLLA0_A03619g"
                     /db_xref="GeneID:2896545"
     mRNA            <326530..>328080
                     /locus_tag="KLLA0_A03619g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451159.1"
                     /db_xref="GeneID:2896545"
     CDS             326530..328080
                     /locus_tag="KLLA0_A03619g"
                     /note="similar to uniprot|P06776 Saccharomyces cerevisiae
                     YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
                     component of the cAMP-dependent protein kinase signaling
                     system protects the cell from extracellular cAMP contains
                     readthrough motif surrounding termination codon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451159.1"
                     /db_xref="GeneID:2896545"
                     /db_xref="GOA:Q6CY30"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:Q6CY30"
                     /translation="MTVHVCCVGPCVEVIKRLSRDSDHVSIQKFDSVTQVMMWFFQKR
                     LQDKSMTFEGSCLFICYDPIRTKLRSTSVLNSMDPETLSCFISDMFPCFNVMCVPSAN
                     FIDYYESVILNTDMIGNDDSDEDMDRISSVYRWMYSGSESLTDGSEEHHDLPCSNNLY
                     TMASHLAYVNSNDRLKRERVPIWDYIDITDMIKSNLSHNDAYYWKCLDSWDFCAHSLN
                     CTELIWCAYLLFHKLNTESNLSHAPPSTNRLLLMLLNIEAAYHQGNKFHNFRHAVDVL
                     QATYQLCHLLELPKLASFLLCIAAIGHDVAHPGTNNMLFNKYVSPISKYYKEQSVLEN
                     FHADIYLDILSHYWPELSQEFTGIKDSIIATDMALHNHYVETIKQETGPNLTGLTSLI
                     IKAADISNVTRPLLISAKWAALISMEFKECAVLEKNLVELADAKDDEKKRISYKLDLD
                     FDSYSELPSNIDDILKEFPNIPKGQAFFIDTFALSLFSGLGLKYKQLQFLVDNVENNR
                     KFWMERGD"
     gene            complement(<328807..>330186)
                     /locus_tag="KLLA0_A03641g"
                     /db_xref="GeneID:2896691"
     mRNA            complement(<328807..>330186)
                     /locus_tag="KLLA0_A03641g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451160.1"
                     /db_xref="GeneID:2896691"
     CDS             complement(328807..330186)
                     /locus_tag="KLLA0_A03641g"
                     /note="some similarities with uniprot|Q08831 Saccharomyces
                     cerevisiae YOR359W VTS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451160.1"
                     /db_xref="GeneID:2896691"
                     /db_xref="GOA:Q6CY29"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /translation="MSSQNMLSSLPGRTQSPVNLPRGAHPGAVLLSPKGSSANLQALG
                     TNPTSPSQQPLFLNDLLNQQQFSLDSQLHLRDDLGRPSNMVSPLSNSAMNPTASNGST
                     FLDTFSRPTSSMAINHQPLPLQHSNSNANVMVNFTNDVNQLCNWISMLTPSQQNTVMD
                     NLLSSLNEEVLHSTKLKLDSLVHSGYISPQLGPIASPIPNKVQSQVHQAENPQPLNLD
                     SVLNGDNIYRQWSPLPQNTASPMQQPMYDYLADIPRPRSADPYNAFKKGGLSSGNANN
                     NSNNGNAISNLNSSNPFGTNTVSSTNMSNSNSSSSATGRKNMNQNQHQNQYLNRPQSP
                     TNIKANVFNKTSLATSSSNSGNALTTVNSASSTTSNFNCTNNSMNAKGLCDPKLLKNV
                     PAWLKSLRLHKYSEALGSKPWFELIYLDDEALENMGVSALGARRKLLKAFSIVREYKA
                     NDMIDSSAF"
     gene            complement(<331039..>333513)
                     /locus_tag="KLLA0_A03663g"
                     /db_xref="GeneID:2896615"
     mRNA            complement(<331039..>333513)
                     /locus_tag="KLLA0_A03663g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451161.1"
                     /db_xref="GeneID:2896615"
     CDS             complement(331039..333513)
                     /locus_tag="KLLA0_A03663g"
                     /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
                     YAL043C PTA1 Subunit of holo-CPF a multiprotein complex
                     and functional homolog of mammalian CPSF required for the
                     cleavage and polyadenylation of mRNA and snoRNA 3' ends
                     involved in pre-tRNA processing binds to the
                     phosphorylated CTD of RNAPII"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451161.1"
                     /db_xref="GeneID:2896615"
                     /db_xref="InterPro:IPR021850"
                     /db_xref="UniProtKB/TrEMBL:Q6CY28"
                     /translation="MSTSVDPLVQLQQAAAMAMQHMPEQMLPKVLETGITLFLNDKRN
                     LGFSRFSTQLLLDILVHDKIPSSEKPFIVCQNITALWEMAETRDYVTYKNCILCLGNI
                     YDRLFDLVAKTSDDKLWSVMLKFKELIIANWKTCYPLDLSDNDLNNHSRGTGVKLASV
                     KLISKIIIVHTSGPGISVGSIPENHPVISNKQALEAEAKYLLDKLLTFLIEEPMMCAP
                     WFTGALHSLSFIMKQRPLATIRIASALLKFNIDMKFQRDDEPTLQYRLAKRFVERCYR
                     NLVQFGIKSQLLKNSGSMTQYRNKLAKISQTLFVIGEETKAKGILNYDPAAIEHKMTP
                     ADKKKYTRVKEVNDSSSDSSSGTFSATTKSPSPIQMPPIVSPMIGNTMMNTASTPPLL
                     NNFQPQIHAPVKNIPAPPPPPPDLSVLQSLQSYAFTKSTTKHPHFLNPAHTSVDNSYS
                     AVFALMNPVTSGFDVSKLSQDTMVKICTEALSNTNTGTAINGLSIVASRYTDLINKWL
                     QNNAQQQSATISNDSSPVPFNNSSQSQASKRPREENSAALPIKQEVAMKNEEPLQQPA
                     DDRYVIDDSAPIQPPESKRAKIERVEDAEPSSSHTVSLGVPTLTYDEKLTHLQRIVQN
                     ILLIPTKTDVSTPMTQLQSTNPLDKVLLMNWDNKTSWVFLLSRLCSRGVSSNQDVRDI
                     VTNAIFDYFCEDFQNRITLVLEWLSEEWYHEELISDGKDHTIYNEWSVKVLDFMIPKL
                     DDSHRRLFIRMVSEMPLLTQEHIEKMKSLCLDPTRSVLGFQSLKFMLMFRPPVKPFIK
                     VALESMAEVDESIKPQCDSLLNKYFS"
     gene            complement(<334065..>334535)
                     /locus_tag="KLLA0_A03696g"
                     /db_xref="GeneID:2896679"
     mRNA            complement(<334065..>334535)
                     /locus_tag="KLLA0_A03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451163.1"
                     /db_xref="GeneID:2896679"
     CDS             complement(334065..334535)
                     /locus_tag="KLLA0_A03696g"
                     /note="highly similar to uniprot|Q758Y6 Ashbya gossypii
                     ADR391W ADR391Wp and some similarites with uniprot|Q02516
                     Saccharomyces cerevisiae YOR358W HAP5 Subunit of the
                     heme-activated glucose-repressed Hap2/3/4/5 CCAAT-binding
                     complex a transcriptional activator and global regulator
                     of respiratory gene expression required for assembly and
                     DNA binding activity of the complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451163.1"
                     /db_xref="GeneID:2896679"
                     /db_xref="GOA:Q6CY26"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:Q6CY26"
                     /translation="MDQPAANNQENVTNEQGPLMDLEEDEEIDVFHNVGQGLAGRYRE
                     IMIQYWQELINEIESTNEPGSQFQDDFKSHSLPLARIKKVMKTDEEVRMISGEAPILF
                     AKACEIFITELTMRAWCVAEENKRRTLQKQDIADALQKSDMFDFLIDIVPRNVQ"
     gene            <334828..>335322
                     /locus_tag="KLLA0_A03718g"
                     /db_xref="GeneID:2896685"
     mRNA            <334828..>335322
                     /locus_tag="KLLA0_A03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451164.1"
                     /db_xref="GeneID:2896685"
     CDS             334828..335322
                     /locus_tag="KLLA0_A03718g"
                     /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
                     YOR357C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451164.1"
                     /db_xref="GeneID:2896685"
                     /db_xref="GOA:Q6CY25"
                     /db_xref="InterPro:IPR001683"
                     /translation="MCPQRQFQSFTTTAESTLSHTTHKQLSGATIYDEPENFLEIEVC
                     NPKTHFPSGDAKGMYTDYEIICRTNLPGFSKRSSSVRRRYSDFELFRKLLIKELQLSN
                     HPKVSVQHLPGKILLSNRFSDAVIEERRQGLNKWLASVAGHPLLQTGSKVLVRFIQDP
                     TFQG"
     gene            complement(<335548..>337287)
                     /locus_tag="KLLA0_A03740g"
                     /db_xref="GeneID:2896800"
     mRNA            complement(<335548..>337287)
                     /locus_tag="KLLA0_A03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451165.1"
                     /db_xref="GeneID:2896800"
     CDS             complement(335548..337287)
                     /locus_tag="KLLA0_A03740g"
                     /note="similar to uniprot|P38925 Saccharomyces cerevisiae
                     YOL122C SMF1 Divalent metal ion transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451165.1"
                     /db_xref="GeneID:2896800"
                     /db_xref="GOA:Q6CY24"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:Q6CY24"
                     /translation="MPENKFEVTEEYLDPQSMLELSMPGGASKLSVRQKLILKCRRAM
                     RMRDTEKKGSSSTDPVQSQYSLSLSSAEDKKRGFFGSVQDVLRKYMRFVGPGLMVSVA
                     YMDPGNYATDVSAGASNEFSLLCIVLVSNIIAIFLQSLCIKLGSVTGLDLSRACKKHL
                     PKWLNLTIYVFAECAIIATDVAEVIGTAVALNILLRIPLPAGVVITCIDVLFVLIAYK
                     PGSSSMRFVRMFEYAVALLVFGVVICFCVELAYIPKTPVGHIFRGFVPSKQMFEHNGM
                     YTATSILGATVMPHSLFLGSGLVQPRLLEYDVDHGYYDLLAEEDEDNVIEETEDTHSA
                     VKEKEDIEVIRERRYFNYQPTNSAIKYAMKYSIFELAITLFTFALFVNSAILIVAGAT
                     LYGSEEAVDADLYTIHSLLSKNLAPIAGTVFMLALLFSGQSAGIVCTIAGQIVCEGHL
                     DWNFKPWKRRLITRGISIIPCLIISLTIGRSALSKALNASQVVLSILLPFLVAPLIFF
                     TCKKSIMKVKVNNKDKLNAPTVIGEEEQPDEYIDMSNNWITTIIAFLVWIFISLLNVY
                     TIVQLGISHGDIS"
     gene            337927..338000
                     /locus_tag="KLLA0_A03762r"
                     /db_xref="GeneID:2896787"
     tRNA            337927..338000
                     /locus_tag="KLLA0_A03762r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2896787"
     repeat_region   338075..338509
                     /note="solo LTR"
                     /rpt_type=long_terminal_repeat
     gene            338524..338594
                     /locus_tag="KLLA0_A03784r"
                     /db_xref="GeneID:2896613"
     tRNA            338524..338594
                     /locus_tag="KLLA0_A03784r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2896613"
     gene            complement(<338807..>340615)
                     /locus_tag="KLLA0_A03806g"
                     /db_xref="GeneID:2896802"
     mRNA            complement(<338807..>340615)
                     /locus_tag="KLLA0_A03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451166.1"
                     /db_xref="GeneID:2896802"
     CDS             complement(338807..340615)
                     /locus_tag="KLLA0_A03806g"
                     /note="highly similar to uniprot|P06782 Saccharomyces
                     cerevisiae YDR477W SNF1 Protein serine/threonine kinase
                     required for release from glucose repression invertase
                     expression sporulation and for expression of
                     catabolite-repressed genes when glucose is limiting
                     regulates Adr1p-dependent transcription primarily at the
                     level of chromatin binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451166.1"
                     /db_xref="GeneID:2896802"
                     /db_xref="GOA:F2Z677"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:F2Z677"
                     /translation="MSHDPNQQQPHGGSGQGHHQRQLTNHAQGQHIGKYQIIKTLGEG
                     SFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVI
                     KSKDEIIMVIEYAGNELFDYIVQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKP
                     ENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSS
                     GVILYVMLCRRLPFDDESIPVLFKNISNGVYTIPNFLSQGAASLIKKMLIVNPVNRIT
                     VHEIMQDEWFKVDLPDYLVPAESTHQENSESKTEDGGPSVPLELIDDSLVQTLSNTMG
                     YDVDEIYEALESDEDHPSLNEIRDAYQLIKENRNLINDIKVNKQQSNDLDTFLSQSPP
                     TFEQSLHAPPGSKNRHSHRHSKRTQQRTYQYHYGNGSQDGDSTIAILPSSLPQIHRAN
                     MVAQGSQAAAKISPLSVKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEE
                     DLWTIRVRWRYNIDMPDDEMKNKQIPDLMKMVIQLFQIETNNYLVDFKFDGWESSNGV
                     VYSSRNDDEMSTFSAYPFLHLATRLIMELAVNSQGS"
     mobile_element  complement(341014..344221)
                     /note="DNA transposon of KLLA part of the newly discovered
                     ROVER DNA transposon family of the Kluyveromyces:
                     degenerate copy with probably 2 frameshifts"
                     /mobile_element_type="transposon"
     gene            <344642..>345098
                     /locus_tag="KLLA0_A03883g"
                     /db_xref="GeneID:2896684"
     mRNA            join(<344642..344725,344850..>345098)
                     /locus_tag="KLLA0_A03883g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451170.1"
                     /db_xref="GeneID:2896684"
     CDS             join(344642..344725,344850..345098)
                     /locus_tag="KLLA0_A03883g"
                     /note="highly similar to uniprot|P33328 Saccharomyces
                     cerevisiae YOR327C SNC2 mediate the targeting and
                     transport of secretory proteins vesicle-associated
                     membrane protein (synaptobrevin) homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451170.1"
                     /db_xref="GeneID:2896684"
                     /db_xref="GOA:Q6CY19"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:Q6CY19"
                     /translation="MSSSVPYDPYVPATEETAGDSKTAALKSEIDDTVDIMRDNINKV
                     AERGERLTSIQDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRMCLVLVVIILLIVII
                     VPIAVHFS"
     gene            complement(<345818..>350470)
                     /locus_tag="KLLA0_A03905g"
                     /db_xref="GeneID:2896682"
     mRNA            complement(<345818..>350470)
                     /locus_tag="KLLA0_A03905g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451171.1"
                     /db_xref="GeneID:2896682"
     CDS             complement(345818..350470)
                     /locus_tag="KLLA0_A03905g"
                     /note="similar to uniprot|P19524 Saccharomyces cerevisiae
                     YOR326W MYO2 One of two type V myosins involved in
                     polarized distribution of mitochondria required for
                     mitochondrion and vacuole inheritance and nuclear spindle
                     orientation moves multiple cargo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451171.1"
                     /db_xref="GeneID:2896682"
                     /db_xref="GOA:Q6CY18"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CY18"
                     /translation="MPYEVGTRCWYPSKDQGWIGAEVTKHTLQGDSYNLELTLEDGQK
                     VELLVSSLDETKEPSLPLLRNPPILETTEDLTSLSYLNEPAVLHAIKARYAQLNIYTY
                     SGIVLIATNPFDRVDQLYSQEMIQAYAGKLRGELEPHLFAIAEEAYRLMKTTDQNQTI
                     IVSGESGAGKTVSAKYIMRYFASVEENNEENAHHNLEMSETEKKILATNPIMEAFGNA
                     KTIRNDNSSRFGKYLEILFDDDTSIIGARVRTYLLERSRLVFQPKTERNYHIFYQILS
                     GLSDDEKSQLKLTDIQDYHYMNQGGDSHIEGVDDASEYGDTVEALSLVGISKDTQFQL
                     FKILAALLHIGNIEVKKVRNDASLSSDEPNLQIAADLLGIDAFDFAKWVTKKQIVTRS
                     EKIVSSLPYHQAIVSRDSVAKFIYSALFDWLVDNINTVLCNPEVVSEIYTFIGVLDIY
                     GFEHFQKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEQIEWSFIEFNDNQPCID
                     LIENKVGILSLLDEESRLPAGTDEGWTHKLYETLNKPPTNEVFSKPRFGQTQFIVSHY
                     ALDVTYDVDGFIEKNRDTVSDGHLEVLKASNNETLLSILETVDKNAEKLAEKQAQKQE
                     SQKKPGPASRKIVRKPTLGSMFKQSLIDLMETINSTNVHYIRCIKPNEDKEAWKFDNL
                     MVLSQLRACGVLETIRISCAGFPSRWTYTEFALRYHILVPSELWSNILLSDPSEEDVK
                     NLCKEILKRTMDDTAKYQAGNTKIFFKAGMLAHLEKLRTDKLFSSSVMIQKKIKGLHY
                     RKTYLRTVDAIKRLQANVSGKIIRLRTENEFKNNAALLIQSAYRGISVRDNVSSIIIS
                     IIRIQSMARKQITCKELLERRRGDAAVTIQKSVRSFQPRKSFLHEKKGTVVIQSFIRK
                     HYAQRKLKQLKSEAKSVNHLQEVSYKLENKVIELTESLASKVKENKELVSRLENLQKS
                     LNESENIKSSLEEEKEGHTKALADQKSIHEEEYGKVNDQLIAAKEEIISAKAEVDELL
                     NKQKNLKDEIASTLEELTSARDELLTSQSENADLKKEVFSLKEEVARLQSSMRSGVYV
                     GGGINATPVKNRRFSANSTLNDGSSPKQLNVVSINNNFNTEDVSALMSQINDELYKMF
                     EDSRSLNTEIIEGLLKGGKVPPTGVSVNLTRKEVLYPSRVLIIILSDMWRLGLTSQSE
                     TFLAEVLDAIQKIISNLKPDVMIEHGAFWYTNVRELHSFVVYAYESITTDETYNSGMN
                     EEEYNRYVNLVKELKDDFEALSFNVYNLWMKKLRKNLEKIAVPAVVVSQSLPGFVVPE
                     PSQFLQKFLQNSSTYKMDDVLTFFNNIYWAMKSYDIEMEVFEDVITNLLKLLDALCFN
                     DLILRKNFLSWKRGLQLNYNVTRIEEWCKSHHISEVSVCLQHILQAAKLLQLKKRIVA
                     DIDIIWDICNCLKPIQLKQLITQYSVADYEEPIAPEILQYVAEKVKNDTSKAEVGNND
                     VFLPVDNGPFEDPYQKVEVRAFGKIEAYIPAWLNLPITRRIVELVTQFVAVQEQAE"
     gene            <351240..>352502
                     /locus_tag="KLLA0_A03938g"
                     /db_xref="GeneID:2896812"
     mRNA            <351240..>352502
                     /locus_tag="KLLA0_A03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451173.1"
                     /db_xref="GeneID:2896812"
     CDS             351240..352502
                     /locus_tag="KLLA0_A03938g"
                     /note="some similarities with uniprot|P39734 Saccharomyces
                     cerevisiae YAL028W FRT2 Tail-anchored endoplasmic
                     reticulum membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451173.1"
                     /db_xref="GeneID:2896812"
                     /db_xref="UniProtKB/TrEMBL:Q6CY16"
                     /translation="MEVSHREHTNHIGSQVNPLFRGSVFHKNDAADLRVPWDGKRRKS
                     GASINSKTQMGDLTEFNPSHHASNKNIYHDDITCGSLRFSDALLDGSFKCQDEHSSNR
                     SGHMASSKPGSGNSSLGLLKNQSYSNISISSTQSFKKTHTKLLNFSQLKPDLTTASSF
                     ESQPSKGNSLARQFLETASKAKCNREIIPTLFYSPSANSCGDTSGALDYLSSGFTDKL
                     FPIFNSKETDPKDMKIDVDCKDIPEYFAMDYIKHIHRDLTALEFRLKHFLMKVILPQE
                     MDFTQNINHVSNLSKSVTQLHMDIEKIKHDTKDIYLEKLAAAFNGSDSESFVSKLTTL
                     MDSHVSRLQALEGKTVDFQNELEAKKLQLRKLENLIKLNDMIGDFKRNMKLSEKLKEY
                     YGTFGDVTVLALSISLIMYLFRRWFASE"
     gene            <352856..>353796
                     /locus_tag="KLLA0_A03960g"
                     /db_xref="GeneID:2896783"
     mRNA            join(<352856..352866,352938..>353796)
                     /locus_tag="KLLA0_A03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451174.2"
                     /db_xref="GeneID:2896783"
     CDS             join(352856..352866,352938..353796)
                     /locus_tag="KLLA0_A03960g"
                     /note="similar to uniprot|P39735 Saccharomyces cerevisiae
                     YAL027W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451174.2"
                     /db_xref="GeneID:2896783"
                     /db_xref="InterPro:IPR021624"
                     /db_xref="UniProtKB/TrEMBL:Q6CY15"
                     /translation="MVPTSALIQINSKCVLSVRVFINRNKVLKSITNSDTIFEAPILS
                     NNSIIRLKTPAIRLHLSNEDMKFLLNEIRDSLLFMLYELCSPILEEKVLNKLKIDTFM
                     DFADVLEILKKGSSLETRSTDVYNPIDGIDVHITSIERTGKKSYKLHFSHNWRLDILI
                     ENIDKLHHWRKLLTLLDSVQSVSNTGQSIPLFIPFKSTNVLVRSIKPLESDTNSSKSE
                     DPPILIEPEDDGLGQVPRDEIEMVDQDPNDIKLDTKDDKKPIFDYQYKGMRLFDKCIK
                     IHVLGRPKRGKKN"
     gene            <354208..>355551
                     /locus_tag="KLLA0_A03982g"
                     /db_xref="GeneID:2896796"
     mRNA            <354208..>355551
                     /locus_tag="KLLA0_A03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451175.1"
                     /db_xref="GeneID:2896796"
     CDS             354208..355551
                     /locus_tag="KLLA0_A03982g"
                     /note="highly similar to uniprot|P54885 Saccharomyces
                     cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
                     catalyzes the second step in proline biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451175.1"
                     /db_xref="GeneID:2896796"
                     /db_xref="GOA:Q6CY14"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="UniProtKB/TrEMBL:Q6CY14"
                     /translation="MSVSESIAKTARAAGNILKTLSDEERSSILYKIHDGLKANAASI
                     EAANKLDLEQAKSTNLSDSLVKRLDLFKGDKFETMLQGIVDVANLQDPVGKVNFAREI
                     DENLTLYQITAPVGVLLVIFESRPEVIANITALSIKSGNAAILKGGKESLNTFKEMSR
                     IVNDVVEQNEKTTHVPVGAVQLIETREDVSDLLQQDEYIDLVIPRGSNALVRQIKSST
                     KIPVLGHADGICSIYVDESADIGKAKRILVDAKTNYPAGCNAVETLLINPKLQHWWEV
                     LNSLIENGVTLHVSKEVKKQYKEHNSTSDHIVDLDESKDFDKEFLSLDIAVAFVESTE
                     AAVLHINTHSSKHTDAIVTENSENAEYFLKAVDSSSVYWNASTRFADGFRYGFGTEVG
                     ISTSKIHARGPVGLDGLVTYQYQLRGNGQIASDYLGAGGKKAFVHKDLDVKSISI"
     gene            complement(<355624..>359655)
                     /locus_tag="KLLA0_A04015g"
                     /db_xref="GeneID:2896355"
     mRNA            complement(<355624..>359655)
                     /locus_tag="KLLA0_A04015g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451177.1"
                     /db_xref="GeneID:2896355"
     CDS             complement(355624..359655)
                     /locus_tag="KLLA0_A04015g"
                     /note="highly similar to uniprot|P39524 Saccharomyces
                     cerevisiae YAL026C DRS2 Integral membrane Ca(2)-ATPase
                     potential aminophospholipid translocase required to form a
                     specific class of secretory vesicles that accumulate upon
                     actin cytoskeleton disruption mutation affects maturation
                     of the 18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451177.1"
                     /db_xref="GeneID:2896355"
                     /db_xref="GOA:Q6CY12"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6CY12"
                     /translation="MKPKYFEREIQSQRGATHRSTCFPMSGSTKHGDSDALFDVDFLD
                     DSYTPDLRDSPRRNSPSAVIDSGMDTSQRGLLPQETIDLSDNIENDIENPFNDRYSAS
                     FADTNPRNSVLPQPSGFNRFMSNVKSAVGMNGGHKGQFQSFEMNDYDQSNTNRYESST
                     RKFDIKVLFNRYILRKGKTSCKSDEPRTILLNDSSANSRFGYRDNHISTTKYNAATFL
                     PKFLFQEFSKYANLFFLFTSIIQQVPNVTPTNRYTTIGTLLVVLIVSAVKESVEDLKR
                     SNADKELNHSLCDVLDERSGEFVRKKWIDIAVGDIIRVRSEEAIPADLIILSSSEPEG
                     LCYIETANLDGETNLKIKQARQETANYLDEKALCKLHGRVQSEHPNSSLYTYEGTMTL
                     NGSTFPLSPDQMLLRGATLRNTAWIFGLIVFTGHETKLMRNATATPIKRTAVERVINM
                     QILALFGVLIVLALISSTGNVIMTKRDSAHLGYLYIEGTNKAGLFFKDILTFWILFSN
                     LVPISLFVTVEMIKYYQAYMIGSDLDLYHEESDTPTVVRTSSLVEELGQIEYIFSDKT
                     GTLTRNVMEFKSVSIAGRCYIETIPEDRRATVEDGIEIGFHSFESLKDKMTDPEDDEA
                     GIVIEFLTLLATCHTVIPETQSDGTIKYQAASPDEGALVQGAADLGFRFDIRRPNSVS
                     ISTPFSEQLEYQLLNICEFNSTRKRMSAIFRMPDGSIKLFCKGADTVILERLDSEFNP
                     YVQSTLRHLEDYAAEGLRTLCIASRTIPEKEYEEWSKIYEAASTTMKDRTEELDRAAE
                     LIEHDLFFLGATAIEDKLQEGVPETIHHLQEAGLKVWVLTGDRQETAINIGMSCRLLS
                     EDMNLLIVNEETKEDTRTNLQSKLNAIESHQISQQDMNSLALVIDGKSLGYALEEDLE
                     DQFLTIGKLCKAVICCRVSPLQKALVVKMVKRKTSSLLLAIGDGANDVSMIQAAHVGV
                     GISGMEGMQAARSADFAIGQFRFLRKLLIVHGSWSYQRISLAILYSFYKNMALYMTQF
                     WYVFANAFSGQSIMESWTLTFYNVFFTVMPPFVIGIFDQFVTSRLLDRYPQLYKLGQK
                     GQFFSVTIFWGWVLNGFYHSAVVFIGSVLFYRYGNCLNMGGETADHWVWGVGIYTTSI
                     IIVLGKAALITSQWTKFTLVAIPGSLVIWLLFFPFYSAVFPRVNVSKEYYGIIGHVYG
                     SATFWLMCIVLPVFALLRDFVWKYYKRTYSPESYHVVQEMQKYNISDYRPRMEQFQKA
                     IRKVRQVQRMKKQRGFAFSQSEEGGQDRIIRMYDTTLKRGVHGELADASLNPFNDTPA
                     QVEPSSNVGLRQSFESTNPFKDV"
     gene            complement(<359981..>360889)
                     /locus_tag="KLLA0_A04037g"
                     /db_xref="GeneID:2896788"
     mRNA            complement(<359981..>360889)
                     /locus_tag="KLLA0_A04037g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_451178.1"
                     /db_xref="GeneID:2896788"
     CDS             complement(359981..360889)
                     /locus_tag="KLLA0_A04037g"
                     /note="some similarities with uniprot|P10962 Saccharomyces
                     cerevisiae YAL025C MAK16 Essential nuclear protein
                     required for normal concentration of free 60S ribosomal
                     subunits required for maintenance of M1 satellite double-
                     stranded RNA of the L-A virus"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_451178.1"
                     /db_xref="GeneID:2896788"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:Q6CY11"
                     /translation="MSDEIIWQVINQHFCAYKVKTDKGQNFCRNEYNVTGLCSRQACP
                     LANSKYATVKNVDGTLYLYMKTAERAHTPAKLWERVKLSKNYTKALAQIDEHLLYWNK
                     FLIHKCKQRMTKLTQVMITERRLALREEERHYVGIAPKVKRREENRERKALSAAKIEK
                     AIEKELLERLKSGVYGDKPLNVDEKIWKKVMGRVEDEDLDEEENDWDEEEESDEGEVE
                     FVEDEDAEDEMVDMEDLEKWLGGSDTSDYSSDEDSDEDSSDEDSDEEENPSKRQKKST
                     QTRKRHPKVEIEYEQELNSNQQELAQ"
     gene            complement(<361328..>365428)
                     /locus_tag="KLLA0_A04059g"
                     /db_xref="GeneID:2896846"
     mRNA            complement(<361328..>365428)
                     /locus_tag="KLLA0_A04059g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451179.1"
                     /db_xref="GeneID:2896846"
     CDS             complement(361328..365428)
                     /locus_tag="KLLA0_A04059g"
                     /note="similar to uniprot|P07866 Saccharomyces cerevisiae
                     YAL024C LTE1 Putative GDP/GTP exchange factor required for
                     mitotic exit at low temperatures acts as a guanine
                     nucleotide exchange factor (GEF) for Tem1p which is a key
                     regulator of mitotic exit physically associates with
                     Ras2p-GTP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451179.1"
                     /db_xref="GeneID:2896846"
                     /db_xref="GOA:Q6CY10"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /translation="MSEVVEKADENVVPLFSRPELYPVPSESVLTVDLRDGTVRILKC
                     TLPALLVQLSSPLDKVDYSMLTDFFLVYRNFMSSQKLLDLIQERFQWAIDLRQSDPSS
                     QEKITSEVILVRMFVLVRHWLSNYFAQDFVVDTSLRRQFLQFINGYSPVDRFLDNIII
                     SLKKLWVQNVQIMWEDLENLIVENNVVSRDDWLKWEIEDVPSGSSSETGEGSTKGKRL
                     SFIALQNINNPVLRNESLLSLLHTREKIPLPQQSEDESKKQSTRIKQRTGSMLLFPEN
                     ASNGLSINEKLTASGVSPEATPKQEREITDPKNSKDNKHILPQLSRVTNVSYMMKDLE
                     YPSTPSVDIFVPPTPAKNIEFILQTSYMETDLPEQSNGSDSTNTVNGNNTNHKGILGL
                     LSKWKLNHQRKPTVNPVQNPPRVENLIKYVFSISSLDNHANPLPDSLSSMFDILSART
                     IDEVEYLVSVESDLLAKLEAKKLTTEISKLETNEDESQDYSVIDNLNLYKTVSSIANS
                     VISLSKTLNVRTNKSTTHLLSPSTSALERKNIRNSAPMLYSYNNSRYSITNALMGLPN
                     TNDNSSPKRLVFHDPTRNSPTKKAILANNLNNIGEYNGERDSITSIVTYDSAFSDISS
                     SGNILSQHKGSSNIFMESAPTLKRKLNVNDLRRFNFEKSDSTDDRSCSPQNREATETS
                     ATSMESDANDNAIQDEYENENEDIASLITAYEESTSEIDTQCQNNAQIRRPTSGRISI
                     TRNYSVASPNSLRSILPKSPLILGNEVFIERDKALAANQDIISELEETTSLLLNDNDR
                     KFTVSRGSVCNDSDSQSISTNLLFSSAQASPQKLVIKEVDVIQEKSEHPDVPTPVLCK
                     QPISKLSETPSIKSIGSRDSEESFDLTSIASKPNRAQSTTLREKYHLEKQATNDIFEE
                     DVENLNPENNKYLFSPDTDSIDFASPEKNLDDLKQQFIDQSTDEQTSLDEEEIATQDN
                     ENKDHGIDKKKLEDIMNGIDDTADTSMDPVNLALMKLEGTYDKGEKEIDDKSPSINSE
                     LAREVENFQIVQTAALPESARKRQSMFIQRRRNTMIDFSVRDSLIDKDSSCTRLENTD
                     EQIRNLLNQYTLTDSRLKIDNLEQHIPFILMYDSKSVANQLTLIEKEILSEVDWKDLL
                     DLTMSEQLPQFTSWLQLLVQNENLSGIDLAIARFNLTVDWIISEIVMTQDIRLRRNTI
                     QRFIHIAEHCKELQNYNTLMEIILALNSIVVQKFTETWRLVEPGDLLTWETLKAIPSL
                     EKNYSNIRQLIDEVEPLSGCIPFIVVYLSDLSLNIEKRTWIVHDEVLNYNKFQTNVQI
                     VKNFVQKMQWSKFYNIDIDHELLSKCVYITSLSHDEINSISHKSPI"
     gene            <366969..>368552
                     /locus_tag="KLLA0_A04081g"
                     /db_xref="GeneID:2896537"
     mRNA            <366969..>368552
                     /locus_tag="KLLA0_A04081g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451180.1"
                     /db_xref="GeneID:2896537"
     CDS             366969..368552
                     /locus_tag="KLLA0_A04081g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451180.1"
                     /db_xref="GeneID:2896537"
                     /db_xref="GOA:Q6CY09"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CY09"
                     /translation="MTSEIKEKEQFEIGVVGDTETGSIEVYDGEIKNVKSQQLEGTEH
                     AVGLDLFQEVLDSDLKYDDKEYSKIRRKIDTWLLPVLCITYMLQFLDKLSLNYASAYS
                     MKEDLGLVGNEYGNIAAIFNVGYLIGSIPANYVIQKLPVAKYTGVALFVWAILLIGHI
                     GATNYSSMMALRFLLGLMEASISPSNMMMCAMFYNKREQPFRMCTFLSMNGVATMVGA
                     LLAYGLGHATNTSLQPWKLIFLVFGIMNLVWSAVFLYIAPDSPANAKFLTHEEKLKVI
                     DHVSKNQMGIKDTKIKPDQFKEAMLDLNSWILAFIGLGCGVINGSTSNFISSLIKGFG
                     FSGLNATLLQLPTGAIELVVVFAAGMVALFTNKNVRVILLFLTCIPTLGALIGIRLIP
                     LSEKWSLVGCCWLLYIIGGPVIMCWVLINVTVAGSSKISTVKIVWFIFYTAGNICGSK
                     IMYANEAPRYDSGMKGLITCYSGMMFLCIVYYFLMYYRNKKRDAEYGELTPEDEKEGV
                     INGFKDLTDFQNQFFRYVY"
     gene            <369258..>371615
                     /locus_tag="KLLA0_A04103g"
                     /db_xref="GeneID:2896534"
     mRNA            <369258..>371615
                     /locus_tag="KLLA0_A04103g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451181.1"
                     /db_xref="GeneID:2896534"
     CDS             369258..371615
                     /locus_tag="KLLA0_A04103g"
                     /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
                     YOR322C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451181.1"
                     /db_xref="GeneID:2896534"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:Q6CY08"
                     /translation="MGFPKFGSSKHNSSSSSLQALDYTNHDDHPIELSINIESPPCVL
                     YGSATESSGALLGGLLTVTINDDLPEIQPCKSTPLTPVNSGQRKQLTNSLTTSLSHLS
                     LSHAHHAHHQKSGDNLKRLASMSNLITPPKAITSVSLNSVELSLIQKVHYEKPFRPSA
                     AVLNTCTNCKTKITEFHRWTIMNKPTELAVGQHSFPFSHLIPGNLPPTTHLGSNSHST
                     IKYELIAVATYKHPFKGKGESAKRVLQLNLPISITRSILRGSDKTSLRVFPPTELTAN
                     AVLPNVVYPKSTFSMELKLDGICSDDRRWRMRKLNWRIEEKVKVRAHGCQAHKAKLKQ
                     LEEKVKQDEERDRQIRKSSKPIKRSVDMGPQVKMTVNTFHDVLLQQLSRANTEAEDVD
                     NPEDTTTAPSDEALRDEDHDTIPDTPTDFIHPNDDAMRQEIMQQQQRVRQQQIEEELK
                     QESALYTEEVRTIANGEIKSGWKSDFSDKGTIELVTDIDCMRLNSGVTNPISHASTRN
                     PCVLPNQDNVNVSCDMEDTNLGVYVSHLLFVEVIVAEEQLQNVNGGNRSRTGSTVSDT
                     SKTASKPKNNADQRLAELSPIFADRENKPQPVIDNQPGNNVGPKIVGVPTGAARVLRM
                     QFRVIMTERSGLGISWDDEVPPAYQDIRMLTPPRYQDVSTTLLHSTLSSPTITPPGES
                     SLFTLETGNGAERAVTGSAPETRSNSSVRLNVNNAEYIRPPPALHHSANTSSTSIAFQ
                     FSDLDHVMSTQGAEPGFNSALTPQTTRMINVPTISELLDTDRITQ"
     gene            <372826..>374589
                     /locus_tag="KLLA0_A04125g"
                     /db_xref="GeneID:2896536"
     mRNA            <372826..>374589
                     /locus_tag="KLLA0_A04125g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451182.1"
                     /db_xref="GeneID:2896536"
     CDS             372826..374589
                     /locus_tag="KLLA0_A04125g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451182.1"
                     /db_xref="GeneID:2896536"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CY07"
                     /translation="MINSAKTDKITQKINDLSFDEKDNTLIDSTNPAPFPGAQESAAQ
                     HPTATPSNNKEPKPRTKSFLNNDGIDQLTPVTRKKRVSSLSLSDQWSASQGGIAPLTS
                     MTPLNTAEGSNGQNGSSGAAGAQSASADAAAAAAADSRSVGISRSSSVRTKREVIDHE
                     RVASYAFAFDIDGVIVRGPETIPEARQALRLLNGDNKYNIKVPYIFITNGGGRSERAR
                     CKDLSKRLGITVTEDQVIQGHTPMKDLVPVYKNVLVVGGVLNSCRDVAKGYGFENVYI
                     PIDIMKWKPSVTPYYTLSDEEKEAAVDADFSKISIDAILVFADSRNWAADQQIILELL
                     LSKNGVMGTVSETADEGPGLYFAHSDFVWATDYGLSRYGMGALQVSIAALYQEHTGKE
                     LQVTRFGKPQRGTFRFAEKVLSKWRKNTLEEHVEQLGISFQKQQKTLQQQQQSSDSPF
                     GPDSETDQETDLTSTEDDDDLEDDEDDEGIVINKTSSVLLDLPPASTVYFVGDTPESD
                     IRFANSHDSSWYSILVKTGVYQEGTTPKYKPKQICENVLEAVRFAIEREHQKELQEWN
                     HSAEVSVPVVKEETETVKKTN"
     gene            complement(<374897..>375985)
                     /locus_tag="KLLA0_A04147g"
                     /db_xref="GeneID:2896678"
     mRNA            complement(<374897..>375985)
                     /locus_tag="KLLA0_A04147g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451183.1"
                     /db_xref="GeneID:2896678"
     CDS             complement(374897..375985)
                     /locus_tag="KLLA0_A04147g"
                     /note="similar to uniprot|Q7LIE3 Saccharomyces cerevisiae
                     YDR214W AHA1 Activator of Heat Shock Protein 90 ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451183.1"
                     /db_xref="GeneID:2896678"
                     /db_xref="GOA:Q6CY06"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:Q6CY06"
                     /translation="MVVHNPNNWHWVDKNCIDWAKKYFQEKLVGLTTGESTDELYAEI
                     TKLSSLEGDCEVNQRKGKVISLFDLKLNVGIAGHVGENKLEGSITVPEVAFDSDPEDY
                     QFDISIFKETSKLFEIKPVIREKLIPQLRDIFSNFGKQLLLTHGNDIQVSSDKVTSKF
                     TKANQQSSFSTSGSTKEDANKDSATGNTSTANASSSTKAAVTSSETQQKNSGNAAKYN
                     TTKVHLESSFQVPAIELYNTFIDKRRIEAWSRSPIQPEANTGDFSGSTLQLNDAFKLF
                     GGNITMKFLSGEPGKKIVFQWRLNDWKQGHYSELSLEFHESQEYHETKLVVNWSGIPV
                     GEEDRVRGNFEEYYIRSIKVTFGFGAIL"
     gene            complement(<376273..>378600)
                     /locus_tag="KLLA0_A04169g"
                     /db_xref="GeneID:2896359"
     mRNA            complement(<376273..>378600)
                     /locus_tag="KLLA0_A04169g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451184.1"
                     /db_xref="GeneID:2896359"
     CDS             complement(376273..378600)
                     /locus_tag="KLLA0_A04169g"
                     /note="similar to uniprot|Q05958 Saccharomyces cerevisiae
                     YLR228C ECM22 Sterol regulatory element binding protein
                     regulates transcription of the sterol biosynthetic genes
                     ERG2 and ERG3 member of the fungus-specific Zn[2]-Cys[6]
                     binuclear cluster family of transcription factors
                     homologous to Upc2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451184.1"
                     /db_xref="GeneID:2896359"
                     /db_xref="GOA:Q6CY05"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CY05"
                     /translation="MSSSNINSNPMPSVETGSNGRSKSSSEKVELIELHGKTVSKTAT
                     GKRKFHKKSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDCVYTPVQPRSRKNSAATAP
                     KHSSKVSKPATVSTPTEPISLNQVDILVNTMKADAELEQHQQQHQQVRQQQQQQQQQL
                     QQQDQNVKVKSERSAAASPNKQAMGQDNLLLPPIAQNSNFLQHLHHQIQQQPYLLPQL
                     MTLTNSEKFAAQFEVPNSPSTGMQSQPMNVSNSIASILAGGKLPSHLSSNLALLQQLT
                     QSPQRPSTKLPSNNGAASIPGGFNLKQLGTFPTAGIGGVTYDFQELLGLKSPPNTSTT
                     ETVPTVSHDNDPLKQESAAEVLASLQMKQQQKTSNPLDSNNLDIGTPSLPNNPTISPA
                     APMSPLTKLDDSQARGNADSKSVGPNGGIVNSNATSMSKSNTQESQASSDTELSRIGT
                     IASMIDFSTNTNLNLIDLKLFHHYCTNVWPTITAAGISEKKIWSVDVPEIAFEYPFLM
                     HALLAFSATHFSRTESGLERYVTQHRLEALRLLREAVLEINESNTDALVASAIILIMD
                     SLANAATPTASGVNSPLNSGSISTSAWIFHVKGAATILTAVWPLTEKSRFYNLINVDL
                     SDLGDVINQENGSIAELVCFDESIADLYPVELNSPYLITLAYLDKLNKEKGQPGFILR
                     VFAFPALLDKTFLALLMTGDLGAMRIMRSYYQLLRGFASEMKDEVWFLEGMTQVLPQD
                     VDEYSGGGGMHMMLDFLGGGLPSMTTTNLTDFGIF"
     gene            complement(<379492..>381171)
                     /locus_tag="KLLA0_A04191g"
                     /db_xref="GeneID:2896562"
     mRNA            complement(<379492..>381171)
                     /locus_tag="KLLA0_A04191g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451185.1"
                     /db_xref="GeneID:2896562"
     CDS             complement(379492..381171)
                     /locus_tag="KLLA0_A04191g"
                     /note="highly similar to uniprot|P12612 Saccharomyces
                     cerevisiae YDR212W TCP1 tailless complex polypeptide 1
                     chaperonin subunit alpha"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451185.1"
                     /db_xref="GeneID:2896562"
                     /db_xref="GOA:Q6CY04"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:Q6CY04"
                     /translation="MAQVYGNSRSDTLFLGGEKISGDDIRNQNVLASLAVANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILALLDVQHPAGKILVDLAQQQDREIGDGTTSVV
                     IIASELLKKANDLVKNKIHPTTIITGYRVALREAIRYIDEVLSVPVDTLGKDTMLNIA
                     KTSMSSKIIGSDSEFFSNMVVDALLAVRTQNAKGDVKYPVKAVNILKAHGKSARESVL
                     VQGYALNCTVASQAMPKQITGGNVKIACLDMNLQKARMAMGVQINIDDPEQLEEIRKR
                     EAGIILDKVKKIIDAGAQVVLTTKGIDDLCIKEFVNAKVMGVRRCKKEDLRRIARATG
                     ATLVSDMSNLEGDEVFESSYLGTCQEVVQTKFSDDECILIRGTQKHSSSSIVLRGPND
                     YSLDEMERSLHDSLCVVKRTLESGNVVPGGGCVETALNIYLDNFATTVGSREQLAIAE
                     FANALLVIPKTLAVNAAKDSSELIAKLRSYHAASQQAKPDDIKRRKYRNYGLDLIKGK
                     IVDEVHAGVLEPTISKVKSLKSALEACIAILRIDTMITVDPEPEKEGDACA"
     gene            complement(<382243..>382818)
                     /locus_tag="KLLA0_A04213g"
                     /db_xref="GeneID:2896618"
     mRNA            complement(<382243..>382818)
                     /locus_tag="KLLA0_A04213g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451186.1"
                     /db_xref="GeneID:2896618"
     CDS             complement(382243..382818)
                     /locus_tag="KLLA0_A04213g"
                     /note="highly similar to uniprot|P19073 Saccharomyces
                     cerevisiae YLR229C CDC42 Small rho-like GTPase essential
                     for establishment and maintenance of cell polarity mutants
                     have defects in the organization of actin and septin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451186.1"
                     /db_xref="GeneID:2896618"
                     /db_xref="GOA:Q6CY03"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CY03"
                     /translation="MQTLKCVVIGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQIDLRDDKVIIEKLQRQRLRPITPEQGERLARELRAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCIIL"
     gene            complement(<383275..>385485)
                     /locus_tag="KLLA0_A04235g"
                     /db_xref="GeneID:2896625"
     mRNA            complement(<383275..>385485)
                     /locus_tag="KLLA0_A04235g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451187.1"
                     /db_xref="GeneID:2896625"
     CDS             complement(383275..385485)
                     /locus_tag="KLLA0_A04235g"
                     /note="similar to uniprot|P32501 Saccharomyces cerevisiae
                     YDR211W GCD6 Catalytic epsilon subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2 activity subsequently regulated by
                     phosphorylated eIF2 first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451187.1"
                     /db_xref="GeneID:2896625"
                     /db_xref="GOA:Q6CY02"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CY02"
                     /translation="MSGKKTKSGKANQNKKQEVVQDERLQAIVLTDSFETRFMPLTSV
                     KPRCLLPLANIPLIEYTLEFLAKAGVNEVYLICASHGEQIQEYIDQSKWSLPWAPFKV
                     NTIMSLESRSVGDAMRDVDNRGLITGDFVLVSGDLVTNMDFEKALDIHKQRRKADKDH
                     IVTMCLSKATQFHKTRSHEPATFIFDKSNDRCIYYQDIPLASSREKTTIDIDPELLEG
                     VDEFVLRNDLIDCHVDICSPHVPAIFQENFDYQFLRRDFVRGVLSSDLLKKHIYGYIT
                     DEYTTRAESWQTYDAISQDFIARWCYPLVLNANLLKGQTYSYESQHIYKEKDVVLAQS
                     CKIKKNTAIGSGSKIGEGTVIENSVVGRNCKIGSNIRIKNSYIWDNVVIDDNTTIEHS
                     LVASDVKLGSNVTLNDGSIIGFNVVIDDNVTIPVGTKISAVPVQRNTAQFLDTAHNLS
                     SSDEDEEGSTFTRNSSSLSISNSDEVADAKIKLSKQLVGPNGRGVLYESDDEDEDEDG
                     STEKGIANTLTYRDDDIYLSDTSISSITQKHRKRRTMSMTSIYTDYEGEEDEEEDFEK
                     EAIATVERAIENNHDLDTSMLELNTLRMSMNVTYHEVRNASVIAIFRRVYHFVATQTL
                     GPKDAVTKVLQQWGPVFKRQAFDSDEFIDLMNIILDRVLDQKFDKPDFILFHVYNVLY
                     DLDILEEDVIYKWWDSVSGDSKYSEVTALLAKWVDWLKTADEESSDEEDSDEDE"
     gene            complement(385847..385985)
                     /locus_tag="KLLA0_A04257r"
                     /db_xref="GeneID:2896677"
     tRNA            complement(join(385847..385883,385947..385985))
                     /locus_tag="KLLA0_A04257r"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:2896677"
     gene            complement(<387006..>389165)
                     /locus_tag="KLLA0_A04301g"
                     /db_xref="GeneID:2896841"
     mRNA            complement(<387006..>389165)
                     /locus_tag="KLLA0_A04301g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451188.1"
                     /db_xref="GeneID:2896841"
     CDS             complement(387006..389165)
                     /locus_tag="KLLA0_A04301g"
                     /note="similar to uniprot|Q750P3 Ashbya gossypii AGL096W
                     AGL096Wp and weakly similar to YDR208W uniprot|P38994
                     Saccharomyces cerevisiae YDR208W MSS4
                     Phosphatidylinositol-4-phosphate 5-kinase involved in
                     actin cytoskeleton organization and cell morphogenesis
                     multicopy suppressor of stt4 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451188.1"
                     /db_xref="GeneID:2896841"
                     /db_xref="GOA:Q6CY01"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR023610"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:Q6CY01"
                     /translation="MTAVHMVQDPGPPTVPHLSDDKNETAAYIIETTIGKGQDQPLIP
                     KRLSNVSVVDDGDISPKHLPSTSSPIKRTDSAVANHTTAVPTTLDTNGGTKSDSNVLL
                     HSRHRMSSKSLPMQRRRSTRDSIRQGPYHPGKHARIIPMDSNSSSASSSSSSLRSLEH
                     RRTQSTSSQRSVPNSTHNITTSSKAANQRMARSSTDLHSHSRSSARFNPDLPNKALTR
                     SLASLDLQHYEGPENNINGNNTSDTTHHGTSKQLNNDGALKRSESAALEIQKMRQSLL
                     QKREMRRKQKKFLDDDRVLVGNKVTEGHVNFIIAYNMLTGIRVAVSRCSGIMKPLTDK
                     DFKLTKKLAFDYHGNELTPSSQYAFKFKDYCPEVFRELRALFGLDPADYLMSLTSKYI
                     LSELNSPGKSGSFFYFSRDYKYIIKTIHHSEHKHLRKILKRYYEHVKQNPDTLISQFY
                     GLHRIKMPYSFRSKIKYRKIYFLVMNNLFPPHLQIHKTFDLKGSTWGRYTKCEKTEDP
                     QHSPVFKDLNWLEMNEKINFGPLKSKKFLQQLQQDVLLLSELNIMDYSLLLGIHNIET
                     GNDLIEEGNKNDLVDPLEDSNAMPNLLPSQSSRRTIHQHKSHHHRRHTHHSVNPPINN
                     TQVVKHFFQQDEGGIRASDQFNNDLNQIYFVGIIDCLTNYSMLKRMETLWRSMNHDLK
                     VVSAVPPKVYGDRFYHFIENSVNKHYDENQQQPGYHD"
     gene            <391590..>392201
                     /locus_tag="KLLA0_A04323g"
                     /db_xref="GeneID:2896354"
     mRNA            <391590..>392201
                     /locus_tag="KLLA0_A04323g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451189.1"
                     /db_xref="GeneID:2896354"
     CDS             391590..392201
                     /locus_tag="KLLA0_A04323g"
                     /note="some similarities with uniprot|Q04433 Saccharomyces
                     cerevisiae YDR534C FIT1 Mannoprotein that is incorporated
                     into the cell wall via a glycosylphosphatidylinositol
                     (GPI) anchor, involved in the retention of siderophore-
                     iron in the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451189.1"
                     /db_xref="GeneID:2896354"
                     /db_xref="UniProtKB/TrEMBL:Q6CY00"
                     /translation="MKFSTVAATALAASSSALAAQTVITATNDGVVYTKTIDLAETDA
                     TLAPGEYLTSIVVTRGDTVYTKVITESSAAATEETTAAAEETTAAAETTSAAAETTTA
                     APAEETSSAQESETITLTLSKNGHWFTKTVTQAVGYVWTGEDTANWTGTPSWLSNITT
                     STSAAETTEAASSTAEVATYTGAAALASVGTGLLGVAVAGLLI"
     gene            <394997..>395902
                     /locus_tag="KLLA0_A04345g"
                     /db_xref="GeneID:2896791"
     mRNA            <394997..>395902
                     /locus_tag="KLLA0_A04345g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451190.1"
                     /db_xref="GeneID:2896791"
     CDS             394997..395902
                     /locus_tag="KLLA0_A04345g"
                     /note="some similarities with uniprot|Q04433 Saccharomyces
                     cerevisiae YDR534C FIT1 Mannoprotein that is incorporated
                     into the cell wall via a glycosylphosphatidylinositol
                     (GPI) anchor, involved in the retention of siderophore-
                     iron in the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451190.1"
                     /db_xref="GeneID:2896791"
                     /db_xref="UniProtKB/TrEMBL:Q6CXZ9"
                     /translation="MKFSTVAATALAASSSALAAQTVITATNDGVVYTKTIDLAETDA
                     TLAPGEYLTSIVVTRGDTVYTKVITESSAAATEETTAAAEETTAAAETTAAAAEEEAS
                     TTEYETVTLTLSKNGHWFTKTVTQAVGFVWTGEATTYTGVAPWATSSAADEEITSSGF
                     SNSTEVTETVTDKTKTTATITSCEDDICQKTTEEEASSSTVITTVIEGVTVVTTVPCT
                     TTSTVECTEEQCQKTSTNAPVNPTTVVPTTEAPGKTSSGIVTVSSSSAETAQPSVTVS
                     TYTGAAAMASVGTGLFAAAVGAMLL"
     gene            complement(<397648..>398133)
                     /locus_tag="KLLA0_A04367g"
                     /db_xref="GeneID:2896357"
     mRNA            complement(<397648..>398133)
                     /locus_tag="KLLA0_A04367g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451191.1"
                     /db_xref="GeneID:2896357"
     CDS             complement(397648..398133)
                     /locus_tag="KLLA0_A04367g"
                     /note="similar to uniprot|Q08906 Saccharomyces cerevisiae
                     YOR382W FIT2 Mannoprotein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451191.1"
                     /db_xref="GeneID:2896357"
                     /db_xref="InterPro:IPR020337"
                     /db_xref="UniProtKB/TrEMBL:Q6CXZ8"
                     /translation="MKFSNTAFFAATVSVVAAEAATTVSTIKTIVATNGDHVYTKVVT
                     DSAAPVYTESTTVTTTITNNGASYVKTLTIAPQTTIGSSTTSKITITNSDNGATYTKT
                     NVVAISSSSDDDDETSSSSSSSSSSSSTSSESSTSDDAAGMLPINVGGALIAGAVACL
                     L"
     gene            <400113..>400775
                     /locus_tag="KLLA0_A04389g"
                     /db_xref="GeneID:2896352"
     mRNA            <400113..>400775
                     /locus_tag="KLLA0_A04389g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451192.1"
                     /db_xref="GeneID:2896352"
     CDS             400113..400775
                     /locus_tag="KLLA0_A04389g"
                     /note="weakly similar to uniprot|Q04734 Saccharomyces
                     cerevisiae YMR063W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451192.1"
                     /db_xref="GeneID:2896352"
                     /db_xref="GOA:Q6CXZ7"
                     /db_xref="InterPro:IPR009571"
                     /translation="MSHFKIVFLTSLSLALVFELFNTISVPITSHLFISEYNGYKFGV
                     FGWCKVDGSICSPIRMGYSLDDILLFNDNEYLHLPNHAKYALSKLLLVHVLSFVCVLV
                     FWLFAILICIKWLNTSKSVLLFAVGWSMVTFMVSLLGFLIDVLMFASHVTWSSWLMLV
                     SAFFVALSGILLCLMIRDLSYRRFVKLQGEVDVCVPMTEPRDPDELNEIWKKKTSKRE
                     IL"
     gene            complement(<400945..>401796)
                     /locus_tag="KLLA0_A04411g"
                     /db_xref="GeneID:2896674"
     mRNA            complement(<400945..>401796)
                     /locus_tag="KLLA0_A04411g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451193.1"
                     /db_xref="GeneID:2896674"
     CDS             complement(400945..401796)
                     /locus_tag="KLLA0_A04411g"
                     /note="similar to uniprot|Q05892 Saccharomyces cerevisiae
                     YLR290C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451193.1"
                     /db_xref="GeneID:2896674"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:Q6CXZ6"
                     /translation="MMRRIALSKRVLCIPEAIDMSRKLIVLGGTGFLGKRICEAAVGA
                     NFQVVSLSRSGKATSSEPWANEVEWRSCDIFNPDTYAPVLRNATDVVHSLGILLENEN
                     YKKQINGSFWSVPKLSFGGFGKNPLAPKKPERSRFTYDMMNRYSATLLADTYMKVNGG
                     QAQTFSYISADRGFPSIPSGYIDSKRQAEEHISQYGKQIRSIILRPGFMFDERNSESD
                     GRTQIRNFLQMLNCGNEMVLRQKIPFVNDLVRPLISTQQVAHSLILALQDPNCEGVLT
                     LDEMLKM"
     gene            complement(<402462..>403532)
                     /locus_tag="KLLA0_A04433g"
                     /db_xref="GeneID:2896672"
     mRNA            complement(<402462..>403532)
                     /locus_tag="KLLA0_A04433g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451194.1"
                     /db_xref="GeneID:2896672"
     CDS             complement(402462..403532)
                     /locus_tag="KLLA0_A04433g"
                     /note="highly similar to uniprot|Q74ZF9 Ashbya gossypii
                     AGR292C AGR292Cp and similar to YLR291C uniprot|P32502
                     Saccharomyces cerevisiae YLR291C GCD7 Beta subunit of the
                     translation initiation factor eIF2B the guanine-nucleotide
                     exchange factor for eIF2 activity subsequently regulated
                     by phosphorylated eIF2 first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451194.1"
                     /db_xref="GeneID:2896672"
                     /db_xref="GOA:Q6CXZ5"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:Q6CXZ5"
                     /translation="MSDINVVIDSFVDRLKRKQVVESYQAGLETLQILMRYVSAIRWT
                     STEDLILQIKKFGYSLEKAQPYEYTCGNVVRRVLSMIRDETEEEQTSAEPMISSMFNL
                     LQKPMTDTKTKKVQDNKLDVRQTIVQSIRDLIDEIKNIDEGIQQIAIELIHDREILLT
                     PTPDSKTVLRFLLKAREGNNRNFTVLVTEGFPNNATVAHEFAKKLSEHDIETIVIPDS
                     AVFALMSRVGKVIIGAKTVFTNGGTISSTAGVSSVCECAREFRTPVFAVAGLYKLSPL
                     YPFDVEKMVEIGGSQNVLPTTENDRVGTVALETINPIADYIPPENIDIYITNIGGFAP
                     SFIYRVVWDNYKQEDVNLGEKI"
     gene            complement(<404732..>405376)
                     /locus_tag="KLLA0_A04499g"
                     /db_xref="GeneID:2896681"
     mRNA            complement(<404732..>405376)
                     /locus_tag="KLLA0_A04499g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451197.1"
                     /db_xref="GeneID:2896681"
     CDS             complement(404732..405376)
                     /locus_tag="KLLA0_A04499g"
                     /note="highly similar to uniprot|P32836 Saccharomyces
                     cerevisiae YOR185C GSP2 GTP binding protein (mammalian
                     Ranp homolog) involved in the maintenance of nuclear
                     organization RNA processing and transport interacts with
                     Kap121p Kap123p and Pdr6p (karyophilin betas) Gsp1p
                     homolog that is not required for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451197.1"
                     /db_xref="GeneID:2896681"
                     /db_xref="GOA:Q6CUG0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUG0"
                     /translation="MSAEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEV
                     HPLAFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCGIIMFDVTSRITYKNVPNWH
                     RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLW
                     LARKLAGNPQLDFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL"
     gene            complement(<405802..>406581)
                     /locus_tag="KLLA0_A04521g"
                     /db_xref="GeneID:2896831"
     mRNA            complement(<405802..>406581)
                     /locus_tag="KLLA0_A04521g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451198.1"
                     /db_xref="GeneID:2896831"
     CDS             complement(405802..406581)
                     /locus_tag="KLLA0_A04521g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451198.1"
                     /db_xref="GeneID:2896831"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF9"
                     /translation="MSKKFSSIADAVKYINDELTKKGYLKDDKLQCSASNESSSEKEQ
                     LDRDKLVVNVINKLLQRVDNLQDRLKDQDLQLRKAQDKLIERTHFIKSEHNKSANTPE
                     KERKVTKITKIQYREKDTKYLEAKIRKLRLELEDQSSQLRQYADGDRPNITWGTSLGH
                     LTVGKLMYSRDAVEANQIDMLSDKLSDVIDINTSLSQDLDAATRLISNMNKTIYTKFV
                     LQIPDTTSKTVTVDKSDHHEASSQALNELTRDWEDIKSQLP"
     gene            complement(<406920..>407249)
                     /locus_tag="KLLA0_A04543g"
                     /db_xref="GeneID:2896554"
     mRNA            complement(<406920..>407249)
                     /locus_tag="KLLA0_A04543g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451199.1"
                     /db_xref="GeneID:2896554"
     CDS             complement(406920..407249)
                     /locus_tag="KLLA0_A04543g"
                     /note="similar to uniprot|Q12349 Saccharomyces cerevisiae
                     YLR295C ATP14 Subunit h of the F0 sector of mitochondrial
                     F1F0 ATP synthase which is a large evolutionarily
                     conserved enzyme complex required for ATP synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451199.1"
                     /db_xref="GeneID:2896554"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF8"
                     /translation="MFRAVPLTLRASRGFSTSFIRRNVIQDLYLKELKAVNLKPITAA
                     DAQGAVKPWTTPAAPKLPELELQSADALKEYASSGVETVSEANEQSAEVEEGDWLVLE
                     ELEDAHH"
     gene            complement(<407581..>408150)
                     /locus_tag="KLLA0_A04565g"
                     /db_xref="GeneID:2896634"
     mRNA            complement(<407581..>408150)
                     /locus_tag="KLLA0_A04565g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451200.1"
                     /db_xref="GeneID:2896634"
     CDS             complement(407581..408150)
                     /locus_tag="KLLA0_A04565g"
                     /note="weakly similar to uniprot|Q05900 Saccharomyces
                     cerevisiae YLR298C YHC1 U1 snRNP protein required for
                     pre-mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451200.1"
                     /db_xref="GeneID:2896634"
                     /db_xref="GOA:Q6CXY9"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY9"
                     /translation="MVRFYCWYCKSYLTHDTASVRKSHLLGKNHIRLVADYYRNISLI
                     EESKKLKRTKNRKPHEKEVTESRNAPRCVIHCPTNRRKRMMKITKNKDTLDDLDVLDA
                     IYKGSPGYERIFRPENRIDIGHLLKVSKQPQRGNVNRNSVAKPTLNESTSVLPPPRTL
                     AWNNTYSMKFHDPSLLQKSINHTVKQLKR"
     gene            <408699..>409991
                     /locus_tag="KLLA0_A04587g"
                     /db_xref="GeneID:2896784"
     mRNA            <408699..>409991
                     /locus_tag="KLLA0_A04587g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451201.1"
                     /db_xref="GeneID:2896784"
     CDS             408699..409991
                     /locus_tag="KLLA0_A04587g"
                     /note="highly similar to uniprot|P02992 Saccharomyces
                     cerevisiae YOR187W TUF1 Mitochondrial translation
                     elongation factor Tu comprises both GTPase and guanine
                     nucleotide exchange factor activities while these
                     activities are found in separate proteins in S. pombe and
                     humans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451201.1"
                     /db_xref="GeneID:2896784"
                     /db_xref="GOA:Q6CUF6"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004541"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CUF6"
                     /translation="MSFLAPRFLTTKVFRPMSIGARTFSSSIRVSAAAFDRSKPHLNI
                     GTIGHVDHGKTTLTAAITKTLAERGGADFLDYSSIDKAPEERARGITISTAHVEYETD
                     KRHYSHVDCPGHADYIKNMITGAAQMDGAIIVVAATDGQMPQTREHLLLARQVGVQHI
                     VVFVNKVDTIDDPEMLELVEMEMRELLTQYGFDGDNTPVIMGSALCALEGKQPEIGEQ
                     AIMKLLDAVDEYIPTPARDLEKPFLMPVEDIFSISGRGTVVTGRVERGNLKKGEEIEI
                     VGHNTTPFKTTVTGIEMFRKELDQAMAGDNAGVLLRGVRRDQLKRGMVLAKPGTVKAH
                     TKFLASLYILTKEEGGRHSGFGENYRPQIYVRTADVTVVLKFPEAVEDHSMQVMPGDN
                     VEMECELVHPTPLEAGQRFNIREGGKTVGTGLVTRILE"
     gene            complement(<411494..>412765)
                     /locus_tag="KLLA0_A04609g"
                     /db_xref="GeneID:2896675"
     mRNA            complement(<411494..>412765)
                     /locus_tag="KLLA0_A04609g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451202.1"
                     /db_xref="GeneID:2896675"
     CDS             complement(411494..412765)
                     /locus_tag="KLLA0_A04609g"
                     /note="weakly similar to uniprot|Q6Q5F4 Saccharomyces
                     cerevisiae YPR015C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451202.1"
                     /db_xref="GeneID:2896675"
                     /db_xref="GOA:Q6CXY7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY7"
                     /translation="MNLNFNQTHHMVLDSDVPYRRHSSLEAKYAHSSKNVMYQLVRDK
                     TAELRRLVEGFVTDETVNSTEHNVIQTEVLQILNILHASTYVPTTAFPSPLSTSWNTN
                     QTTVANNNTSNTRNSVSQVVTDTSSNLPTSNDNSMDYTPMRSVGSFVNFQSNYSYRTL
                     PQSVNDRESIEAKRCVAEKPKSDLSAANNVRVLIQLPPVNTLLMKENDINNSHQHYPL
                     SQPANMYHQNQQHFPIQHHDSVSQESSQFQPLQDRHYHQTGTTPVPPMMVTTNDAAGP
                     VIPSTANASQIQEEQDGSVVNDKDDHSSGSTTERETTLRISKTELDGSITNAMPINDS
                     SLPLKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKR
                     HEFKSAAAATAAGQRQHQTAPRTNEANFVNA"
     gene            complement(<413642..>413914)
                     /locus_tag="KLLA0_A04620g"
                     /db_xref="GeneID:9487407"
     mRNA            complement(<413642..>413914)
                     /locus_tag="KLLA0_A04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999300.1"
                     /db_xref="GeneID:9487407"
     CDS             complement(413642..413914)
                     /locus_tag="KLLA0_A04620g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999346.1"
                     /db_xref="GeneID:9487407"
                     /db_xref="UniProtKB/TrEMBL:B5RSI4"
                     /translation="MHGNVWSTKTLDVSVSVSVSGSKKKCFMANMKEKIHSQDTKRQH
                     HVSYLVSHVWYDMGRPMLVESRYRQSTCLTHNRHPLPEMQKKKSTA"
     gene            complement(<415070..>416809)
                     /locus_tag="KLLA0_A04631g"
                     /db_xref="GeneID:2896673"
     mRNA            complement(<415070..>416809)
                     /locus_tag="KLLA0_A04631g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451203.1"
                     /db_xref="GeneID:2896673"
     CDS             complement(415070..416809)
                     /locus_tag="KLLA0_A04631g"
                     /note="weakly similar to uniprot|Q04602 Saccharomyces
                     cerevisiae YDR119W Uncharacterized transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451203.1"
                     /db_xref="GeneID:2896673"
                     /db_xref="GOA:Q6CXY6"
                     /db_xref="InterPro:IPR001411"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY6"
                     /translation="MVESDRTSLLQPVRNALNPELSEGLPAYVGAEVAETEHLLESED
                     EAREGLQVSEMSRARLHIIISSMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIA
                     TAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAG
                     IGGGGVTSLGSITASDIVPLRSRALYQGIFNFFFGLGIAIGGLIGGWFSESKNGWRMA
                     FLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSNDKDGKVDIKDKLKRIDWLGSLSLVT
                     FLFAFMLASSLGGKEIPYNSNIFKLLVVATILSGTAFIYVELYISDDPILPIRFLTNR
                     SILGASFANWFCMMSGVTLAFYVPVYWSSVQNLKPTDMGKRIAPNFFSTAFGSIGAGY
                     YMKKTGRYYGFLLKFTGLMVLGQLQVLLMKPDISTWRQYILLPLPHFGSSVLITVTLL
                     AMIAAVPHEHQAATTSISYAFRSTGSTLGVSVGAALFRNKLSGSLFDSVMKFESDKYS
                     KEYLLSIIKQASESSEYVHANAPKFIQATLIQCYEQACKSTFAFCFLISIFAWISCGV
                     IKEYKLHTSMERK"
     gene            complement(<417313..>419415)
                     /locus_tag="KLLA0_A04653g"
                     /db_xref="GeneID:2896785"
     mRNA            complement(<417313..>419415)
                     /locus_tag="KLLA0_A04653g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451204.1"
                     /db_xref="GeneID:2896785"
     CDS             complement(417313..419415)
                     /locus_tag="KLLA0_A04653g"
                     /note="similar to uniprot|P48234 Saccharomyces cerevisiae
                     YGR145W ENP2 Essential nucleolar protein of unknown
                     function contains WD repeats interacts with Mpp10p and
                     Bfr2p and has homology to Spb1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451204.1"
                     /db_xref="GeneID:2896785"
                     /db_xref="GOA:Q6CXY5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY5"
                     /translation="MVLKSTSASEISVYQVSGTNVARSLPDWIAKKRKRSLKNDLEYQ
                     NRVELIQDFEFSEASNKIKVTPDGNYVMATGTYKPQIHVYDFSNLSLKFERHTDAENI
                     DFCILSEDWTKSVHLQNDRTIQFQNKGGIHYTTRIPKFGRSLAYNKVNCDLYVGASSN
                     ELYRLNLEQGRFLNPFKLDTEGVNHVSINEVNGLLAASMETNVVEFWDPRSRSRVAKL
                     HLENNLDSADFQVTCSSFKNDGLNFACGTSNGYSYIYDLRTSEPSIVKDQGYGFAVNK
                     IIWLDSVEDSNKILTCDKRIAKIWNKNDGKAYASMEPSVDINDIEHVPGTGMFFTANE
                     GIPMHTYYIPNLGPAPRWCSFLDSITEELEEKPSDSVYSNYRFITKADVKKLNLTHLI
                     GSKVLRAYMHGFFINTELYDKVALIANPNSYRDEREREIRRRIEKERESRIKSTGAIT
                     TSKVKVNKMLVDKLSEKRGDKVAGKVLEDDRFKEMFEDDAFQVDEDDYDYKQLNPVKS
                     ARETSEGAAKRIRALTAAEESDEERIAARDGKSNYSDESDSESESESDEGNGERDQDM
                     SEKEKKAIAKQVAVVKRRREAKEKEQKFMNELTVGQIESREQDAINMTFDKKVKQLNK
                     EIGSSRSKDAIVRKNHRGEAELTFVPKKAPQKKKKVKFENNSDGDDDDETAKVDNGRT
                     KPRFDGRRRASKNVFRGM"
     gene            420025..420096
                     /locus_tag="KLLA0_A04686r"
                     /db_xref="GeneID:2896676"
     tRNA            420025..420096
                     /locus_tag="KLLA0_A04686r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2896676"
     gene            complement(<420317..>421372)
                     /locus_tag="KLLA0_A04708g"
                     /db_xref="GeneID:2896571"
     mRNA            complement(<420317..>421372)
                     /locus_tag="KLLA0_A04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451206.1"
                     /db_xref="GeneID:2896571"
     CDS             complement(420317..421372)
                     /locus_tag="KLLA0_A04708g"
                     /note="highly similar to uniprot|P53290 Saccharomyces
                     cerevisiae YGR163W GTR2 Cytoplasmic GTP binding protein
                     functions as a negative regulator of the Ran/Tc4 GTPase
                     cycle downstream of its binding partner and homolog Gtr1p
                     homolog of human RagC and RagD proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451206.1"
                     /db_xref="GeneID:2896571"
                     /db_xref="GOA:Q6CXY3"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY3"
                     /translation="MDNNTVDASKATILLMGLRRGGKSSICKVVFHNMQPLDTLYLES
                     TTSPTQEHFSTLIDLAVMELPGQLNYFEPNYESEQLFKSVGALVYVIDSQDEYLNALT
                     NLAMIIEYAKNVNPYLNIEVLIHKVDGLTEDFKMDIQRDIMQRIGDELLDLGIEGIQL
                     SFYLTSIFDHSIYEAFSRIVQKLIPELPFLENMLDNLVQHSKLEKCFLLDINSKIYVS
                     TDSSPVDIQTYEVCAEFVDVTIDLQDLYKGKLQNSNNKDGTDMKSVSVLNNGVVIYLK
                     QMIRGLALVTLMRPDDTDIEARLTVMDYNVDIFKRGLEKIWEKSKLISNSQDNDDNKD
                     NCEHVAPMTNGNASATY"
     gene            complement(<421863..>424928)
                     /locus_tag="KLLA0_A04730g"
                     /db_xref="GeneID:2896573"
     mRNA            complement(<421863..>424928)
                     /locus_tag="KLLA0_A04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451207.1"
                     /db_xref="GeneID:2896573"
     CDS             complement(421863..424928)
                     /locus_tag="KLLA0_A04730g"
                     /note="some similarities with uniprot|P39935 Saccharomyces
                     cerevisiae YGR162W TIF4631 also called eIF4 (eIF-4) gamma
                     mRNA cap-binding protein (eIF-4F) 150K subunit highly
                     homologous to Tif4632p homologs of mammalian p220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451207.1"
                     /db_xref="GeneID:2896573"
                     /db_xref="GOA:Q6CXY2"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022745"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY2"
                     /translation="MGEPTSDQQPAVEAPVVQEETTSSPQKNSGYVKNTAGSGAPRNG
                     KYDGNRKNSRPYNQRGNNNNNNGSSSNKHYQKYNQPAYGVSAGYIPNYGVSAEYNPLY
                     YNQYQQQQQLYAAAYQTPMSGQGYVPPVVSPAAVSAKPAKVEITNKSGEHIDIASIAH
                     PHTHSHSQSHSRAVPVVSPPANVTVAAAVSSSVSPSASPAVKVQSPAANGKEQSPAKP
                     EEPKKDTLIVNDFLEQVKRRKAALAAKKAVEEKGPEEPKESVVGTDTDASVDTKTGPT
                     ATESAKSEEAQSESQEKTKEEAPAEPKPLTLAEKLRLKRMEAAKQASAKTEELKTEES
                     KPEETKTEELKTEESKPEETKTEELKTEETKSEELKTEEPKAEESKAEEPKPEEPKTE
                     EPTTEQPKSDEPKSEESKTEEPKTEVLKTEEPKSEESKPAEPKTEETATEETATEANA
                     EEGEPAPAGPVETPADVETKPREEAEVEDDGKITMTDFLQKLKEVSPVDDIYSFQYPS
                     DITPPNDRYKKTSIKYAYGPDFLYQFKEKVDVKYDPAWMAEMTSKIVIPPKKPGSSGR
                     GEDRFSKGKVGSLRSEGRSGSRSNSKKKSKRDDRKSNRSYTSRKDRERFREEEVEEPK
                     VEVAPLVPSANRWVPKSKMKKTEVKLAPDGTELYDAEEASRKMKSLLNKLTLEMFEPI
                     SDDIMKIANQSRWEEKGETLKIVIQQIFNKACDEPHWSSMYAQLCGKVVKDLDDSIKD
                     SETPDKTGSHLVLHYLVQRCQTEFQTGWTDQLPTNEDGTPLQPEMMSDEYYKMAAAKR
                     RGLGLVRFIGFLYRSNLLTSRMVFFCFKRLMKDIQNSPTEDTLESVCELLETIGEQFE
                     GARIQVTAEAVIEGSSLLDTLFDQIKNVIENGDISSRIKFKLIDIVELREKRNWNSKN
                     KNDGPKTIAQIHEEEALKRALEERERERDRHGSRGGSRRMNSERNSSRRDFSSHSHSH
                     NQNRDGFTTTRSSSVRYSEPKKEEQAPTPTKSSGGAANMFDALMDAEDD"
     gene            complement(<425610..>426824)
                     /locus_tag="KLLA0_A04752g"
                     /db_xref="GeneID:2896813"
     mRNA            complement(<425610..>426824)
                     /locus_tag="KLLA0_A04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451208.1"
                     /db_xref="GeneID:2896813"
     CDS             complement(425610..426824)
                     /locus_tag="KLLA0_A04752g"
                     /note="highly similar to uniprot|Q01939 Saccharomyces
                     cerevisiae YGL048C RPT6 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451208.1"
                     /db_xref="GeneID:2896813"
                     /db_xref="GOA:Q6CXY1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXY1"
                     /translation="MSAVQISSIPLTSHDSGIKPFFDQKIQESELRIREKTSNLRRLE
                     AQRNALNDKVRFIKDELRLLQESGSYVGEVLKVISEKKVLVKVQPEGKYIVDVAKDIN
                     VKDLKVSQRVCLKSDSYQLHKVLENKVDPLVSLMMVEKVPDSTYDMVGGLTKQIKEIK
                     EVIELPVKHPELFESLGIAQPKGVILYGPPGTGKTLLARAVAHHTDCKFIRVSGAELV
                     QKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGSGGGDSEVQRTMLELLN
                     QLDGFETSKNIKIIMATNRLDILDPALLRPGRIDRKIEFPPPTVAARTEILRIHSRKM
                     NLTRGINLRKVAEKMNGCSGADVKGVCTEAGMYALRERRIHVTQEDFELAVAKVMNKN
                     DETAISVAKLFK"
     gene            <427263..>427856
                     /locus_tag="KLLA0_A04774g"
                     /db_xref="GeneID:2896531"
     mRNA            <427263..>427856
                     /locus_tag="KLLA0_A04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451209.1"
                     /db_xref="GeneID:2896531"
     CDS             427263..427856
                     /locus_tag="KLLA0_A04774g"
                     /note="similar to uniprot|P53178 Saccharomyces cerevisiae
                     YGL047W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451209.1"
                     /db_xref="GeneID:2896531"
                     /db_xref="GOA:Q6CXY0"
                     /db_xref="InterPro:IPR007235"
                     /translation="MNNTVLVTCGATVSFPRLVETVLDRSVTEKLKVLGYGRIVIQYG
                     RGFSDTFLQLVEKHLGLFTEKKSCGIKVLDKIENLKVISVDGIEICGFEFSHDIEKLI
                     ANNIDLVISHAGTGSILDSLRVGKKLIVVVNDTLMDNHQQLIADKFEQQKLLWSVHAN
                     TEELLRALDRSENEELLKIDNTYNKQFEKLLYNVAID"
     gene            complement(<427861..>428502)
                     /locus_tag="KLLA0_A04796g"
                     /db_xref="GeneID:2896592"
     mRNA            complement(<427861..>428502)
                     /locus_tag="KLLA0_A04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451210.1"
                     /db_xref="GeneID:2896592"
     CDS             complement(427861..428502)
                     /locus_tag="KLLA0_A04796g"
                     /note="similar to uniprot|Q754R6 Ashbya gossypii AFR006C
                     AFR006Cp and weakly similar to YGL020C uniprot|P53192
                     Saccharomyces cerevisiae YGL020C MDM39 Protein involved in
                     determination of mitochondrial structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451210.1"
                     /db_xref="GeneID:2896592"
                     /db_xref="GOA:Q6CXX9"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /translation="MESWLLVILAFLVLERLWPLIDSLIQRFAQANSTKLKELMHQRQ
                     AILAEQKEISAQDQYVKWTKNNRTLEKINKQIEEEKKQLLSQVDRTKASLKKVKLVLI
                     TVPFTILKFYKGKMPIYDLPKGLFPNYLQGLFQHGWVYLALGPLNIKKVGDGTHVTVS
                     LAIWLFALLKVVSTLGNIWESLTAPAIPAPTITTDPIDQTNESEKPPVDQPVD"
     gene            <429275..>430108
                     /locus_tag="KLLA0_A04818g"
                     /db_xref="GeneID:2896549"
     mRNA            <429275..>430108
                     /locus_tag="KLLA0_A04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451211.1"
                     /db_xref="GeneID:2896549"
     CDS             429275..430108
                     /locus_tag="KLLA0_A04818g"
                     /note="similar to uniprot|P43639 Saccharomyces cerevisiae
                     YGL019W CKB1 beta (38kDa) subunit of protein kinase CK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451211.1"
                     /db_xref="GeneID:2896549"
                     /db_xref="GOA:Q6CXX8"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX8"
                     /translation="MSFIEPSNDSSDSGNYEEWIPTFCSRFGHEYFCQVPTDFIEDDF
                     NLTGLSQEVAYYRKALDTILDLESTSDEEEEKNDASSNSKKDNDAHVTRSIVEHSAEQ
                     LYGLIHARFILTKAGLQAMAEKFDRKEFGTCPRYHCGSIQLLPCGLSDTLGKQTVRLY
                     CPSCQDLYIPQSSRHLSLEGAYWGTSFPGVFLKHFKELEDYVEKKNKETYELKIFGFS
                     IAKEAICGPRMQWLRQYPKTDEEWEEFKKCEFEIPKELLEDNPGSQSSDDNNMSSTVT
                     N"
     gene            complement(<430541..>431113)
                     /locus_tag="KLLA0_A04840g"
                     /db_xref="GeneID:2896446"
     mRNA            complement(<430541..>431113)
                     /locus_tag="KLLA0_A04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451212.2"
                     /db_xref="GeneID:2896446"
     CDS             complement(430541..431113)
                     /locus_tag="KLLA0_A04840g"
                     /note="similar to uniprot|P53193 Saccharomyces cerevisiae
                     YGL018C JAC1 Molecular chaperone involved with partner
                     Ssq1p in assembly of Fe/S clusters and in mitochondrial
                     iron metabolism contains a J domain typical to J-type
                     chaperones localizes to the mitochondrial matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451212.2"
                     /db_xref="GeneID:2896446"
                     /db_xref="GOA:Q6CXX7"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX7"
                     /translation="MHRLLLRSYSNASSKTSKTLFQWFPKTFTSGKPQWEVDLKKLRK
                     EYRQLQSEHHPDVITSTVDNVSSELNRAYKTLSKPLPRSQYILSLHGIDLTQDGEAQK
                     VMSKDPQLLMLVLDVHEQLEDINSEEDLKQIEQENKQRLNECEQKLKKAHESQDWETA
                     AMLTVELRYWSNLDNAIKEWEPGKPILLTH"
     gene            <431710..>433221
                     /locus_tag="KLLA0_A04862g"
                     /db_xref="GeneID:2896777"
     mRNA            <431710..>433221
                     /locus_tag="KLLA0_A04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451213.1"
                     /db_xref="GeneID:2896777"
     CDS             431710..433221
                     /locus_tag="KLLA0_A04862g"
                     /note="similar to uniprot|P16639 Saccharomyces cerevisiae
                     YGL017W ATE1 Arginyl-tRNA-protein transferase catalyzes
                     post-translational conjugation of arginine to the amino
                     termini of acceptor proteins which are then subject to
                     degradation via the N-end rule pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451213.1"
                     /db_xref="GeneID:2896777"
                     /db_xref="GOA:Q6CXX6"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX6"
                     /translation="MDFTDKLIISRPLYISDNADPKCGYCNGKKDSSHKFASPGWSDF
                     YKGDEDKVELQSSTVGFNSELVNAETYDKLCNLGFRRSGSFMYKTDMLRNCCRLYTIR
                     TNEKYLTMSKELKTSLKRFKKKITSPEFKPQPKYVSWIDELCDYEPKSTSFKAVFEPA
                     EFTDEKYDLYVRYQHYIHSDEDNTPSQFESFLCDTPFTDSEITGTEKEWEQLNNWHNL
                     QPGERVTKNGPAHECYYHNGKLIALSVLDFLPSGVSSVYFIWDPDYYDWSLGKVSALR
                     ELALVSKIGRPYYYLGYYIDDCPKMNYKAKFGGEILDVCNQKYVPLSKIHQIIKHNEL
                     FVGLNSTVASPDSEILITSASDKINFDEPFINAVDDIYGPNGNASQNAITSVAKLRKY
                     GINYSPDLQRSIYKEIPNDGNSTSSASSDKKDVYRIPNVVPGLVPLMEIVSLFESGKM
                     NELNNNVVLFDTKINALRIVRDFISEKPEIKTVITDVIRLIGLDNTKKAIIII"
     gene            <433581..>436760
                     /locus_tag="KLLA0_A04884g"
                     /db_xref="GeneID:2896815"
     mRNA            <433581..>436760
                     /locus_tag="KLLA0_A04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451214.1"
                     /db_xref="GeneID:2896815"
     CDS             433581..436760
                     /locus_tag="KLLA0_A04884g"
                     /note="similar to uniprot|P32767 Saccharomyces cerevisiae
                     YGL016W KAP122 Karyopherin beta responsible for import of
                     the Toa1p-Toa2p complex into the nucleus binds to
                     nucleoporins Nup1p and Nup2p may play a role in regulation
                     of pleiotropic drug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451214.1"
                     /db_xref="GeneID:2896815"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX5"
                     /translation="MDINHIVSLIETFNNSHDSKVINDIQNVLQQHQKSELGIDLANA
                     LLSQENGSTNVKYFGALTYTVQLTTCLHTESQLWSIFQGNLVHLTRMMFLFTSNPAAA
                     SNLLVTITKLMSNLSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLFEW
                     RTDNSEIAERLVRTCLNEDVPYTELIGNISSSAPLNKLLLLFTKVIVEDMNKYQSKKS
                     SLSNVYEMVHNHLYISTMAILNFNLENMMSSGATSEVFPCITSWIHYISMARNVSAHG
                     TMDLTEMFNNMINVMCMASNGSQEFPYSDEVISIFDDLFSNDPTLMSFEVRAKLEAIF
                     LGVSRHSMNTSNDWMLAYMNHLVTNELYDDLKVLASCVVDFLQISNLDVCNKLFTNIH
                     ENTGDQSLEDYIRVLLQLTNFPLIPILQETYSSKMIEFWLDLAEGYGNLPQEALKADA
                     NEIAENMFNQVVQIYLPKISLMNKQKIMEEDDDQSLLHEFDDFRSATQDLMEILWTIL
                     GHSKLTIVLIRGVGQADTNNVDLYQVEAMSFLLAKLLDGVNFSQSPFISDAIGENHLI
                     DNLLFLLQTGCKQKEHSKTAQVLKLDFVKATCNLLGVMATYFHVDSKPLGPIVESLFE
                     CLETSRQYNPIEYSIKMELQLNRTISLICENCRKELIPFLPNFIQVLRSIMRPESPVS
                     HFTREKFVKSIGNIIQMCVSEGPEAQANHISNMVDMIGGLIQTTDAKSDMLSLLACLS
                     ELGSGLSQLPNDDEFIENNPMYLAQLPAFQAYWLQDPMRVKDKVMHLVQYALSKYGTD
                     PEFVEVSCLIIGKAITLPDDIPHFLRYPLSEMMSFYMTCISNCDYASGLPYIEYQLEK
                     IVAGFKDQLTSHEFDEMFKQFFLNYYSSHISSDPDLIQSMVSWVNSVLEAKPSLALKS
                     EYWTQFIVPEFLKYLQAKEKFTISSTTKFWMKTLNNRRYTQEDTEIINALFQSMGKQL
                     VYQTMFSLHHAQRSDVPQYAELIRTLFAKYPMPMKDWLYELLPQITGKEAIFHERFIN
                     KLTVTRASRATLSTVTEWWLDCNGLPNLQ"
     gene            <437523..>438965
                     /locus_tag="KLLA0_A04906g"
                     /db_xref="GeneID:2896839"
     mRNA            <437523..>438965
                     /locus_tag="KLLA0_A04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451215.1"
                     /db_xref="GeneID:2896839"
     CDS             437523..438965
                     /locus_tag="KLLA0_A04906g"
                     /note="similar to uniprot|P53090 Saccharomyces cerevisiae
                     YGL202W ARO8 Aromatic aminotransferase expression is
                     regulated by general control of amino acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451215.1"
                     /db_xref="GeneID:2896839"
                     /db_xref="GOA:Q6CXX4"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX4"
                     /translation="MTVKDMGCRTNVLHLLSDEAKIRKASPIKTTMKYFSDPNIVFLG
                     AGMPSGNMFPFESISFKSVSLDDVNGTGAVEGCIHRDKSDLEICQDVPLGVALQYGNS
                     RGQPELISFLKEHTSIFHNISINDWDLITTAGSTQAWDACLRLFCNRGETVLMEEYTY
                     SSSLEAAVAQGLNCVAMKMDKDGIKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPT
                     GCTLHEERKPELVRLASQYDFIIIEDDPYYFLQMNEFGAPELNVPGDVNEMQWFKENF
                     VNKLGRSLLEWDDVGRIIRLESVSKTFAPGCRLGWAIGPRYLLDHLWNYHEVSMQSTC
                     GFAQTLINGMFQRWGQIGYMKWLLRLRNSYSMKRDHCLTQCQKYLPNEVCSINLPISG
                     MFFMVYIDPHKHPKFEREFKSKVDLLEEHLYNSFVQNGMLLACSSWFRVDPNHNKILA
                     FRGSYASVDAEKMQNGIIMLGNVIKAEFCL"
     gene            <439349..>441934
                     /locus_tag="KLLA0_A04928g"
                     /db_xref="GeneID:2896848"
     mRNA            <439349..>441934
                     /locus_tag="KLLA0_A04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451216.1"
                     /db_xref="GeneID:2896848"
     CDS             439349..441934
                     /locus_tag="KLLA0_A04928g"
                     /note="similar to uniprot|P32479 Saccharomyces cerevisiae
                     YBL008W HIR1 Non-essential transcriptional corepressor
                     involved in the cell cycle-regulated transcription of
                     histone H2A H2B H3 and H4 genes contributes to nucleosome
                     formation heterochromatic gene silencing and formation of
                     functional kinetochores"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451216.1"
                     /db_xref="GeneID:2896848"
                     /db_xref="GOA:Q6CXX3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /translation="MKLLKLPWLQHREEHKSYEVYTCDVSPDSQRLATGGLDGKIRIW
                     SIPDILKFASNPNASTDKDILMKPLSTMSRHAGSVTTVKFSPDGKYLASGSDDRILLI
                     WELEGGTTQPMFGAESTDIEHWNVRRRLVAHDNDIQDICWAPDSSIMVSVGLDRAIII
                     WNGSTFEKVKRFDVHQSHVKGVVFDPANKYFATASDDRTIKMFRYHKTGETSFSVEHV
                     ITEPFKGSPLTTYFRRLSWSPDGQHIAAPNAMNGPVSTVAIIERGTWESPVSLVGHDQ
                     PTEVASFNPRIFKRQKDDSTTDTIDGKKTGISDEVDCIVASSGQDKTLAVWSTSKARP
                     LIVAQDICGKSITDMSWTPDGKILFITSLDSSIVVLTFEDNEFGEAIPLEQNIEYLHR
                     YGVDKDSLVFPETVEQLILEDQAKNLKKSNVDMNLLENRLGKPGTIAEPNILQVRSKK
                     RAQLTGTGNHTDNNTTSKAEPPHVNILQVKRKNKVTGVTEVLHDTVVKNGKKRVAPTL
                     ITMGHSPDKSRKRVILSTAQSLNNTVQPTTKPAPEEKSTLAKLQSTKLSKPSFSIPRL
                     GIHTLIMGFKERTRENFINQGSTDSTVDESNVNIDEGPQQLEQNSAEEHLLTLNSKTT
                     LEKIWRDEPNTRYLEFNSILPDADAVLREMGTIDDLYVLEVRNGVERSIQFDTEALYD
                     NSTRVLGYHAGQRSFELFFPDVVLTCVGCMETKTWILATTTGQLFFIDTLGQARCPRI
                     SIGHKIIKLCTSQSHVIAITETALIYVWDLVSMSLTLKNIPLLPLLARDPITGNRARF
                     TSKIKSAKMTENKDLQLVMTDIAPDSDSNPSTLHFLYSSSLSCWCSPKEALLVDASVE
                     QVITS"
     gene            <442461..>444818
                     /locus_tag="KLLA0_A04961g"
                     /db_xref="GeneID:2896339"
     mRNA            <442461..>444818
                     /locus_tag="KLLA0_A04961g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451218.1"
                     /db_xref="GeneID:2896339"
     CDS             442461..444818
                     /locus_tag="KLLA0_A04961g"
                     /note="highly similar to uniprot|P07264 Saccharomyces
                     cerevisiae YGL009C LEU1 Isopropylmalate isomerase
                     catalyzes the second step in the leucine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451218.1"
                     /db_xref="GeneID:2896339"
                     /db_xref="GOA:Q6CXX1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX1"
                     /translation="MTAPAATESNGPQTLYDKVFQDHIVHKDESGSYLLYIDRHLVHE
                     VTSPQAFEGLKNAGRKVRRVDCTLATVDHNIPTESRKNFVDTASFIKQADSRLQVQTL
                     EQNVKDFGVTFFGMTDARQGIVHIIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGI
                     GTSEVEHVLATQTIIQAKSKNMRIYVDGPLSPSVTSKDLILHIIGVIGTAGGTGCVIE
                     FAGQAIEELSMEARMSMCNMAIEGGARAGLIQPDQTTFDYIKGRPLAPKGAEWNKAVA
                     YWKTLHTDEGAQFDYDITIKSTDVIPTITWGTSPQDALPITASVPDPATISDPAVKAT
                     VERALKYMGLTPNVPLKELSIDKVFIGSCTNARIEDLRAAAAVVKGHKKADNVKLAMV
                     VPGSGLVKKQAESEGLDKIFEEAGFEWREAGCSMCLGMNPDILDPEERCASTSNRNFE
                     GRQGALSRTHLMSPAMAAAAGIAGHFVDIRDHEYRNSDVPKVSIEQEAEDKILQNAVY
                     EHEKEPIEEGESVDEQVDDQQLDIPPSDHVTKETPLKDAPTSAPKGMDPFLKLDGIAA
                     PVDKANVDTDAIIPKQFLKTIKRTGLKSGLFYEWRFTKGPDGKDVETDWVLNVEPWRN
                     AEILVITGDNFGCGSSREHAPWALKDFGIKCMIAPSFGDIFYNNSFKNGLLPIRLPED
                     LIVEKLSPLAEAGAKLIVDLPSQKIMDAEGNVLVDHFDVEPFRKHCLVNGLDDIGITM
                     QKEEYIAKYEAMRRDRFSFLEGGSKLIKPIKGTKKSPFGNRAQEW"
     gene            complement(<445032..>448787)
                     /locus_tag="KLLA0_A04983g"
                     /db_xref="GeneID:2896806"
     mRNA            complement(<445032..>448787)
                     /locus_tag="KLLA0_A04983g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451219.1"
                     /db_xref="GeneID:2896806"
     CDS             complement(445032..448787)
                     /locus_tag="KLLA0_A04983g"
                     /note="similar to uniprot|P32790 Saccharomyces cerevisiae
                     YBL007C SLA1 Cytoskeletal protein binding protein required
                     for assembly of the cortical actin cytoskeleton contains 3
                     SH3 domains interacts with proteins regulating actin
                     dynamics and with proteins required for endocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451219.1"
                     /db_xref="GeneID:2896806"
                     /db_xref="GOA:Q6CXX0"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007131"
                     /db_xref="UniProtKB/TrEMBL:Q6CXX0"
                     /translation="MTVFLGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTV
                     KKRVIGSDQDEPVGLVPKTYIEEAPVIGSVVALYDYEQVQNANEELVFHENDTFQLYD
                     DRDADWFLVKNTKNSEVGFVPGNYVEKQSQQAGGPAAGVTQSKHQAPAVLPLSELPAP
                     PQRLDRVNSQPSFRSGSTPAGAASTADAPGAPSTSTPPPASNAGVASHTTMPVDVSLL
                     PPPPKRNDTATTEVQRESAVAEPPAMPQRPSNTEHQTSYRDDPRDNNRTSQITRDYSD
                     DERDYDFDDDEEDQPPLPSRNGRPSASTAEHVWSVSEVDGRKKCKATLTVSAERIHFF
                     SAKTKVDQEWAVKDLINYNNEKKHLFLEFKNPYINLELHTGSNDLANEIMGVLGEIKG
                     AQTAVGLREVEAASRPAMTKKRAKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYM
                     CESVETGKRGIVPAQFVETRGSGSSRPSDESPSRSKSKTRSRSNTSNFTQNLVGSWKE
                     DADQDVSKKKSKTSSFFSKKKKTDDKEFPDPKKVRIWVDRSGTFKVEAQFLGCVDGKV
                     NLHKVNGVKIAVAADKLSEDDILYVERLTGMSMEKFKHKPKSSNNDSSAVNAERERRR
                     KAKERERELEERERDRQLREQELKELKRARDLLESEREKLRSAQDKELPPVKPPRPGS
                     EASKTHPVTKSSKNPEYDWFEFFLNAGVDVNNCQRYTINFEREQISEEILPDIEPSLL
                     RNLGLREGDILRVMKYLDNKFGRTKEASPSTGLFTEADGSLKVNHTGAPASAGVSHNL
                     LPDSNSSNRDDDAWTVRPAAKASDSSNKAQDFSGSLQDLLDLQPLEPKKKETPAPDVK
                     HLESVTTNGSNKKEETPLSANKTGTSLVPLDPFKTGGNNLIPITTGGFIMMPVATGGL
                     MPFQPTGGLVPLQRTGGMIAPQTTFGMQPTGTVLPVQKTANGLIPANTGGLMPQTTFG
                     VQPQTAFPATTFGSSITGGAMPLQRTGGALPPTSFNTQMPGAMPLQSTNTFGNQLTGG
                     ANLLPSTTFGNQFTGGANLQPATTFGNQFTGGANIQPATTFGNQFTGGANIQPNFNSG
                     NLFTGNQMNIQPQTTFGNQFTGGINLQNQPSLGNQLTGGALLQQSQLSFGNQLTGGAN
                     VQQPFNSNLPQTSFGLSQTTTGGFQPQSSFGINLQRTGGMNTAPQTSFNNQGGVNQVT
                     NSFQNMNLSQQPLQNQPTGFGFGNGPQAQQQRQANIFNASSSNPFGF"
     gene            complement(<449590..>450111)
                     /locus_tag="KLLA0_A05005g"
                     /db_xref="GeneID:2896804"
     mRNA            complement(<449590..>450111)
                     /locus_tag="KLLA0_A05005g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451220.1"
                     /db_xref="GeneID:2896804"
     CDS             complement(449590..450111)
                     /locus_tag="KLLA0_A05005g"
                     /note="similar to uniprot|P25338 Saccharomyces cerevisiae
                     YGL010W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451220.1"
                     /db_xref="GeneID:2896804"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW9"
                     /translation="MSPSLLDLETQLAFYKAYHNNTGNVLIHSIFVPTILFTSMRILN
                     DVKIWNGYTLTHLLALSFGLFYILLRVGTGILASLILALTCKFLNDGTIKMTQTTAWI
                     LFVISWIFQFIGHGVFEKRKPALLDNLVQSLVLAPYFILYELLFILGFMPELKKNLQA
                     RVDKELDRMRASK"
     gene            <450398..>451138
                     /locus_tag="KLLA0_A05027g"
                     /db_xref="GeneID:2896519"
     mRNA            <450398..>451138
                     /locus_tag="KLLA0_A05027g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451221.1"
                     /db_xref="GeneID:2896519"
     CDS             450398..451138
                     /locus_tag="KLLA0_A05027g"
                     /note="highly similar to uniprot|P21243 Saccharomyces
                     cerevisiae YGL011C SCL1 Proteasome subunit YC7alpha/Y8
                     (protease yscE subunit 7)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451221.1"
                     /db_xref="GeneID:2896519"
                     /db_xref="GOA:Q6CXW8"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW8"
                     /translation="MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTA
                     SVVISQKKVPDKLLDPKTVSYIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKY
                     GYDIPCSVLAKRMANLSQIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGY
                     KATATGPKQQELNSALEKHFKKLKDDKIDEESWEKTVEFGITTLIDSLGTDFSKNDLE
                     VGVAIKDKFFTLTADEIEERLVSIAEQD"
     gene            complement(<451480..>451926)
                     /locus_tag="KLLA0_A05049g"
                     /db_xref="GeneID:2896825"
     mRNA            complement(<451480..>451926)
                     /locus_tag="KLLA0_A05049g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451222.1"
                     /db_xref="GeneID:2896825"
     CDS             complement(451480..451926)
                     /locus_tag="KLLA0_A05049g"
                     /note="weakly similar to uniprot|P38210 Saccharomyces
                     cerevisiae YBL006C LDB7 Protein of unknown function null
                     mutant shows a reduced affinity for the alcian blue dye
                     suggesting a decreased net negative charge of the cell
                     surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451222.1"
                     /db_xref="GeneID:2896825"
                     /db_xref="InterPro:IPR013895"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW7"
                     /translation="MGYYDAICTLDTLDGAEQVSFTKNQLAFLVEEEIQQRKDRDELK
                     PKDTVEGRRVPVHEYLGPLSPKQAEAAAFAEYHWDHQLLGPYVPKSKLESLSANEFAA
                     YFRKRQFEEGRKALERVSMVPAIDLPIMGGGNPYGAAPHKQKHYRN"
     gene            complement(<452333..>453730)
                     /locus_tag="KLLA0_A05071g"
                     /db_xref="GeneID:2896703"
     mRNA            complement(<452333..>453730)
                     /locus_tag="KLLA0_A05071g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451223.1"
                     /db_xref="GeneID:2896703"
     CDS             complement(452333..453730)
                     /locus_tag="KLLA0_A05071g"
                     /note="similar to uniprot|P25340 Saccharomyces cerevisiae
                     YGL012W ERG4 C-24(28) sterol reductase catalyzes the final
                     step in ergosterol biosynthesis mutants are viable but
                     lack ergosterol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451223.1"
                     /db_xref="GeneID:2896703"
                     /db_xref="GOA:Q6CXW6"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW6"
                     /translation="MSDSTEEIKVAVRKPFLPQGKYLKLEEIEYEFGGIPGVIGMMVG
                     FPALMYYMWLSAQFYNGAPAWPKDGETWGQFLGHLLQLVKDHGVPSLYAWTIFLTFWV
                     AQIVFYYTLPGVWTKGQPLDHLQGKQLPYYCNAMWTFYVSNALIITLHLTGIFKLYTI
                     LDMFGEIMTCAIISGFAFSIYLYVYTLTVSKDYHRMTGTHIYDLFMGAPLNPRIGYLD
                     LKMFFEVRLPWYTLYFLTLGACFKQAEVYGRVSPQLWLILFAHWSYANACSKGEELIV
                     PTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYQWSTIYNVSLFVVLMIA
                     YYFFDTTNAQKNSFRKQIAGDKTIRKTFPFLPKQVLKNPKYMITENGSYLLIDGWYKL
                     ARKIHYTADWTQSLIWGLSCGFNSPFPWFFPVFFFVVLVHRALRDDAKCKKKYGADWD
                     KYCKECPYLFIPYVF"
     gene            <454423..>455211
                     /locus_tag="KLLA0_A05093g"
                     /db_xref="GeneID:2896822"
     mRNA            <454423..>455211
                     /locus_tag="KLLA0_A05093g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451224.1"
                     /db_xref="GeneID:2896822"
     CDS             454423..455211
                     /locus_tag="KLLA0_A05093g"
                     /note="highly similar to uniprot|P32379 Saccharomyces
                     cerevisiae YGR253C PUP2 Alpha subunit of the 20S
                     proteasome involved in ubiquitin-dependent catabolism
                     human homolog is subunit zeta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451224.1"
                     /db_xref="GeneID:2896822"
                     /db_xref="GOA:Q6CXW5"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW5"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNE
                     GIVLGVEKRVTSALLESDSIEKIVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLY
                     YDEKITVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAESLVLKILKQVMEEKLDENNAQ
                     LSSITKEGFQIYSDEKTAEIIKELKEKEKEEKPPGSEHSDVEME"
     gene            complement(<455456..>457006)
                     /locus_tag="KLLA0_A05115g"
                     /db_xref="GeneID:2896739"
     mRNA            complement(<455456..>457006)
                     /locus_tag="KLLA0_A05115g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451225.1"
                     /db_xref="GeneID:2896739"
     CDS             complement(455456..457006)
                     /locus_tag="KLLA0_A05115g"
                     /note="highly similar to uniprot|Q03330 Saccharomyces
                     cerevisiae YGR252W GCN5 Histone acetyltransferase
                     acetylates lysine 14 on histone H3 catalytic subunit of
                     the ADA and SAGA histone acetyltransferase complexes
                     founding member of the Gcn5p-related N-acetyltransferase
                     superfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451225.1"
                     /db_xref="GeneID:2896739"
                     /db_xref="GOA:Q6CXW4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR018359"
                     /translation="MPPKRRHHGAGRVQNKRGKVDTVKEEIKPKDEPVETEIDGGSAV
                     DEDVTDDLEHKTSKEDQKEDQKEEDGPIDAQNGTSETKVAGESVKTVEDKIESVTTNE
                     EVVESPVNDYNASSTTTKAEEKQLEEEANEKTDTSPIVENEVVDEEAGTTKFDFDGQE
                     YSYKDRPSVIEEKEGKIEFRVVNNDNSKENMMVLTGLKNIFQKQLPKMPKEYIARLVY
                     DRSHLSMAVVRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDY
                     VRATSPIKYFLTYADNYAIGYFKKQGFTKEITLDKNVWMGYIKDYEGGTLMQCSMLPR
                     IRYLDAAKILLLQEAAIRRKIRSISQSHIVRPGLKQFLDLDNIKPIDPMTIPGLKEAG
                     WTPEMDELAQRPKRGPHYAAMQNLLTELQNHAAAWPFLQPVNKEEVPDYYEFIKEPMD
                     LSSMEMKLNGNRYEKMENFIYDARLIFNNCRAYNGENTSYFKYANRLEKFFNSKVKEI
                     PEYSHLVD"
     gene            complement(<457440..>459251)
                     /locus_tag="KLLA0_A05137g"
                     /db_xref="GeneID:2896361"
     mRNA            complement(<457440..>459251)
                     /locus_tag="KLLA0_A05137g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451226.1"
                     /db_xref="GeneID:2896361"
     CDS             complement(457440..459251)
                     /locus_tag="KLLA0_A05137g"
                     /note="similar to uniprot|P38862 Saccharomyces cerevisiae
                     YHR171W ATG7 Autophagy-related protein that is a member of
                     the E1 family of ubiquitin-activating enzymes mediates the
                     conjugation of Atg12p with Atg5p a required step in the
                     formation of autophagosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451226.1"
                     /db_xref="GeneID:2896361"
                     /db_xref="GOA:Q6CXW3"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR006285"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /translation="MLNDLKFSPAFKSFVDTSFFHELSRLKLEVFKLDSAEKELFSAL
                     DLENITSNTVSLSLRDDSFDPVLNNEAVTLKGSVLNFNTIESFKSCDKVKFIKEKGQQ
                     LLEQGLKNGLKECVRFYVISFADLKKYKFYYWVCMPTFQSEGSSYEIISTKSIEDGVK
                     KDIWEQNSFISCVVDGKIQEASPQYLKVCQKVIFKDFSRLKGIPAAVTKNFLTVWSQI
                     STRNTYTICFLRDDNSSFAAEIRVTGSNTGCLKVSGWEKNGLGKLAPKSADLSSLMDP
                     VKIAEQSIDLNLKLMKWRIAPDIDLERIKNIKALILGSGTLGCYVARALLAWGTRHVT
                     FVDNSTVSFSNPVRQPLFNFEDCGRPKAEAASDSLKKIFPSVVSAGYQLEIPMIGHPV
                     SNESKQRKDYEILDELIRTHDVIFLLMDARETRWLPSVLGRMHEKIVINAALGFDSYL
                     VMRHGNNNDNLGCYFCNDIVAPSDSLTDRTLDQMCTVTRPGVALLAASQAVELLVTYL
                     QPSTNVLGSAPHQIRGFLNEFKTVKLETPAYQHCCASNENVILTLKENGWNFVKQALD
                     DYKCVEQLSGLSKVQEEAELAIQEDISFDDDEELSIE"
     gene            complement(<459573..>461117)
                     /locus_tag="KLLA0_A05159g"
                     /db_xref="GeneID:2896504"
     mRNA            complement(<459573..>461117)
                     /locus_tag="KLLA0_A05159g"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_451227.1"
                     /db_xref="GeneID:2896504"
     CDS             complement(459573..461117)
                     /locus_tag="KLLA0_A05159g"
                     /note="similar to uniprot|P38861 Saccharomyces cerevisiae
                     YHR170W NMD3 Protein involved in nuclear export of the
                     large ribosomal subunit acts as a Crm1p-dependent adapter
                     protein for export of nascent ribosomal subunits through
                     the nuclear pore complex"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_451227.1"
                     /db_xref="GeneID:2896504"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW2"
                     /translation="MNYTPLDQNHMQHQHATVLCCSCGVPMDGSSGLVMCYDCIKLNV
                     DITEGIPREANVSFCRNCERFLQPPSQWIRASLESRELLALCLRRLKGLNKVRLVDAS
                     FIWTEPHSRRIRVKLTVQGEAMANTIIQQTFEVEYVVIAMQCPDCARSYTTNTWRANV
                     QIRQKVPHKRTFLYLEQLILKHNAHVDTISISEAKDGLDFFYSQKNHAAKMLDFLNAV
                     VPIKCKKSEELISQDIHTGSSTYKFTFSVEIVPICRDDLVVLPKKLAKSLGNISQFVI
                     CSKVSNSLQFLDPTTLQTCDLTAPMYWREPFSALAEVSQLVEFIILDVEPTGQVRNKW
                     VLADVTVARSSDLGSNDQVYYVRTHLGGIIHPGDSVMGYFIANSNYNSELFDGLNIDY
                     VPDIVLIKKLYQRKTKKNRKWKLKRMAKEHKDIEASQDYTSRQQKQEMERAERDYEIF
                     LQELEEDEEMRQTINLYKSNKPAEHEGEMEEDEDEDAPQIDIDELLDELDEMTLEDQQ
                     QGEEML"
     gene            complement(<461373..>461966)
                     /locus_tag="KLLA0_A05181g"
                     /db_xref="GeneID:2896741"
     mRNA            complement(<461373..>461966)
                     /locus_tag="KLLA0_A05181g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451228.1"
                     /db_xref="GeneID:2896741"
     CDS             complement(461373..461966)
                     /locus_tag="KLLA0_A05181g"
                     /note="similar to uniprot|P53317 Saccharomyces cerevisiae
                     YGR251W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451228.1"
                     /db_xref="GeneID:2896741"
                     /db_xref="InterPro:IPR022592"
                     /db_xref="UniProtKB/TrEMBL:Q6CXW1"
                     /translation="MSRAQEIKEKQALLAKFQNGFSSSTAKVLGWIEDSKTSSNDLAK
                     EDSNESKKEFFQLPVIQIGSGLSFENAQSTDDTDIHTIGEFIKSDKKVSSLAKKKRAT
                     KDVQQRNSIHRVRKDDSQAMVSLKHKIRNQERQKIRNELPRGTNVSKDHSKNQYYTKS
                     TSSHSDSSSDEEDMEPKVQKHSKKQFGLLFAGKKSKR"
     gene            complement(<462167..>463474)
                     /locus_tag="KLLA0_A05203g"
                     /db_xref="GeneID:2896757"
     mRNA            complement(<462167..>463474)
                     /locus_tag="KLLA0_A05203g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451229.1"
                     /db_xref="GeneID:2896757"
     CDS             complement(462167..463474)
                     /locus_tag="KLLA0_A05203g"
                     /note="highly similar to uniprot|P38719 Saccharomyces
                     cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
                     helicase of the DEAD-box family involved in biogenesis of
                     the 40S ribosomal subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451229.1"
                     /db_xref="GeneID:2896757"
                     /db_xref="GOA:Q6CXW0"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSNSEFKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDC
                     IGGANTGSGKTIAFAAPMLTKWSEDPQGMFGIVLTPTRELAMQIAEQFTAFGSAMNIR
                     VAIVVGGESIVQQAIELQKRPHFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEAD
                     ILLTETFSKDLATCVSILPPKNKRQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVE
                     SVDNVAIPKTLETTYLLVPEHVKESYLYQILTSEKYVKSSCIIFVNRTVTAEILRRTL
                     KSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVLIATDVASRGLDIPIVELVVNYDIP
                     GNPDTFIHRAGRTARAGRHGESLCFVTEKDIQRVEAIEERINKKMEEFTDVGDTAVIR
                     KSLTKVTAAKRESLMAMDKEGFGERRKLQKRKNESKEKTHRRT"
     gene            complement(<463760..>465448)
                     /locus_tag="KLLA0_A05225g"
                     /db_xref="GeneID:2896768"
     mRNA            complement(<463760..>465448)
                     /locus_tag="KLLA0_A05225g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451230.1"
                     /db_xref="GeneID:2896768"
     CDS             complement(463760..465448)
                     /locus_tag="KLLA0_A05225g"
                     /note="similar to uniprot|P38860 Saccharomyces cerevisiae
                     YHR168W MTG2 Putative GTPase member of the Obg family
                     peripheral protein of the mitochondrial inner membrane
                     that associates with the large ribosomal subunit required
                     for mitochondrial translation possibly via a role in
                     ribosome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451230.1"
                     /db_xref="GeneID:2896768"
                     /db_xref="GOA:Q6CXV9"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV9"
                     /translation="MDTRRKSIRTGAIVMLGRPIFRRISRVNRCRFFSDVPDNAPGAI
                     DNEIWLQELASSRSKQKAPTAAVESTQNLSIKEEKKTSVQPMKGLRNKITFNIISTPP
                     DTQYIEIKSPLSNFTKLSYLQKNKNIRVQQSNFVDLRIIKCASGNGGDGCISFFRDRG
                     RAIGPPDGGDGGGGGSVYVQAIEGINSLSKLQTTYIADNGSNGTSAQADGSKGKDVMI
                     TVPVGTVVTWCLDPKVVREHVDQKIKEQGGGSLRTILDTSNIILNCTGRFYMDQKPNR
                     IQMFRESYEPGKGWIFKGKDEEYHLSKDWFQDLSKNVTEYDHNLLQTELESDRFPLYG
                     LDLSKPTEKPICLLKGGKGGLGNMHFLTSLIRNPRFCKEGRSGLQQHFMFELKSIADL
                     GLVGLPNAGKSTILNQISNATPRVGHWEFTTLHPTIGTISLGIDKPKFTVADIPGIIK
                     DASQDKGMGLEFLRHIERSKGWVFVISLEKDDPSQDLQILIEEVGGKEVVSLKNILVV
                     CNKADIDEKSTFKKYQKIQAQCQENNWDVVPISALKGENIDVLLHKMAQCAGKL"
     gene            complement(<465702..>466481)
                     /locus_tag="KLLA0_A05247g"
                     /db_xref="GeneID:2896700"
     mRNA            complement(<465702..>466481)
                     /locus_tag="KLLA0_A05247g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451231.2"
                     /db_xref="GeneID:2896700"
     CDS             complement(465702..466481)
                     /locus_tag="KLLA0_A05247g"
                     /note="some similarities with uniprot|O13539 Saccharomyces
                     cerevisiae YHR167W THP2 affects transcription elongation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451231.2"
                     /db_xref="GeneID:2896700"
                     /db_xref="InterPro:IPR018557"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV8"
                     /translation="MSNIYLDKLDEQEDQMRVTHTVATDIINSLEELVGALEREETTE
                     GLETLKVLKSKNDELLKSIAVTRVLQINSSEIRANLMKDPDLTASKIFLSSDDRDDPN
                     NLFNYFEETKGLHEAWMRHLSLVANLSDDLVHKLESSDESNKVLVNKNPLPAVLKETV
                     KQYEEIGDEQQRIENIRAKLFQYLDEIKAGRAKYALENKYILNSTLQQITKEVSEWSQ
                     RWTHIENSLFGDSPTSLKKLVQKAENIKELLTVESTDYQME"
     gene            <466776..>468674
                     /locus_tag="KLLA0_A05258g"
                     /db_xref="GeneID:2896720"
     mRNA            <466776..>468674
                     /locus_tag="KLLA0_A05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451232.1"
                     /db_xref="GeneID:2896720"
     CDS             466776..468674
                     /locus_tag="KLLA0_A05258g"
                     /note="similar to uniprot|P16522 Saccharomyces cerevisiae
                     YHR166C CDC23 Subunit of the anaphase-promoting
                     complex/cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451232.1"
                     /db_xref="GeneID:2896720"
                     /db_xref="GOA:Q6CXV7"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR007192"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV7"
                     /translation="MERLVFEDVQQQLRQSSTDLSRWKLFQSSKWSAEALMGMRPTDS
                     EDSLSADMSLATDGDDESPLKKRQILSSRCVLLDFCDNENQSETLPDVIPLMGKELDL
                     YLLASSMFDCKEYDRCAFFLKDTSHDGLEFLYLYSRYLLWDKKVTESTEDVMIKDPEI
                     FSADLSESLQAAEYGNDAEGKCRSGISLSNRDVDVGNGEKINLPKLHHEITDFLEKNK
                     SLSKLGTALLMYLLGIIQKKQGVPSGAMSYFLKSLKLYPYNWTCWCELLSCISRTDES
                     ILLLKYLNDNFSIVKENGIIHEHLMLRFFKLAVFKEFGGDFDKYIEELGEIMKVFPNF
                     SFLRAQHALINYKYMDYANAEIVFDELVTMDPYRLDDLDTYSNVLYVLQKPYKLAYLA
                     QYAANVDIYRPETCCIIANYFSSKQQHEKSILYFRRALMLDKSYTHAWILMGHEFIEM
                     KNSHAAIECYRRASDVNPRDFQAWYGLGQAYEVLDKHSFALYYFQKACALKPLDKRMW
                     FASASCYEKLDKTVQAIKCFQRSSQLSGEQDISILYRLAKLHEKNNDVSSCKHYMAKC
                     VELDEVKKAQQIDEIGKAKLWLAKHEFKHRNYSDAYNYANGVIHGTSQEIEEARAILA
                     ECRKRIDI"
     gene            <469130..>476365
                     /locus_tag="KLLA0_A05280g"
                     /db_xref="GeneID:2896628"
     mRNA            <469130..>476365
                     /locus_tag="KLLA0_A05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451233.1"
                     /db_xref="GeneID:2896628"
     CDS             469130..476365
                     /locus_tag="KLLA0_A05280g"
                     /note="highly similar to uniprot|P33334 Saccharomyces
                     cerevisiae YHR165C PRP8 Component of the U4/U6-U5 snRNP
                     complex involved in the second catalytic step of splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451233.1"
                     /db_xref="GeneID:2896628"
                     /db_xref="GOA:Q6CXV6"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012591"
                     /db_xref="InterPro:IPR012592"
                     /db_xref="InterPro:IPR012984"
                     /db_xref="InterPro:IPR019580"
                     /db_xref="InterPro:IPR019581"
                     /db_xref="InterPro:IPR019582"
                     /db_xref="InterPro:IPR021983"
                     /db_xref="InterPro:IPR027652"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV6"
                     /translation="MSGLPPPPPPPPGFPSYDITSKNHKSKGNEMEKHRSPVGAPPPP
                     PPGFSRVDLGPPPPPPPGIQPGIDILSDKAKNNLPPPPPPPPSSSSTSMIDEAQNDDQ
                     HYNGLSRDTKKIRKGKKRVAQKKSGLVHSHKVEMPPEHLRKILNDHMDMTSSRFNSDK
                     RAHLNALRYLPHAILKLLENMPQPWEQVKAVKVLYHVSGAITFVNEIPRVIEPVYTAQ
                     WSTMWIAMRREKRDRKHFKRMRFPPFDDDEPPLTYSDTIENLEPSEAITLDLDNYAHD
                     GVKDWIYDTRPLEDNAKAVNGSSYKRWKLDNGVMCSLYRLAKPLIEESNSDKNAKYLF
                     EQKAFFTSKALNNSLPGGPKFEPLYPNEEEEDYNEFNSIDRVIFRIPIRTEYQIAFPQ
                     IYAARPRSVETLWYHDPLSCTVKSEMEHSSATFFFGQSLNPTISHSLPHFHTTAENTR
                     DNSFRIPMDVRPLMETQELFFPTTNEAMSLYHAPYPYNKRSGKTTRAQDVALIKRWYQ
                     EHPDERYPNKVKSSHQRLLKNIVANELHTDDHTSKKKVKLLQSLANTKFFQETTIDWV
                     EAGLQVCKQGHSMLNLLIHKKGLTYLHLDYNFNLKPTKTLTTKERKKARFGNAFHLIR
                     EILKIIKLLVDSHVQYRMGNVDAFQLADGLYYILNHTGQLTGIYRYKYKVMHQIRTCK
                     DLKHVVYYRFNKIIGKGPGCGFWQPAWRVWIFFLRGIIPILERWLGNLLTRQFEGRST
                     DVVKTTTKQRLDAYYDLELRASVMNDILDMIPDGIKQSKARTILQHLSEAWRCWKANV
                     PWEVPGMPEPIKNIIERYVKAKADGWTSQAHYNRDRIKSGAHVEKIVLKKNLGRLTRL
                     WIKHEQERQKEIEKAGPEVTPAEASAVFSAMVDWLDARNFSPIPFPPLTYKNDTKILV
                     LALENLKEQYVSKVRLNAQEREELALIEEAYDNPHDTLNRIKKLLLTQRLFKPIQLTM
                     MDHYQHISPVYNVDPLEKITDAYLDQYLWYEADRRQLFPSWIKPGDSEIPPLLVYKWC
                     QGINNLDSVWDISKGQSTVLLQTDLQEFVEKMDLTLINRLLRLIIDPTLADYITAKNN
                     VSLIFKDMNHVNKYGLIRGLQFAPFVYQFYGLMIDILILGHERAQELAGPPNEPSEFL
                     QFPDKATETKSPIRLYSRYLDKIHILFHFEESESDELIQDYLMENPDPNFENSVGYNN
                     KKCWPRDARMRLIRHDVNLGRAVFWELTSRVPKSLVNITWENTLSSVYSKNNPNLLFT
                     MCGFEVRILPKSRMEDVISHDEGVWDLVLDSTKERTAKAFLQVSQEAIDEFRGRIQSI
                     LMGSGSTTFTKIVGKWNTALIALFTYFRESIVTTEPLLDLLVKSETRVQNRVKLGLNS
                     KMPTRFPPAVFYTPKELGGLGMLSASHILIPASDLRWSKHTDTGITHFRAGMSHEDEK
                     MIPTIFRYITTWENEFLDSQRVWADYAAKRQEAIKQNRRLAFEELEGSWDRGIPRIST
                     IFQKDRHTLAYDKGHRIRRQFKEYSVERSNAFWWTNNRHDGKLWNLNAYRTDVIQALG
                     GIETILEHTLFKGTGFKSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPNRRFTLW
                     WSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVFDICQ
                     ILDGQMDILQIESVQKESIHPRKSYKMNSSAADITLNSIYKWKVSRPTLLHQTKDSFD
                     ATTTDKMWIDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSLYPSPTGIMIGIDLAYNI
                     YDSYGTWFEGLKPLIHNGMKTIMKANPALYVLRERIRKGLQIYQSQVQEPFLNSSNYA
                     ELFSNDTKFFIDDTNVYRVTVHRTYEGNVATKPINGCVFTLNPKTGELYLKIIHTSVW
                     AGQSRLAQLAKWKTAEEVSALVRSLPKEEQPKQIIVTRKAMMDPMEVHMLDFPNISIR
                     PTELRLPFSSVLNIEKLNDVVLSATEPQMVLFNIYDDWLTRVSAYTAFSRLILLLRAL
                     KTNEEKAKMILLEDPTIPTRANHLWPSFTDDQWIEIETKMRDLILLEYGQKYNVNIAS
                     LTQTEIKNLILGQNIRAPSVQRQKMAELEAARNQKTDESSQSATAAMKLKTINAQGEE
                     ITVVSSSNYESQSFSSKNAWRSNAISNSLLHLKLKNIYVTAEDFVEDKDVLVFPRNLL
                     KKFVTIADVDVQIAGYMYGSPVKDHPNVKEIKTIALVPQLGSSATVRISPPPSSSKYL
                     NDMELLGWIHTQKVDSKFMSPSEVITHSKMFSDHNESAVDLCINLIPGAVSITGYTLS
                     TTGFNWGLQSKDITDPSPEGFEASFSETAQILLSERIMGNFLVPSSSIWNYAFMGTAF
                     SEDLPYELKLDIPLEFYNELHRAPHFIQFSELAGDEELEPDQENLFA"
     gene            <476757..>477878
                     /locus_tag="KLLA0_A05302g"
                     /db_xref="GeneID:2896808"
     mRNA            <476757..>477878
                     /locus_tag="KLLA0_A05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451234.1"
                     /db_xref="GeneID:2896808"
     CDS             476757..477878
                     /locus_tag="KLLA0_A05302g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451234.1"
                     /db_xref="GeneID:2896808"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV5"
                     /translation="MARTTTKRNVSAATRPQRKNPLRFKPGNSGPKYNRPNAAGPKKT
                     DHMIAATSTNANQTSNSDKSSKFLPMSGHEMNAAKYIMELTRLGYSFDKVQKGSKSNY
                     NFLSKMYNALRLPVNIDSGDISSNEENDVKIAVKENLLTKPTAFQNSIEKQETPKLSQ
                     NETEATEFNQSTSAPNVSNTKNRSFALPEERELTAIDSIASEMNEEKLGMALYEQTSR
                     ILMKTRLNLLKLKAAANKRVPKFSKELEASLKKKKDLLISDIESFYSTIGLRDEFAPG
                     MNDDFIELGDSFMDKSNHDEHIVNDENELPKRLQSPDQHISMANSKTYQLNLNQASNG
                     LVEPSTIIQDSVIKLKKSTPDHFTPYQSLNLTKRTQPNT"
     gene            <478337..>482674
                     /locus_tag="KLLA0_A05324g"
                     /db_xref="GeneID:2896765"
     mRNA            <478337..>482674
                     /locus_tag="KLLA0_A05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451235.1"
                     /db_xref="GeneID:2896765"
     CDS             478337..482674
                     /locus_tag="KLLA0_A05324g"
                     /note="weakly similar to uniprot|P38859 Saccharomyces
                     cerevisiae YHR164C DNA2 Essential tripartite DNA
                     replication factor with single-stranded DNA-dependent
                     ATPase ATP-dependent nuclease and helicase activities
                     required for Okazaki fragment processing involved in DNA
                     repair pathways potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451235.1"
                     /db_xref="GeneID:2896765"
                     /db_xref="GOA:Q6CXV4"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV4"
                     /translation="MVSTPKKKRTASVSISPFKKDTDAISVDYKGKPKKKPSKSYHFA
                     PLNRLSSEEPILKSIPISRVRNVEAGSSVKDTVNAKTSGKTKLASKRIINSTKTRREK
                     STEAVPETRYSDGPSEEVIWRYSPRKIDEQLCNHYNTGNDDNNSDELSQDMPLGQSST
                     PLINDKFKDVIDFENMDPNSIDKECRKIAQGSPVKRGEKDVTPMRDIHEILNDLEGPK
                     LLPPSSPICSEPVVIDDDPVENLPELASESISNHKHTTTNGIERTFTMYPPQINIDDD
                     EDEDDSLIDILTQRFTKPVITECNEESEESDASLLELLDEEKPATLPQLQVRKIERIE
                     VMLESEDENVEDSVKSNENQTDHLLNNKADVVERYVNLAKFPFPQRGCQRLCIFEIKE
                     MKSPAQIILTCFNQDAGKVNLILRDPWIRFRYEQGMIIHLIEGDHFPNKRLLSNDKDP
                     KTGLENDNLLIVYPDVLLSATAIGTAMDCERRAVLSSKFNEPGEYSLAAVLGNIIHAL
                     VQEVLKLKLLEPNQFLSKGLALEILDKVIKPFTTEVNMCGESVESVIKTISDEHLPFI
                     IEFVNIYVTKDNSRSWIQVIGTKNKRKLSVSQIVDIEENIWSSKYGLKGYIDVTVETN
                     VDSDGKKLLAPVEIKTGKWKSNAHEAQGLIYTLLLQDRYDIPVNLHMMLYTKLREFSL
                     QPKILISLKHLLNLRNKLATYLQVMNEEMSDWGGPQHELPAMIQNSKCDQCFMKTSCM
                     VLNKLSDKEQTPGLLKHEYTDLTRHLEAQGSQVLELFRSFYGKYDRLLMMEETSITSV
                     TKDTFLMSGTDREAQTGHCISQLTIKNVQDQGNGRYLYTFCRENDIQGSFATSNAEQQ
                     ETKKLKSAPPSMLSSDIHKGDYIMISNDTSGQLAIGTGHVSEIANDFIVINCARNILA
                     NNIHGDSFDRNTRQVVRSVLLKQKEPLNEKQSLTNSHRYRIDKNESATGLTLARYNLL
                     NLFLPEVLIEAEFSPQKSGEKLQLPVKRSLGGYSRGRRLIVELSEPKWTTHAARIPTL
                     NDSFNENQKMAIERSLTCRDYNLILGMPGTGKTSVICELVSILVNQGKSVMVTSYTNS
                     AVDNIIMKLTSRIPRSKMVRLGSGRRVHDLVKPYCITEMLDGDNENLSEIIDAAQVVG
                     VTCLGINDPWLQMRNGDFDYVILDEASQVSLPVAIGPLRFGYKFILVGDHYQLPPLVK
                     NSFARDNGLQESLFEKLCHSHPQSVVELQLQYRMNAEIMSLSNVLIYGGKLQCGTDEI
                     RRQVLQFPNNYKCSQDTWLQKAINPEQPVVILDHDGFQSTSNQQFVEQNDHGQLSNVG
                     EANVVNEVVRELLAHGIEVDQIGVMSMYKAQMSLLKTTLEDLDIDVLTADQFQGRDKD
                     CIIISMVRSNPDQASGVLLRDLRRINVAVSRAKKKLIIICSWKCISKIHPLKPFVDHV
                     ARNNWITKM"
     gene            <485886..>488510
                     /locus_tag="KLLA0_A05346g"
                     /db_xref="GeneID:2896810"
     mRNA            <485886..>488510
                     /locus_tag="KLLA0_A05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451236.1"
                     /db_xref="GeneID:2896810"
     CDS             485886..488510
                     /locus_tag="KLLA0_A05346g"
                     /note="some similarities with uniprot|P53316 Saccharomyces
                     cerevisiae YGR250C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451236.1"
                     /db_xref="GeneID:2896810"
                     /db_xref="GOA:Q6CXV3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV3"
                     /translation="MTSASRKNSEVKETSPSRDVANGNGSNDNATSTNSTEYFANTNV
                     LTCRLKWVDPDTFITDPKKSQLLTSLNQLVHSNKGLLINPKEMENYQYFSDHERIAHL
                     KENLDVYLFERGNAEVDSWYRDSDLENEKTTWFYDVVIQAQFKPYKDLQATKEGFLSE
                     LTKFSGNGNKSSSILECWSISENPHALNHPGNLYVRGIPKNLTKEDLVPIFAKFGPIL
                     VLKIILDSNTNESMGFGFVSYALGSQASNCIKELNGNLMNGSPLFVNYHVERKERERI
                     HFDQWKQNEQEESTKFKGVFVGNLPIFTTENKLLTPSIVLEKFKKALPDCEMVSYFFP
                     KTNSQTNVEYSETDEDSKSESPLHLNAESFPVKSKHNSDETNKRNNEKIEDPQLKTIE
                     KHHDNGDEDIVMKNDATTSSDTEVPKSSSSSDDETEATNEETCSSQNEESPLKGYGFF
                     RFATHEMALKCIETFNDSQWYGHQLVVNKAIQKFHQHQHSYHGNSSSSLSSMNNNGNN
                     NHYHNHHHQQQQQQQQQQQQQQQYNNNNHHYSGPHQTHHGHSSPHQPYYQQSFFPPMY
                     SFRLSRRHSDRSISSRQSNAPGFSPPPITPLPLNEPSYNRNNSSNSRSISRQNSITNI
                     QYGSRDQAYDHHSPSSSTQNSIPPPSMSQPVYPVSIPPPPTGIPGQALPPLVTQSIPV
                     LTNSSTNSTGSPRNNSIYGPMNMPLTYSSSNPMFNTPLPIPRSDEQESNLYVKHLPLD
                     WRDEDLYQFFEKFGEIISAKIITVGGSIKEQDDQDLKKDELFGKSKGYGFVCFQNPLD
                     ASRAMYHTDGLKLNSDNTLFVSFAQRRSKSIDSIKGPVSNNVNYNKKFLNAMYQQQQQ
                     QYHPWMVPVPMHYPPPSH"
     gene            complement(<490032..>491270)
                     /locus_tag="KLLA0_A05368g"
                     /db_xref="GeneID:2896774"
     mRNA            complement(<490032..>491270)
                     /locus_tag="KLLA0_A05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451237.1"
                     /db_xref="GeneID:2896774"
     CDS             complement(490032..491270)
                     /locus_tag="KLLA0_A05368g"
                     /note="weakly similar to uniprot|P53050 Saccharomyces
                     cerevisiae YGR249W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451237.1"
                     /db_xref="GeneID:2896774"
                     /db_xref="GOA:Q6CXV2"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV2"
                     /translation="MHSKTFIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSS
                     KVLKRFFKHGNVSSFVRQLHMYGFHKLPHSASSTLAASGADNNGATASTNNATSKSEI
                     EWKFTHHSHDFCKSASEAQLKRIHRKSNNLGKDGKRRNVLSPVCVSYLGSSQDPTANA
                     NLPAELSRKSSGPVQPTHMSQTSNSPVHPLPSGSPLLQQPQPIHQHQLSIPTSVPGPI
                     RQASLPTTNPTIPAMPTIPPPPMNGAPLPITSPIPRMLGTPYYSISPYPSVSSHAGLG
                     PSSTALQTHTLFQYEQNLGILLRSMLQMCDVLSADDSNIQEHLQRLKLFKLELMTTES
                     NWNTLMANNSMTTKSSTASASTTASAVNRFNSYGSLESQKNSIFSNPRFSKVQKVSLG
                     GTTTQFPEGSGSVSQEYGPK"
     gene            complement(<495847..>496617)
                     /locus_tag="KLLA0_A05390g"
                     /db_xref="GeneID:2896320"
     mRNA            complement(<495847..>496617)
                     /locus_tag="KLLA0_A05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451238.1"
                     /db_xref="GeneID:2896320"
     CDS             complement(495847..496617)
                     /locus_tag="KLLA0_A05390g"
                     /note="similar to uniprot|P38858 Saccharomyces cerevisiae
                     YHR163W SOL3 Glucose-6-phosphate dehydrogenase weak
                     multicopy suppressor of los1-1 mutation homologous to
                     Sol2p and Sol1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451238.1"
                     /db_xref="GeneID:2896320"
                     /db_xref="GOA:Q6CXV1"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:Q6CXV1"
                     /translation="MVSVHEYSNSSELASSVGEFIVAEQNKALESHGRFNVAISGGSL
                     INVLRKALVDDPSVSKQIQWAKWHVYFSDERLVPLEDKDSNYGAFKQAVLEELTRKQV
                     IGPVVYTINESLVQEGGSENEKVSNEYESLLPKEPFDLILLGCGPDGHTCSLFPGEAH
                     KYLLEENKRKVLWCHDSPKPPSDRITITLPVLSASKSLAFVAEGSGKKPILDEIFNKQ
                     NQELPCTIVNKENDAKTRWFVNSDAVEGLGLHAEKYSA"
     gene            complement(<496866..>497507)
                     /locus_tag="KLLA0_A05412g"
                     /db_xref="GeneID:2896761"
     mRNA            complement(<496866..>497507)
                     /locus_tag="KLLA0_A05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451239.1"
                     /db_xref="GeneID:2896761"
     CDS             complement(496866..497507)
                     /locus_tag="KLLA0_A05412g"
                     /note="similar to uniprot|P53314 Saccharomyces cerevisiae
                     YGR247W CPD1 Cyclic nucleotide phosphodiesterase
                     hydrolyzes ADP-ribose 1'' 2''-cyclic phosphate to ADP-
                     ribose 1''-phosphate no detectable phenotype is conferred
                     by null mutation or by overexpression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451239.1"
                     /db_xref="GeneID:2896761"
                     /db_xref="GOA:Q6CXV0"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR012386"
                     /translation="MGISLWLCPYGHSPEYETFKTLIESLQTLFPNSPVFEPHVTVCS
                     GLSCENMEEVHKVLEMAHHAINAVKSKVDSENALVEFDGFNIGKKYFEKCRLECKPNP
                     MLYSLAKLIRSMFVGELNIDTWLFEEFHPHLSLAYSDIYPMDQAMIRLIRQRIEDLFD
                     VTTEEIESHSRDQDAYKLQHTLKGWSFPLTFKVVRCEGPVEEWEVLSEVTVHG"
     gene            <497874..>499544
                     /locus_tag="KLLA0_A05434g"
                     /db_xref="GeneID:2896820"
     mRNA            <497874..>499544
                     /locus_tag="KLLA0_A05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451240.1"
                     /db_xref="GeneID:2896820"
     CDS             497874..499544
                     /locus_tag="KLLA0_A05434g"
                     /note="similar to uniprot|P29056 Saccharomyces cerevisiae
                     YGR246C BRF1 TFIIIB B-related factor one of three subunits
                     of RNA polymerase III transcription initiation factor
                     TFIIIB binds TFIIIC and TBP and recruits RNA pol III to
                     promoters amino-terminal half is homologous to TFIIB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451240.1"
                     /db_xref="GeneID:2896820"
                     /db_xref="GOA:P46070"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /translation="MASTLQVSSRKCKNCGSTDFVRDISNTTNELICKVCGLVTEENS
                     IVSEVTFGEASNGAAVIQGAFVSANQAHPTFMSHSGQNALMSRETTLNNARRKLKAVS
                     YALNIPEYVTDAAFQWYRLALSNNFVQGRKSQNVIAACLYIACRKERTHHMLIDFSSR
                     LQVSVYSIGATFLKLAKKLQIVKLPLADPSLFIQHFAEKLELGDKKIKVIRDAVKLAQ
                     TMSRDWMYEGRRPAGIAGACLLLACRMNNLRRTHSEIVAISHVAEETLQQRLNEFKNT
                     TSAKLSVKEFRDDETEVNEGERSAESKPPSFDKNRLKEKKIKDSLDTKEMLETSEEAV
                     SRNPILTQVLGAQELSSKEVLYYLKKLSERRKAEFSRIKATHGIDGEDLHKTEKDKKR
                     SLDEIDGYSLEKDPYRPRNLHLLPTTASLLSKVSDHPENLDDVDDAELDSHLLDEEAS
                     KLKERIWIDINGDYLIEQESKRLKQEADLASGNTSLRKKRSKRTNRNQSSASIVKVQV
                     DGLPLDVSVDDADAVDVVAAGGVKNLLQKTTFSKKINYDAINGLFGQK"
     gene            <500097..>502376
                     /locus_tag="KLLA0_A05456g"
                     /db_xref="GeneID:2896334"
     mRNA            <500097..>502376
                     /locus_tag="KLLA0_A05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451241.1"
                     /db_xref="GeneID:2896334"
     CDS             500097..502376
                     /locus_tag="KLLA0_A05456g"
                     /note="highly similar to gnl|GLV|CAGL0F08129g Candida
                     glabrata CAGL0F08129g and similar to YGR245C
                     uniprot|P53313 Saccharomyces cerevisiae YGR245C SDA1
                     Severe Depolymerization of Actin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451241.1"
                     /db_xref="GeneID:2896334"
                     /db_xref="GOA:Q6CXU8"
                     /db_xref="InterPro:IPR007949"
                     /db_xref="InterPro:IPR012977"
                     /db_xref="InterPro:IPR027312"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU8"
                     /translation="MVRRSRAAILPTNIILLQNLVKRDPESYREEFLQQYAHYQSLRD
                     IFMLNSVNNESTDESAMAEFMGAIGFVSQVCSCYPRETANFPNELKQLVLDHHKSLPF
                     DVKEKIITSLTMLRNKNVISPETLIQTMFPLLIAYSSPSNSMVQNSHAKELRTLIYNT
                     LVQLMKSCNTSGKNQKLNKSTHALCFNLLEQPDSQGIWASKLTRELWRRGIWDDSRSV
                     EIMTHAALHNDVKIAYSGVLFFLDADKEREEAFEENDDEDEIDTTALKHKLQINKKSS
                     KRGKKLEQALKVVKKKSAKGVQQNNFLNFSAIHLLRDPQGFAEKLFERHLSGKNSNKF
                     DFEQKTAIMQLLSRLTGTHKLMVLGLYSYFLKYLTPKQRDVTKILSAAAQSCHDLVPP
                     ETIEVMVRKIANEFVSDGVSNEVATVGLNTVREILTRAPLAIDETLLQDLTEYKGSKA
                     KSVAIAAKGLIALYREVAPEMLKKKDRGKTASMGLQDDKRNGRESKRVKFGVETTNVQ
                     GIDGIELLAKWKRENGNEEDDDDEAAWDLNNRDELSDASDVEGEWVTIESDKEYEVDM
                     DSDDEESKNKTGHKGKKRSHDEVEPEAGEDSDLELSGDEEEPKVGEEQKEESESADPE
                     EAFRELASSRILTPADFAKLQELRTEKGVTKLMGINNEETIEHYKLMGPAKHKKQNKE
                     ERMASIMEGREDREKYGSKRGKRDSSMRSTTNKEKSRKKNFVMMIHKRSVKGKQKMSL
                     RDKQKVLRAHITKQKKKGN"
     gene            <503729..>504997
                     /locus_tag="KLLA0_A05478g"
                     /db_xref="GeneID:2896758"
     mRNA            <503729..>504997
                     /locus_tag="KLLA0_A05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451242.1"
                     /db_xref="GeneID:2896758"
     CDS             503729..504997
                     /locus_tag="KLLA0_A05478g"
                     /note="highly similar to uniprot|P53312 Saccharomyces
                     cerevisiae YGR244C LSC2 Beta subunit of succinyl-CoA
                     ligase which is a mitochondrial enzyme of the TCA cycle
                     that catalyzes the nucleotide-dependent conversion of
                     succinyl-CoA to succinate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451242.1"
                     /db_xref="GeneID:2896758"
                     /db_xref="GOA:Q6CXU7"
                     /db_xref="InterPro:IPR005809"
                     /db_xref="InterPro:IPR005811"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013650"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016102"
                     /db_xref="InterPro:IPR017866"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU7"
                     /translation="MLSQAYKLRSCLHKSSSVVRQQVRNLSIHEYRSAELLRQYGVGT
                     PKGAAAHTVDEATKIAKELGGKNLVVKAQALTGGRGKGHFDNGMQSGIHMIDSVQDAT
                     EVSGKMLGYHLITKQSGIKGKLVSGVYIVERVNAKHEAYLSILMDRKTKKPLIICSSE
                     GGMNIEDVAKTNPDAIKKFYVEDSVGLTPETAAEIAASLGFSKEAEADAKDAVLKLYK
                     IFKEKDATQIEINPLSEVLDQDKKVMCMDAKFGFDDNASFRQKDVYSWRDLTQEDPDE
                     VTAKKSDLNFVKLKGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIET
                     AFKLILSNDNVDAIFVNIFGGIVRCDFVAQGLVAATKNLSVKVPIVARLQGTNLEQGR
                     RIIAESGLKIYSFDELDPAAEKVVELTNSK"
     gene            complement(<505579..>505989)
                     /locus_tag="KLLA0_A05500g"
                     /db_xref="GeneID:2896738"
     mRNA            complement(<505579..>505989)
                     /locus_tag="KLLA0_A05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451243.1"
                     /db_xref="GeneID:2896738"
     CDS             complement(505579..505989)
                     /locus_tag="KLLA0_A05500g"
                     /note="similar to uniprot|P53311 Saccharomyces cerevisiae
                     YGR243W FMP43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451243.1"
                     /db_xref="GeneID:2896738"
                     /db_xref="GOA:Q6CXU6"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU6"
                     /translation="MSSAAGNAFRRFMNSETGPKTVHFWAPTLKWGLVFAGFSDTKRP
                     VDKLSGTQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYQIGRIIKYRIEE
                     GDSASQIVKYIINGAEKPVVEKIVDKATPSAATQ"
     gene            <506882..>507130
                     /locus_tag="KLLA0_A05511g"
                     /db_xref="GeneID:9487488"
     mRNA            <506882..>507130
                     /locus_tag="KLLA0_A05511g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999301.1"
                     /db_xref="GeneID:9487488"
     CDS             506882..507130
                     /locus_tag="KLLA0_A05511g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999347.1"
                     /db_xref="GeneID:9487488"
                     /db_xref="UniProtKB/TrEMBL:B5RSI5"
                     /translation="MNSNHWSALTMSLGKRPRVVYDEVSSSGCYGPTLKKGNIGSRSD
                     CDGQDDRKGNVYDVRILMLNARILAKTKNTAEQPVDSV"
     gene            <507778..>509481
                     /locus_tag="KLLA0_A05522g"
                     /db_xref="GeneID:2896725"
     mRNA            <507778..>509481
                     /locus_tag="KLLA0_A05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451244.1"
                     /db_xref="GeneID:2896725"
     CDS             507778..509481
                     /locus_tag="KLLA0_A05522g"
                     /note="similar to uniprot|P53309 Saccharomyces cerevisiae
                     YGR241C YAP1802 Yeast Assembly Polypeptide, member of
                     AP180 protein family, binds Pan1p and clathrin; member of
                     clathrin assembly polypeptide AP180 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451244.1"
                     /db_xref="GeneID:2896725"
                     /db_xref="GOA:Q6CXU5"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU5"
                     /translation="MTTYHRLVKGATKIKMAPPKTKYTDPILLGTTNERDFGEIVNAL
                     EERINDSAWTVVFKSLAVAHLMIRDGDKDIALKYFSRNLDFFELRGLARSYPARSGDV
                     QALDRYRLYLKVRSEEYGKVRKDYVRNSNTNLKKFDDNRSSECLEHVESLELQIGALI
                     KNRYSQCDLNNDLIMFAFKMLVQDLLALYNALNEGIITLLESFFELTRSNAERTLKLY
                     KRFVQLTENVVRYLKSAKAVGLKIPVIKHITTKLINLLEDHLREDTENKGNTFSKDDQ
                     TQVQSELERIRHQRIALENQLKHQSVQQIQQTQTGYNPFATSPMSMASPQFDTRPAQV
                     ANTSNPFQQYQQVQPQMTQQMPQQVPQQVQPQMTQQIPQQVPQQMQQQMPQQVAQQTG
                     YNPFLQDLQMQQRAPQQTGQQQMPQQMQQQMQQQMQQQMPQQMAPPLQNTVTGIQPLQ
                     TGMMPLNNAATAPIIPSKTGPNNPFSLENVNRQQLQRQQTNPFSVQNYSQVSNNPFST
                     APESSPLIVPPNRATTGNNTFGGLELLPTVPVFPQTQIQQGFQAVANQRSQNEPNLID
                     I"
     gene            <510371..>513349
                     /locus_tag="KLLA0_A05544g"
                     /db_xref="GeneID:2896656"
     mRNA            <510371..>513349
                     /locus_tag="KLLA0_A05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451245.1"
                     /db_xref="GeneID:2896656"
     CDS             510371..513349
                     /locus_tag="KLLA0_A05544g"
                     /note="highly similar to uniprot|P16861 Saccharomyces
                     cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
                     phosphofructokinase involved in glycolysis indispensable
                     for anaerobic growth activated by fructose-2
                     6-bisphosphate and AMP mutation inhibits glucose induction
                     of cell cycle-related genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451245.1"
                     /db_xref="GeneID:2896656"
                     /db_xref="GOA:Q03215"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /translation="MNNSVYGVAFRSLSTGDEKLYKEATRFYHSLGFQTVKLYDNFKN
                     HDDSNLIVGTSKNSVKECWLESFKLSELDSQGFRVPQQEASNQLQTDGVMIKLRLVDT
                     EPLNQTADTVVYYTVSLDEVSKIGERVDDHNVKLVDPLGNVVLVTDSHDGKELNASEF
                     IAPKDSSVEQKITVELVDKDSKKKKIAVMTSGGDSQGMNAAVRAVVRSSIYYGCDVYA
                     VYEGYEGLVKGGDYLRKMEWKDVRGWLSEGGTLIGTARSKEFRERWGRKQACSNLIDQ
                     GIDALVVIGGDGSLTGADLFRSEWPSLVEELVKDGKFTEDEVALYQNLTIVGMVGSID
                     NDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRHCGWLGLMSGIATA
                     ADYIFIPERAAPHGKWQDELKRVCQRHREKGRRNNTVIVAEGALDDQLNPITAEQVKD
                     VLVELGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAILNMTPETPSPLIGILE
                     NKVIRMPLVESVKLTKQVAAAIEAKDFDKAISLRDTEFIELYSNFMSTTVNDDGSQLL
                     PEADRLNIAIVHVGAPSAALNAATRAATLYCLAHGHRPYAITNGFSGLIQTGQVKELS
                     WIDVEDWHNLGGSEIGTNRSVAAEDMGTIAYHFQKNKFDGVIILGGFEGFKSLKQLRD
                     GRDQYPIFNIPMCLIPATVSNNVPGTEYSLGSDTCLNALVKYTDAIKQSASSTRRRVF
                     VVEVQGGHSGYVASFTGLVTGAVSVYTPENAINLKTIQEDLALLKESFKHEQGETRNG
                     KLVIRNEMASDVYTTELLADIITEQSNDRFGVRTAIPGHVQQGGVPSSKDRVIASRFA
                     VKCVKFIEQWNKKNTAADNEDFKILRFNYVNGVKQYTVLDEDLSAAVICVNGSKISFK
                     PIAHIWENETNIELRKGQEIHWEEYNEIGDILSGRSMLRRKIQKEQQEESSLPSVADT
                     PLSSVTVSTSAAKEDSALYV"
     gene            <514368..>514619
                     /locus_tag="KLLA0_A05566g"
                     /db_xref="GeneID:2896805"
     mRNA            <514368..>514619
                     /locus_tag="KLLA0_A05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451246.1"
                     /db_xref="GeneID:2896805"
     CDS             514368..514619
                     /locus_tag="KLLA0_A05566g"
                     /note="weakly similar to uniprot|Q3E7A3 Saccharomyces
                     cerevisiae YJL133C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451246.1"
                     /db_xref="GeneID:2896805"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU3"
                     /translation="MFANYSAKVSRTVTKAIPSVATIASVSIPSKVATTKANTALFNA
                     GNSFKSFKEYREVATKYGPLSAKLAIKRQLAYPNGAPQL"
     gene            complement(<516514..>528711)
                     /locus_tag="KLLA0_A05621g"
                     /db_xref="GeneID:2896465"
     mRNA            complement(<516514..>528711)
                     /locus_tag="KLLA0_A05621g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451249.1"
                     /db_xref="GeneID:2896465"
     CDS             complement(516514..528711)
                     /locus_tag="KLLA0_A05621g"
                     /note="similar to uniprot|P36022 Saccharomyces cerevisiae
                     YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
                     motor protein required for anaphase spindle elongation
                     involved in spindle assembly chromosome movement and
                     spindle orientation during cell division targeted to
                     microtubule tips by Pac1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451249.1"
                     /db_xref="GeneID:2896465"
                     /db_xref="GOA:Q6CXU0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXU0"
                     /translation="MIHQEQNIVEPVLDFIHGVSVLYFKNCETLEGFRDQNTDQIQNW
                     LSEKTDAEPLFLVHDLDTLRVGLLLQIDSENLKKNNVLMVMKNQSVIDSDASIESQFN
                     IIMLPQDSQFDTLKTLVDVGLYQIFDKVVINRSRDSKTVPDSLLNTKRKIKDLSLSLQ
                     NLDKEIQLPNIEESIHPLVKQLVIDGATAHNVDEHLPPDQLNDSSFLNALQKTSNSWI
                     KAVHSISRLENNLADGTALDEVNFWRNYCTALRELEKMLSCKEVEITISILVSAKRFY
                     SSTSFINDTGLSNMIAETQSFSTFLDGLAIQNISSATSMPDLNIAIEKFAYEIRKLKI
                     TQYPLEKAIKLIEKVSDDICIKAEELLPNLLLMDYEQFLNIKENALMVLDNFEDKLKD
                     FTLMIRELMRKKAAKFIFLKLNCSTEGLKQRISNVSTFREQHHIFLEALTAVDNRPLR
                     ERTERIYDKVKPVNVLKADVVSWVHLQKNYSQQISLIEDELIAILRKELENCHSSKEM
                     FSIFERYELLTKRIRVLNAVREYQHQLLDNVKTDTNFIRDSISSWTPTNAAEEQFDIQ
                     SIIHDIVWRKKLLKKLKLITSKLTVILGSDWDKTTIGSQISKECTSIQSSLSTDKIYE
                     SWIWNAQNTEFSLDQSVFKVILSKTDYELKVNFNFSSGSLFKALRNLIWQGYDIPSDI
                     VRKSRITRNTYPYAAIIAEKLQTFFLVVDGVKQLSYTTPLLRNSVNDVWKSLSTLITE
                     SWETVPIDTIVDGSNISGDLARFEEGVDRLLRDYENFSTMEFQVKEYYLNLDNFSLDE
                     ASGNITEQLQYIVDKFRLEVTEDNVLFVSMLNHRLRMTLIQKFKDFIQSLILEPIEQR
                     ITFSNGVFQFEPSFCAVKSSWINRLSFIVNKIQNQPKLIVCSFGTALNTATFTDILSD
                     IQPTIVEYMDSIDRFHASLGKILSKWKTTEYLWTLTEEQFVANVSTDIEICLAFMTNI
                     YEQRKTMNYISFNTEAESSINVKVSEEQALLQCCAKFDQWHAFGLRHLILLYTQLSTD
                     LHHRLTMDRKFFEDLPLSFSSLKSITDMIIHLDNVGSKSEVTYKQFAILKSSQRLFLQ
                     VRANLPADFIYCEQLKTDLDSLKEICMKRENLVTENRDIIATKLDSEIERLKLVSESL
                     IQGWKNRKPVGSETDPAEALAVIASFEDSVNATKNQIHDLLKTAKVLLIPTTVNFHLQ
                     DILTEIQNYKAMWLSVGTLWNSMQDILNQTWNSVAIGDVKQRLQTLYDDTNNLPSNVL
                     QYSVFQNLLQSINSVLSAMKTLQNLKSAPLKAKHWCCIFQKFGSWEPPATTLDSQSFS
                     LIDVLSLSVSVNENELNNIVNQAKDEEVLASTLKDMRDKWKEVTIDSFIHQSGHKLIK
                     NWSSLFTTATDDINTLLSMKNSQFYKIFDQEIYELETKLTDFSEILMTGLEIQKQWCY
                     LYGVLNEGSSLKALLSVEAAQFSVLTSDLNILFNTLQTAKIAMDVLYHSDYINALRSL
                     LESLTRVRKSLNDFLESQRELFPRFYFIGNEDLLQLIGFSTDFEFLSNQMRKMFGSVG
                     RLEIVDNSITAIYSIEGERLSLINDVKVTPQTPAYQWLSSLEKELKHTLSTLATACYR
                     KYSLKDLDSLIDEYPFQVIWLCMLVNWTERAQTMRPDDLGNLIDDFTDAIKRLSIRKR
                     AADGMCRHTLIDSLLSEMFGLKEMTLLLKTAENKEVTWNETQKFYIDTSAAALETVKI
                     VQTGIEVQYGFEYVGVPETLVQTPTLQTFFATMLHALSNNLGGSPFGPAGTGKTESVK
                     YLAKRLGRFVLVFNCDDTFDYRSMARILFGIAQVGAWGCFDEFNRLKADLLSAVSSQI
                     EAIQSSMISEDRKLSILERNGLIHRNTAIFITMNLGYAGRSQLPGNLKRMFREFTMSA
                     PQTVIIIETLLNTMGFEDAKGTSSQLVSFFAELESKTSCQSHYDFGLRAIKSVIRNCN
                     LQLMQNEGIPNHAILLRSIWNIITPKLLEEDEAIFETAWNRFFPKNFSSVKGHDLEEI
                     VIEFCEKQHITFNDSFYKKCQQLYEVQKSQQGVILVGEAGCGKTTVLNATMEMVQNTT
                     KKSNVIYTIDSKALKKEQLYGNLDPVTFEWQDGLFTTILREINEDYLDEYENANIWII
                     FDSDLDPIYAETLNSALDDNKVFTLPNGERLDIPHHLHIVFEVEDLTFATPATISRCG
                     MLWFNKNIISPHNLFCSTYNRLFNSTPNYGPSATKLKDSMLEISDSIFCPEDFELILR
                     KSADLNHILDFDINRIAKVYSNLICNPYVSYFNDLSKMTSSIFKLFILRHSALSIVWA
                     FAGDCPVDDKIVFSSFIQSHLQSHGLPPVNGLILDYEVSPVSAELLPHKRNLQNTELE
                     AHQVLLPDLIIPTVDTYRHEAILFTLLKQHQPLILCGPPGSGKTMTLQSALKQSEDHM
                     LVGMNFSKDTTVESFLKTIEQHTTYKSTAEGLIMQPVSFGKQLVFFCDEINLPKPDKY
                     GSQPIILFLRQLLEKNGFWSPKDNKWVSLKNIQIVAACNPSSDPGRSKMTKRFTRHAA
                     IIMVDYPSKESLLHIYQTFFRSVLKASSIKKDYADNLARVSVEIYFECKKQFTVQQQY
                     HYIFSPRELTRWVRGVYHAISSSEMVDLPQLIKIWAYESRRIFSDRLVSEEERHLFDK
                     FLVDAVSSEFPLQNITDIIQPSFVFCNWLNMKYEQSDLNKIRSFVSERLKTFCEEVLS
                     YDIILHNEMLYAMLNVDRILKQVQGHGILVAPSGSGKTTITRFVAWLNGIDVRIPLVH
                     RNYNLLEFDAFLRHVLVESGVENKKVCMILDESNMVEASFVERLNTLLANSDIPGLFQ
                     AEDYDSLIAKIRGSPFLPRTVLDTEQSMYDWFTEQISKNLHVVIKISDPKKSNSANIM
                     TSPALFNRCVLTWMGTWKNGTLIQVAKHFIDKIPLDQTMEASDTVGQISSDSLRSKVT
                     EIFYSVFKDYYSSYDVPYPSPALFLDSLKVLRIEYTKKLTESDNNQRFIRNGLIKLKE
                     SVIMVKKLNKEMESKKNILQEKKIEARKTLDQMLHDQNESERKQEASIEIQKILNLQE
                     QEISKRRDVVMNDLAKAEPAILEAQRGVKNIKKQQLTELRTMINPPEAVKITLEAVCV
                     LLGFQIGTWKDIQQTIRKDDFIARIVTFETETMLSQELKHYIQTHYLNRSNFKYENVL
                     RASQACGPLYLWIEAQILFSDALTRVGPLQRDLQILEDEILRTRAKVLAADEMINELQ
                     EQIEKSKELYSKIIRDIEVLKSEMSLVESKVSKSTTLLESLNSEKERWTFETRQFTEV
                     KKNLLGDTILSSLYSAYCFTHDFKTRAELVGKWKMILATSDIAYDQSFNNLAKRVSLE
                     NKSFWIENGLSEDEFAIETFSAVVSPTIEKYPLILDPEGNILDVLYAVYGSKLVMTSF
                     LDQNFSKSLENTLRFGGVLLIQDGEFFDPFVTKVLKQEFQNVGGRRSIELGDSIRDLD
                     VSNDFRMIIYSRDKSWRVPNYVLTKTKAFNFTITKGNLESQTLQDILTNELPTIQNER
                     KLLLEKDSTCQLRLRELGNRLLGLLNSSESNILENEELLKTLENLKVEAGTMSTEISK
                     IQSLVLEQESAITEFSPISTIAVQIFELLEWVRIKKHWFYDVEVNEFLTVFRYVLENS
                     DELVNSKPNKPNKILSVLIRLMFCAFGPMFLENDRLSFAARLMELQMYSMESTRTVEE
                     WKMIRSNIDLLRTQPQLSERFTEFKEGLLVGDAKDGLSQMILTIMKEQPWEISDFLSK
                     NTRSNILLVGADKGVDGSFMIKKLAEQLQKKITTIAMGSSESCKIAEETLNDCVEVGG
                     WVLLQNIQMSLTWCNEILPKYLKQIISNSNENFKLFMTCSLQDSIHPSSQLLQYSTKI
                     AYEGESGVLYKVKKFWELIIQKKPVEGTGLYLKHLVCWIHSLLLERVKITTKDVEYHD
                     LDLELAINAVENCVDNEAIDWPKLRFIVGKLIYCNRLDKRDELYQWIMNLTASIMHEG
                     SFKANSNIIGDVGSPSSKHSMHGITEWLNNLPWTIEHKDIWLSVPKGNLERISFMQAV
                     SCMSDLVAMDAGSDQLDVK"
     gene            <528976..>529632
                     /locus_tag="KLLA0_A05643g"
                     /db_xref="GeneID:2896319"
     mRNA            <528976..>529632
                     /locus_tag="KLLA0_A05643g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451250.1"
                     /db_xref="GeneID:2896319"
     CDS             528976..529632
                     /locus_tag="KLLA0_A05643g"
                     /note="similar to uniprot|Q00246 Saccharomyces cerevisiae
                     YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
                     subfamily of Ras-like proteins likely to be involved in
                     the establishment of cell polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451250.1"
                     /db_xref="GeneID:2896319"
                     /db_xref="GOA:Q6CXT9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT9"
                     /translation="MALIVDNFRRTLGDIPHYSQCGVKGRSAQYHLKIVVVGDGAVGK
                     TSLLISYTQGKFPEDYVPTIFENYVTNLEGPNGKIVELALWDTAGQEEYSRLRPLSYT
                     DVDVLMICYAINSKVSFYNIEEMWLPEVKHFCPDVPIMIVGLKSDLYAEDNISDFVDA
                     FKAEETAKRIGAFVHLQCSSKSQQKVREVFDTAITAALYDELKPKKKKLNSRRKCVII
                     "
     gene            <529964..>531700
                     /locus_tag="KLLA0_A05665g"
                     /db_xref="GeneID:2896581"
     mRNA            <529964..>531700
                     /locus_tag="KLLA0_A05665g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451251.1"
                     /db_xref="GeneID:2896581"
     CDS             529964..531700
                     /locus_tag="KLLA0_A05665g"
                     /note="similar to uniprot|P33753 Saccharomyces cerevisiae
                     YKR056W TRM2 tRNA methyltransferase 5-methylates the
                     uridine residue at position 54 of tRNAs and may also have
                     a role in tRNA stabilization or maturation previously
                     thought to be an endo-exonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451251.1"
                     /db_xref="GeneID:2896581"
                     /db_xref="GOA:Q6CXT8"
                     /db_xref="InterPro:IPR001566"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT8"
                     /translation="MQLARIIFQRGFLRTFGTVAKKEFINMSTQVELKRVATQDIQPV
                     KPKQSKKSKIRKYKPKPLDPTSALGVLQFEIDEILKEFSLARDAILNDVGCILNEERD
                     GPMHRLYHREVNSVEVLKMGANGEGLALIPNPVDLDKKQIALIPFALPGDVVRIKTFK
                     THPHYVECDLLEVIKPSSKRNNDLIQCRYFGKCSGCQLQYLTYEDQLAFKKRTVMNAY
                     KFFAPRLMEDKLVPEIGETMRSPLEIGYRTKLTPHFDLPKRMKGNGERPALGFGHKGR
                     PQWRGNADGGSGPMLDIEECIIGTKIINQGMTNERARFEREFTKYNKGATILLREHTK
                     VIDPEIPVAEQLDDGSEDIEGKISYLQINDEENDKSLVKTCVTNTRQIVTEYINGYTF
                     QFSAGEFFQNNNSILPSVTAYVRKNLQIEGSKPEDPHYLVDAYCGSGLFSITSSKGVD
                     RVIGVEVSADSVAFAERNAKANGVENCKFIVGKAEKIFGSIDTPCDRTSVILDPPRKG
                     CDDIFMKQLAEYNPARIVYISCNVHSQARDVEYFLKETENGKHYKIESLRGFDFFPQT
                     HHVESVCVLSRS"
     gene            complement(<531875..>532354)
                     /locus_tag="KLLA0_A05687g"
                     /db_xref="GeneID:2896727"
     mRNA            complement(<531875..>532354)
                     /locus_tag="KLLA0_A05687g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451252.1"
                     /db_xref="GeneID:2896727"
     CDS             complement(531875..532354)
                     /locus_tag="KLLA0_A05687g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451252.1"
                     /db_xref="GeneID:2896727"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT7"
                     /translation="METGAVNYEDSGIIVSNNNTTNQNSTSVRDIRFQMSLQKHVSFV
                     ECLRIQLDCPFGIRIQLKKRAVSQCRKVKKWFKKLRKNIHCKNDINSPIPNWYHNVFG
                     NDAAEQPYVDDLQRNLFAAEDLSNESILTLGSSNTVVHSPKCAPLFIPVSGMLNREV"
     gene            <532965..>533756
                     /locus_tag="KLLA0_A05700g"
                     /db_xref="GeneID:2896593"
     mRNA            join(<532965..532988,533517..>533756)
                     /locus_tag="KLLA0_A05700g"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_451253.1"
                     /db_xref="GeneID:2896593"
     CDS             join(532965..532988,533517..533756)
                     /locus_tag="KLLA0_A05700g"
                     /note="highly similar to uniprot|P0C0V8 Saccharomyces
                     cerevisiae YKR057W"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_451253.1"
                     /db_xref="GeneID:2896593"
                     /db_xref="GOA:Q6CXT6"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHSSVQINIAQVDEEGR
                     AIPGEYVTYALSGYIRARGEADDSLNRLAQQDGLLKNVWSYSR"
     gene            <534438..>535670
                     /locus_tag="KLLA0_A05709g"
                     /db_xref="GeneID:2896575"
     mRNA            <534438..>535670
                     /locus_tag="KLLA0_A05709g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451254.1"
                     /db_xref="GeneID:2896575"
     CDS             534438..535670
                     /locus_tag="KLLA0_A05709g"
                     /note="weakly similar to uniprot|P47011 Saccharomyces
                     cerevisiae YJL137C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451254.1"
                     /db_xref="GeneID:2896575"
                     /db_xref="GOA:Q6CXT5"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT5"
                     /translation="MLGVVTLLYSLDYLPGALTLAYQLRKLLPKGSKEKQLCLILSKE
                     LIEEGQLSDDALKVLEILFDDIIEIDPIDLSDPVIRQNQVNLMMLENRSELAFTFMKL
                     HLWELTQYEKVLYLDSDVLPLDSDIFKIFDHVSNQTSDQIAAVPDCGWPDLFNSGVMV
                     IKPSKEKYQELHELATKELSIDGADQGILNQFFNPMCHDGDRLTEWIRLPFFYNVTSP
                     NAGYQYSPAIKFFANKLKLVHFIGKNKPWKHGSTGGQYNDKYRNQWWSLYMELCHEYF
                     QSELDIDIDHICRGVKDVDLSDIDLEDVKPTPVWNPAKEAPSDELPAEAPHLNISNSY
                     TWESELVVIPDDTPAQEKVTVPSEDGADITADHDTIVEAELPVTEHRHKTYTRPKPIF
                     PWELDTNYKATRVFPEDE"
     gene            <536243..>537433
                     /locus_tag="KLLA0_A05731g"
                     /db_xref="GeneID:2896809"
     mRNA            <536243..>537433
                     /locus_tag="KLLA0_A05731g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451255.1"
                     /db_xref="GeneID:2896809"
     CDS             536243..537433
                     /locus_tag="KLLA0_A05731g"
                     /note="highly similar to uniprot|P10081 Saccharomyces
                     cerevisiae YKR059W TIF1 translation initiation factor
                     eIF4A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451255.1"
                     /db_xref="GeneID:2896809"
                     /db_xref="GOA:Q6CXT4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSDGITDIDENQIQSTYDKVVYSFDDLKLKEELLRGIFGYGFVE
                     PSAIQQRAILPIIEGKDVLAQAQSGTGKTGTFSIAALQNIDEKIKAPQGLILAPTREL
                     ALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRGGAQIIVGTPGRVFDMIDRRIF
                     KTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVVLLSATMPGDVLEVTSKFMK
                     DPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSISVTQAVIFCNTRRKVEE
                     LTERLRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVI
                     NYDLPSNKENYIHRIGRGGRFGRKGIAINFVTNKDIGAMRELERFYSTQIEELPSSIS
                     ELFD"
     gene            <537889..>538701
                     /locus_tag="KLLA0_A05753g"
                     /db_xref="GeneID:2896826"
     mRNA            <537889..>538701
                     /locus_tag="KLLA0_A05753g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451256.1"
                     /db_xref="GeneID:2896826"
     CDS             537889..538701
                     /locus_tag="KLLA0_A05753g"
                     /note="similar to uniprot|P36144 Saccharomyces cerevisiae
                     YKR060W UTP30 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451256.1"
                     /db_xref="GeneID:2896826"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT3"
                     /translation="MPIELDTDGATTKALRALTKQCEVDPKLANDTSIHLIINTQQPV
                     GIRNDHVPRIIPLKHSQMKSANDVRILLICKDPSTLYRDSLTKEKATAELFKEIISVK
                     KLKQRFRGKKLKELYNEFDMIVADYRVHHLLPSVLGSTFYRSNRKLPFVVRMSKQIKE
                     KGSKMKEDCDPKYVKAQVKSICKNTWFLPNKDNCLSIKIGEIGVHAEAELMANAEDVI
                     DFLCDRSKKPQGGCIKDGKISSIFVKTSNSLSLPIWKKLEQESIDDDEEIRL"
     gene            <538934..>540268
                     /locus_tag="KLLA0_A05775g"
                     /db_xref="GeneID:2896827"
     mRNA            <538934..>540268
                     /locus_tag="KLLA0_A05775g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451257.1"
                     /db_xref="GeneID:2896827"
     CDS             538934..540268
                     /locus_tag="KLLA0_A05775g"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061W KTR2 Mannosyltransferase involved in N-linked
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451257.1"
                     /db_xref="GeneID:2896827"
                     /db_xref="GOA:Q6CXT2"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT2"
                     /translation="MQTSCIYKMIYSDGSSLAGYSMFALRRVYLGAYAAIVSLSLTLY
                     LIRVGFAVIKEVYLHQRIEQGFFPRSEDVLHKYDNIRRFNKSFGELKPASNSYLDDLI
                     IPVERDSIIQERENATILMLCRNWEIPGVLQSMRSLEDRFNRRYKYDWTFLNDVPFDD
                     YFIEATSAMASGKTKYGLIPSEDWDRPAWIDEELFEERLQMLKEKKVIYGDSKSYRNM
                     CRFNSGFFFRQKLLDQYDYYFRVEPDVEYFCDFPYDPFKVMREKKKKYGFVISIFEYE
                     DTVTTLWDAVEEFMDTYPEILHPNNSLSFLTDTTMVGRFFPVVDSNTDYNLCHFWSNF
                     EIGDLNFFRSDEYLQYFNYLDSKGGFYYERWGDAPVHSIGASLLLDKNEIHHFDEIGY
                     SHVPFETCPTSISARLVLRCMCDPNGESNIPIHPNSCLMRWWKNGAGKLFIR"
     gene            complement(<540318..>540920)
                     /locus_tag="KLLA0_A05797g"
                     /db_xref="GeneID:2896584"
     mRNA            complement(<540318..>540920)
                     /locus_tag="KLLA0_A05797g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451258.1"
                     /db_xref="GeneID:2896584"
     CDS             complement(540318..540920)
                     /locus_tag="KLLA0_A05797g"
                     /note="highly similar to uniprot|Q75BM1 Ashbya gossypii
                     ACR250W ACR250Wp and similar to YJL140W uniprot|P20433
                     Saccharomyces cerevisiae YJL140W RPB4 RNA polymerase II
                     subunit B32 forms two subunit dissociable complex with
                     Rpb7p dispensable under some environmental conditions
                     involved in export of mRNA to cytoplasm under stress
                     conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451258.1"
                     /db_xref="GeneID:2896584"
                     /db_xref="GOA:Q6CXT1"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT1"
                     /translation="MNTSTSTVQTKRRGLKKFVEEENAATLHLGEEFNLKQINHQGQE
                     ENLVALNLSESRLIIKETLQNRRKLFKTWASNGASNKDDDMDDEDNVNVHTQTQEKEL
                     QDIDRLLEQTTGGQNQALKQTMIYLTNFSRFRDQETVTAVSQLLSSTGLHPFEVAQLG
                     SLSCEDADEAKTLIPSLGTKISDEDLERILKELSNLETLY"
     gene            <541545..>543659
                     /locus_tag="KLLA0_A05819g"
                     /db_xref="GeneID:2896588"
     mRNA            <541545..>543659
                     /locus_tag="KLLA0_A05819g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451259.1"
                     /db_xref="GeneID:2896588"
     CDS             541545..543659
                     /locus_tag="KLLA0_A05819g"
                     /note="similar to uniprot|P14680 Saccharomyces cerevisiae
                     YJL141C YAK1 Serine-threonine protein kinase that is part
                     of a glucose-sensing system involved in growth control in
                     response to glucose availability translocates from the
                     cytoplasm to the nucleus and phosphorylates Pop2p in
                     response to a glucose signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451259.1"
                     /db_xref="GeneID:2896588"
                     /db_xref="GOA:Q6CXT0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:Q6CXT0"
                     /translation="MGDKNSLWNPAFMASQQGASSSNQNQNFSQTQANTQNQGPEIAP
                     DGPAGSSSNAGGNIYAGQQQGGNAAGGFQMQSPRQSIFKNPWQEIPQIPESQRSTMRK
                     QSNFPLPTTYEEDNAVDESSQQFRRRNSSLVIPPARAAGPDPFLYEKQPFPNYNDAQR
                     RQSVAVTGGSQLSPQQVTKPSQLRKPGINTAGYMAGSINSSVYPATAGAYMSTRGGSS
                     SLPSSRPPSPIIIVPKFNKIFTRQDLNPVIHSTPKYRRASLSSKTVSPLMALTKSLTT
                     TYSLCNDDFAYQTSKNPKRVLTKPNEGKYNNGHDNVNSDYILYVNDVLGVEHNRKYLV
                     LDLLGQGTFGQVVKCQNLITKEILAVKVVKSKSEYLNQSVTEAKVLELLNRQIDPNNE
                     HHFLRLHDTFVHKHHLCLVFELLSNNLYELLKLNEFHGLSMTLIKTFSKQLLDSLCVL
                     KDSKLIHCDLKPENILLVSNDRPDLKVIDFGSACEETRTIYTYIQSRFYRAPEVLLGI
                     PYSTGIDMWSFGCIVAELFLGIPIFPGNSEFDQVTRIVESLGMPPAWMCDMGKNSKKY
                     FHKMNTTVEKKFRMKTIDEFNLEFAANEESVKRYVKHILFDDIIRNARISKRISGNPA
                     LVEREIKNRDCLLHFLRGVLNLNPLERWTPQQAILHPFITEEPFTGEWYPPGTIPKKS
                     QTARNPSLQFDSVALDKLQLGD"
     gene            complement(<543975..>544439)
                     /locus_tag="KLLA0_A05841g"
                     /db_xref="GeneID:2896585"
     mRNA            complement(<543975..>544439)
                     /locus_tag="KLLA0_A05841g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451260.1"
                     /db_xref="GeneID:2896585"
     CDS             complement(543975..544439)
                     /locus_tag="KLLA0_A05841g"
                     /note="highly similar to uniprot|P39515 Saccharomyces
                     cerevisiae YJL143W TIM17 Mitochondrial inner membrane
                     protein involved in protein import 16.5 kDa inner membrane
                     protein required for import of mitochondrial precursor
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451260.1"
                     /db_xref="GeneID:2896585"
                     /db_xref="GOA:Q6CXS9"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005678"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS9"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGVIGGCVWHGIKGFRNSPLG
                     ERRAGAVSAIKARAPVVGGNFGVWGGLFSTFDCGVKAVRKREDPWNAIIAGFFTGGAL
                     AIRGGWKHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPDQPMQA"
     gene            complement(<544850..>545104)
                     /locus_tag="KLLA0_A05852g"
                     /db_xref="GeneID:9487470"
     mRNA            complement(<544850..>545104)
                     /locus_tag="KLLA0_A05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999302.1"
                     /db_xref="GeneID:9487470"
     CDS             complement(544850..545104)
                     /locus_tag="KLLA0_A05852g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999348.1"
                     /db_xref="GeneID:9487470"
                     /db_xref="UniProtKB/TrEMBL:B5RSI6"
                     /translation="MTKSYRSRTGIRTKRQTRRLAPPSQQAKEPDRNVLPTYQYHNQY
                     ENQFEPVPITFYYVVFPQGESQNEPDGGTNNSQTHPNPLP"
     gene            <545949..>547088
                     /locus_tag="KLLA0_A05863g"
                     /db_xref="GeneID:2896459"
     mRNA            <545949..>547088
                     /locus_tag="KLLA0_A05863g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451261.1"
                     /db_xref="GeneID:2896459"
     CDS             545949..547088
                     /locus_tag="KLLA0_A05863g"
                     /note="highly similar to uniprot|P32451 Saccharomyces
                     cerevisiae YGR286C BIO2 Biotin synthase catalyzes the
                     conversion of dethiobiotin to biotin which is the last
                     step of the biotin biosynthesis pathway complements E.
                     coli bioB mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451261.1"
                     /db_xref="GeneID:2896459"
                     /db_xref="GOA:Q6CXS8"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS8"
                     /translation="MFVRRFSTSLIRAGAGATALKESVAGENVSAISYALSLNEPQHV
                     WTKEQLAEIYHTPLMELMHQAQLQHRKWHDPTKVQLCTLMNIKAGGCSEDCKYCAQSS
                     RYDTGLKAEKMISVEEVIKEAQIAKENGSTRFCLGAAWREMRGRKSALKRIGEMIGKI
                     NEMGMESCVTLGMVDETQAKQLKDAGLTAYNHNIDTSREHYPKVISTRSYDDRLQTIK
                     NVQDAGIKACTGGILGLGETEDDHIGFVHTLANMSPHPESLPINRLVSIKGTPMHEEL
                     KKVSSKKLEFDEILRTVALARIVMPQAIIRLAAGRYTMKETEQFLCFMAGCNAIFVGK
                     KMLTTMCTGWDEDKAMLSKWGLQPMESFSYSANKAPAEAACAGGQ"
     gene            complement(<547338..>548231)
                     /locus_tag="KLLA0_A05885g"
                     /db_xref="GeneID:2896330"
     mRNA            complement(<547338..>548231)
                     /locus_tag="KLLA0_A05885g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451262.1"
                     /db_xref="GeneID:2896330"
     CDS             complement(547338..548231)
                     /locus_tag="KLLA0_A05885g"
                     /note="similar to uniprot|P47008 Saccharomyces cerevisiae
                     YJL145W SFH5 putative phosphatidylinositol transfer
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451262.1"
                     /db_xref="GeneID:2896330"
                     /db_xref="GOA:Q6CXS7"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /translation="MPLNFETDEQKKCYELLRADVENIVKETGYDELYGHKLTPDDQF
                     YEEVIVDNLIYKFCRANQFEIEGAKSQLKKTLKWRKEFKPLHAAFSETHDSLLNDVCA
                     ITVSEENDPNQKVVSWNLYGLLVKHKEVFEDTDKFLRFRIGLMERGLQLLDFASEDNY
                     LMTQVHDYNNVSMWRLDPAIKKCSKAIIEVFQDFYPETLFSKFFVNVPYVMTWLYEIV
                     KRFVSEDTRKKFIVMSDGTQMKDYLKVLPKEYGGEATLNSSKLENIEPNAYVSYLLTQ
                     CGGEEPAETTAPEQEKETATA"
     gene            complement(<548720..>549763)
                     /locus_tag="KLLA0_A05907g"
                     /db_xref="GeneID:2896763"
     mRNA            complement(<548720..>549763)
                     /locus_tag="KLLA0_A05907g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451263.1"
                     /db_xref="GeneID:2896763"
     CDS             complement(548720..549763)
                     /locus_tag="KLLA0_A05907g"
                     /note="weakly similar to uniprot|P46958 Saccharomyces
                     cerevisiae YJL146W IDS2 Protein involved in modulation of
                     Ime2p activity during meiosis, appears to act indirectly
                     to promote Ime2p-mediated late meiotic functions; found in
                     growing cells and degraded during sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451263.1"
                     /db_xref="GeneID:2896763"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS6"
                     /translation="MNDQVENLSKELDISIDIANAVNKSLKETNVDPTFRSNTPIQSQ
                     SEDSIQGSETADNTSYQLWNHHYVEAPSAADNSNITEILEDWNFIDDNVRNKRRTSME
                     DIFKVRHYLNPRSSFTNSGTNSRCWVTIITQMAEISCAIALNSSLRAHDSKLILCVVI
                     PKDWNIPLPQLPFLTFVKLPKVTFADKELTLLTLWNHLDYEFCCFLSPFAILQTNIDE
                     MLLNDEIFLEIDNETCVFLTNDTYQRKEDIVFLLFKPSVEIGTAVDEFLKVYSGDSAK
                     LAQLQETDPYDALNTLFGEAWGFVGRDICQTLYDPSLSSNASILNYKKLEPWKGNHSG
                     ICQLWWDMYKGDN"
     gene            <550666..>551748
                     /locus_tag="KLLA0_A05929g"
                     /db_xref="GeneID:2896458"
     mRNA            <550666..>551748
                     /locus_tag="KLLA0_A05929g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451264.1"
                     /db_xref="GeneID:2896458"
     CDS             550666..551748
                     /locus_tag="KLLA0_A05929g"
                     /note="weakly similar to uniprot|P47007 Saccharomyces
                     cerevisiae YJL147C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451264.1"
                     /db_xref="GeneID:2896458"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS5"
                     /translation="MLKRSFSILPRVLKSKDSAAVKRTIQYITEDKTFKSILGGSKAD
                     DENVFVDDVLKLLNSSLPDVKKHQKTMDVHYSVLMNKLRGMVDKEIVYATVDVNKRIA
                     DCADANDLYRLIWEIQMDPLLRDKATLKHYYHIINSPNFSVAKCAELLDCIDMIKYSK
                     TDIMIMAIYKLNNPTVTSKYVKELISIYPSLNQFSQKLTLRILRGANRLQELFDTQND
                     QIHTITGNHSQVVMIFQTLFRSAYKLPEHLIDESTELTPLQRSFCSSVRVLSEYSSAQ
                     PKLAKCCSQMVKASFMNKVSHCNKESEHSININEYKFLKYMEETLEDCLNIAGLDDFF
                     YDSCRRILCSVRKTYTEESQLSLRLI"
     gene            <552438..>553298
                     /locus_tag="KLLA0_A05951g"
                     /db_xref="GeneID:2896497"
     mRNA            <552438..>553298
                     /locus_tag="KLLA0_A05951g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451265.1"
                     /db_xref="GeneID:2896497"
     CDS             552438..553298
                     /locus_tag="KLLA0_A05951g"
                     /note="highly similar to uniprot|Q75BM7 Ashbya gossypii
                     ACR244C ACR244Cp and similar to YKR062W uniprot|P36145
                     Saccharomyces cerevisiae YKR062W TFA2 TFIIE small subunit
                     involved in RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451265.1"
                     /db_xref="GeneID:2896497"
                     /db_xref="GOA:Q6CXS4"
                     /db_xref="InterPro:IPR003166"
                     /db_xref="InterPro:IPR016656"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS4"
                     /translation="MSNDLLANLNAFKNKVKTSPALTTRKVLANKDRDGQTNGNGKST
                     EVIEVDDPNSDEKDMPLKKRAKSSSVAPTGQLDSTHLSTKMLIATEYIQERGEAVPVD
                     QIESYLSLPKDNNVIPMLKGLQKFKFDPKRNTLQYVSIYDVHSAEELLQLLRSQATFK
                     GISCKELKDGWPQCFDTIDELEAKNRILVLRTKKDNSPRFVWYNHAGPSRQIDEEFVT
                     MWEACKLPQRSELPRKLQDLGLKPASVDPATIKNEQTTRKEVKKRRSRKGKVTNTHMA
                     GILRDYSDRV"
     gene            complement(<553403..>553987)
                     /locus_tag="KLLA0_A05973g"
                     /db_xref="GeneID:2896329"
     mRNA            complement(<553403..>553987)
                     /locus_tag="KLLA0_A05973g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451266.1"
                     /db_xref="GeneID:2896329"
     CDS             complement(553403..553987)
                     /locus_tag="KLLA0_A05973g"
                     /note="weakly similar to uniprot|P47006 Saccharomyces
                     cerevisiae YJL148W RPA34 RNA polymerase I subunit A34.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451266.1"
                     /db_xref="GeneID:2896329"
                     /db_xref="InterPro:IPR013240"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS3"
                     /translation="MAKVDKTLSKEYISDSDSDNDGSSETVTDVFVPPENYKKCTHLK
                     SFVKPKNLKQKELWLIKLPKSLDVSKLSKLPIDFTAESETGIEQKGKHFSVKEEIQQE
                     NSTSGASSSSELTLLTPVDKTKLTVDSSASRSFDKIFTISETAKIPSIDYSKVRVDRK
                     DVLKVKGLKTRHFATGYYEDKDLKKVSKKKRKHD"
     gene            554734..554970
                     /gene="SNR190"
                     /locus_tag="KLLA0_A05987r"
                     /db_xref="GeneID:9487315"
     ncRNA           554734..554970
                     /ncRNA_class="snoRNA"
                     /gene="SNR190"
                     /locus_tag="KLLA0_A05987r"
                     /product="snR190"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR190"
                     /transcript_id="XR_002633557.1"
                     /db_xref="GeneID:9487315"
     gene            555022..555187
                     /gene="SNR128"
                     /locus_tag="KLLA0_A06002r"
                     /db_xref="GeneID:9487506"
     ncRNA           555022..555187
                     /ncRNA_class="snoRNA"
                     /gene="SNR128"
                     /locus_tag="KLLA0_A06002r"
                     /product="snR128"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR128 (U14
                     RNA)"
                     /transcript_id="XR_002633558.1"
                     /db_xref="GeneID:9487506"
     gene            complement(<555280..>556650)
                     /locus_tag="KLLA0_A06017g"
                     /db_xref="GeneID:2896493"
     mRNA            complement(<555280..>556650)
                     /locus_tag="KLLA0_A06017g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451268.1"
                     /db_xref="GeneID:2896493"
     CDS             complement(555280..556650)
                     /locus_tag="KLLA0_A06017g"
                     /note="similar to uniprot|Q75BM9 Ashbya gossypii ACR242W
                     ACR242Wp and weakly similar to YKR063C uniprot|P36146
                     Saccharomyces cerevisiae YKR063C LAS1 Essential nuclear
                     protein possibly involved in bud formation and
                     morphogenesis mutants require the SSD1-v allele for
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451268.1"
                     /db_xref="GeneID:2896493"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:Q6CXS1"
                     /translation="MRITPWRSRSELEQLKQWLFVDDTPASKRRAIQRIDAYLTRGPY
                     LPHIIEYTVRLMQCQLNDPGEAQDGDDMEYLKWQYCMVLIRFVNGMLDPVQQAQFAIP
                     LHTLAENIGLPSWFVELRHLSTHERELPSLEMLRLCCKEAIQWTWDNYWNNDEWEEED
                     QDFDEAEDEDATDDNDDSEAKKRKSQSSVQLKSLFTQYTGLKRLLKENEYLWKRQRIA
                     RSTFGEQDSTEDEEVSDWLTVLKTAWKQIHKSDFVEYMILHCDETLLEICFHSLDTFQ
                     VRCIEWLIENYEKRIMNEETKITDRFSNHKKLLKFVNKCCSMVNGRKFLSNGLFSNVV
                     DKYHNYLVLHILKNLSNESGSSGNYSGSKSRKKKKANEIDAKKVIEEFEAKGIRNVEL
                     ELYNSRKRTSSEEIEPVSEDSPALDILKDLNELKNQFKKIKQSNAPISNWQEVTEWTP
                     RPFGVL"
     gene            <557368..>559341
                     /locus_tag="KLLA0_A06039g"
                     /db_xref="GeneID:2896452"
     mRNA            <557368..>559341
                     /locus_tag="KLLA0_A06039g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451269.1"
                     /db_xref="GeneID:2896452"
     CDS             557368..559341
                     /locus_tag="KLLA0_A06039g"
                     /note="weakly similar to uniprot|P36023 Saccharomyces
                     cerevisiae YKR064W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451269.1"
                     /db_xref="GeneID:2896452"
                     /db_xref="GOA:Q6CXS0"
                     /db_xref="InterPro:IPR001138"
                     /translation="MVYEMLSPVPVKKRHRPTLVCLNCRRRKTKCDRGKPSCSNCLKL
                     GETCVYSEDTDENASKKVRYEYMDDLGLPEFINMAPKGLHLLSKRSASWFNGLFSDIA
                     ICDRDPYLRITNAVIDILRKSASKGIDRSERDTVLQLPNSLKTVTMYNRSEKSEDQLY
                     HQIAREFSALRSAPIPETYVPYEYEFWSKYYPYFVDKIHPLVPVFNLIELKDLLEKFF
                     QRQKDHPGKLNDKVHESTLLMLTYLIINFFLLEFDSHNRLIQDHINIIKKWLVQSKWF
                     QKTTLLQLRVWLVLRFHNWCTYHDNDGNRMNANDGLMGLIMGHCASLGITWQLWTNVD
                     SDECKNIWINALHWDRKLAVLNGNDTFNGRTMRVPELPNDHLVLKFLKCCVDDPTHVN
                     YKLAIEILNKLNFEEQNPMVTWEWKVIVAVTKLQINHGRLNHINEGISAVIASLEDLI
                     TLWNEHFIRPLAPVSYSSRIIEISMNKALVLLPAIILRARNPCKQKILQLMDKILTTY
                     FNEFPYYYHVFKRLFKYKLTLNLINREDSLDHMLTILKHENHQVLEKLGITSKDAEMS
                     DDDVIKVWNARFSFTEKVVNLKVEMMCKNYEPNLFSSSYQHALEKLEERHSAKADAID
                     VTQFLQQVFDSTDFDLFYGMDVGELPKMDSILP"
     gene            complement(<559396..>560994)
                     /locus_tag="KLLA0_A06061g"
                     /db_xref="GeneID:2896492"
     mRNA            complement(<559396..>560994)
                     /locus_tag="KLLA0_A06061g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451270.1"
                     /db_xref="GeneID:2896492"
     CDS             complement(559396..560994)
                     /locus_tag="KLLA0_A06061g"
                     /note="similar to uniprot|P47005 Saccharomyces cerevisiae
                     YJL149W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451270.1"
                     /db_xref="GeneID:2896492"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR9"
                     /translation="MIDTFPLESLPDELLAEVITHVPQRDRLNLCLVNKRVSKLALPI
                     LYRRIYLNDSNVVESDIVNLAINWTYLYMPPNEAECWSRGLANAKLDLLIRTLSRNSE
                     RLNSIQWIRINWDLDKEKQAEVLRLLCTYSKSIIRLENVTDPDCNDIIANGIQSRHNV
                     TSFDSAPPNSMPEGEVSRTYLPNLAQYLKQRISSNLSHMTLFMDPIQLFNCIYPLQFK
                     LQIHDLKLHWRKEYYPPDQLKPLNQYPKLTKLSDVFDVRTLKVLTIISWNENLNKREL
                     EILTEFYEFTEIRDLSLISMRQNPAILIELFKRLKNLKRLKTDFLHEFTPHPVSTDVF
                     LSILLNCRELQFLDLRFENIDRQIISIEGSRFKFLHNCHCDDCNHVFQDILYGKFFNS
                     SKDMVIRDLSDLIAKDIFTMMKYLSLLPYSKAFDIYPSVRTQPMNLSDFVTKINEYNR
                     HYKSMHRNSTPIEPITESDVIKCYHAMVHHNKKTYTTILSNLKRLRYLVLNDVPCIVL
                     EREGARVPVPVFFNNGYKSNMGNC"
     gene            561559..561933
                     /locus_tag="KLLA0_A06072r"
                     /db_xref="GeneID:9487354"
     tRNA            join(561559..561595,561884..561933)
                     /locus_tag="KLLA0_A06072r"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:9487354"
     gene            complement(<562140..>562730)
                     /locus_tag="KLLA0_A06083g"
                     /db_xref="GeneID:2896450"
     mRNA            complement(<562140..>562730)
                     /locus_tag="KLLA0_A06083g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451271.1"
                     /db_xref="GeneID:2896450"
     CDS             complement(562140..562730)
                     /locus_tag="KLLA0_A06083g"
                     /note="similar to uniprot|P36147 Saccharomyces cerevisiae
                     YKR065C FMP18 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451271.1"
                     /db_xref="GeneID:2896450"
                     /db_xref="GOA:Q6CXR8"
                     /db_xref="InterPro:IPR013875"
                     /translation="MLRLGINLQNRLLVGLNGQSLLKRAVTRNAVAIRMNSTNAGKTA
                     SHEMTWPEFFKLRKKERVFNTASSVATAIVFVNGSWFYFSTLEIDPTQTIFGFDPLMA
                     ITAGMITCAAVGWLLGPIVGTALFKATSGPKLLQFQEKQLSFLAKIQKNRVNPQSQSF
                     SNPVPDYYGEKINSIPQYRQWLRDCHSYKRKASEFL"
     gene            <563147..>564067
                     /locus_tag="KLLA0_A06105g"
                     /db_xref="GeneID:2896776"
     mRNA            <563147..>564067
                     /locus_tag="KLLA0_A06105g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451272.1"
                     /db_xref="GeneID:2896776"
     CDS             563147..564067
                     /locus_tag="KLLA0_A06105g"
                     /note="some similarities with uniprot|P25623 Saccharomyces
                     cerevisiae YCR030C SYP1 Protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451272.1"
                     /db_xref="GeneID:2896776"
                     /db_xref="InterPro:IPR018808"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR7"
                     /translation="MSDVLAFAEIVQGYIQSLEELKETKFDSNSELFSEVSQELVRSK
                     ELLLQLQERENILKLRESGPDSESPPLPEINGDIVETLSCVITDDNITNVSLVGEVAI
                     NGTKWDQRTSDLYMKFNNVSSVKINDTFLEPVDVVQNIYKLKREREWDNVVTGLVKYA
                     VTNLPQVQCPILVTPVWQFKEAEIISMINLRPLIPVNYTLLKVCIKIGTKAQDILSKP
                     TGFYNQVDGTIQWDLPMLEQDQILILRYKGGQRTDVVTSQAIGPPHVRIDFTASQLLT
                     QVNVEYGYSPTRLTDLPLNVMTISGNYKAQ"
     gene            complement(<564088..>564597)
                     /locus_tag="KLLA0_A06127g"
                     /db_xref="GeneID:2896693"
     mRNA            complement(<564088..>564597)
                     /locus_tag="KLLA0_A06127g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451273.1"
                     /db_xref="GeneID:2896693"
     CDS             complement(564088..564597)
                     /locus_tag="KLLA0_A06127g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451273.1"
                     /db_xref="GeneID:2896693"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR6"
                     /translation="MSFGVRRFSKRVVRTSARSDDILSEEAWLDLDIGEYHVVNDPLV
                     LSSSSDDDEMEQEDPTRRIERWMSTNAVVRMQTPDIASVDDDYYQDYSSNSSDAVCLV
                     VPYLSEKLSCLTEYQLRWVHDFVAEMLPLLPRKSVSPVSSVSTSSSSSEISFKSSRNE
                     KYRLPRVIV"
     gene            <565427..>565819
                     /locus_tag="KLLA0_A06149g"
                     /db_xref="GeneID:2896701"
     mRNA            <565427..>565819
                     /locus_tag="KLLA0_A06149g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451274.1"
                     /db_xref="GeneID:2896701"
     CDS             565427..565819
                     /locus_tag="KLLA0_A06149g"
                     /note="similar to uniprot|P32445 Saccharomyces cerevisiae
                     YCR028C-A RIM1 Single-stranded DNA-binding protein that is
                     essential for mitochondrial genome maintenance
                     Single-stranded zinc finger DNA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451274.1"
                     /db_xref="GeneID:2896701"
                     /db_xref="GOA:Q6CXR5"
                     /db_xref="InterPro:IPR000424"
                     /db_xref="InterPro:IPR011344"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR5"
                     /translation="MFRLAQRRAFSATARTNDFAKMSIIGRIGSEYQEFTTANDTRYL
                     KYSIASQPRKDSNTNWFNVTVFNTNHINFMTQYVKKGALVYIEADASNYTFEREDGSR
                     GQSLSLVQRDINLLKNPKAPETEEEQQA"
     gene            <566176..>566535
                     /locus_tag="KLLA0_A06171g"
                     /db_xref="GeneID:2896326"
     mRNA            <566176..>566535
                     /locus_tag="KLLA0_A06171g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451275.1"
                     /db_xref="GeneID:2896326"
     CDS             566176..566535
                     /locus_tag="KLLA0_A06171g"
                     /note="similar to uniprot|P46984 Saccharomyces cerevisiae
                     YJL184W GON7 Protein of unknown function proposed to be
                     involved in the transfer of mannosylphosphate groups onto
                     N-linked oligosaccharides also proposed to be involved in
                     responding to osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451275.1"
                     /db_xref="GeneID:2896326"
                     /db_xref="GOA:Q6CXR4"
                     /db_xref="InterPro:IPR014849"
                     /translation="MSLPHATYTGPKSTHEFEVDPSDPRYQTTEGRTTGASDYVLKQG
                     HQDVDKPSDPKKVDNVNSKTGIDQYTTLSQLRMQLTGLQDDINEYLTEKINHVKKPRN
                     SKQEQEINDLLDGSEET"
     gene            <566780..>568096
                     /locus_tag="KLLA0_A06193g"
                     /db_xref="GeneID:2896750"
     mRNA            <566780..>568096
                     /locus_tag="KLLA0_A06193g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451276.1"
                     /db_xref="GeneID:2896750"
     CDS             566780..568096
                     /locus_tag="KLLA0_A06193g"
                     /note="similar to uniprot|P25621 Saccharomyces cerevisiae
                     YCR028C FEN2 Plasma membrane H -pantothenate symporter
                     confers sensitivity to the antifungal agent fenpropimorph"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451276.1"
                     /db_xref="GeneID:2896750"
                     /db_xref="GOA:Q6CXR3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR3"
                     /translation="MGKLFRVDLTVLSFVCLQYWINYVDRIGFTNAYVSGMKEDLGFK
                     SNQFNIANTCFTVGYLLGMIPHNLILLRIKPRIWLSFCTFAWGILTLSMFSIDSVWQC
                     YVIRFFQAWFESCTFSGTHLILGSWYTPSQLPIRTAIFTSSGLLGAMTSGFLQVAIHD
                     SLNGKAGLPGWKWLFIIDGLITIPIALYGLFFFPEPDADARESNHKNSWIFTGKHKQQ
                     IDTLDWSIFKRCGSRWHWWLFSFVWVLGGENISFASNSTFNIWLDNQGYSLADKNRFP
                     VGIYAVGIVSTVASSLYVHKYSHFAKHWHVALFISISMFIVSLLILTNPLNPKFMFAA
                     QYLGGISYTGQTLFFAWCNVVCRGDLQERAIVLASMNMFSGAVNAWWSLLFYSTSMAP
                     KFTNGCYALMATSISSGIVSLLIHYLQKRDDLDLSQYTDPEEQIKE"
     gene            <568689..>569927
                     /locus_tag="KLLA0_A06215g"
                     /db_xref="GeneID:2896447"
     mRNA            <568689..>569927
                     /locus_tag="KLLA0_A06215g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451277.1"
                     /db_xref="GeneID:2896447"
     CDS             568689..569927
                     /locus_tag="KLLA0_A06215g"
                     /note="similar to uniprot|P46985 Saccharomyces cerevisiae
                     YJL183W MNN11 Subunit of a Golgi mannosyltransferase
                     complex that also contains Anp1p Mnn9p Mnn10p and Hoc1p
                     and mediates elongation of the polysaccharide mannan
                     backbone has homology to Mnn10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451277.1"
                     /db_xref="GeneID:2896447"
                     /db_xref="GOA:Q6CXR2"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR2"
                     /translation="MPFIPKNKKKWTKSFKVWISELKFYLHKRNKFSMLLLISVIIFL
                     LYELTSSLPSKSSAGYRIPKTHGMYQNEVQSSTPLIFPSVQDHGTLKELGVEGLFTLR
                     IDVDGNREYVFKPEDTPMTEAERKELAETDKKKFVKRTFLDHGKLVYKNKANHPEVVI
                     VTIIDFENYSLDHIINTVQNRVDYAQRHNYGTYVRWAQEFLPQVQKQSMEASYEFIKP
                     LAVRAAMNAFPYAKYFWFFDQNGLIMQLDTSLQQQLLEPKVLDAAVLKSVPVFEKSNI
                     KTYKHFDAKTAKIIIPKTGAGKLDTSSFVVTPSIHGKAFLDYINDPLVRNYPWPSSFT
                     SAIGHLLQWHPRILKRTALVVPKTIASVYSPSAVKKQADDAERFNYMDGDFVITFTGC
                     EASKTCEIELDKHYQLVKQD"
     gene            <570630..>573071
                     /locus_tag="KLLA0_A06237g"
                     /db_xref="GeneID:2896744"
     mRNA            <570630..>573071
                     /locus_tag="KLLA0_A06237g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451278.1"
                     /db_xref="GeneID:2896744"
     CDS             570630..573071
                     /locus_tag="KLLA0_A06237g"
                     /note="weakly similar to uniprot|P47101 Saccharomyces
                     cerevisiae YJR030C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451278.1"
                     /db_xref="GeneID:2896744"
                     /translation="MDNTVRLDQLHDEQYRRILPTLNGYFEQKDTSLSRLDPRNYRNE
                     NYKKMNAIIPVLLRAHQCHPTDWKLLFANAQTLNFYSALLEGLLMFMFQSFSTTVGFG
                     SNMEFLRCMLKTYEYLYTVAKTLPSPELGQRVMSFQNHFMRNWNKVQCESLLFDQVKD
                     LLSHAHDFVAPPLFNLESVIKRDYFKITCDKLRYENLCVELFHLDNGNMAIFKVNTQT
                     LPLYTNEQTHELLLRLTRNIDMGAYQDPLFQIGRTLLFPTIRPMDLRIADESRKSILL
                     ETKTGNGVTLALTPYDTLAWSQHWRPFVQSLCAVADSPKAFLSDRNESTFGSPINKDT
                     ITSAGTRGLGISLKKSEVRTNLDTGLRKSKPLASEALSISEIESLNMKKLMELNDSTD
                     ASTMNSSMKSPVPTNIRHIQEPSNIIEQMSPVIGSRVDDIDSIISDDDGINNEGSLGG
                     SPVFNLSAEFHKPQLTKRKSSSFLNLFKKDKSKSQKNSTDSLAKLSDTKSIHPPESAM
                     SSHASTPSSTSKSSKSSKSSSTLSPSTCKLPSSVKLDTNNVLLDTLVKLSQWRNNSWR
                     FFSSSWLQLQVVNSNQGRYMFVVQDDNSNLKLCIAIGERWTISRTTAQDIQIRFPPTD
                     VVASVAEPVPTLLSVRCPQVDNIANLLKHCKKNEVILTSSNNMSNSATQLTLGSNSSS
                     ILSNNVSNMSFSRSSTASNDLSHGWSKPQVLDSSKDCKSLLLLSKIKVRLHKYDQQYG
                     WKMTKVGLLNVYSREYNGSVAGCKFEMDDTESFISSISDLKRIGRTGISAGERLVEFK
                     NQNVADETYKLLGAL"
     gene            complement(<573195..>574178)
                     /locus_tag="KLLA0_A06259g"
                     /db_xref="GeneID:2896740"
     mRNA            complement(<573195..>574178)
                     /locus_tag="KLLA0_A06259g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451279.1"
                     /db_xref="GeneID:2896740"
     CDS             complement(573195..574178)
                     /locus_tag="KLLA0_A06259g"
                     /note="similar to uniprot|P22135 Saccharomyces cerevisiae
                     YJL180C ATP12 Molecular chaperone required for the
                     assembly of alpha and beta subunits into the F1 sector of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451279.1"
                     /db_xref="GeneID:2896740"
                     /db_xref="GOA:Q6CXR0"
                     /db_xref="InterPro:IPR011419"
                     /db_xref="InterPro:IPR023335"
                     /db_xref="UniProtKB/TrEMBL:Q6CXR0"
                     /translation="MLRLSRPFRLVSPTVLSRVRCYAQASPLGVDHSIENNLQTETNR
                     LSKTLTKFWEQVSLEETPENVTIKLDSKPLRTPLGNPLTLPQSRKLLSVMVLNEWSNL
                     PSLSVKPYVLPLTSLVSRCIDLEKANEDGVDPELVAKIGGNREKLTEGLLRYLDTDTL
                     LVFSPANEYEGALRKAQDELYLPIISGVEKFLSQINKDKKEVKLQILDADLHGLRGNA
                     QSGETREVAKQYLDSLSVWDLAIFEKTVLTTKSFICGLLLLLNKSATVTNIPELQVSM
                     EDIARAATLETIYQVERWGEVEDTHDVDKRDVRRNIHAAAIVAFGPPTSSK"
     gene            <574472..>574813
                     /locus_tag="KLLA0_A06281g"
                     /db_xref="GeneID:2896454"
     mRNA            <574472..>574813
                     /locus_tag="KLLA0_A06281g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451280.1"
                     /db_xref="GeneID:2896454"
     CDS             574472..574813
                     /locus_tag="KLLA0_A06281g"
                     /note="similar to uniprot|P46988 Saccharomyces cerevisiae
                     YJL179W PFD1 Subunit of heterohexameric prefoldin which
                     binds cytosolic chaperonin and transfers target proteins
                     to it involved in the biogenesis of actin and of alpha-
                     and gamma-tubulin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451280.1"
                     /db_xref="GeneID:2896454"
                     /db_xref="GOA:Q6CXQ9"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ9"
                     /translation="MSSQPQDIVKEMANSLRNSRSQLDMTLAQLEQLQRQKKIAKLTE
                     KELGNYGNEQVWRSCGKMFIRQEKQAYTADLNHDERILDEQIKALEQKRHYLQTTVDN
                     TVESLRRVIGN"
     gene            complement(<575020..>575877)
                     /locus_tag="KLLA0_A06303g"
                     /db_xref="GeneID:2896518"
     mRNA            complement(<575020..>575877)
                     /locus_tag="KLLA0_A06303g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451281.1"
                     /db_xref="GeneID:2896518"
     CDS             complement(575020..575877)
                     /locus_tag="KLLA0_A06303g"
                     /note="similar to uniprot|P46989 Saccharomyces cerevisiae
                     YJL178C ATG27 Type II membrane protein that binds
                     phosphatidylinositol 3-phosphate required for the
                     cytoplasm-to-vacuole targeting (Cvt) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451281.1"
                     /db_xref="GeneID:2896518"
                     /db_xref="GOA:Q6CXQ8"
                     /db_xref="InterPro:IPR018939"
                     /translation="MKVLLATALVSLLPFSSAVECSKNEILNKYRVNEFSIGGVSVQD
                     TPPSETKESWWLNICDEHDSKSSIPDQCNVKDIFCGVTSVALPGKESIVTKVMDFTSS
                     VALEVKETAEALSIRLSGAAWGSHILNADIYLQCQEKGSGSLTESSWTDDQNVKLVFS
                     GPFGCLKKGNDNKDGNGDDDNNDKDGDDSDKKPHDGDKNGSKPKGGAGLGSWLVWLFM
                     YATIFALIYLVVTSYMNTRNGSFNDFREEFVDRSTTFATNLPQFAKEVAGKIVNSGSS
                     SQRGGYSAV"
     gene            <576887..>577850
                     /locus_tag="KLLA0_A06336g"
                     /db_xref="GeneID:2896509"
     mRNA            join(<576887..577195,577605..>577850)
                     /locus_tag="KLLA0_A06336g"
                     /product="60S ribosomal protein L17"
                     /transcript_id="XM_451283.1"
                     /db_xref="GeneID:2896509"
     CDS             join(576887..577195,577605..577850)
                     /locus_tag="KLLA0_A06336g"
                     /note="similar to uniprot|P46990 Saccharomyces cerevisiae
                     RPL17B Protein or YKL180W uniprot|P05740 Saccharomyces
                     cerevisiae YKL180W RPL17A Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L17"
                     /protein_id="XP_451283.1"
                     /db_xref="GeneID:2896509"
                     /db_xref="GOA:Q6CXQ6"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005721"
                     /db_xref="InterPro:IPR018260"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ6"
                     /translation="MARYGATSTNPAKSASARGSYLRVSYKNTRETAQAISGWNLQKA
                     QKYLDQVLDHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAASNA
                     EAKGLDATRLYVSHIQVNQAPKQRRRTFRAHGRINKYESSPSHIELVVTEKEEAVEKA
                     SEKKVARLSSRQRGRLATQKRITA"
     gene            complement(<578090..>580057)
                     /locus_tag="KLLA0_A06402g"
                     /db_xref="GeneID:2896448"
     mRNA            complement(<578090..>580057)
                     /locus_tag="KLLA0_A06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451285.1"
                     /db_xref="GeneID:2896448"
     CDS             complement(578090..580057)
                     /locus_tag="KLLA0_A06402g"
                     /note="similar to uniprot|P34237 Saccharomyces cerevisiae
                     YKL179C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451285.1"
                     /db_xref="GeneID:2896448"
                     /db_xref="GOA:Q6CXQ4"
                     /db_xref="InterPro:IPR012955"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ4"
                     /translation="MNLSTYEHALSLWKEAGFSSIQSLLDDSIAKIKDLETSSLESRK
                     TLASETKKYKKLPDDEKPSQSLKLVKEYQKEIDSLTTRSTFSEKVVIELYEKLIEQPD
                     PTGILESIVEELKKDGTNVDDIKAENQKLAAIVSKCADYDTLKKRLSDLEQNSAKTLS
                     NRLIAKEKEITSKWEEKQRNWNNREDELLKQLETLKNTNSILEKKIGAQVDLEQQEDG
                     DDDTVLVSGKNSAQSELLVQELEAAQIRIMSLESRNEELNSEVTKLKSDEQQDSIFQE
                     KETKLNQLESENAKLVTCLEEERKSLKETSQTLSSQLKSSALETQTYKSELETLRRKL
                     TNYSDYEKIKQELNAMKKIEFGTSDDSDNENDDGDDSITSSLKHANQKLQNNLVKANT
                     EKNKYMNETQTLKKSIEALYSKIQNLETLNAKLEADIEKVEDVTNQFSDTQSMMSGAT
                     RQISNRHATNEKLSPTSSIIGIPEEKELDTFSGNFNGSPSILPIVTKQRDRFRSRNLE
                     LERQIKHCNQEQTKLKVQVKELKADNSKLYEKAKLLSSYSNNSAVRNTVDLESPFSEE
                     YEESLHPLSSFKERELERYERRKMPPLERLFLSFAKVILANKQTRMLFMLYCLGLHGL
                     VMVMTIYVTSFTNYITPDVSSSSGSMINTNQ"
     gene            complement(<580397..>583288)
                     /locus_tag="KLLA0_A06424g"
                     /db_xref="GeneID:2896729"
     mRNA            complement(<580397..>583288)
                     /locus_tag="KLLA0_A06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451286.1"
                     /db_xref="GeneID:2896729"
     CDS             complement(580397..583288)
                     /locus_tag="KLLA0_A06424g"
                     /note="weakly similar to uniprot|P32591 Saccharomyces
                     cerevisiae YJL176C SWI3 transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451286.1"
                     /db_xref="GeneID:2896729"
                     /db_xref="GOA:Q6CXQ3"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ3"
                     /translation="MADDEQRDSVLESAQTQSSVENTQNTSEQPGLIDHTEDVDMGGI
                     DDNLDMDVEPNLPDDFGNEFSESLPQDFPEEFGDAPLAENLPEGINDKLLSNLDNENG
                     DADDADLFEEEPEEQNPANEASESDLLKSPSKEDDTTAAGNEEQEQEQEQEQDEQMDK
                     ENDEIALPETKKESDSNGEGNNDPVGNIETEQSEVEPAQNELETANDKQEPAPEPESF
                     TENPKLPDVKDLGQPDSGIDAPVHTTTETTVDEEIDKEHNTEAEAEPEVDSILEQESR
                     SASPESNITVKQESNTADPKLFVPQSHEIVIPSYSKWFNLTKVHEIEVKSLPEFFTNR
                     IPSKTPQMYVKYRNFMVNSYRLNPNEYFTVTAARRNLCGDAGALFRLHKFLTKWGLIN
                     YQVNATKKPKMVEPPFTGEYETRYDAPRGLFPFQSYKPALQLPDMTRLKKIMTQLDTK
                     PSEPSSLKRTSDEISSEHTQDLSNGGSSHVNGITNKTASGSVGPENYGLKDEKESPVN
                     ADLERNDRKPKRPKISQLIDKDWTQEEIYKLIELIKEHGTDWFNIAKTLGTKTPEQCI
                     LRFLQLPIEDAFLMDEKDLGLLKFGSHIPFNKSDNPVMSTLAFLIGLVDPNIVQHLTK
                     RAISLHDINVNTGANTEAKDAEERQEEQKEEQTEESKEEQKEEIKTDAREIEHTETGA
                     EKSEPANSNAADHSTATEGTAPAAEQVANSDVTVDTSNEKNANTPENEEKEATEVRAE
                     KTGEEGLQKAEEKNKEEGSQEEAIPVEEPHQEESLENEALSNKETPSEKQELPEEQAV
                     TVTNAESDARITVKDGTEVALATLGLRSHVFATNQEKLMNRTTNDLINTQLTKVDLKL
                     KALDTMEKSLELERKAVHRKQEDVFIQRLSFTKYANSLMGKFESLLKQIPESPEIKQQ
                     LHELRTIIADPPKTSITSQSGNLQDSDDLDSANKPISIESPQLYRYWSG"
     gene            <583793..>584659
                     /locus_tag="KLLA0_A06446g"
                     /db_xref="GeneID:2896344"
     mRNA            <583793..>584659
                     /locus_tag="KLLA0_A06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451287.1"
                     /db_xref="GeneID:2896344"
     CDS             583793..584659
                     /locus_tag="KLLA0_A06446g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451287.1"
                     /db_xref="GeneID:2896344"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ2"
                     /translation="MSDTDNMSEGISSCQGNTEQRASGTQYGSATGSNNKKLFNNYSI
                     KEVTDEYSSSITRYLKDNIFSPFPCEKAKYDVHIREVKTKDFLEKWLFDIYKYFTYCG
                     YEDKFDFSNTTLFDGINSDQVAWWQDVYERVVSLPENPEWLEAHREKFREDYADIPTI
                     AMDYIHKKYNPYLLEHRVKFFEVNPRYKVKGLIKTLTDLVEAFKKCNLPHLDTILADK
                     VYRHIMIYHGFDSIHPISKPPTNQTTEIILELKKELRFSKMTKQKRTLENTDRRIDDR
                     NKSFKQRNKFWD"
     mobile_element  584843..585278
                     /mobile_element_type="retrotransposon"
     gene            <586957..>587778
                     /locus_tag="KLLA0_A06468g"
                     /db_xref="GeneID:2896567"
     mRNA            <586957..>587778
                     /locus_tag="KLLA0_A06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451288.1"
                     /db_xref="GeneID:2896567"
     CDS             586957..587778
                     /locus_tag="KLLA0_A06468g"
                     /note="similar to uniprot|P39005 Saccharomyces cerevisiae
                     YJL174W KRE9 Glycoprotein involved in cell wall
                     beta-glucan assembly null mutation leads to severe growth
                     defects aberrant multibudded morphology and mating
                     defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451288.1"
                     /db_xref="GeneID:2896567"
                     /db_xref="GOA:Q6CXQ1"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ1"
                     /translation="MLMLIQAFLFVQLFTRLLFVHADVSIVKPTSGASYSPESGSDSI
                     DIEIVWEESVDLPSISSYDYFTFSLLYGPGTDMDLIDKVEEVAASNITLSESQYSYTP
                     SFSIADAGNGQFFIQVYAYSKELGYTIHYSPRFKITSISGGATTYTYTTDSDAVPTPE
                     WSLANSGIDTKSFTVPYTQQTGIRRYAPMQTQPGTAITVTTWSRRYATSAVTYYTSLR
                     NSLEQMTTYTPGWSYSRTSDYNYATPAPFPSDNGGWYDPTDRQTLTTRKLNNKRR"
     gene            complement(<588024..>588374)
                     /locus_tag="KLLA0_A06490g"
                     /db_xref="GeneID:2896764"
     mRNA            complement(<588024..>588374)
                     /locus_tag="KLLA0_A06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451289.2"
                     /db_xref="GeneID:2896764"
     CDS             complement(588024..588374)
                     /locus_tag="KLLA0_A06490g"
                     /note="similar to uniprot|P26755 Saccharomyces cerevisiae
                     YJL173C RFA3 Subunit of heterotrimeric Replication Factor
                     A (RF-A) which is a highly conserved single-stranded DNA
                     binding protein involved in DNA replication repair and
                     recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451289.2"
                     /db_xref="GeneID:2896764"
                     /db_xref="GOA:Q6CXQ0"
                     /db_xref="InterPro:IPR013970"
                     /db_xref="InterPro:IPR016588"
                     /db_xref="UniProtKB/TrEMBL:Q6CXQ0"
                     /translation="MSNQTPRIDPSQISNTQHSVFRIIAKVLDQPQPKELILQSPTTN
                     GEMITLSQVKLSQGSNIEVGSWYEFVCRNVDTGDIGLMVLDSVKCELKEGEEISVSGI
                     VALQQLSGKFPDLY"
     gene            <589213..>591012
                     /locus_tag="KLLA0_A06512g"
                     /db_xref="GeneID:2896847"
     mRNA            <589213..>591012
                     /locus_tag="KLLA0_A06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451290.1"
                     /db_xref="GeneID:2896847"
     CDS             589213..591012
                     /locus_tag="KLLA0_A06512g"
                     /note="similar to uniprot|P27614 Saccharomyces cerevisiae
                     YJL172W CPS1 Vacuolar carboxypeptidase yscS expression is
                     induced under low-nitrogen conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451290.1"
                     /db_xref="GeneID:2896847"
                     /db_xref="GOA:Q6CXP9"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017141"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP9"
                     /translation="MADEKRDKQPVKGSSSKTLVLLLASLFLAGFGYLLHNQNYDIEQ
                     VKSLVDQHFSNTFGTSIGKLVVEEENDDDEIDFDSVCLKTEPISPSGESSIEKILNDA
                     EYKKLAIEKLSGALQIPTEIQDVNPRPKDNIEYYSEFFKFHKYLEEQYPLVHKHLKKE
                     LVNEVGLVYTWAGSNADLKPVMFTAHQDVVPVNRDTWGAWKFPPFSGHYDEKTDTIWG
                     RGAIDCKNLLLGELAAIEHLLSEGFVPERGVVLSYGFDEESSGVLGAKYLSEFLHDRY
                     GDNGIYALVDEGNTVLPLSGNVFVAAPVTAEKGYVDLKITVHGHGGHSSMPADHTTIG
                     IASDLITLLEANPFPYHLTEDNPVYGFLTCAAKHDTRIPPKIKKAIVEAPKSEKQKNL
                     VFRWLNVVKPLRDLFRTSQAVDIINGGIKANALPEVTSFLVNHRIDVTSSVKQTIDKD
                     LAHADQVAKKYNLGLVRDGEVLIEKTKDGYIEIVSEKSLEPAPSSPTKNSSVWDLFTG
                     TIQDVFGTHILSKKNADLFVTTSMTTGNTDTKYYWALTKNIYRFFPMIVDPKVISIIH
                     SVNEHVEVSNHLSIIAFFYEYILNINEYASNDV"
     gene            complement(<591225..>592532)
                     /locus_tag="KLLA0_A06534g"
                     /db_xref="GeneID:2896754"
     mRNA            complement(<591225..>592532)
                     /locus_tag="KLLA0_A06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451291.1"
                     /db_xref="GeneID:2896754"
     CDS             complement(591225..592532)
                     /locus_tag="KLLA0_A06534g"
                     /note="similar to uniprot|P06783 Saccharomyces cerevisiae
                     YKL178C STE3 Cell surface a factor receptor transcribed in
                     alpha cells and required for mating by alpha cells couples
                     to MAP kinase cascade to mediate pheromone response ligand
                     bound receptors undergo endocytosis and recycling to the
                     plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451291.1"
                     /db_xref="GeneID:2896754"
                     /db_xref="GOA:Q6CXP8"
                     /db_xref="InterPro:IPR001499"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP8"
                     /translation="MGYSQSIIALSVIAFVVLLPPLAWHSYTRNTPAIILIVWLLLMN
                     LKAIVDAGIWGGADYQQKWFGYGWCDVMTKLQIGANVGVSCAVANIAFNLHRILKANK
                     EIPDNRSWKKIRVDLAISLVSPIVIMSLIYLVQVFRFGIFRYNGCQSMLSPTWVTTVL
                     YTVWMLVWSLIGFIYASLLLFVFYKKRKDVRDILHCTNSGLNISRFSRLLIFCMVIIL
                     IMFPFSMYSFVSDLKNVSPTYRHYSFKETHNSALWNVILHFDPGQPLYSVWLYIVMSY
                     LVFLIFGLGSDALNMYANFLRTIGLGVVIDSITDWRIKHKDTRVGKITEKILPNNPQQ
                     QDNYAQFYCGSSSDGVVTMSDYSEKMDSPSSPSQFEIDYTLPHERNMKNYDPHNQYEI
                     DPKLSIFSHSISHDSDASSELDTPNAMGNESNQLQYHYRLDRR"
     gene            complement(<593187..>594386)
                     /locus_tag="KLLA0_A06556g"
                     /db_xref="GeneID:2896514"
     mRNA            complement(<593187..>594386)
                     /locus_tag="KLLA0_A06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451292.1"
                     /db_xref="GeneID:2896514"
     CDS             complement(593187..594386)
                     /locus_tag="KLLA0_A06556g"
                     /note="similar to uniprot|P46992 Saccharomyces cerevisiae
                     YJL171C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451292.1"
                     /db_xref="GeneID:2896514"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP7"
                     /translation="MVQALDILASLFAVATVAAQSSNQVQSYNLIEFGNVGFTGSYTN
                     VKKISDAEEDSCSCTVGDRVWFSGDNAPLNEALSVHLRGPLSLSKFAFYTSPSFDIND
                     SSSTSWSREAYYDSTSQTAENVTFLTGAGDSSPCLGKALTFASENGTGKADDSTILES
                     NNLLASDEEVIIFSNVSCPKSGYDKGCGVYRSGIPAYYGFEGDTKMFLFEFTMPTATE
                     KNSSSIDYYDMPAIWLLNDHIPRTAQYPSSSSSNCSCWASGCGEFDIFEVMNGTEKNH
                     LYSTFHTFQGIEDLGTGIQAGGYIARDTSATMKGGVLFDSSGNTVVFMSNDTVFDSSI
                     DYDTINTLISNIDDDETYSTELATISATAPTSTSKSGAAIMIKPSAGTIRYLLLSALM
                     SVFNLMV"
     gene            complement(<594872..>595564)
                     /locus_tag="KLLA0_A06578g"
                     /db_xref="GeneID:2896856"
     mRNA            complement(<594872..>595564)
                     /locus_tag="KLLA0_A06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451293.1"
                     /db_xref="GeneID:2896856"
     CDS             complement(594872..595564)
                     /locus_tag="KLLA0_A06578g"
                     /note="similar to uniprot|P46993 Saccharomyces cerevisiae
                     YJL170C ASG7 Protein that regulates signaling from a G
                     protein beta subunit Ste4p and its relocalization within
                     the cell specific to a-cells and induced by alpha-factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451293.1"
                     /db_xref="GeneID:2896856"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP6"
                     /translation="MSTFGSTFYDSVAKNYICECGSCKIGKNVEFYMVRFFIMGFVLP
                     VLWILNLMLYLYANWIIDHNVRVPELDSETLYTEYECQQWKQRSVTSLNKSITKDFYA
                     INNPLTFSMLTLKLPDPVPLTTYQHLSLPDPTKGSDEKNQFSESATTLDEGATDSSSF
                     ETEDGGTKSIVTAQCLKEIASELMKNHDVNARTIRNWFLRSLCAMTGYTISIIMIVVI
                     VKTNSQPASYRE"
     gene            complement(<596010..>598118)
                     /locus_tag="KLLA0_A06600g"
                     /db_xref="GeneID:2896759"
     mRNA            complement(<596010..>598118)
                     /locus_tag="KLLA0_A06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451294.1"
                     /db_xref="GeneID:2896759"
     CDS             complement(596010..598118)
                     /locus_tag="KLLA0_A06600g"
                     /note="similar to uniprot|P46995 Saccharomyces cerevisiae
                     YJL168C SET2 Histone methyltransferase with a role in
                     transcriptional elongation methylates a lysine residue of
                     histone H3 associates with the C-terminal domain of Rpo21p
                     histone methylation activity is regulated by
                     phosphorylation status of Rpo21p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451294.1"
                     /db_xref="GeneID:2896759"
                     /db_xref="GOA:Q6CXP5"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR006560"
                     /db_xref="InterPro:IPR013257"
                     /db_xref="InterPro:IPR025788"
                     /translation="MTESGNGIVNTRQPKLFLDVPDMTSEAKKTYAELDVCTYTPKNL
                     GDSKHEFMECDCFEEFRDGLNHACGEDSDCINRATLIECVNGLCKHSCGTDCQNQRFQ
                     KKAYADISVFKTERKGFGVRANSDIEPHNFIYEYIGEVIQEEEFRNRMVKYDQMGFKH
                     FYFMMLQTGQFIDATLKGCIARFCNHSCNPNAYVNKWVVNGKLKMGIFANRHISKGEE
                     VTFDYNVDRYGANAQPCYCEEPNCIGFLGGKTQTDAASLLPQSFADALGIRPSMEKKW
                     INMMKAKGEKIAKSDTTTVNVDFVNSLSLEPCTKTEDVNRVMSVLLQIDDAFIAEKLL
                     ERITLTEDEAMHYQFIKLHGYLIFSRLITMFEDKPDIIWKILNFLLVLPKTTKNGIIH
                     SGIDKKVEQLKNTPKFEVICEDLLEKWSKYETYTRISKKDISENSKVIDLRRIRLPIG
                     WEIIHENGRPVYYNAQRQIKQANPPTDSAYRSNSSHNLSGVSDPKSRSATPSSNTSRY
                     SGSVKYIPTPTYGQMQQKRTLSPEEYEKRKKSRIEWEQKELELRKLMEQETLKAKLDQ
                     ETQKKSELERIIEEANKQKELERLQKLKQQQEDEERKKVKKQASHVNAIENKWVKFFA
                     QHVPNLIKNYQKDVGKDVLKESARNIVKSLAQKELKKDSSRSPPEELSKEKRAKVKTF
                     SMQYMDRLVAKMKEKKEKKR"
     gene            complement(<598561..>600705)
                     /locus_tag="KLLA0_A06622g"
                     /db_xref="GeneID:2896770"
     mRNA            complement(<598561..>600705)
                     /locus_tag="KLLA0_A06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451295.1"
                     /db_xref="GeneID:2896770"
     CDS             complement(598561..600705)
                     /locus_tag="KLLA0_A06622g"
                     /note="similar to uniprot|Q757Y7 Ashbya gossypii AEL127C
                     AEL127Cp and weakly similar to YKL176C uniprot|P34239
                     Saccharomyces cerevisiae YKL176C LST4 Protein possibly
                     involved in a post-Golgi secretory pathway required for
                     the transport of nitrogen-regulated amino acid permease
                     Gap1p from the Golgi to the cell surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451295.1"
                     /db_xref="GeneID:2896770"
                     /db_xref="GOA:Q6CXP4"
                     /translation="MLGRLLRTSSLSEFVPFGSSNVTVGEEVFQNEPFYMTDDLKTLL
                     YGTRDKALFERIANDRLHNGGFRLIISQELGHVTSRNNYQVVLDHSSVNFHTGAHIPL
                     NELKDYIFGSSIRTIDYSASSDKIKVVKSANIVLFTRIFYLNEKSTLRIAISCCVTDD
                     VLPVLTECWPHISSFLDQCENTLLKYLAKNDTQFLPHDWKARNCIEVAAVLQTFQRKI
                     IPLLSGYSDTPRLFLYPMDSIPYIKTWVKYVTNWIELKDGPRVRFLPILLAKLRYDFA
                     SLLKENSNTRIVILTGNMNVANRLIFILTAFLGPHFRGTLHKSINSQGCPSPAGRKMS
                     NMSGASDFPFELKPSNSSITETNKGWEIPRIKRDPTFSVTSVSSDETGVQTFIQPSSL
                     KSGASSVQYLSSSLNSAYGSYGSWFKKVAQSPSSRSNESSHEVPPILHRNSSSTSFHQ
                     QAVLGNINGSQRVTPQPSPTIAEYEEYPWFSPSPIARDQPRPEKRIPTPISSYTTEKE
                     RRTHLQSEIYDVDMKRTVNRLIDEDSLNDAFADLVIDPPSYDTTVSNEKHGEIVEVNM
                     ASPRKQRNNQNQELLRRFTSYTPHYNQWFQLQACQITTESENKVIHSMKRDLTYADQD
                     PCKKDKSTSTLLISLRSREIKQVTIVRDTNNRFIQRTKKILQNGKVGPVSRAMLSGIE
                     TTDQHLKKLMECNNDNEALVSLFNDIVTCAST"
     gene            <601527..>602948
                     /locus_tag="KLLA0_A06644g"
                     /db_xref="GeneID:2896712"
     mRNA            <601527..>602948
                     /locus_tag="KLLA0_A06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451296.1"
                     /db_xref="GeneID:2896712"
     CDS             601527..602948
                     /locus_tag="KLLA0_A06644g"
                     /note="similar to uniprot|P34240 Saccharomyces cerevisiae
                     YKL175W ZRT3 Vacuolar membrane zinc transporter transports
                     zinc from storage in the vacuole to the cytoplasm when
                     needed transcription is induced under conditions of zinc
                     deficiency"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451296.1"
                     /db_xref="GeneID:2896712"
                     /db_xref="GOA:Q6CXP3"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP3"
                     /translation="MLGTEHLPKWLLYSATSSFLCILGSFMVPIVYASFSSHREVNTK
                     LLNYGLSLSAGSMLCTSLLKMLGSTEQANSAIVFVGFSAGCLISFILNYIVHSYTSQS
                     LIHCAHSDEGGELISDNFDDSHLYDMQTHAHRLSHSHSHGHSNNYGFGASEVENDIPD
                     PQHTHSHHHEMLPEHEEETTPLINHSEHEPVICATVKPKPSTSLSEYHNANDCIPVVR
                     SATISSLPLAKCGSETKPPALCIEPNIGYDLENLAIYREQFMSKGDSTMDSLSDHGTV
                     LHENDHRHVMETPFSKLLSIGIQTCMVICLHKFPEGFIIFYTNPPDKVSDGKPDIGFS
                     IFLSLAVHNFIEGFAMTLPLFTALETKWHALLITVILGGGSQPLGALLGLEWYKHSSP
                     DHSPEYATEKMDFLLSITSGFLFVISLQMFQTAVAFSDTHHHHEGEDNSTIREHHSAG
                     TTCLKFCCVGVLLILASSALQTL"
     gene            complement(<603169..>604851)
                     /locus_tag="KLLA0_A06666g"
                     /db_xref="GeneID:2896747"
     mRNA            complement(<603169..>604851)
                     /locus_tag="KLLA0_A06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451297.1"
                     /db_xref="GeneID:2896747"
     CDS             complement(603169..604851)
                     /locus_tag="KLLA0_A06666g"
                     /note="similar to uniprot|P36029 Saccharomyces cerevisiae
                     YKL174C TPO5 Protein involved in excretion of putrescine
                     and spermidine putative polyamine transporter in the Golgi
                     or post-Golgi vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451297.1"
                     /db_xref="GeneID:2896747"
                     /db_xref="GOA:Q6CXP2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP2"
                     /translation="MSPRKDRHFAKTDAERVLGNKKGELTKGSHRAELHFEMPEYIWL
                     SNLNGNIHIPERLLSLLNEEDQDIPDEVKEFTYVQQLDKNLLSRTSVIGLGFGLMSPV
                     LGMSTTMSIGLLNGGSPSIIFGYLICGIMTWISSLSLSEIVSKYPIELHGAAAMLAPG
                     RLRLRMSWYCGWLMLFGSWTMSTSITFAGAQLIISLLTMTNESLIDSRWLTLWTVLMF
                     YLIVTVVGVINLKFSSFIETINKVCVYWILYAILFTSTLLLLFQPNHRSFKDVFTKFD
                     NSLSGYSSMALSFLIGGFQQSNFTFQGFAMLSALSDETEKPEKDIPYSMTRSVIISLV
                     SGLFFLIPMMLILPDVSEVMNHEGVMPIVLIFTKSTKSLFVSIFLVLLILGNLLFSGI
                     GSVTTSSRALYSLSRDRGIPYHHLWTYVDPASESKVPKYSVMLSMGVSYVLALLALIS
                     TAAFNAFVGCAVLCLCSASMLPILLSLYHRRKLVKGSAFRIKYRLGYITNCLTVIWLL
                     FTMVIISLPQKVPVTFRSMNYSSVVYFLFMIMVTVLYDRWGIYNFRAPLVGE"
     gene            <605011..>607812
                     /locus_tag="KLLA0_A06688g"
                     /db_xref="GeneID:2896722"
     mRNA            <605011..>607812
                     /locus_tag="KLLA0_A06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451298.1"
                     /db_xref="GeneID:2896722"
     CDS             605011..607812
                     /locus_tag="KLLA0_A06688g"
                     /note="similar to uniprot|P36048 Saccharomyces cerevisiae
                     YKL173W SNU114 involved in splicing U5 snRNP-specific
                     protein related to EF-2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451298.1"
                     /db_xref="GeneID:2896722"
                     /db_xref="GOA:Q6CXP1"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP1"
                     /translation="MDEDLYDEFGNFIGDPMQLIDSDDDSLEEVGEQEAQHELRQKIV
                     EADSTDVVLRDVNRDFDDDVEVLLEVEDREPEKPLIGDDSKSYSEAVNRKVPKALFDR
                     GYLKSLFSIPERQLNVGIFGALHCGKTSFTDMFALDTHRNLPSLTKKVKEGWVPFRYL
                     DQARIEKERGISLRLNGMSFAYESSRGRTYAVTMLDTPGHVNFWDDVGIALTACQYGV
                     IIVDVIEGITSVVSKLIRELISNGIPFIIVLNKIDRLILDLRLPPTDAYSKLQYIVNE
                     INTYTKERFSPELGNVLFASTKFGFLFSVESFVNSFYAKSLKDKTEQFAAQLWGQINY
                     REGAFYQTEFITDNIAFIQFILQPLYKVFTHTLSASEEELRTVIETNFQIRLSDEILS
                     KDPQPLLFSVFHAILPHYHCFIDAIVSTQDHKINNLSSDESTVVHVLRHMSLEGSKWS
                     LCRIIEGSVKKGNKLYIFNESVDSVVDFGDDEYSKVTIERVALMGGRYVYELEEAIKG
                     QIVLLKGFEDQYTKYATLSSSLMNPLAPINYLNESVFKFAIQPQKPSELPRLLNGLQQ
                     ANELYPALVVRVEESGENIIIGTGELYLDCVMDELRKKFCEIEIKVSQPLVQFTESCQ
                     NESFASIPVKSNNGVVSLSVMAEKLDGKIVHDLTHGEIDSSELNNMRKFSKRLRTEYG
                     WDSLAARNCWDLSKCNVFIDDTLPDETDKQLLKKYKENILQGFEWAVKEGPLADETIH
                     ACQFKLLQFKVQEDSIEDIIPSQLVPMTRKACYIALMSATPIIMEPIYEVDIIVSGVL
                     ESVIQNLLKRRRGGRIYKTEKIVASPFIEIKAQLPVIESIGFETDLRVATAGSGMCQM
                     HFWNKIWRKVPGDVLDEEAFIPKLKPAPAASLSRDFVMKTRRRKGLSESGHMTQDGPS
                     LKKYIDQDLFKKLQQKRFV"
     gene            <608103..>609374
                     /locus_tag="KLLA0_A06710g"
                     /db_xref="GeneID:2896697"
     mRNA            <608103..>609374
                     /locus_tag="KLLA0_A06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451299.1"
                     /db_xref="GeneID:2896697"
     CDS             608103..609374
                     /locus_tag="KLLA0_A06710g"
                     /note="similar to uniprot|P36049 Saccharomyces cerevisiae
                     YKL172W EBP2 Essential protein required for the maturation
                     of 25S rRNA and 60S ribosomal subunit assembly localizes
                     to the nucleolus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451299.1"
                     /db_xref="GeneID:2896697"
                     /db_xref="InterPro:IPR008610"
                     /db_xref="UniProtKB/TrEMBL:Q6CXP0"
                     /translation="MVKGFKLKELLHRRKAIDQSEQKVTSKKTKQPSPSNAQDEEPVI
                     VTKDDLRADEDVEPEVESEDEEEGVTGEYESHALSRKEKRKLKKLSKKQQAEEPSKKG
                     EEEEEEEQEEEQEEEEEEESDNESDEEDRLDLEKLANSDSDSDSDEEEEEEEEEEEEE
                     EEEKEEEEEEDVPLSDVEIDEDADVVPYQKTTINNVKAMKDALERIQKPWEKHSFQEH
                     QSVTSQLNTDEKIKDIYDDTERELAFYKQSLDAVTIAREKLKKLKVPFKRPLDYFAEM
                     VKSDEHMDRLKGKLIKEASEKKARQEARRQRDLKKFGKQVQVATLQQRQKDKRETLDK
                     IKDLKKKRKHNEIGGDDFDIGVEDAAQSEKKHKPNFKREAKNSKYGSGGLKRYKRKND
                     AQSSAEMPEFSQRKMKGKAPRPGKSKRSRRH"
     gene            <609710..>610759
                     /locus_tag="KLLA0_A06732g"
                     /db_xref="GeneID:2896751"
     mRNA            <609710..>610759
                     /locus_tag="KLLA0_A06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451300.1"
                     /db_xref="GeneID:2896751"
     CDS             609710..610759
                     /locus_tag="KLLA0_A06732g"
                     /note="highly similar to uniprot|P08524 Saccharomyces
                     cerevisiae YJL167w ERG20 farnesyl-pyrophosphate
                     synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451300.1"
                     /db_xref="GeneID:2896751"
                     /db_xref="GOA:P49349"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /translation="MSDNRAQFLEVFPSLVQELRDILAGYGMPEEAIEWYEKSLNYNT
                     PGGKLNRGLSVVDTYALLKGYKSVSELSAEEYKKVAILGWCIELLQAYFLVADDMMDQ
                     SITRRGQPCWYKVENVGDIAINDAFMLEGAIYCLLKKHFRTEPYYVDLLELFHDVTFQ
                     TELGQLLDLITAPEDKVDLSKFSLEKHSFIVIFKTAYYSFYLAVALAMFAAGITDSKD
                     LKQASDVLIPLGEYFQIQDDFLDCFGKPEDIGKIGTDIQDNKCSWVINVALKNATKEQ
                     RDILDENYGRKDSEKEQKCRAVFNELNIQDIYHKYEEETASNLREKIANIDESRGFKA
                     EVLTLFLNKIYHRKK"
     gene            <611055..>611339
                     /locus_tag="KLLA0_A06754g"
                     /db_xref="GeneID:2896709"
     mRNA            <611055..>611339
                     /locus_tag="KLLA0_A06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451301.1"
                     /db_xref="GeneID:2896709"
     CDS             611055..611339
                     /locus_tag="KLLA0_A06754g"
                     /note="highly similar to uniprot|P08525 Saccharomyces
                     cerevisiae YJL166W QCR8 Ubiquinol cytochrome-c reductase
                     subunit 8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451301.1"
                     /db_xref="GeneID:2896709"
                     /db_xref="GOA:P49346"
                     /db_xref="InterPro:IPR004205"
                     /translation="MGGPHAKAYMGWWGSIGSPAQKGITTYTVSPYAQKPLNNIFHNA
                     VFNTFRRVKSQILYMALPAALYWAWWVNCRDYNAYLYTKAGREELERVNV"
     gene            <612115..>614517
                     /locus_tag="KLLA0_A06776g"
                     /db_xref="GeneID:2896748"
     mRNA            <612115..>614517
                     /locus_tag="KLLA0_A06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451302.1"
                     /db_xref="GeneID:2896748"
     CDS             612115..614517
                     /locus_tag="KLLA0_A06776g"
                     /note="similar to uniprot|Q757Y0 Ashbya gossypii AEL120W
                     AEL120Wp and some similarites with YKL171W uniprot|P36003
                     Saccharomyces cerevisiae YKL171W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451302.1"
                     /db_xref="GeneID:2896748"
                     /db_xref="GOA:Q6CXN7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016241"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN7"
                     /translation="MSSSYNVGSGMKRSNTPTLYERDFPSEVVSVGSLQSLTQREDNE
                     RDSFKLRHKNDSYNHAVNFNIGSSRTSESYQESSDYEEQLSFKPRRMRKGDTNSTLTN
                     TNLSNNDNDNSTNNSNSRLTRVYSETEKANFHDVTGVRMYDDMKYRPMHFQNNSNDSD
                     DRVSIAQDPIPIDIEPKPDVGGYRQARHQHVIRRRFSSGESPLRSPYFNERYNQGLPL
                     FNDMQDEYIPDFDFAEAVSQWQSSDDTNMLSRFNTWEPDYLGKPQKESVLKLDDLHSQ
                     VAPIPLPNVKNEQQPQIPIARPSSSSLFSASSLRTPPAQIEISEHDLDRIMRSIPSDF
                     INMPFSQRKKIIQDLSPNHDYKTIMNILKREKLSHSGSTHNVRSRHGSVASKYLNSFT
                     PGSSSFKRDDKGSFILGHRLGKIIGFGAWGMIRECFPSTDESQNQNNTCCKAMKIIKF
                     KDNRSVKRQVLREISIWSKLSHNNILPLTKWKLDDDLVAYCLTDKIDHGTLYDLVVSW
                     GECGNSKISLRERCQATSALALQLIDAVQYMHSKFIAHGDIKLENCLLEKKSENYKDW
                     KLVLCDFGMSHFYGHFKDQMENESIQLKSLFDGSTLHLKRRPSIPRSSSSTNNSSLRL
                     KSRLRQIVNDKKLIHDDTTLGIHSVPKSTRSNLTSSLNQKTDITLTPNKDLHEHINDD
                     MSRIGSLPYAAPELLEPNPPPIGPSADIWAIGVLIFTMLTGKLPFKHEYEPRLRAIIT
                     SGKYDKTTLRQVCNCDMNSNLGVDDQVEFQGLFNAVKGCLTKDLTRRWELDMVKVALG
                     KH"
     gene            <614979..>615395
                     /locus_tag="KLLA0_A06798g"
                     /db_xref="GeneID:2896511"
     mRNA            <614979..>615395
                     /locus_tag="KLLA0_A06798g"
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /transcript_id="XM_451303.1"
                     /db_xref="GeneID:2896511"
     CDS             614979..615395
                     /locus_tag="KLLA0_A06798g"
                     /note="highly similar to uniprot|P35996 Saccharomyces
                     cerevisiae YKL170W MRPL38 Mitochondrial ribosomal protein
                     of the large subunit appears as two protein spots (YmL34
                     and YmL38) on two-dimensional SDS gels"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL38/YmL34"
                     /protein_id="XP_451303.1"
                     /db_xref="GeneID:2896511"
                     /db_xref="GOA:Q6CXN6"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR005745"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN6"
                     /translation="MIYLKSFLKVIDNSGAQIAECIKVLGKGSPKSPGRIGDKIVCVV
                     KKAKPLTQTITGQSNNNRVKKGDIVHAVVVRTKQRNMIRPDGSTIAFGDNACVLINKN
                     NGEPLGSRIMGNDGVVGRELREKGYNKICSLASKVL"
     gene            complement(<615686..>618004)
                     /locus_tag="KLLA0_A06820g"
                     /db_xref="GeneID:2896336"
     mRNA            complement(<615686..>618004)
                     /locus_tag="KLLA0_A06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451304.1"
                     /db_xref="GeneID:2896336"
     CDS             complement(615686..618004)
                     /locus_tag="KLLA0_A06820g"
                     /note="weakly similar to uniprot|P38970 Saccharomyces
                     cerevisiae YJL165C HAL5 Putative protein kinase
                     overexpression increases sodium and lithium tolerance
                     whereas gene disruption increases cation and low pH
                     sensitivity and impairs potassium uptake suggesting a role
                     in regulation of Trk1p and/or Trk2p transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451304.1"
                     /db_xref="GeneID:2896336"
                     /db_xref="GOA:Q6CXN5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /translation="MASSNVDSSEPRISRESSLKRSLSISKSLKGLFKSGGGNANTGP
                     TTAAAAAAPSSISTPEVPTLATKDKQDRLKNLAANKEKELQTSRRGVASPSLSPTRHV
                     SLSNLAKLSLTSRAGTGQVDPNVIHETSPLASDEESTDLAFGKRQSSSNRSSSFSNEE
                     QEPNNKYPLLEKLMGDLDEMVCGSIDTQLSKSPDTVEASSLRRSRSTQRKRLNSFSLR
                     PRALSNPGQNPNHPVENRERSNTSSIDLLMSHESESRAIYKSDQFSVYPDGHHAHHLK
                     VVPIVHDLEQSLNKPKSSFSFSGFFKTHRTIADDGENLATALSLLPANRFSFHKRLSQ
                     IIDEENGNHNADEELEHNGNNGVDSDSDADYDNQSSGNSNPSDDESESDEDGYKGPNK
                     SANVPKIVNEKSVIGANELKLINQLTEKIDNGFCLKGSKSDAVSSNEPSSAPRKQHLC
                     EKYGKSIGIIGQGAYGVVKLCYKFIDPDEPDLKDNTYFHDNKLFYAVKELKPRPDEPP
                     KKFSTRLTSEFVIGLSLSGGNKSRRSSARTHPNILNVIDLMQTPNAFYEVMEFCPSGD
                     LYSLITRSSKSDSVLHPLEADCFMKQLLHGIQYMHAHGVAHCDIKPENLLFLPTGVLK
                     ICDFGTSSVFQTAWEKKAHFQTGPAGSEPYVAPEEFIPKQQYDPRLVDCWSCGIIYCV
                     MVLGHYLWKIAIKGKDSVYDAFLEDMEKHGQYYVFDEMKHVSPGMNRYRTAALYHIFQ
                     VDPNKRITVDSLLKSSWMKRTKCCVTYPPRPV"
     gene            complement(<618848..>620818)
                     /locus_tag="KLLA0_A06842g"
                     /db_xref="GeneID:2896482"
     mRNA            complement(<618848..>620818)
                     /locus_tag="KLLA0_A06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451305.1"
                     /db_xref="GeneID:2896482"
     CDS             complement(618848..620818)
                     /locus_tag="KLLA0_A06842g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451305.1"
                     /db_xref="GeneID:2896482"
                     /db_xref="InterPro:IPR007300"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN4"
                     /translation="MTVRSIAVRHTGSFVDFLHIYKYSLLKQYVFVPIGVILIMMILY
                     GVNILIKDVIGIKFPASVAVMLVNFCFLCVLSMINENLTQKIVGVIDVPLSWALRWMN
                     LFFTPAFVTLPLSPWISFREAMLIAASFVFMYIITGFCLAYVTIFGQKLFALATGHLG
                     RSNGRKRTSLLGSKEDILRDAENGYSSADEDATEEESTLDINEDDDDIHSFADIFSDP
                     DVEDFQLVNVASNSGFPLQRTRTNLTHHLAMGDTANLDADILRGSEIGLPNDKGLGIT
                     QNVQDIYDEDNTHGSDSTAETNQLLLQPALIHSRNNAAMVPMASKRFCGSTSHDQFSD
                     RNREVECERAITRQFSHRMEHLFTVNMWHDHLHHVLYGLGFFATIFTYYFSWYIMPFQ
                     LFTAICMFFIVTDAPLLPNPKYKKFLHPVICSVALFWIVELISSLIKHRQIKYFLSDL
                     REYKVGTTYLTLFTNTSVSGPNKNWPGAGDIFSSCMDVSIVALSMPMYTYRSDLKKHF
                     VVLLIPTISLCAATLMLNPFICYNIGISSYNSIGFIGRSITLALGMPVIENFEGSVTV
                     MAVITVLSGIVGALSGGPMLDFFRVPRDDFVTRGLTLGCNCGAIATSYLLTVDRRAAA
                     ISSLSFVLYGAIMVILSSIGPIKDFVHQIVSL"
     gene            621223..621295
                     /locus_tag="KLLA0_A06864r"
                     /db_xref="GeneID:2896476"
     tRNA            621223..621295
                     /locus_tag="KLLA0_A06864r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2896476"
     gene            complement(<621646..>623409)
                     /locus_tag="KLLA0_A06886g"
                     /db_xref="GeneID:2896520"
     mRNA            complement(<621646..>623409)
                     /locus_tag="KLLA0_A06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451306.1"
                     /db_xref="GeneID:2896520"
     CDS             complement(621646..623409)
                     /locus_tag="KLLA0_A06886g"
                     /note="similar to uniprot|P19145 Saccharomyces cerevisiae
                     YKR039W GAP1 General amino acid permease localization to
                     the plasma membrane is regulated by nitrogen source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451306.1"
                     /db_xref="GeneID:2896520"
                     /db_xref="GOA:Q6CXN3"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN3"
                     /translation="MSQEKKLDYSIDQETQLESGEFHEQNSYVSQSDASPVEGTRWER
                     FRDSFKRADTQDLDPNLTDAEKMAILTANAPLKRTLKSRHLQMIAIGGAIGTGLFVGS
                     GKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDESFGFA
                     FNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKGYGE
                     AEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANGFKGVCSVFVT
                     AAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL
                     IGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACSRSMAALANQ
                     GSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWG
                     GIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIALFPIGD
                     KPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRETDIEALKQEI
                     AEEKAFIASKPFYYRMYKFWC"
     gene            625123..625195
                     /locus_tag="KLLA0_A06908r"
                     /db_xref="GeneID:2896385"
     tRNA            625123..625195
                     /locus_tag="KLLA0_A06908r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2896385"
     gene            complement(<625498..>627261)
                     /locus_tag="KLLA0_A06930g"
                     /db_xref="GeneID:2896475"
     mRNA            complement(<625498..>627261)
                     /locus_tag="KLLA0_A06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451307.1"
                     /db_xref="GeneID:2896475"
     CDS             complement(625498..627261)
                     /locus_tag="KLLA0_A06930g"
                     /note="similar to uniprot|P19145 Saccharomyces cerevisiae
                     YKR039W GAP1 General amino acid permease localization to
                     the plasma membrane is regulated by nitrogen source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451307.1"
                     /db_xref="GeneID:2896475"
                     /db_xref="GOA:Q6CXN2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN2"
                     /translation="MTEEKKLDYSIVQETQLEPGEFDELNSYVSQSDTSRVGGTRWER
                     FKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGS
                     GKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFA
                     FNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGE
                     AEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANGFKGVCSVFVT
                     AAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRL
                     IGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQ
                     GSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWG
                     GILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGG
                     KPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEI
                     AEEKAFIASKPFYYRMYKFWC"
     gene            complement(<628173..>630323)
                     /locus_tag="KLLA0_A06952g"
                     /db_xref="GeneID:2896470"
     mRNA            complement(<628173..>630323)
                     /locus_tag="KLLA0_A06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451308.1"
                     /db_xref="GeneID:2896470"
     CDS             complement(628173..630323)
                     /locus_tag="KLLA0_A06952g"
                     /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
                     YDR338C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451308.1"
                     /db_xref="GeneID:2896470"
                     /db_xref="GOA:Q6CXN1"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:Q6CXN1"
                     /translation="MATLFGKTLSQVHPKLRTNGIGIATNHRRISLGFDLVSRDKKNP
                     LLRKYLRKRRHRGLRRGLHPDEQGSYHTLDEDFGSSVREPSVYDDLDEVLEDIDEYDE
                     DGEPLSRTVSLPSRVSEPSNVSQQNLDWLLEEHERRFSSSQNSENDEDEDLENGTSEQ
                     ADVIAYDDFMHRVRQQLQQDFHDRAYAGGAGGSGAGGPNRRRGSLISVTSRGSVPQVF
                     QDVGSMKEEDLSHAKVTANSELKVLASYSIPLIFTFLLEQMFPVVCSLTVGHLGRTEL
                     AAVSLASMTTNITYAIFEGIATSLDTLCPLAYGSGNYYSVGVHMQRCIMFSFTVFIPF
                     GFIWWWSETLLTLVMPHEPELIHMTAKFLRVSILGAPAYIIFESLKRFLQAQGIFDAG
                     IYVLMICAPWNMFVSYTLVWNERIGMGFIGAPIAVVLNFWTMVTLLSLYAIYVDGYKC
                     WGGFNSKSLKHWKALSELAVPGIVMLEAEDLSYEILTLFSSYFGTPYLAAQSAVSTTA
                     ALLYMIPFSVGISSSTRIGNFIGCRRPNCAKLSAELGIGSSLFVGLLNCLIINVDKRS
                     IANIYTKDEEVIQLMCQLLPLVGIVEIFDSLNAISGSCLRGLGLQYIGSIVNLVVYHL
                     VAIPLGIFLAWYMDMKLNGLWIGIGVGMLIIGLVQSYYVIFADWNDVMERAEKRRDHD
                     RDADSDTDSLESVSSVEAYSDSESDSESSPLLLR"
     gene            complement(<630572..>631459)
                     /locus_tag="KLLA0_A06974g"
                     /db_xref="GeneID:2896517"
     mRNA            complement(<630572..>631459)
                     /locus_tag="KLLA0_A06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451309.1"
                     /db_xref="GeneID:2896517"
     CDS             complement(630572..631459)
                     /locus_tag="KLLA0_A06974g"
                     /note="similar to uniprot|Q757W2 Ashbya gossypii AEL100W
                     YNG2 Chromatin modification-related protein YNG2 and some
                     similarities with YHR090C uniprot|P38806 Saccharomyces
                     cerevisiae YHR090C YNG2 Yeast homolog of mammalian Ing1
                     NuA4 histone acetyltransferase complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451309.1"
                     /db_xref="GeneID:2896517"
                     /db_xref="GOA:Q6CXN0"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /translation="MSSINERPQDPSSALEQATQDVANLKSEFHHIMDEMQVADKTLV
                     SSREQYLREDYVLHKLVKQHGSLTKDPKEGSITETVEKEMKRCGDLQQQKCILANTAL
                     YLVTKHLSKIKANIESLEEDGLLAPLDDELSDKKAGSVDLGAGIAGLGNGTAGSGSSS
                     GRKRPASSSSANGKGQKRKQQKKERSRSHQRAGTVSRDVSPNAGIGRDPTFDALAYND
                     DLFKMNQGGEEDDKQLYCFCQRVSYGEMVACDGPNCKYEWFHYSCVNLTEPPKGQWYC
                     PECRLEIANQKLNKKKKKQ"
     gene            <631799..>632410
                     /locus_tag="KLLA0_A06996g"
                     /db_xref="GeneID:2896525"
     mRNA            <631799..>632410
                     /locus_tag="KLLA0_A06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451310.1"
                     /db_xref="GeneID:2896525"
     CDS             631799..632410
                     /locus_tag="KLLA0_A06996g"
                     /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
                     YLR326W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451310.1"
                     /db_xref="GeneID:2896525"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM9"
                     /translation="MVFYSFILRKISNKIFGDIKIGEGEDPYYEEVTFVKKSFWTGNS
                     QVVHKKLKKAIPDYVPLNDRTVLQRVRKRAYRLDMMFKIFGMRVGWLGIIGLLPVVGD
                     LICLYLSWTVFHEAQKIQGGLPVPLQAELLGNICIDFLLGLIPIVGDIVGIAYKANSR
                     NTLALEQYLRKKYGGETIAASPVELGSVSPGRDPDLVKGLKQT"
     gene            complement(<632523..>633092)
                     /locus_tag="KLLA0_A07018g"
                     /db_xref="GeneID:2896486"
     mRNA            complement(<632523..>633092)
                     /locus_tag="KLLA0_A07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451311.1"
                     /db_xref="GeneID:2896486"
     CDS             complement(632523..633092)
                     /locus_tag="KLLA0_A07018g"
                     /note="highly similar to uniprot|Q05498 Saccharomyces
                     cerevisiae YDR339C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451311.1"
                     /db_xref="GeneID:2896486"
                     /db_xref="GOA:Q6CXM8"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM8"
                     /translation="MGKAKKTRKFALVKRTLNAKKDSRLKSNQAKEVKKDDPELTKNI
                     PQVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNILITDCV
                     MAELEKLGPKYRIALKLARDPRIKRLSCSHKGTYADDCIVHRVLQHKCYIVATNDAGL
                     KQRVRKVPGIPLMSVGGHSYVIEKLPGVF"
     gene            complement(<633503..>635452)
                     /locus_tag="KLLA0_A07040g"
                     /db_xref="GeneID:2896527"
     mRNA            complement(<633503..>635452)
                     /locus_tag="KLLA0_A07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451312.1"
                     /db_xref="GeneID:2896527"
     CDS             complement(633503..635452)
                     /locus_tag="KLLA0_A07040g"
                     /note="highly similar to uniprot|Q05506 Saccharomyces
                     cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451312.1"
                     /db_xref="GeneID:2896527"
                     /db_xref="GOA:Q6CXM7"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM7"
                     /translation="MLRRLSSPVLSSIIRTTKHIIFSERTYTAALSSYRSPHINNTRM
                     SSSIVSQLKKLSIEEPTKVAESHPDVNVVDLMRNYITQELAKISDVPAEQIYPALEWT
                     NTLERGDLLIPVPRLVRKKGINPKEIAEEWATKFPCGDYLEKVEANGPFVQFFFKPEF
                     LFKIVLPDILTRKEKYGSSPLGGNKKILIEFSSPNIAKPFHAGHLRSTIIGGFLSNLY
                     EQLGWDVTRINYLGDWGKQFGVLAVGFERYGDEEALRNDPINHLFEVYVRINKDIENE
                     GDTLSEEESTDGKARSYFKKMEDGDPEALKIWKRFRELSIEKYIKTYARLNIKYDVYS
                     GESQVSKEQMDKAMRMFEDKNLTHEDRGATLIDLTKFNKKLGKTIVQKSDGTTLYLTR
                     DVGAAMDRYEKYHFDQMIYVIACQQDLHVAQFFEILKQLGFEWANRLQHVNFGMVQGM
                     STRKGTVVFLDNILEETKEKMHEVMRKNETKYAQIENPDEVADLVGISAVMIQDMQAK
                     RINNYEFKWERMTSFEGDTGPYLQYAHSRLRSVERNASDITPDQWVSADFSLLHEPAA
                     VILVRLLAQYPDVLRNAIKTHEPSTVVTYLFKLTHQVSSCYDVLWVAGQTPELAAARL
                     ALYGAARQVLNNGMRLLGLTPVDRM"
     gene            complement(<635924..>636275)
                     /locus_tag="KLLA0_A07051g"
                     /db_xref="GeneID:9487366"
     mRNA            complement(join(<635924..636086,636166..>636275))
                     /locus_tag="KLLA0_A07051g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999303.1"
                     /db_xref="GeneID:9487366"
     CDS             complement(join(635924..636086,636166..636275))
                     /locus_tag="KLLA0_A07051g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999349.1"
                     /db_xref="GeneID:9487366"
                     /db_xref="InterPro:IPR010760"
                     /db_xref="UniProtKB/TrEMBL:B5RSI7"
                     /translation="MGVEDRLNRKQQRLAALKVSYQELEKKFQTLAHELHITETPEKI
                     NLKHIADLKLYNELRDTGLRLVQMVADEKQCKMKDVFEEIGYEMKD"
     gene            complement(<636546..>638291)
                     /locus_tag="KLLA0_A07062g"
                     /db_xref="GeneID:2896749"
     mRNA            complement(<636546..>638291)
                     /locus_tag="KLLA0_A07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451313.1"
                     /db_xref="GeneID:2896749"
     CDS             complement(636546..638291)
                     /locus_tag="KLLA0_A07062g"
                     /note="highly similar to uniprot|P15705 Saccharomyces
                     cerevisiae YOR027W STI1 Heat shock protein also induced by
                     canavanine and entry into stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451313.1"
                     /db_xref="GeneID:2896749"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM6"
                     /translation="MSADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNR
                     SACYASNKDFVKALDDANECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD
                     SANKAAQDGLSQVQQTQQQRTAQPDLGLGNMFKDPMMIEKLKKNPKTAEFMKDPQFVA
                     KILQFQQNPQAMGQEMLSDPRLMTVLAALMGIDLSMDPNESNSIPKEEPAAKEAASAT
                     KSEPKAEPKAEPKAEPKVETKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIE
                     KYNEAWETHNDITYLNNRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFAR
                     MGNSYHKLGDLKKAIDYYEKSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEA
                     RLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAI
                     EKDPNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGANTREIDQLYIKASQ
                     ARFEPANANETPEEAYARATKDPEVASILQDPVMQSILSQAQQNPAALQEHMRNPDVF
                     KKIQTLIAAGIIKTR"
     gene            <638900..>640483
                     /locus_tag="KLLA0_A07084g"
                     /db_xref="GeneID:2896814"
     mRNA            <638900..>640483
                     /locus_tag="KLLA0_A07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451314.1"
                     /db_xref="GeneID:2896814"
     CDS             638900..640483
                     /locus_tag="KLLA0_A07084g"
                     /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
                     YDR257C SET7 Nuclear protein that contains a SET-domain
                     which have been shown to mediate methyltransferase
                     activity in other proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451314.1"
                     /db_xref="GeneID:2896814"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM5"
                     /translation="MTATDFERKTDLFLEWLPTVGIKLSKNVKIVDSRDEHQGRSMIC
                     INDVKEGEKLFSVPETASLNIITGSLGKLDESYLGILLSKVEHWHGLILTILYEWKYL
                     GEKSKWWPYFQVLPDQFDTLIYWDKEDLDKLKPSLVLDRLGEQQSKDMYVKVLELMKT
                     FNVADKIGEVTYDDFQRVASWIMAYSFDKEITAENSEVVGEEDGDEEEVEEEVEITED
                     NNEDEDADEDADDSVIENSVNFDGVIKCMIAVADILNSDTNLVNANIIYDKTGLICCA
                     TKDIKAGEQVYNIYGNHPNSEILRRYGYVEWTGSKYDFGEVTLKNILDSLSEKYNVST
                     EFLDRVVEILREDEKIKEIWDYEDVVLDSYDCYADGETIPEAASTIQILFVLLQSHEV
                     VKLEELALTRLLQRIVKKCQQLLESGRVTESVNSIWQQAVEKRLKMYPQTNPVLSEDR
                     IKETFAKSKSDQRQLMASCILECERRCIAKSREGISKQFKLLDDEKLLKNVLKRPVEE
                     EKKKKSRIVKRVKKNRNDD"
     gene            complement(<640536..>641468)
                     /locus_tag="KLLA0_A07106g"
                     /db_xref="GeneID:2896730"
     mRNA            complement(<640536..>641468)
                     /locus_tag="KLLA0_A07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451315.1"
                     /db_xref="GeneID:2896730"
     CDS             complement(640536..641468)
                     /locus_tag="KLLA0_A07106g"
                     /note="similar to uniprot|P26449 Saccharomyces cerevisiae
                     YOR026W BUB3 Kinetochore checkpoint WD40 repeat protein
                     that localizes to kinetochores during prophase and
                     metaphase delays anaphase in the presence of unattached
                     kinetochores forms complexes with Mad1p-Bub1p and with
                     Cdc20p binds Mad2p and Mad3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451315.1"
                     /db_xref="GeneID:2896730"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM4"
                     /translation="MNGYAKLQGVPKDYISDIRIISSDNRVVVSCWDGSLSLFDITQQ
                     QLLMKLQHSWPLTSCHVSKDGRIWAGSVQGEVLEADWESERLIPNDTMSFSLGVSGIT
                     SIDHFIIASSWDGSLIVLDYLRNQIVKQWKFEEKIFQLCASEVRVMCSLSSGKVKLIQ
                     FPSWDITETESGLKYQCRSCTLIPNNRGFVQGSVDGRVSVEFFDDQSPKFAFRCHRMN
                     LEDVQMVFPVTALAFQPNSLNLFTGGADGKIVSWNLVTRKKQEEFHKLDDTIMKLCCT
                     EDYLVIAVSDDSFKTCAVPQDIELHPSAIYIKHL"
     gene            <641974..>643551
                     /locus_tag="KLLA0_A07128g"
                     /db_xref="GeneID:2896734"
     mRNA            <641974..>643551
                     /locus_tag="KLLA0_A07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451316.1"
                     /db_xref="GeneID:2896734"
     CDS             641974..643551
                     /locus_tag="KLLA0_A07128g"
                     /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
                     YDR479C PEX29 Peroxisomal integral membrane protein
                     involved in regulation of peroxisome size and number
                     genetic interactions suggest that Pex28p and Pex29p act at
                     steps upstream of those mediated by Pex30p Pex31p and
                     Pex32p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451316.1"
                     /db_xref="GeneID:2896734"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM3"
                     /translation="MDAIWKSTTGRSDTSPSQSTQSLLNDKLVEKIIYMALPASNDLA
                     TDTIENRVQAGAGRPGLSVPIMSRNFVQMNSRLGAPFMIIDEIIRIFNWTNAAYTLCI
                     MSFYSFLVLKPLPVLVSGPFVYILFGIMSPTYMDIHKPDPHMNLDHNPIPARGPPLKN
                     PQLPGPVPEFSKEFILNLTDLQNHMTLYVMAYDFVSNFLAKFAYFKNENVSSAVFLGL
                     LLFSCINSLAIDSISSLIPWKFIFLCAGWTFVISLHPKIRDTMFNLMYSEETRLRILT
                     KMNHIERIINDKFDSYEPRERREASIFELQRFNAEEKSWELVGYSTDEYALFSESRMK
                     ELSTSQIPNVQTLAEVKPPAEWDWLLNVDWTLDLHPTEWVSAGFIQYVDVDNETKWVY
                     DVELNGERGQYRRRRWVKACIRQKHFTAAVKNGGNSTTKSNEVNETDDEMESVDRNLY
                     NGYASITQTSFSGADKNATKTNDANNDNGIVKSPSTASISSFISQGSTNSVAQQTNSA
                     EKSKAVRSLTDLLSLTG"
     gene            complement(<643679..>644251)
                     /locus_tag="KLLA0_A07150g"
                     /db_xref="GeneID:2896468"
     mRNA            complement(<643679..>644251)
                     /locus_tag="KLLA0_A07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451317.1"
                     /db_xref="GeneID:2896468"
     CDS             complement(643679..644251)
                     /locus_tag="KLLA0_A07150g"
                     /note="weakly similar to uniprot|P40993 Saccharomyces
                     cerevisiae YDR478W SNM1 Subunit of RNase MRP which cleaves
                     pre-rRNA not shared between Rnase MRP and nuclear Rnase P
                     in contrast to all other Rnase MRP protein subunits binds
                     to the NME1 RNA subunit of Rnase MRP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451317.1"
                     /db_xref="GeneID:2896468"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM2"
                     /translation="MSGRRDREKFMDRTMAHKYNMIHHVQRLGEPQLSGLYLKNFYNT
                     AKRYRLPLPESIRADNVKFCGNCGCVRIAGYNLTMKLLRETDENGVVTRNLRYQCGHC
                     QSEYNIEVDKTEPKKDASSKEPSPKVDIQWPRQSSPEVNDDKIKKNTTAKERAKKRKQ
                     STLSNLLASKKEKEESKKKNVSLSLMDFMK"
     gene            complement(<644634..>646013)
                     /locus_tag="KLLA0_A07172g"
                     /db_xref="GeneID:2896529"
     mRNA            complement(<644634..>646013)
                     /locus_tag="KLLA0_A07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451318.1"
                     /db_xref="GeneID:2896529"
     CDS             complement(644634..646013)
                     /locus_tag="KLLA0_A07172g"
                     /note="similar to uniprot|P53687 Saccharomyces cerevisiae
                     YOR025W HST3 Member of the Sir2 family of NAD()-dependent
                     protein deacetylases involved along with Hst4p in
                     telomeric silencing cell cycle progression radiation
                     resistance genomic stability and short-chain fatty acid
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451318.1"
                     /db_xref="GeneID:2896529"
                     /db_xref="GOA:Q6CXM1"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM1"
                     /translation="MSAIVLSPSKNLKMEENDAGVSSSQESEGCCSQSSRKVTLGSMI
                     QTERVKHLSLSEYRETNENSELISQINRVIHRSRKCAVLTGAGISCNAGIPDFRSFEG
                     LYRMVKEQYPDVNIRSGQDMFDISLFREEEKISVFASFMENLYSHTIQAKPTKTHEFI
                     AHLKNRGKLLRCYTQNIDGLEEMLGLQMSKSRDADQSFSIQWKNLDVVQLHGDLTTLS
                     CTQCFKVFSWSRHWKRCLKNGELPVCPKCLEKNNRRSIEGKRCLGHSGMLRPNIVLYG
                     ENHPNADFITQGLNMDINRGKPDLFLIMGTSLKVDGVKRLVKTISKQVHDRGGLVILI
                     NKTSIGDCNWHGIIDYQIESDCDEWVTELKKHMSDFFLSQQQLEKVRQMKREASELRK
                     RQREEKQLLSQSSQSPTTPPNSPKKRKTATLPNEKSIPKLKKTKSLCMLPSPEEMFSM
                     SPRTTSSVS"
     gene            complement(<646573..>647548)
                     /locus_tag="KLLA0_A07194g"
                     /db_xref="GeneID:2896327"
     mRNA            complement(join(<646573..646987,647529..>647548))
                     /locus_tag="KLLA0_A07194g"
                     /product="40S ribosomal protein S19"
                     /transcript_id="XM_451319.1"
                     /db_xref="GeneID:2896327"
     CDS             complement(join(646573..646987,647529..647548))
                     /locus_tag="KLLA0_A07194g"
                     /note="highly similar to uniprot|P07280 Saccharomyces
                     cerevisiae YOL121C RPS19A Protein component of the small
                     (40S) ribosomal subunit or YNL302C uniprot|P07281
                     Saccharomyces cerevisiae YNL302C RPS19B Protein component
                     of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S19"
                     /protein_id="XP_451319.1"
                     /db_xref="GeneID:2896327"
                     /db_xref="GOA:Q6CXM0"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="InterPro:IPR018277"
                     /db_xref="UniProtKB/TrEMBL:Q6CXM0"
                     /translation="MPGVSVRDVPAQDFINNYASFLQRQGKLEVPGYVDIVKTSAGNE
                     LPPQDSEGWFYKRAASVARHIYLRKQVGVGKLNKLYGGAKNRGVRPHKHVDASGSINR
                     KVLQSLEKLGVVEISPKGGRRISDNGLRDLDRIAAATLEDEE"
     gene            complement(<648431..>649488)
                     /locus_tag="KLLA0_A07227g"
                     /db_xref="GeneID:2896337"
     mRNA            complement(join(<648431..648879,649377..>649488))
                     /locus_tag="KLLA0_A07227g"
                     /product="60S ribosomal protein L18"
                     /transcript_id="XM_451321.1"
                     /db_xref="GeneID:2896337"
     CDS             complement(join(648431..648879,649377..649488))
                     /locus_tag="KLLA0_A07227g"
                     /note="highly similar to uniprot|P07279 Saccharomyces
                     cerevisiae YOL120C RPL18A Protein component of the large
                     (60S) ribosomal subunit, identical to Rpl18Bp and has
                     similarity to rat L18 ribosomal protein; intron of RPL18A
                     pre-mRNA forms stem-loop structures that are a target for
                     Rnt1p cleavage leading to degradation"
                     /codon_start=1
                     /product="60S ribosomal protein L18"
                     /protein_id="XP_451321.1"
                     /db_xref="GeneID:2896337"
                     /db_xref="GOA:Q6CXL8"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="InterPro:IPR021132"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL8"
                     /translation="MGIDHTSKQHKRSSHRTAPKSDNVYLKLLVKLYAFLARRTDAPF
                     NKVILKSLFLSKINRPPVSVSRISRALKQEGAAQKTIVVVGTVTDDNRIFEFPKTTVA
                     ALRFTAGAKAKILKAGGEAITLDQLAVRAPKGQNTLIVRGPRASREAARHFGFGPHKG
                     KAPRIQSTGRKFERARGRRRSRAFKV"
     gene            complement(<649905..>651431)
                     /locus_tag="KLLA0_A07249g"
                     /db_xref="GeneID:2896332"
     mRNA            complement(<649905..>651431)
                     /locus_tag="KLLA0_A07249g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451322.1"
                     /db_xref="GeneID:2896332"
     CDS             complement(649905..651431)
                     /locus_tag="KLLA0_A07249g"
                     /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
                     YOL119C MCH4 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451322.1"
                     /db_xref="GeneID:2896332"
                     /db_xref="GOA:Q6CXL7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL7"
                     /translation="MNIGNVFNFHLLKPQKLFHKKSSDEISVIKDNGSEFEMQVQGSS
                     AYPGDSRTATGYAANIENTTSGDKQVTGPHESTREFAEAEGDPLLLDDHSKFPDGGLK
                     AWLVVFGSFIGLIPVFGLVNSIGAIESYISINQLAGVSSPVISWIFSLYLCTTFTSCI
                     LAGGYFDRNGSRDPMIFGMIMFTGGLIATANCTTVWQFILAFSVVVGFASGILMIPLV
                     SVVATFFIKKRAIATSIATTGGSIGGIVFPILLRKLYTKVGFQWALRILALICAVCLI
                     FATVMVKEREKPETEPFKNKKEMIKWYYDSSLNWRYFLEPKYLFATLGASLAESSLTA
                     SSTFIASYALVQGNTQTVSYTLITTTNAVGVLGRYIPGYIADRYLGRFNVMIITVFMA
                     AVFNFTMWLPFGSSTPVLWAYSMLYGFSTGSILSLTPVCIGQISKTTDFGKRYSTAYF
                     QQALITLPVMPICGALIGDRSIEGFNHFIIFVSVLMLCGSICYVISRYLSVGAKFVKF
                     "
     gene            complement(<651863..>652408)
                     /locus_tag="KLLA0_A07271g"
                     /db_xref="GeneID:2896391"
     mRNA            complement(<651863..>652408)
                     /locus_tag="KLLA0_A07271g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451323.1"
                     /db_xref="GeneID:2896391"
     CDS             complement(651863..652408)
                     /locus_tag="KLLA0_A07271g"
                     /note="highly similar to uniprot|Q75AS4 Ashbya gossypii
                     ADL154C ADL154Cp and some similarities with uniprot|P38013
                     Saccharomyces cerevisiae YLR109w AHP1 Alkyl hydroperoxide
                     reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451323.1"
                     /db_xref="GeneID:2896391"
                     /db_xref="GOA:Q6CXL6"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL6"
                     /translation="MLSTKLFKPSLTRGFKTFTPTLFKAGDSIPTGLKGLHESSPGNS
                     VDLGKEVAHGKYIIVGLPAAFSPACSASHVPGYIAHLKELKEKGVKQVFVTAVNDSFV
                     TQAWAEDLGVPSDIRIIADTLGEFAKAGDHLFDSKQIFGNDRSIRYAVIVQDGKVVKE
                     FAEPDKIGVDVSSAENVLKEL"
     gene            <652702..>654453
                     /locus_tag="KLLA0_A07293g"
                     /db_xref="GeneID:2896316"
     mRNA            <652702..>654453
                     /locus_tag="KLLA0_A07293g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451324.1"
                     /db_xref="GeneID:2896316"
     CDS             652702..654453
                     /locus_tag="KLLA0_A07293g"
                     /note="weakly similar to uniprot|Q12348 Saccharomyces
                     cerevisiae YOL117W RRI2 subunit of COP9 Signalosome (CSN)
                     like protein complex that cleaves the ubiquitin-like
                     protein Rub1 from Cdc53 COP9 signalosome (CSN) subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451324.1"
                     /db_xref="GeneID:2896316"
                     /db_xref="GOA:Q6CXL5"
                     /translation="MSDEEDYAEYMMSEEDMSSFEMDVDSDVEPDDAGLEQDQQVTGD
                     DYDGSAGNSGDSMAAVEKQCESWYDTGKAFKNDDQFEEARKWFMKCHASPIWWFKSLK
                     QIIKSDLSQGLRVNERLREMFELVSTKKEMIGEESYIYGSVKRLINRIVPDLNSHLLF
                     TERLRQSSIDVSTLMERQRYLDILEKSVADMDQELRDLVTIRKIVYCVWIHVLRWEQI
                     PKETLEDLHENVNLETYFILLQLHVRTFVDEDIVHLIELVKVVDEMGRFMTNSLSVSQ
                     IPTVTSVYHFARFLTLWKSTDHYNQSQMLSKCEGELTSCFQDLEAIGGTERDGLMLTR
                     FSLMGIVFCHLLLNDKTKLVPFELEQIKVLEADELVVLLQELYQCWLDMDIYALEQCL
                     LQLEDFYSPWYNVMIEKIIALCQSNKLWKRIAPTYSCIALQDLMAKLETGNTITMNRD
                     QLLTLLMKSIAKDTADVYYKLDLVEDYVYFGEEYFVPLRSEELNIVNPLSQQMGSEII
                     GKDEWLCNVSNWHKPKVPKKLSAIEFMDYMKAARVTISQTNLAHHEPTVTSFLLKLST
                     ITHAQLTQNSSSLASTN"
     gene            <655210..>655533
                     /locus_tag="KLLA0_A07315g"
                     /db_xref="GeneID:2896439"
     mRNA            <655210..>655533
                     /locus_tag="KLLA0_A07315g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451325.1"
                     /db_xref="GeneID:2896439"
     CDS             655210..655533
                     /locus_tag="KLLA0_A07315g"
                     /note="similar to uniprot|P48560 Saccharomyces cerevisiae
                     YNL300W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451325.1"
                     /db_xref="GeneID:2896439"
                     /db_xref="GOA:Q6CXL4"
                     /db_xref="InterPro:IPR020514"
                     /translation="MQFSTVISALTLSAVAVFAQETVVSDGVTYVDVTETPEVTVSAV
                     STELSTSTPYSTTTLAVATLETYAGDNSTSTEHTVEPYSGAALKQEVLGSSLVGVVAL
                     VAALL"
     gene            <656187..>657368
                     /locus_tag="KLLA0_A07337g"
                     /db_xref="GeneID:2896719"
     mRNA            <656187..>657368
                     /locus_tag="KLLA0_A07337g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451326.1"
                     /db_xref="GeneID:2896719"
     CDS             656187..657368
                     /locus_tag="KLLA0_A07337g"
                     /note="similar to uniprot|P22148 Saccharomyces cerevisiae
                     YOL116W MSN1 Transcriptional activator involved in
                     regulation of invertase and glucoamylase expression
                     invasive growth and pseudohyphal differentiation iron
                     uptake chromium accumulation and response to osmotic
                     stress localizes to the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451326.1"
                     /db_xref="GeneID:2896719"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL3"
                     /translation="MDDSMLQKRVEGLERQISMYERLFQSFSSKLDHHFKKYDVLVSS
                     QQQQINILTEALSTMLNDQYRYSEILRDKLGTALSSVSATHVNIAGLSNQRMQDNQKQ
                     QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQPLSNVTAFLEDFIAPDVPLS
                     NAVPRRAKLGSFQTKQTTALNPTPDQDTGFRPLEVDVPVPSGVAVEDSQQQVQQQQIQ
                     NNSGSGKRKHRTTNGDGSSSKKINRSLPMPDSTSADGHRQSQEPQASHIADEKYYTSR
                     GQSKKRKVYTGNFKFFNSPQSIMDIWKEYTEGFEGQPSIKEMEQMYHVSWRREPAMNK
                     RYHRRRVLCKAIERGLEKGFHLDDVLRMLEDARVIDAERGTKHSISWICQFSHIPEIL
                     R"
     gene            <657936..>659990
                     /locus_tag="KLLA0_A07359g"
                     /db_xref="GeneID:2896745"
     mRNA            <657936..>659990
                     /locus_tag="KLLA0_A07359g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451327.1"
                     /db_xref="GeneID:2896745"
     CDS             657936..659990
                     /locus_tag="KLLA0_A07359g"
                     /note="similar to uniprot|P53632 Saccharomyces cerevisiae
                     YOL115W TRF4 DNA polymerase sigma involved in mitotic
                     chromsome condensation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451327.1"
                     /db_xref="GeneID:2896745"
                     /db_xref="GOA:Q6CXL2"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL2"
                     /translation="MSKRPSSGKGVKPNRNRNKPVKQVKKMRKSSLSRAQKNFSVFQQ
                     QSHENKYESLQSIRDDGEDAGDEVVFLHDEGKDLNSDDIDEVSVSENDLDLEDEEDEE
                     EGEEEEPVGTADGIIGNNSLDANEDFIAFDLSEPEEDEHENGFEEHSEPETAGKEEIE
                     EGEGDKLRHNADFPWILNHDHSKQREIADWLTLEIKDFVSYISPNRQEIEQRNQAIAK
                     LKEAVVELWPDSSLNCFGSYATDLYLPGSDIDCVVRSASGDKENRNALYSLASFLKRK
                     QLATQVEVIAKARVPIIKFVEPESKIHIDVSFERTNGLEAARVIRGWLEEQPGLRELV
                     LIVKQFLHARRLNNVHTGGLGGYSIICLVYTFLKLHPRVLTGDIDPLENLGVLLIDFF
                     ELYGKNFGYDDVGISVSEHEARYIPKNEHPDLSAGRPRFSLLIQDPGDPSNNISRGSF
                     NLRDIKKGFAGAFDLLANRCFELDSATFKDRIGSSILGNVIKYKGTKRDFNDERDLVI
                     NEAIQENEKYHNKRGRIVHDDLFTDISDIEAEEEIYQVQEPPTKKTKKDKSKEKKERK
                     EKRREKRKKQQLKENTERVQEVEEDNYDPTEAIIVNDEPSEQEDDYDPSKPSVDDYMG
                     LPEENNDENDKDTKEEARTPVINLIEDENGASDDSNSDPKMQLVDKQTKRDYWLSKGQ
                     AM"
     gene            complement(<660082..>660579)
                     /locus_tag="KLLA0_A07381g"
                     /db_xref="GeneID:2896523"
     mRNA            complement(<660082..>660579)
                     /locus_tag="KLLA0_A07381g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451328.1"
                     /db_xref="GeneID:2896523"
     CDS             complement(660082..660579)
                     /locus_tag="KLLA0_A07381g"
                     /note="similar to gnl|GLV|CAGL0E02123g Candida glabrata
                     CAGL0E02123g and weakly similar to YOL114C uniprot|Q12322
                     Saccharomyces cerevisiae YOL114C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451328.1"
                     /db_xref="GeneID:2896523"
                     /db_xref="GOA:Q6CXL1"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL1"
                     /translation="MLTVLKRHYSDAIAVGRAWIEGFKAENVPLKLFVATYDRSRGKG
                     GQNVNKVNSKCTLTLYNFSKCSWFPDEIRKQLLDKGFRYYAPSKDALVIQSDETRSRE
                     QNRDICVEKLVKEVKKLVFFPGETDMSTKRKWNEIKKRSNEVRLSEKKFKSDKKRSRT
                     VKLDF"
     gene            <661261..>663900
                     /locus_tag="KLLA0_A07403g"
                     /db_xref="GeneID:2896420"
     mRNA            <661261..>663900
                     /locus_tag="KLLA0_A07403g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451329.1"
                     /db_xref="GeneID:2896420"
     CDS             661261..663900
                     /locus_tag="KLLA0_A07403g"
                     /note="similar to uniprot|P48562 Saccharomyces cerevisiae
                     YNL298W CLA4 Involved in localizing cell growth with
                     respect to the septin ring protein kinase homologous to
                     Ste20p interacts with CDC42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451329.1"
                     /db_xref="GeneID:2896420"
                     /db_xref="GOA:Q6CXL0"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:Q6CXL0"
                     /translation="MSLSAAARDYSDADFQNIGPAPKPPMGFNQTQPISNDFNKLDLN
                     RNLKQRSLVSTTQKRKSGWISYKDDGILSFIWQKRYMVLSDAYLSLYKTEQTIRETPV
                     MQIPLTSIVSVSRNQLKQNCFEIIRSSSANGSMPMSASQDGSKKSIYISTKTELELHT
                     WLDAIFARCPLLSGVSSPTNFTHRVHVGFDPETGSFVGMPSNWEKLLKHSRITGEDWN
                     NNSAAVIQVLQFYQEYNGVNQSSASLPPSASSATPSPSTNTLPTIAKNNFHATLQSNG
                     SGGSSSGSSTSSFNHNNFNNSSTNVDAARSDHGKNELIPQRKPPSPPSSSSSNVHPNV
                     EISKASPNNHGPKVAQQYVPSPQHTQRKPLASLHNMANPYSRTKAGPTVRQQVSTQPY
                     SYQQQQPKQNYQQSLQQQQQQANRQQTPAKYPTDGPNVSPRDQNHKPPSPQNHNQYQH
                     NLKQPQQQQQKQLIQQHTVAIPPRMHPQRIASDRSQNQPKPGMQPLIQVTTSQNKQPS
                     PSQSAAQMAMRQHNQHPAGMPKVANAKLQPAREAPRVGDSNQQKTTEVSKKKPSKPAM
                     SNAEIMTNLKNVTFNMDPTPFFRMVEKAGQGASGSVYLAERLQLPPYKDELEAEKNQL
                     GNKVAIKQMILSKQPRKELIVNEILVMKDSKHNNIVNFLEAYLKTEDDLWVVMEYMEG
                     GSLTDIIENSPTGSSGQSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDT
                     RGRVKITDFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEM
                     LESEPPYLNEEPLKALYLIATNGTPKLKHPEYLSLEIKRFLSVCLCVDVKYRASTEEL
                     LHHSFFNMSCESQDLISLLEWKN"
     gene            complement(<663956..>668764)
                     /locus_tag="KLLA0_A07425g"
                     /db_xref="GeneID:2896441"
     mRNA            complement(<663956..>668764)
                     /locus_tag="KLLA0_A07425g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451330.1"
                     /db_xref="GeneID:2896441"
     CDS             complement(663956..668764)
                     /locus_tag="KLLA0_A07425g"
                     /note="similar to uniprot|P48563 Saccharomyces cerevisiae
                     YNL297C MON2 Peripheral membrane protein with a role in
                     endocytosis and vacuole integrity interacts with Arl1p and
                     localizes to the endosome member of the Sec7p family of
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451330.1"
                     /db_xref="GeneID:2896441"
                     /db_xref="GOA:Q6CXK9"
                     /db_xref="InterPro:IPR026829"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK9"
                     /translation="MAAAGSFVALSEQLVRDLQTLASESKRRSSDIKQACEKSIEILQ
                     RSHSEEELVRHPDFVDPFITACLSGNAKLTSISMQSMQRISGIRCICTSKMESLLNAL
                     LKSTELAIDIQLKVLQLIPILFKTYADVITDRLLAKLFLCCTQLLHQPNRTSILIGTV
                     SATLQQLVNEVFDRCKDADNDDVKGPRPVPISNDKAGVVNKYRYDAHIVLANLSQLND
                     PHTYDDAILDVKNIPEDCGLEILEFLLSNHASSICQFEDLLFLLRTKVVPLLLRIFST
                     SKSFPIVVRTARCANLLISIQFFDKLELESEIMLWLLIHTLSKDSDSPMWKKILSLEI
                     FDNCTKHPKLIEKIFKSYDHLEDRKDICKSLLSAIDSSVHSFEFESLLNESDILMKGD
                     ILILSPDNSSSKMSLLNLLDKSSPPLIDQTYVIYLLLSISNNISDGVSSLASLSDQKE
                     EVDEENDVLIELFKETYPSLFRIHRRFLYSTTLDTHLFHLLIRAFQKLSLAAGIFGCN
                     EQLHELLSLFQTLILNNVPERRSAPVPTPSSGSVLGSIGDTLVNVAATMTEKQTDVKP
                     RTTKDFRSRFFQQRNLNLFRALVSLSISLGSSFDAKSWETFLVTWQWVSYYMYGPTAD
                     FLDGYYGKDVVPATAITKQDLLTYETSVKKFIENSMNFTHAGLYVLFKTAVSCSVSVL
                     ESSQDLSSALVDSSGNVRFCPYNRSFFVAELSELLVSNYEKILVQNGDGGIWPMFSKY
                     LISQIANRKLPDAALRLYLSRVYSDTVVELSAKCNSEGQTQNDLSLQTQEVIMKSLLE
                     LIDAIRALPISSESVYSNDTNVESDIILQALKTLNDLLNSFGETLNSWDIVLKILNSP
                     FDVIDNGSQKITVDTESNISQVLVQKHKDMIQMSFEVFKLISDNFLQYLPLNIIKDFI
                     DTLSNFVNQDRDLNISFSSISQFWLIADSLRMQKGDASVEESETKSYDALVQKGEINK
                     IIEQDFPISQKLKALWIYLLVTLVRCAYDLRPEVKNGAVQTFFGILDSNFNLFPSWDL
                     IASQVLKLLLSFNLPVENANGYAEFVNITFKGLLQIYSKHLTYFNSQNDMTEHWIILV
                     SKMGDLMQLTAYDVVYSVCNNFKQLLEISKAIEDFPVLIIRKYYEIWSSYNIVYTSIP
                     TNDYRKKTNSDCLQAFMDCFKPLYELHRMHSLIDTDFMEKCLSTINASARYPLLPDHI
                     SDRLKPSPLQKSLLAAIGTFDEDLPPNLQVLLLAQLSAIVDLPFETRDRIEKKLSAKL
                     GDLTKTKIPSFEAISYSACELLSQRISRLERLDKTIIESRSFSKLLNNLSHPMTKNSM
                     ICPSIDSERPVLWKLACDSFCMLSDKLFYALVANLTATEEDNVNEYTAILIQMLIATI
                     VKEGKQDDENIGIQAVIIYKQLKELFIKCLSLGLLSKEQIQPFGSALWSSSYYYEIDE
                     VEDAVIKQCANLEDIVRQFAKFDFDNIVGSTKEPVALPNYNLTAICLGDLIAFCTLQT
                     NKGEIVREVCFSFMIARVAFVLRKFIADQQLLNLQPISKVKSLELQQVSNGILSVLAF
                     YNTVDTTIQSFELLDDLYPLLLRAIPLSQKVPGLQDTLLQIALLYAKLNK"
     gene            <669272..>670732
                     /locus_tag="KLLA0_A07447g"
                     /db_xref="GeneID:2896425"
     mRNA            <669272..>670732
                     /locus_tag="KLLA0_A07447g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451331.1"
                     /db_xref="GeneID:2896425"
     CDS             669272..670732
                     /locus_tag="KLLA0_A07447g"
                     /note="similar to uniprot|P48564 Saccharomyces cerevisiae
                     YNL295W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451331.1"
                     /db_xref="GeneID:2896425"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK8"
                     /translation="MLSGIRITPLRRASRLLFAQQYSSKSNPTALKWQKDNTEEEQES
                     NSKSKTDVKDLRSKVEALKVSEPETVTTNDKGTSSKKRKAEKSFLVPQVPSTDYLPRE
                     DLETEGLFAGYKPLFLGNSPLESNNNDVLLDGLFSSIRKLKNAQINSENNTVEIDVSD
                     MLDDLKKDNQEYQRLHEKAPKIPWDASISGLVYNDEPFKGVPRSVVSKLKPFKLVRVE
                     KKNSKDKEAKNDKIKLKFHGTRIKDDSTMVDLIQETSKKKERDNAFGTTGNDVAQGTK
                     VKYETEKIDYTYKFQFIGADQRIFKNNVSKLTRLFMKEFMKVRNVRLASDFKENYLPL
                     YIYVDHSTQSRSMFKRYLRRKIIDYIRPLLMTLSHSYETKEQGRKFERRIMLKVDSIV
                     NTLSEYLPSVYFKSEEVDCLLLPSPVSAFGRMHWLKPTKRRNVFWGKNVTNDYVFNLS
                     YDMKVTRSGIKRMRYPINLHWKSFNNAFTEWEYSYL"
     gene            complement(<670942..>672501)
                     /locus_tag="KLLA0_A07469g"
                     /db_xref="GeneID:2896424"
     mRNA            complement(<670942..>672501)
                     /locus_tag="KLLA0_A07469g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451332.1"
                     /db_xref="GeneID:2896424"
     CDS             complement(670942..672501)
                     /locus_tag="KLLA0_A07469g"
                     /note="similar to uniprot|Q758G4 Ashbya gossypii AEL202C
                     RIM21 pH-response regulator protein palH/RIM21 and weakly
                     similar to YNL294C uniprot|P48565 Saccharomyces cerevisiae
                     YNL294C RIM21 Protein proposed to be involved in the
                     response to alkaline pH; has similarity to A. nidulans
                     PalH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451332.1"
                     /db_xref="GeneID:2896424"
                     /db_xref="GOA:Q6CXK7"
                     /db_xref="InterPro:IPR014844"
                     /translation="MTGRSRWRYHFPSEDYSSCQGVQLDEGVLIWNKLPDKFAYIKSL
                     VFTSNCQDGTPLYSSFVELEDECPYLPIVAFDWNSYINNDGYTGPFKYSIYSVIYSVT
                     ANFIITVFLTVIVFINVPTKPSRKASYILKLGALLASLNLSIFVIRVWKNIAENYTYN
                     GYVSSTSFLNLLWGDKVFAGIDLVVVFLLQISQVQIVMRFFDRMQEKRMVFYFGLFLI
                     LVTQILWVIPTLSPVPTKDSDSDIDILPPFVYLFRIALSTCYASVICFHVLTKKSLCF
                     RGRMIFLTLLTIFTVFLHPTFFIVDVSNLWIDDLSEIFNTTCYLASTVIVLEWTNRIH
                     TMERKIHAASVLGRPIYEDEEQNFHFAIYALRMQNAMKMHRDGHVHDHGHTCDSNDNA
                     NVSLQNANTNDSSSIITDNSSQRTSTFGTMATDQVTLHTQQGERNITQFKRAETFWNK
                     CHHVLESIVYYTDNVMVNALAGSKTFDSFTNDAEKLLKTERLRKTVGLDEPEDVYLYR
                     KTTMSSDSVME"
     gene            <673198..>675057
                     /locus_tag="KLLA0_A07491g"
                     /db_xref="GeneID:2896434"
     mRNA            <673198..>675057
                     /locus_tag="KLLA0_A07491g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451333.1"
                     /db_xref="GeneID:2896434"
     CDS             673198..675057
                     /locus_tag="KLLA0_A07491g"
                     /note="similar to uniprot|P48566 Saccharomyces cerevisiae
                     YNL293W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451333.1"
                     /db_xref="GeneID:2896434"
                     /db_xref="GOA:Q6CXK6"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK6"
                     /translation="MNQDQNQANRMYKGPIRLHTMFSPSVPDLNRKFSDLNTSEQSIA
                     VSDGGVALRKNVVRNNSNSERISGSKRPKSTILRENSAGLSLINLYYDLDDENEEEIG
                     QVSMKGHKINQNNSGSSELELNEGALTLATEDKTINLDDSGSSDALNGIGQLPTPESE
                     SRASQLLGNSSLIEDAASIKVKDSHLDRYGFMKQNQYISEKQYNEWWSEYSKYCIRRK
                     RKWKDLLLKSGLPVDNDSPSRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQELLNK
                     NIGVYDKLLTKINDPSFTSKDTEIIERDLHRTFPDNIHFQRSKVSSEDPLIIKSLRRI
                     LKAFAIYNAKIGYCQSMNFLVGLLLLFMDEERAFWMLVIMTSRYLPGVHSINLEGVNI
                     NQGVLLLCIKEYLPHFWQRIYSNKDQQHSPGLSNKNEFLYKLPPVTLCTASWFMSCFI
                     GVVPIEATLRIWDCLFYEGSHILFKMSLAIIELSETNLPKLNHVSSRNSDDEDMELFQ
                     AIQTYPRRLINPNDIIDKAIFKRRLRFNALNQEEIERCKKYVISQRAKYKNFQDVMKN
                     ETTNSNNKRDSKLAQELINETFSNEGYGFKKGLNGVNWNNNIKERVRRLSRKR"
     gene            complement(<675169..>675804)
                     /locus_tag="KLLA0_A07513g"
                     /db_xref="GeneID:2896563"
     mRNA            complement(<675169..>675804)
                     /locus_tag="KLLA0_A07513g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451334.1"
                     /db_xref="GeneID:2896563"
     CDS             complement(675169..675804)
                     /locus_tag="KLLA0_A07513g"
                     /note="similar to uniprot|Q12285 Saccharomyces cerevisiae
                     YOL111C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451334.1"
                     /db_xref="GeneID:2896563"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK5"
                     /translation="MSELDFVGKFLSLAALNEPKLASNYRKPLHEVTNLGVSLPPLRY
                     KYDPSKSHSKSISKVVEVTIKSIKAPKFVHSKSFESTDTVGQIKEFLVETEPEIYTTG
                     QIKLLLKGKVLHDTQLVSDLNQDKISLVAMVSKAEKPVETAPLPKPAQEPEPELELMD
                     VDMEDPQLDLSSQTDIDLPWDKIRTVLESSLDASTASVALGRLQKGWELSK"
     gene            <676032..>676808
                     /locus_tag="KLLA0_A07535g"
                     /db_xref="GeneID:2896443"
     mRNA            <676032..>676808
                     /locus_tag="KLLA0_A07535g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451335.1"
                     /db_xref="GeneID:2896443"
     CDS             676032..676808
                     /locus_tag="KLLA0_A07535g"
                     /note="similar to uniprot|P41912 Saccharomyces cerevisiae
                     YOL110W SHR5 Subunit of a palmitoyltransferase composed of
                     Shr5p and Erf2p that adds a palmitoyl lipid moiety to
                     Ras2p through a thioester linkage palmitoylation is
                     required for Ras2p localization to the plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451335.1"
                     /db_xref="GeneID:2896443"
                     /db_xref="GOA:Q6CXK4"
                     /db_xref="InterPro:IPR019383"
                     /translation="MVSLVLADTADSSDLSKAAITVEESTSAQQPKFFNYHEFVITKY
                     RALDEESCEEHGPENPICITHFPNIYVPEESDEFRTTRVVRIPRRFESSTEFPNFSTQ
                     LPGSEPAALPDTHNKEFVPAGEFEGQWYGETSVSPLSNYLDQAEWTEIVTRINSLLEA
                     AYNPITRRNFVNVILDLLTLNLWSIIEPYLFVNPLQSVEDYVSEINRSESFRLKGIKI
                     IPPRESSYLSVCIDSPAWIKPCTAINEPLLTHCDTLIVLL"
     gene            <677067..>679394
                     /locus_tag="KLLA0_A07557g"
                     /db_xref="GeneID:2896373"
     mRNA            <677067..>679394
                     /locus_tag="KLLA0_A07557g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451336.1"
                     /db_xref="GeneID:2896373"
     CDS             677067..679394
                     /locus_tag="KLLA0_A07557g"
                     /note="some similarities with uniprot|P36165 YKR089C
                     Saccharomyces cerevisiae STC1 Protein of unknown function
                     found in lipid particles potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451336.1"
                     /db_xref="GeneID:2896373"
                     /db_xref="GOA:Q6CXK3"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK3"
                     /translation="MPNVMNTPSVTDIKDDPITSYVIKNYYKRANKGAEMTEEQSRND
                     SGQDEPQLNFFSSLCNSFYKFIRGADSTHEQIARLIEQKQNARSLQEWLAAATKLDDI
                     TNAEQWKSKRESVLYDYCLVESSTEAMKKARLAKDWPNLLYLIRTTWVRNRGGMGNVN
                     LYRHSYVGTKHIIEDYVAESSRSLQELVYNSDLDDTYLLGMLTQTRKNIGRTALVLSG
                     GGTFGLFHIGILVTLFEQELLPRVISGSSAGAIVASILASRQEHELMGLMDEILVKDF
                     NIFKDDLEMSESENLLIKISRFFKNGTWFDNKNLVSTMINFLGNLTFREAYNRSGKIL
                     NITVSPASVHEQPRLLNNLTSPNVLIWSAVCASCSLPGIFPSSPLYEKDPKTGETKQW
                     NSSSVKFVDGSVDNDLPVSKLSEMFNVDHIIACQVNIHVFPFLKLSVSCVGGEIEDEF
                     SARFKMALGKVYKYMASEVIHALEIATEIGIGTNVLTKLRSVLSQQYSGDITILPEMN
                     TLLRFNELLSNPTQEFLLREATNGVRASWPKISIIKNHCGQEFELDKMINYLKGKIIS
                     NTDIKGNPFQISNRDVPLINSPVLANSEKKAIQVFDDVLLNADNLDNFMVVPDGTGSL
                     KSQDLNNPPRYSNEFGSRAHNRRKSDSATNGNRKGKRHNSISLPYSSSSSPLSEKKYS
                     MINFRPSFDKKTSTGDLQVRKPYPYPPKSSSFSRIDYDPRSNSLTPILDHAVGTRRDD
                     SILHSDVKSNPNSPLRLRTKSSVSRRASRKNPDTA"
     gene            complement(<679469..>681631)
                     /locus_tag="KLLA0_A07579g"
                     /db_xref="GeneID:2896323"
     mRNA            complement(<679469..>681631)
                     /locus_tag="KLLA0_A07579g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451337.1"
                     /db_xref="GeneID:2896323"
     CDS             complement(679469..681631)
                     /locus_tag="KLLA0_A07579g"
                     /note="weakly similar to uniprot|Q7LGN4 Saccharomyces
                     cerevisiae YOR080W DIA2 Protein of unknown function
                     involved in invasive and pseudohyphal growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451337.1"
                     /db_xref="GeneID:2896323"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK2"
                     /translation="MGEEIDALDDGLLTRTYELGLKWMQCREYSKALGLFSKAMKVSR
                     SYPMEMVENIRIRAGMPKRCAYDESKAYHPLYVKLLDSRISCLMKVGDYARAVKESQY
                     FCKIEPSSTRALLRLGKSYELADKGDRARQVYKSGRKLVKELKERGVLVSPVHEKLFS
                     DRYEELLKRNAMQLVNSNDAESGARNSEQIPSKKRVLIEQKLVNNEDIEENDLVSDTD
                     QDHDGSTMNKKMKRATIDPIQTFPTELVISIMRRLDTKDITSCMLVSKFWYRKLSTTP
                     MIIDYLSVPKTNYSKINSLLRFVKTKRCVSSVIQYLNFSVMATNEEAKCSQLLFNGLD
                     QEVKKLVLQFTNLNILKVLQLISDKEKLIANLQEFSVFGHYDPNHWADEDVVFLERID
                     NLKKIEVLIGTAMVPGRNSSIHRRRQLQFPNNDNISRSLQSIKLIFKDNGWTGPTPFA
                     CIFSSDTLRFANVSKLIVTNRDFRFNQTADWIKKFPNLTDLWLERNTGLSLMGFLQSL
                     QEPNVLKRLKYFTFRESSTESNRSFNGQMWTDEQIEPILANLGAVQTLDIMNSAIARS
                     VLYRLLNELPSIRKLNIGNVFEMSDELYPRTDIESTAFLFLRHMTHLRDLSVPNMSSH
                     QVRAFRQLALVISEIGSLSRLDLSFNPSMQGYQLYDIIRELFDNGITLKTLVIDGCSH
                     ISATTVKDIERNGYVENIECAFNKQQWEKFGVNSFWYR"
     gene            <682057..>683001
                     /locus_tag="KLLA0_A07601g"
                     /db_xref="GeneID:2896432"
     mRNA            <682057..>683001
                     /locus_tag="KLLA0_A07601g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451338.1"
                     /db_xref="GeneID:2896432"
     CDS             682057..683001
                     /locus_tag="KLLA0_A07601g"
                     /note="weakly similar to uniprot|Q12067 Saccharomyces
                     cerevisiae YOR079C ATX2 Golgi membrane protein involved in
                     manganese homeostasis overproduction suppresses the sod1
                     (copper zinc superoxide dismutase) null mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451338.1"
                     /db_xref="GeneID:2896432"
                     /db_xref="GOA:Q6CXK1"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK1"
                     /translation="MSQLLEPLLSAVFLFFATLGTGLIPVMYMSKLAEKGDSGMGYLK
                     YVSDFGIGMLLGTSCLLVIPEGVEKFGDKGGRGFGISLLLGFMILYGLDRFLHALQAG
                     HILSGSFDASAAPDPLERNIDLINPRKTVPFILTNNIVFALVIHAFSDGLALGIAESY
                     DSLKFVMLIAIIIHKIPATLSLTGIMISKQRLPKLQVISNLIAFSISTPFGLLFVILM
                     RFVSKDLIEKMSDGLLVLSGSSLLYASLLALISPSKDQEQQLQNDGPIPVSGSVLEMG
                     EGVTTEEKIEQESLPDVRLLLLGIFIPLMISFFAPHDS"
     gene            complement(<683112..>683864)
                     /locus_tag="KLLA0_A07623g"
                     /db_xref="GeneID:2896405"
     mRNA            complement(<683112..>683864)
                     /locus_tag="KLLA0_A07623g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451339.1"
                     /db_xref="GeneID:2896405"
     CDS             complement(683112..683864)
                     /locus_tag="KLLA0_A07623g"
                     /note="some similarities with uniprot|O00033 Saccharomyces
                     cerevisiae YOR078W BUD21 Component of small ribosomal
                     subunit (SSU) processosome that contains U3 snoRNA
                     originally isolated as bud-site selection mutant that
                     displays a random budding pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451339.1"
                     /db_xref="GeneID:2896405"
                     /db_xref="InterPro:IPR013268"
                     /db_xref="UniProtKB/TrEMBL:Q6CXK0"
                     /translation="MGLKKVLGSGAALVAKRHLKFDDDADDSFHTADEGNSTLDALKP
                     TKAEANGESESESESDSDAPEEEGLSSGKDAIEKRIQEREEAARLQEEAAREKRRKNE
                     KVFKQQQLEKKKKLLESEEEKQREKMLEFERQLVAQQGSDNDEPEELPQEFFDELESG
                     SASSFAKATPKHITFSAEAQREEEQALKEELRKQKKRSLRELRKTQIQKGPVTVNLLS
                     SMKVSKTLAPKKETSVMKSKDKWLKRRSLKRK"
     gene            complement(<684223..>685041)
                     /locus_tag="KLLA0_A07645g"
                     /db_xref="GeneID:2896367"
     mRNA            complement(<684223..>685041)
                     /locus_tag="KLLA0_A07645g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451340.1"
                     /db_xref="GeneID:2896367"
     CDS             complement(684223..685041)
                     /locus_tag="KLLA0_A07645g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451340.1"
                     /db_xref="GeneID:2896367"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ9"
                     /translation="MKSLLNKRFSPKRRNKPITYAPASAAKPKPKPKPKPKQLDPPMQ
                     SGESSSQKSSTPIPIKSILRPVDGTHEHENKSVRIVESSPHPESVPISTPTRIIVGPL
                     PDGNVSDSLVYNASDLEKGHIGVAEESSPLLESQLPDLTTYQTISPESNPTAQIHCWS
                     TPSLPIPIPPPSSDQPCSGDPVQSPSIPPSRESPFTSPLSRFLQMLYARYPVIITYIL
                     ITICVIGIIYSLVTGTGRSYLLVIIKACICWIMGTDVARMLFGTQFCDIEFKVS"
     gene            <685696..>686613
                     /locus_tag="KLLA0_A07667g"
                     /db_xref="GeneID:2896436"
     mRNA            <685696..>686613
                     /locus_tag="KLLA0_A07667g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451341.1"
                     /db_xref="GeneID:2896436"
     CDS             685696..686613
                     /locus_tag="KLLA0_A07667g"
                     /note="similar to uniprot|P36164 Saccharomyces cerevisiae
                     YKR088C TVP38 Integral membrane protein localized to
                     vesicles along with the v-SNARE Tlg2p green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451341.1"
                     /db_xref="GeneID:2896436"
                     /db_xref="GOA:Q6CXJ8"
                     /db_xref="InterPro:IPR015414"
                     /translation="MADLYEARVSSGGLSRPSDTDFLDSNDNFDDLDDDFLDIYNLSW
                     RQRIVQHGKRHLRNGKDKFNALSRRKKALVVFLGVLEIILIFITVVKREAIMKGLVDA
                     SNDLRQKWYTPLVLMLLILAVSFPPLIGYSFLSLSTGLIYGLSFKGWFILAMSTVIGS
                     VLSFTVFQRLLHSHAERLIRMNPKLEAVSSVLQGNDSYWMIALIRLCPFPYSFINGAI
                     AGIYGISIKNFAIANIITTPKAVIYLFVGERLKNMGETDSGSTRLINFISILLANGFL
                     ILTTWFLYYRFKKRYLELQSEQQNSFDIF"
     gene            complement(<686738..>687457)
                     /locus_tag="KLLA0_A07689g"
                     /db_xref="GeneID:2896369"
     mRNA            complement(<686738..>687457)
                     /locus_tag="KLLA0_A07689g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451342.1"
                     /db_xref="GeneID:2896369"
     CDS             complement(686738..687457)
                     /locus_tag="KLLA0_A07689g"
                     /note="similar to uniprot|P40962 Saccharomyces cerevisiae
                     YOR077W YORO77W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451342.1"
                     /db_xref="GeneID:2896369"
                     /db_xref="GOA:Q6CXJ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR019447"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ7"
                     /translation="MVSGDVGSASFLNKQMKMRGLQKLRFYCQICQKQCRDENGFKSH
                     SKSPSHLQKLSKVTHKDIEEYTVQFEKDFLRLLRLMHGEKKVEANKFYNEFIQDKDHV
                     HMNATRFTSLTRFIQHLSQGGKVRIHGIDELTSDTDPGRFMISYIDSSSPNMIRKKQI
                     ESLKQAERSDQEIKLRLLEKQIEKANAEEVKSGQKEEEEEEEEIKANIRDGPINLTVS
                     TSKVTKKKPKKKLKNVFKPTK"
     gene            <687735..>688772
                     /locus_tag="KLLA0_A07711g"
                     /db_xref="GeneID:2896364"
     mRNA            <687735..>688772
                     /locus_tag="KLLA0_A07711g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451343.1"
                     /db_xref="GeneID:2896364"
     CDS             687735..688772
                     /locus_tag="KLLA0_A07711g"
                     /note="highly similar to uniprot|P36163 Saccharomyces
                     cerevisiae YKR087C OMA1 Metalloendopeptidase of the
                     mitochondrial inner membrane involved in turnover of
                     membrane-embedded proteins member of a family of predicted
                     membrane-bound metallopeptidases in prokaryotes and higher
                     eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451343.1"
                     /db_xref="GeneID:2896364"
                     /db_xref="GOA:Q6CXJ6"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ6"
                     /translation="MFKNVFSRLLRPQARFYNTPIPRVTYKRFNGRTGNSFTQLLFDK
                     TSRKYLAIVFGTGSLFYLTHLEEAPVTARTRFIWLPRSLELKIGQYTYNSVLSETKGK
                     ILPESHPLTRKVTKIFHRIVEAAEHDPSVDQSLLKDVQWKIHIVNDPRAPPNAFVLPG
                     GKVFVFSNILPICQNEDGLATVLSHEFAHQLARHTAENLSKAPAYSILGALIYAVTGL
                     DGINRLLVDGLVRMPASREMETEADYIGLMVMSRACFHPEESLKVWQRMAAMEEQQKR
                     RGMVNVEFLSTHPATTRRIENMAKWLPKSQELYSQANCGNFGGFYNSFQDAFGYGNSV
                     SPEPRITVWGI"
     gene            complement(<688856..>692050)
                     /locus_tag="KLLA0_A07733g"
                     /db_xref="GeneID:2896699"
     mRNA            complement(<688856..>692050)
                     /locus_tag="KLLA0_A07733g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451344.1"
                     /db_xref="GeneID:2896699"
     CDS             complement(688856..692050)
                     /locus_tag="KLLA0_A07733g"
                     /note="similar to uniprot|P15938 Saccharomyces cerevisiae
                     YKR086W PRP16 RNA helicase in the DEAH-box family involved
                     in the second catalytic step of splicing exhibits
                     ATP-dependent RNA unwinding activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451344.1"
                     /db_xref="GeneID:2896699"
                     /db_xref="GOA:Q6CXJ5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ5"
                     /translation="MNAELQEWIQQNTESRVTEKFVETLRQIARIHKDVNKFIGGAKA
                     LGKFKGKDEFLKQLFEKLQAHKQSPKPESAAVPARTIRKKFVVKLPLDDKEDDDEDEL
                     STVKVQVKPKFNKPLTLKRITKQTAAKLNEFSENTEPVVMVKKEEATKGTLIDAEGSD
                     VEDIKDAKDFTAQDRNWYDNDDDFDNVIHDDEYIPAQQDPYEGGDRELDLNEPEIQLT
                     SLSLNERKTIIPPFLLDFHDQSGELAIVGALDMSSNANKGIADPIRNPESDFSINARR
                     GSKLVAMRRIHRDRKSKSQNATELKGSALGKVLGVKQDSSTDAQTKQPNQPIAIKEKE
                     QSFEEIQAVRRSLPAYKVRHDLMRHIRDNQITVVIGETGSGKTTQLAQFLYEDGFTAN
                     GRMIGCTQPRRVAAVSVAERVSKEMDTPIGVKVGYSIRFEDQTSDSTKIKFMTDGILL
                     REAMIDPLLEKYSCIIMDEAHERSLNTDVLLGIFKTLLARRHDLKLVVTSATMNADKF
                     SQFFGNAPQYFIPGKTFPVEIIYTNHPVPDYVESAVQKALDIHLSTPISNGDILIFMT
                     GQEDIEATCSTIIERLTEIYTKKYGANYEEQLADVQVLPIYSSLPADVQGRIFQRQEQ
                     NVRKIVVATNIAETSLTVDGIKYVIDCGYSKLKVYNPKIGLDSLRITPISLANANQRS
                     GRAGRTGPGIAYRLFTHDSAMEDMYPQAIPEIQRTNLANTLLQLKSLNINNLSKFPFI
                     DPPPSQNLMTSLYDLWALEALDNFGHLTKLGRLMGAFPLQPFLSRVLISASQYGCTEE
                     MLTIVSMLSVPSVFYRPKEREEESDQARSRFFIPESDHLTLLNVYAQWKANRYSAHWC
                     NSRFLQFRSLQRAKDIREQLLYVIRKLNLPMASSGSDWAPIRKCLCTGYIQQTAKLSG
                     LGKYVHLKTGMDLKVHPTSALFGLGDLPAYVVYHELLMTTKEYINVVTAVDPLWLMEY
                     SGIFYHIKRRKEQSYQFGLNSSLNNDDQDHQDKIDLQIEKLRLNAKDKLERLETDKSS
                     AALNKTNSIEMRRTTNERQEQPAVRIGIKRRRPF"
     gene            <692606..>693199
                     /locus_tag="KLLA0_A07755g"
                     /db_xref="GeneID:2896698"
     mRNA            <692606..>693199
                     /locus_tag="KLLA0_A07755g"
                     /product="mitochondrial 54S ribosomal protein YmL20"
                     /transcript_id="XM_451345.1"
                     /db_xref="GeneID:2896698"
     CDS             692606..693199
                     /locus_tag="KLLA0_A07755g"
                     /note="similar to uniprot|P22354 Saccharomyces cerevisiae
                     YKR085C MRPL20 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL20"
                     /protein_id="XP_451345.1"
                     /db_xref="GeneID:2896698"
                     /db_xref="InterPro:IPR024388"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ4"
                     /translation="MVRLFSTSARAAKDLSKIIDKSGKLPKIVGPATIYNPKSSASNY
                     KGYLKAKIPAGLYYDPAPSSIHGSTNSETIPKSFLPATDPRHDIIDDLTQGNAEISRV
                     APVLHEKGEKTYHLKPEDIAEIRRLRLEDPVKNSRKALAKKFNCSPLFISIVSEPPKE
                     RKTEMNQVLETIKSQWHPKRALARAERKKRKELWYRA"
     gene            complement(<693423..>693911)
                     /locus_tag="KLLA0_A07777g"
                     /db_xref="GeneID:2896430"
     mRNA            complement(<693423..>693911)
                     /locus_tag="KLLA0_A07777g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451346.1"
                     /db_xref="GeneID:2896430"
     CDS             complement(693423..693911)
                     /locus_tag="KLLA0_A07777g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451346.1"
                     /db_xref="GeneID:2896430"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ3"
                     /translation="MTVPENVLTTHQRVIQSCVLYNIVPRSIARAWEPQHLLWKGKLI
                     VDELLHLDGSNQSTMMQPSLYRFRFVSDKEDGVDKEDINSDERLFCETQVISNLKELH
                     TVLQRREKWYQIAMLCEGQHRHQIALELQIKDAYQMQLFEDIILRIRDEYEIFQEMYD
                     GY"
     gene            <694308..>697112
                     /locus_tag="KLLA0_A07799g"
                     /db_xref="GeneID:2896427"
     mRNA            join(<694308..694563,694879..>697112)
                     /locus_tag="KLLA0_A07799g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451347.2"
                     /db_xref="GeneID:2896427"
     CDS             join(694308..694563,694879..697112)
                     /locus_tag="KLLA0_A07799g"
                     /note="similar to uniprot|P32769 Saccharomyces cerevisiae
                     YKR084C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451347.2"
                     /db_xref="GeneID:2896427"
                     /db_xref="GOA:Q6CXJ2"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015033"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ2"
                     /translation="MSKFYDDDDAVDYDDDVPDFQDEDEFDDYLNDEEFELMNQLFPL
                     AKEQLADYQGWDNLAVKVAIFDHNFELEPALVDLKRRFKKKVSFICLFAEQKVEKKLS
                     ALELLARKRAEARNKASTMAPATTKVSLLDKLKNGGGNGQNGNPVKTTVSVASRLQSL
                     KRGPITTDNNSNGAATASFSQPKTHTLASKLASLRKSKPEGQIIEKPEAEETNVEVVI
                     EENKIDHEKKDKDDPWVILNQLKDSAYVSNINEILAINKVPLYSGILEKLEFNSTTTK
                     RKHEELFSVYYPNTNNRVVKKQAIANFSKPSPDDVVINQQKAAFEVDKIKEKVADLSI
                     QDKQSSKTVEKEEDINDDDDDDEKLPFEEPVVKTYKKVSVPTKPKNAINISSYLDNKK
                     PHLNFVVLGHVDAGKSTLMGRLLYDVGAVDTKLIRKLQKESEMIGKSSFHLAWVMDQT
                     SEERNRGVTVDICTSDFATTKSSFTIVDAPGHRDFVPNAIVGISQADVAVLSVDCGTD
                     AFESGFNLDGQTKEHALLARSLGIKHIVVAMNKMDSVSWYEGRFNDIRSELAVFFEEI
                     GFKGNDVSWVPCSGLSGEGIFKTPYPPSQTWYQGPSLVGELENVALKLACVDESVTKE
                     PFLFNILDVTPTSKNTSAIISGKVESGTIQPGETITIYPSEQSCVVDSILCGNDSQKV
                     DIALHGDFVQLKLHNAFPEDIQGGDLASIVGFDIPSSQEFTSRLLTFRLDRPLLPGTS
                     LMLFRGATEQPCRIKKLCCTVDKSNPSKVLKKKVKHLGSQQAAIVEIELVEKKRRIPM
                     LTFEQNKKLGRVVLRKEGRTIGAALIKSLDY"
     gene            complement(<697189..>698178)
                     /locus_tag="KLLA0_A07821g"
                     /db_xref="GeneID:2896767"
     mRNA            complement(<697189..>698178)
                     /locus_tag="KLLA0_A07821g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451348.1"
                     /db_xref="GeneID:2896767"
     CDS             complement(697189..698178)
                     /locus_tag="KLLA0_A07821g"
                     /note="similar to uniprot|P41834 Saccharomyces cerevisiae
                     YOR075W UFE1 t-SNARE that resides on the endoplasmic
                     reticulum and mediates retrograde traffic from the Golgi
                     complex potential Cdc28p substrate endoplasmic reticulum
                     t-SNARE coprecipitates with Sec20p Tip1p. and Sec22p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451348.1"
                     /db_xref="GeneID:2896767"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR019529"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ1"
                     /translation="MSNRTELFKKYMQVIAETQGIDDARNELNNTKAREDREKVKEKF
                     SVKDTFVKESKQLMKHIMEFQIVIRQLTPRYESATDMTDQEKDDFDTESKLQLQQYFE
                     KYKQLESYERQRQEMMKEKLEKWSATVPFFSRSIDDVSSFHKVNNQFRMGILQSLNMW
                     LMKISDRLSTIQQTRLSRQRHIEAIDFNAQLHLPEEISVSQSPMITTTVEEIKQYEET
                     MSKLSSEQLQILATEHEELLNLKNEELQKAEALRRTAVDIASLQSELATHLQVQTQNI
                     NTLLDNQTDVEMEMEKGNRQLKQANRKGDRLANMVMWFAIICGLLLLFFDYIN"
     gene            <698626..>699564
                     /locus_tag="KLLA0_A07843g"
                     /db_xref="GeneID:2896417"
     mRNA            <698626..>699564
                     /locus_tag="KLLA0_A07843g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451349.1"
                     /db_xref="GeneID:2896417"
     CDS             698626..699564
                     /locus_tag="KLLA0_A07843g"
                     /note="highly similar to uniprot|P06785 Saccharomyces
                     cerevisiae YOR074C CDC21 Thymidylate synthase required for
                     de novo biosynthesis of pyrimidine deoxyribonucleotides
                     expression is induced at G1/S"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451349.1"
                     /db_xref="GeneID:2896417"
                     /db_xref="GOA:Q6CXJ0"
                     /db_xref="InterPro:IPR000398"
                     /db_xref="InterPro:IPR020940"
                     /db_xref="InterPro:IPR023451"
                     /db_xref="UniProtKB/TrEMBL:Q6CXJ0"
                     /translation="MTLSDENVKRVKLEAVNAEEQQYLDLCERIINEGEFRPDRTGTG
                     TYSLFAPPQLRFNLSNDTFPLLTTKRVFTKGIILELLWFVAGCTDGKKLSEQGVKIWE
                     GNGSREYLDSLGLTDRREGDLGPVYGFQWRHFGAEYKTCDDDYSGQGVDQLKEIIHKL
                     KTNPYDRRIILSAWNPPDFPKMALPPCHVFSQFYVSFPKGEGAKPRLSCVLYQRSCDM
                     GLGVPFNIASYALLTKMIAMVCDMEPGEFIHTLGDAHVYKDHVDALRTQIAREPRAFP
                     KLKIKRNVSDIDDFKYEDFEITDYNPHGKIQMKMSV"
     gene            complement(<699725..>701509)
                     /locus_tag="KLLA0_A07865g"
                     /db_xref="GeneID:2896704"
     mRNA            complement(<699725..>701509)
                     /locus_tag="KLLA0_A07865g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451350.1"
                     /db_xref="GeneID:2896704"
     CDS             complement(699725..701509)
                     /locus_tag="KLLA0_A07865g"
                     /note="weakly similar to uniprot|O00031 Saccharomyces
                     cerevisiae YOR073W SGO1 Component of the spindle
                     checkpoint involved in sensing lack of tension on mitotic
                     chromosomes protects centromeric Rec8p at meiosis I
                     required for accurate chromosomal segregation at meiosis
                     II and for mitotic chromosome stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451350.1"
                     /db_xref="GeneID:2896704"
                     /db_xref="GOA:Q6CXI9"
                     /db_xref="InterPro:IPR011515"
                     /db_xref="InterPro:IPR011516"
                     /translation="MSASSQYDEFQAMLEQQKGIYLQQNSQLAKYNSSLMMKITDMET
                     KVSELVQENVSLRSRLSMGELRYREKLNTVFQTLEDGIVEKFLQMNQLLTTVRESQGL
                     ESGIHDNPLKPILRGSNGISPRSAKKVEFTGANTTTKPVGFEDPIAEDNHENSGNSLE
                     LNDDEVRPLRKRRRKSSRRESLFIPADFEFNDEDPELELNQLPITEDEPPPSTAATSV
                     PEEESQENKHTKEEREDEGKENVSTIPLVPVLPSVTNTGTECSNTNKNNTTEMETALA
                     EDDSYNFTTSVIEYSIPEETSTHEHSHILLETSKSKIDVYNDREETNNNEADDSMNIV
                     QCTIPSQSKIKHSMKHPRTKLKGGQDDIMPHTDYDKDDEKRERRTRGKAVNYKLPSLR
                     AKMRRPTEKLVDATTVTDIHDLQVKRRNNQQQGIPSDDDDQEELLVPAGVPDTNVVIA
                     TVEEENRKEPPALPLHEIHLAQNVKPKIALKELSANAINRKVKTSTAVKAISHTKSRV
                     LKDVKFNTLPTKQQAIENNSSDPNVSDENENSNVKPTRTKQATSDLAAFEIIDGISLK
                     HVSRTHRVRAKEDMNKKRKRIHNDEISI"
     gene            <702046..>702444
                     /locus_tag="KLLA0_A07887g"
                     /db_xref="GeneID:2896437"
     mRNA            <702046..>702444
                     /locus_tag="KLLA0_A07887g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451351.1"
                     /db_xref="GeneID:2896437"
     CDS             702046..702444
                     /locus_tag="KLLA0_A07887g"
                     /note="similar to uniprot|Q759Q6 Ashbya gossypii ADR217C
                     DAD2 DASH complex subunit DAD2 and weakly similar to
                     YKR083C uniprot|P36162 Saccharomyces cerevisiae YKR083C
                     DAD2 Essential protein component of the DASH complex
                     involved in spindle integrity and kinetochore function
                     interacts with Duo1p and Dam1p localizes to intranuclear
                     spindles and kinetochore"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451351.1"
                     /db_xref="GeneID:2896437"
                     /db_xref="GOA:Q6CXI8"
                     /db_xref="InterPro:IPR013963"
                     /translation="MAFETEIETKRRELNYLKHVSALTQKLKAQLDELSVQVAQMNSN
                     AVTVKDVMANWDSVLRSISQASISLLQYTENDYETGKWASKEEHRNQQGAEDESAASE
                     SSEDNQQRQQDQLPPLPETLVRVKVADDVE"
     gene            complement(<702533..>705853)
                     /locus_tag="KLLA0_A07909g"
                     /db_xref="GeneID:2896760"
     mRNA            complement(<702533..>705853)
                     /locus_tag="KLLA0_A07909g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451352.1"
                     /db_xref="GeneID:2896760"
     CDS             complement(702533..705853)
                     /locus_tag="KLLA0_A07909g"
                     /note="similar to uniprot|P36161 Saccharomyces cerevisiae
                     YKR082W NUP133 Subunit of the Nup84p subcomplex of the
                     nuclear pore complex (NPC) localizes to both sides of the
                     NPC required to establish a normal nucleocytoplasmic
                     concentration gradient of the GTPase Gsp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451352.1"
                     /db_xref="GeneID:2896760"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI7"
                     /translation="MKQLFQLRKELSVPAAAPEDSVISAEETTTGSAVTNVQFSNEQV
                     ITENGKYKVSKLAPSLSFLPSNVELCCSVDAKSGYALCCDTDNVYVWPFLSSETHPSF
                     VRIPLHDEEYESWSRPPLCCFTWPSVLERDLKSSPGLFLVNSRSGDIQFYEDVDTVSQ
                     VASFLTQTKRHKSVLKLRDGEYVENLINAEPAGILLSTNYGRVEFCTIRDANGKPFVS
                     LKQTIIKCQVGIFSSMSKSKRVVSLKLGEISGKGERIVSILTQGGRYQVWNLSSVGNC
                     YKKIDLNVQSEISQAVLEHFPLATSTLKLLDCHPLSGDSDAYLFLSFLAESNETHYLL
                     STIIVDEDTNSFAIFSTYRLNTYTRPLSDEFAPRLIVPTAYTKEHLPITSVYTLFSDA
                     AVLTQTSSKLDSNYPFKRKWEDIIRFNKDMKVLGYDCNSSSLYITDGRTCALKLETFE
                     KYENSDFQEIRFIKSHVDQYVYFGGQSTDSLLDFNLPDNLDLQPQEIETDIQMSSDEI
                     KYALSNHIPPVANNPMKHLKIRSELFERLLTFVAHNFLDQTSSQFKLDLISDFEMIKC
                     LESLYSLLPQQPTSISQAWKTVLSESSYQSDSDFISDGIVKIPELLGAFLKHLKDLMK
                     STNETMLKSQIAKLINQLVYHSILEECENSYRYGLFQMSPDDVSKNIPWFTTNSIIEN
                     LNDIFFLLRHASEDLAVVSEFVEELLLLVKSLFYMVRQITMWIDANAITDSSYKQFFE
                     ENHLLWNRVLRDVNRSQDSILITDFYQDFEGLVETLQSLPKITAFSLYDEFFQKYGYD
                     FAKSLFSYYIKEGLWDDLYESFGETHSEYLDQFLGECPEYGKVKWIGNIYCHKYDEAT
                     TTLLSISTGTQSLGQDLKQRQAQLSIAKLTALAAEVQDLEKLNEIQTELDLIDGQILL
                     SQELQESTLNPLFKDFTTYRTLFKYLSDAVKRRESLSVPHMIELFTLLNQDTSYGFAL
                     SILAIDHTLPTEVKKYCEYQIWRRCLLSDENAVRQTLRVFFKQQFYHQSIELPIIDNL
                     ANEKLITDSYLDGMYHGLTDLNKLASDVKREVALFANSNLDVTMLQSIIGEINEETGN
                     QCVINYATNTIETSPTSF"
     gene            <706289..>707323
                     /locus_tag="KLLA0_A07931g"
                     /db_xref="GeneID:2896311"
     mRNA            <706289..>707323
                     /locus_tag="KLLA0_A07931g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451353.1"
                     /db_xref="GeneID:2896311"
     CDS             706289..707323
                     /locus_tag="KLLA0_A07931g"
                     /note="highly similar to uniprot|P36160 Saccharomyces
                     cerevisiae YKR081C RPF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451353.1"
                     /db_xref="GeneID:2896311"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI6"
                     /translation="MIRTVKPKNARAKRALDKKEAKLVENVKQALFIPGQTSTKLLHD
                     SMVDLSALKKPDIKRFSKKNNIRPFEDYEPLEFLSEKNDTSLMVLSTHSKKRRNNLTF
                     IRTFGYKIYDIIELQIAENYKLLSDFRKQTFNVGLKPMFSFQGAAFEQHPVYQHIKSL
                     FLDFFRGQNTTLQDVAGLQHIISITVQGDFQDGEPLPNVLFRVYHLKTYKSEQGGKKL
                     PRVELEEIGPRFDFKIGRIHTPSPEMVKEAHKKPRQLEVRVAKNVEIDTMGDKIGRVH
                     VGKQDLGQLQTRKMKGLKAKYDQVDSDMEEYLEEVEGDLDQENVDDTYGEEFVTATDI
                     DAPPAKKQKK"
     gene            complement(<707461..>708441)
                     /locus_tag="KLLA0_A07953g"
                     /db_xref="GeneID:2896481"
     mRNA            complement(<707461..>708441)
                     /locus_tag="KLLA0_A07953g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451354.1"
                     /db_xref="GeneID:2896481"
     CDS             complement(707461..708441)
                     /locus_tag="KLLA0_A07953g"
                     /note="highly similar to uniprot|Q02046 Saccharomyces
                     cerevisiae YKR080W MTD1 NAD-dependent 5
                     10-methylenetetrahydrafolate dehydrogenase plays a
                     catalytic role in oxidation of cytoplasmic one-carbon
                     units expression is regulated by Bas1p and Bas2p repressed
                     by adenine and may be induced by inositol and choline"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451354.1"
                     /db_xref="GeneID:2896481"
                     /db_xref="GOA:Q6CXI5"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI5"
                     /translation="MSTEKPGRTILASSISKTYVQEITGKVESLRNIRPDGPLLVGFL
                     ANNDPAAEMYASWTQKTCESMGFRYELRRIEDRDFLEEAIIDANQDDSVDGIMIYFPV
                     FGNAQDQYLQQVVSREKDVEGLNHVYYQNMYHNIRYLDDQKQLKSILPCTPLAVVKIL
                     EYLKVYNNLLPEGNRLYGKKCVVVNRSEIVGRPLAALLANDGADVFSVDINNIQKFTR
                     GQGLKFTKHHVEDLGAYSEELLKECCKDADVIITGVPGEKYKFPTDYIKEGAICINFS
                     SEKNFDESVKSKASLYVPSTGKVTISMLLRNMLRLVENKQKLQNRSASTN"
     gene            <709271..>710911
                     /locus_tag="KLLA0_A07975g"
                     /db_xref="GeneID:2896307"
     mRNA            <709271..>710911
                     /locus_tag="KLLA0_A07975g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451355.1"
                     /db_xref="GeneID:2896307"
     CDS             709271..710911
                     /locus_tag="KLLA0_A07975g"
                     /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
                     YOR070C GYP1 Cis-golgi GTPase-activating protein (GAP) for
                     the Rab family members Ypt1p (in vivo) and for Ypt1p Sec4p
                     Ypt7p and Ypt51p (in vitro) involved in vesicle docking
                     and fusion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451355.1"
                     /db_xref="GeneID:2896307"
                     /db_xref="GOA:Q6CXI4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI4"
                     /translation="MAIRSSSSSRIDQSPREMFQRSNSNTSSSPNIVGSLLKSWKKST
                     DSFTDSKKHSSRNSPSARHMSPLRAPSHNGSQTHLHHHNHHLHHTTRDKYFKDLDEDW
                     SAVIDDYNMPIPMINNGGIETTLRPPAVIQDDRAIESQKSSMDSYQGTIPNLNRTISN
                     DLKLQYQIEVEKDVQELNSLMVRIEKFKKLIKPKDSTTQVNLPEIRKLAWNGIPMVHR
                     PVVWKLLIGYLPSNLKRQEQVLNRKRLEYKQGVDHIFSDNHEKDVTTWHQIEIDIPRT
                     NPHIPLYQFESVHNSLKRILYFWAIRHPASGYVQGINDLVTPFFQVFLSEYLSPSAKD
                     DVYSLDPLTYLTAEQLSDVEADCFWCLSKLLEQITDYFIHGQPGILKQVKHLSQLVKR
                     IDCDLFSHFESEHVEFLQFSVRWMNCLLMREFQMSMVIRMWDTYLSETSLETSIVSED
                     LMSDASTSLDRKSRTSSSGPSSSDSRQTTLSEFHVFVCAAFLVKWSDELMKMDFQEII
                     TFLQNPPTKSWKESDIEMLLSEAYIWQSLYKDATSHWR"
     gene            <711231..>712958
                     /locus_tag="KLLA0_A07997g"
                     /db_xref="GeneID:2896780"
     mRNA            <711231..>712958
                     /locus_tag="KLLA0_A07997g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451356.1"
                     /db_xref="GeneID:2896780"
     CDS             711231..712958
                     /locus_tag="KLLA0_A07997g"
                     /note="similar to uniprot|P06779 Saccharomyces cerevisiae
                     YJR052W RAD7 Protein that recognizes and binds damaged DNA
                     in an ATP-dependent manner (with Rad16p) during nucleotide
                     excision repair subunit of Nucleotide Excision Repair
                     Factor 4 (NEF4)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451356.1"
                     /db_xref="GeneID:2896780"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI3"
                     /translation="MYRARSRRNNDGSGVRGPNSALTQFLKEQGISAENIRDRWLEAQ
                     KKEAEHPQETQKDDSETESDEDLKAGVAAKKRSRKPRAVKKQESSSSGESDDDEDDDD
                     EDDDDYKAEARLRRLRGADLEDSDEEEEVLPVSDRKKRMLTLTNGKKTSPQLAKARHQ
                     QKKTRRKKAANLLDKKDSLISSLQDICIKVIGKSIVEYNAQSMVEHIRDTLGGVSLEN
                     LNKLAQALTKNRALNDDTLQLFLNTSLTTLTFYDCSKLSYEGYKRLAIFSPHLESLSL
                     QMCGQLNNEALLYLAEKLPNLKELYLDGPFLINEDTWVQFFELLKGRLTAFHVSNTHR
                     FNDNALSAMLRNCGSSLESLGLATLDTVTNYALLPQYLNSPNFHTLILEEPSRETDIN
                     DEVIISLLGSIGQNLRKLSLNRCTGLTDSCIINGFLPFLSNSGQSILTDLELEELDQI
                     TTDGIVLLFSSLQFPLLKRCSLKRCFALEDAAVVELLLNSSSTLEELNLNGLKSLTSK
                     TFTFMACPNLKQLNIGFVHCVDNEIVEKISKDNEKLTIIEVYGDNQVTGKCSPRNGVS
                     IIGRQSDSI"
     gene            complement(<713019..>714866)
                     /locus_tag="KLLA0_A08019g"
                     /db_xref="GeneID:2896694"
     mRNA            complement(<713019..>714866)
                     /locus_tag="KLLA0_A08019g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451357.1"
                     /db_xref="GeneID:2896694"
     CDS             complement(713019..714866)
                     /locus_tag="KLLA0_A08019g"
                     /note="similar to uniprot|P39682 Saccharomyces cerevisiae
                     YML046W PRP39 U1 snRNP protein involved in splicing
                     contains multiple tetriatricopeptide repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451357.1"
                     /db_xref="GeneID:2896694"
                     /db_xref="GOA:Q6CXI2"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI2"
                     /translation="MFEGLDQTFLKNNDEWVQSYNSVDWNDITTIDKLVVGTEALVQK
                     YNNPNEHVKSNIYKVFDELLGRYPLFFGYWKRYVAVKYQLDGLEGSISTLKASLHSFP
                     TSIDLWIDMLNVYLTHNQNDSELIRNQFRKCESLVGSHFLSHDIWDKHIAYETRLQNW
                     ENVFEVYKQVMQQPLHQYARYYTSFKEFLEYHPEFANRESSIHLDTTFISNQEKVNKI
                     WTYESQIKQPFFNIPELPENEIQNWDAYLSFLINNTEFSTELIKSTFERCLIPCLRYE
                     YFWGAYIDWTERTFGPECTFPLFERALRALPADNKSFKQKYIKYLESNMDPYNKLSSK
                     HYMDALYTFQLKWPHDPSSTIKYLRFHKRRYFAASLNDEDKKILEQQSKYATFLDKTI
                     KAYLSGNADTENHDISQQLLAMLNDTTLPILVVELIKVHWLVLKNVIQCRKHFTYFAK
                     LDPIKTSVLFWLTYYKFEKTQKNIARLTKFVDQLGTEIVLPTKVINDIVRDFQGFYLI
                     NADYSEYETNLSQSRFGFDPIVHNRFKINNPTWRPNAKLTKDWYKSEKYRSNGHPGLF
                     IDKPQIKNTIIETLASKQLNPAPLPTFRNLEKIHQKPKFDDYMSIDYLK"
     gene            <715347..>717176
                     /locus_tag="KLLA0_A08041g"
                     /db_xref="GeneID:2896773"
     mRNA            <715347..>717176
                     /locus_tag="KLLA0_A08041g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451358.1"
                     /db_xref="GeneID:2896773"
     CDS             715347..717176
                     /locus_tag="KLLA0_A08041g"
                     /note="some similarities with uniprot|P47113 Saccharomyces
                     cerevisiae YJR053W BFA1 Component of the GTPase-activating
                     Bfa1p-Bub2p complex involved in multiple cell cycle
                     checkpoint pathways that control exit from mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451358.1"
                     /db_xref="GeneID:2896773"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI1"
                     /translation="MSIRPVVLDDVGETSFEDVESTFTYKDDIEVPRLAPNSATSTTT
                     ENTTFSKDKRYSSHTELASDLDDDMNYNSDFEEYQNGTDLPLAVDRRFRESSDQDELA
                     DLQEQLEKKLSLNLRNSKTGGGSGTRNVDQYINHAGLVRPSLKDSVRQRRSMVDLATR
                     SKGNITSLNSQQSRRVPNSRSYMNLRPSSGRTLSYKSSMPSLMRFNRQDVLLEDEDDE
                     DDDEDEDDEPYPYVPRVRRSYRDLGPRFGERTDDGNVVQDIAVEATEMANNGDDDDDN
                     FGNDFEGIDDNFQFATNNNNNFSAFDPTLRLSPSEYDIEHDDTLLTPQLHKKHYAFDA
                     PLDSYREARQQRGTAKQAAAAAAVNRRNSTRARARLKTIRQEIDLNTPLKRGKMKYNP
                     REKRWDGNEDILSSFDNIENVDRKAFIIKNKRSKSPLKTSSSTQIAASGTNAASSNSQ
                     HGKVVGKMRFDEKNLRWLRVDGTEEDPFHGITDLMPRSQSSPTKNVKFQSQGHSGNIL
                     RSQSQLPFGRDEHGNRFISSESTRFHSLTTNSTTDPTYQITSKQLEKFYHEENKWSRK
                     VGGWFILGDKSRDTGSADQSHTSLNDKSYMYEIRNMVISSARN"
     gene            <717703..>719253
                     /locus_tag="KLLA0_A08063g"
                     /db_xref="GeneID:2896363"
     mRNA            <717703..>719253
                     /locus_tag="KLLA0_A08063g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451359.1"
                     /db_xref="GeneID:2896363"
     CDS             717703..719253
                     /locus_tag="KLLA0_A08063g"
                     /note="some similarities with uniprot|P47114 Saccharomyces
                     cerevisiae YJR054W Vacuolar protein of unknown function
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451359.1"
                     /db_xref="GeneID:2896363"
                     /db_xref="UniProtKB/TrEMBL:Q6CXI0"
                     /translation="MFDNDRKLDLNSKTFDVLDLELFKNYRFKTVVSYVFIFWGLTIL
                     KVVLFASDIYTCIKLLAFNSWSNNIIKPYLSFKISKWLFSGCILASIALMLWEVINGI
                     RIYRTRSIALTYVNNFSRMVNSITNYNIFCVYNKITPKGRFQKISFYTFFEFKDCVRL
                     LFTDTPRQVINGLTLWSVLVTNNNGANLGQLENFDGLITKIKIIADTNHQEAVLLSFM
                     LLSFAIWTVFMAKLIVAVIFAPFVYHTIYSNYSVRGLKELVCTTVNKRVDELVEKYKW
                     KKDQKTALQKGLIDGITVPSFDDIEKSTTNDTQFHFDYTSRGTSNTLAMSNYKLGNSS
                     TSDQLSRKFVPVPFTSVINQDADRSTEFLPPPRTVFPSQLGSRPKPNSEPTLAPAVNP
                     FRSKPLNETTDSLDSTLNGSNVESAFNSKRTFVKQLTLEKTDSDPDFGQKINDIVDDY
                     GDDTESLLVPHNPFSSSKSHVTTPDRVYFNDDTPLPARSTSIMDRRLRMETEDYAVYA
                     ERFNMSRR"
     gene            719495..719566
                     /locus_tag="KLLA0_A08085r"
                     /db_xref="GeneID:2896362"
     tRNA            719495..719566
                     /locus_tag="KLLA0_A08085r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2896362"
     gene            complement(<719825..>720982)
                     /locus_tag="KLLA0_A08107g"
                     /db_xref="GeneID:2896378"
     mRNA            complement(<719825..>720982)
                     /locus_tag="KLLA0_A08107g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451360.1"
                     /db_xref="GeneID:2896378"
     CDS             complement(719825..720982)
                     /locus_tag="KLLA0_A08107g"
                     /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
                     YML048W GSF2 ER localized integral membrane protein that
                     may promote secretion of certain hexose transporters
                     including Gal2p involved in glucose-dependent repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451360.1"
                     /db_xref="GeneID:2896378"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH9"
                     /translation="MEVYVRMNDDLEYDYAFQVQKDDTLEQKIALIFNKEKGLSRFMV
                     LKPSIFYKNEPSGFRKSMHPGFLTENGCLLFDYSADDSEYLEDLEVSKKTVWEQLWPG
                     QLVLPKWEKDWKTIWTFVTIMLVWLYTDLPDCISPTPGICLTNQLSKRFASLADNAGL
                     TFVAEKLREELEINSVSVTAQWLFFVFHIVKIVILSSFFYTGLVNPVSFNPLRSLLNK
                     KSAISNGNSELKSTLQTIGWVGARRAIYDDYRDKYYQYVIDKSGGPLHAYRKGIMKQA
                     ANPGVTLSAGEGFQTELSNRFNHNTFETMKSSGKFKLSEDYFLQLETDLKENIKACDG
                     DVAKINAEIRNFRKYGLFECGPELTELVQLRKKVDAAPETEPLPEQEKKEQ"
     gene            <722217..>726026
                     /locus_tag="KLLA0_A08129g"
                     /db_xref="GeneID:2896375"
     mRNA            <722217..>726026
                     /locus_tag="KLLA0_A08129g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451361.1"
                     /db_xref="GeneID:2896375"
     CDS             722217..726026
                     /locus_tag="KLLA0_A08129g"
                     /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
                     YML049C RSE1 RNA splicing and ER to Golgi transport
                     involved in secretion and RNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451361.1"
                     /db_xref="GeneID:2896375"
                     /db_xref="GOA:Q6CXH8"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /translation="MTQDSEVLLWHTVLQRHRNYVHSCIGDFTLDRSSLATAEADTTS
                     VKGPRSSKKRKELQLCLATQDCVELYDVSNGTLDALGKWPIAATILSMTKLNMDRCSH
                     TILVLITDSGNLTFWQFERDSVSGKVYVRTLANEPISRSGIRRFVPQYQMVSDPQSRC
                     VFFSGIERSKMCVLADWQRGKLVVGSPIEIQRSDRITLASAACDVSFDNPVNAAIEVE
                     SGTNDYYLSFYTMDLGLNTLLLRKEHLLEDKSINFVMQCPNLQQYKIKTRPNDETDQD
                     SVNPFVICGYDGYLTLIDLEGFYEVSVQLPVRKTVSSTNIINGTIHKLKKDFFILMQS
                     NHGDMYKVGIIPDEETKAPVLEIAYFDTLPTSEDIHIFKSGALFNVSEFGTSYLTQFE
                     SLGEDLEKITSYTPGRRSFIETESTLKNLSILDSLTSLNPLTSFHASNSTPLTILAAA
                     NQTENLVKLTSAVDFEELISTTLPRIPSKLWTVRIPKNETHSLIFLSMETSTTILKIH
                     EGTVEDFGGDSNPFILNKPSLFVGAMVQRSIIQVTRDCLLQIIEMHDGPYTKKLEWYP
                     PAGVGIVTAFCNETQLVVALTNHEICYFEIIEDSLNELQDRVEMDSTVNSIALLAGQK
                     SGYCVLGCEDSSLQILNLQSKHPDFFTICAIQSLISKPHSLLFMRDTSDLKIHVGMKS
                     GVYLSSKLNINDGTVFDVRTRFVGTKPVQVNLLDNIDINHKDDDDDEPGENDSKIDDF
                     KKKISDFTPLVVLNSSISWVTYEIDDKITLRPLKTDEGITLKHINAFITDDIKRNGCC
                     SITSKGQLLIGKLDNFLSWSNWFNEKKYTLVNDELKNAGNEEEDEDEDEDEDEDASEK
                     YEIVGYQSQRILSDTTDNSLSYVISKTANKETSLSAIRDDKLLATNNGNTVVIIAKEV
                     FNAVCSCNFGTNVKYIVISTESGKFIVIQIRVKNNVLETQYIHETMVHSKVNAMVSFG
                     DKLACCILGNVVLFGLGKKQLLRKSITEMPPYITQVTALDQWDGTMLAVGDIRESVTI
                     FKYDIDNNSFIGVADDIVKRHVTTVKFIDVSSVIGGDRFGNCWVLRVNYESDTRVASN
                     IKACQYTLETLCHMYMNDTPMKFEIVNHMNMSDRPAILWIGLQGTIGCFVPLITRKEQ
                     QLYQSFQSTYAELDVLHFQDNNKPEEVDLEETEGALDEAYHTTKNTDHQDYVEGVISR
                     VGRDFLSYRSSYAPSKNIIDGETLEQLTTYLPSDQRWIASKMKHADSGKLDIFNKYIN
                     EMRTNYV"
     gene            complement(<726017..>726985)
                     /locus_tag="KLLA0_A08140g"
                     /db_xref="GeneID:2896388"
     mRNA            complement(<726017..>726985)
                     /locus_tag="KLLA0_A08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451362.1"
                     /db_xref="GeneID:2896388"
     CDS             complement(726017..726985)
                     /locus_tag="KLLA0_A08140g"
                     /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
                     YML050W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451362.1"
                     /db_xref="GeneID:2896388"
                     /db_xref="InterPro:IPR009737"
                     /translation="MNLYSYSRIIKFPGHNALVLKRLFHRPYQFKSVPDDIKNNLVTE
                     CECFVKRLNEKLPDKSQLDISLTLPNKVPEYHKHVLMLSKDPKGWKNWPSKLEMAHEY
                     PHSMVGTLKSSLKDTRDGSGVLVNELALDGYTSSETHLKFLVIPDMKVYEVHRDRVSD
                     FALFLGDGKQDSRKKLSFNDFLKGSDAVGQTAIHSSGSVANSIPNFQSEPFHSDIAMV
                     CGHYLRDARCGELAPLLIAKLNSIKPNLKTGIVSHFGGHKFAGNLIYYQFNGLKIHND
                     NETGKIDGLWLSKLLPQNLEFVFRHLDKDIILQDFYRGHMSTAAYT"
     gene            complement(<727416..>728789)
                     /locus_tag="KLLA0_A08162g"
                     /db_xref="GeneID:2896324"
     mRNA            complement(<727416..>728789)
                     /locus_tag="KLLA0_A08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451363.1"
                     /db_xref="GeneID:2896324"
     CDS             complement(727416..728789)
                     /locus_tag="KLLA0_A08162g"
                     /note="uniprot|Q06433 Kluyveromyces lactis KLLA0A08162g
                     GAL80 Galactose/lactose metabolism regulatory protein
                     GAL80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451363.1"
                     /db_xref="GeneID:2896324"
                     /db_xref="GOA:Q06433"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="PDB:2NVW"
                     /db_xref="PDB:3E1K"
                     /translation="MNNNKRSKLSTVPSSRPIRVGFVGLTSGKSWVAKTHFLAIQQLS
                     SQFQIVALYNPTLKSSLQTIEQLQLKHATGFDSLESFAQYKDIDMIVVSVKVPEHYEV
                     VKNILEHSSQNLNLRYLYVEWALAASVQQAEELYSISQQRANLQTIICLQGRKSPYIV
                     RAKELISEGCIGDINSIEISGNGGWYGYERPMRSPEYLYDIESGVNLISNSFGHTIDV
                     LQYITGSYFQKINAMISNNIPTQFLLDENGKRTKETISKTCPDHLLFQGILENGKVPV
                     SCSFKGGTPVKKLTKNLVIDIHGTKGDLKIEGDAGFVEISNLVLYFYGIKNGNGSSNG
                     TDNNGAAAIKDKEKVTKSPSPSTGTSEEEQTMEVFHLRNYNSVVGNILRIYESIADYH
                     FLGKPESKSSRGPDDLFASTKFDKQGFRFEGFPTFKDAIILHRLIDAVFRSDKEEKTL
                     DVSKIMI"
     gene            complement(<729440..>730312)
                     /locus_tag="KLLA0_A08184g"
                     /db_xref="GeneID:2896401"
     mRNA            complement(<729440..>730312)
                     /locus_tag="KLLA0_A08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451364.1"
                     /db_xref="GeneID:2896401"
     CDS             complement(729440..730312)
                     /locus_tag="KLLA0_A08184g"
                     /note="similar to uniprot|P54003 Saccharomyces cerevisiae
                     YML052W SUR7 Multicopy suppressor of rvs167 mutation
                     putative integral membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451364.1"
                     /db_xref="GeneID:2896401"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH5"
                     /translation="MSAVGSILTKFVSLLFLMGSTMLLIFIVLSGSIEHSPVNEFYWL
                     QADTSNITGAPALSRWTFWGLCGVSGNKNVNCSSLEPAYPLSPVDDFGTTEGFPSDFV
                     NNRDTYYYLTRFSFCFFLIALVFIGVGLIFYVLSWCSYSFTKTVFVTIVIGTLLNMAA
                     SACQTAATVLAKNAFKDADVSVDIGVKLMAFSWTTVALNIMLFFITGASFIRKAYKAH
                     KEFVELQNYKEQALSYEQQQQQLQFQQQQQQQDLEATGAGTAIDEPQPQESHQTGIKF
                     FKIRRTQKSDEESI"
     gene            <730940..>731632
                     /locus_tag="KLLA0_A08206g"
                     /db_xref="GeneID:2896411"
     mRNA            <730940..>731632
                     /locus_tag="KLLA0_A08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451365.1"
                     /db_xref="GeneID:2896411"
     CDS             730940..731632
                     /locus_tag="KLLA0_A08206g"
                     /note="some similarities with uniprot|P53907 Saccharomyces
                     cerevisiae YNL144C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451365.1"
                     /db_xref="GeneID:2896411"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH4"
                     /translation="MYIYIYRYRYIARTYPCPLPCCTCPTADQQHQTPTMEPLPPYTP
                     SLQISFLLQTQFEHSHRWTPHCVEINSTQLLIRPLIHSHDEKLINKWYSKLDELEYKQ
                     YKATSNHQLCHDQLVQSTQVPNQRDHIVLCTAKGLYLEKDKSLNLIQWNRDPIKKYSL
                     QDCRIGLNTDMSRCLRIRCEREQFLLRVPDDASVTSLFAKIACAAELAVPMDSKSHDP
                     LPLKLMPWEDVM"
     gene            complement(731744..731842)
                     /locus_tag="KLLA0_A08228r"
                     /db_xref="GeneID:2896415"
     tRNA            complement(join(731744..731780,731803..731842))
                     /locus_tag="KLLA0_A08228r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2896415"
     gene            732629..732700
                     /locus_tag="KLLA0_A08294r"
                     /db_xref="GeneID:2896816"
     tRNA            732629..732700
                     /locus_tag="KLLA0_A08294r"
                     /product="tRNA-Gln"
                     /db_xref="GeneID:2896816"
     gene            <733200..>735302
                     /locus_tag="KLLA0_A08316g"
                     /db_xref="GeneID:2896736"
     mRNA            <733200..>735302
                     /locus_tag="KLLA0_A08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451367.1"
                     /db_xref="GeneID:2896736"
     CDS             733200..735302
                     /locus_tag="KLLA0_A08316g"
                     /note="similar to uniprot|P32340 Saccharomyces cerevisiae
                     YML120C NDI1 NADH:ubiquinone oxidoreductase transfers
                     electrons from NADH to ubiquinone in the respiratory chain
                     but does not pump protons in contrast to the higher
                     eukaryotic multisubunit respiratory complex I which is
                     absent in S. cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451367.1"
                     /db_xref="GeneID:2896736"
                     /db_xref="GOA:Q6CXH2"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH2"
                     /translation="MFATGISKGLIGVALPIRSIHGSMRGPIQTVNKLPLRAVCLASF
                     KPSVRNFHVSSCLRSEIEQEKSTPPVGLVKTSGFTSKLGKLVKWSIFTAGIVASGVGA
                     IIIGFFIYDSTTYKSCGTAVEIKVPKLALNPELGGPENLPILRETLDAYDSEMKELTS
                     YKPKLVVLGSGWASVGLLKNLNPGDYDVTVVSPQNYFLFTPLLPSAATGTLEVKSLMA
                     SIRKIVNDVNGHYLEAYAEKVEFDEKLIKVSQINTKTGAKDSFYLPYDKLVIAVGSTS
                     NTHGVEGLQYCSRLKTAEDAITLRKKIKTLLERACLPTTSDEERRRLLSFVVCGGGPT
                     GVEFAAEVFDLLNEDLPSMYPRILRQQLSVHVIQSRSNILNTYDEKISEYATQRFRKE
                     TIDVLTNSRVERILPDRVIFKQKDDKTGEVELKEIPFGICLWSTGVSQNPLTKQVVHS
                     LAHSQRNKRAIETDSYLRVIGAPTEDVYAIGDCSTVRTDLADHTADYIRRFIVNRHLS
                     LTRSNEIITDEDIKHLSLSYNEIIDIAKQVARRHPQTREHLIHLEDDLPKYDVNKSGQ
                     LNFDQISTLLREVETKVTSLPATAQRAHQQGKYLGKKLTKVARSANKDSIQGIHEKGI
                     DEKVYRPFRYVHLGSLAYIGNSAVFDLPGYSFVGGLIAMYLWRSIYFAQTVSWRTRVL
                     LFMDWLKRGMFGRDILSE"
     gene            <736461..>738761
                     /locus_tag="KLLA0_A08338g"
                     /db_xref="GeneID:2896782"
     mRNA            <736461..>738761
                     /locus_tag="KLLA0_A08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451368.1"
                     /db_xref="GeneID:2896782"
     CDS             736461..738761
                     /locus_tag="KLLA0_A08338g"
                     /note="similar to uniprot|P39684 Saccharomyces cerevisiae
                     or to YHR015W uniprot|P38760 Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451368.1"
                     /db_xref="GeneID:2896782"
                     /db_xref="GOA:Q6CXH1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH1"
                     /translation="MSFEAESSLTLSDIPLNIQRNNNIHHHGNSKYSLVKGLMGKTVK
                     NERCNSKKEEENTAEQSDDDEDDENNNGNSSNNHHQHHGRGEKSYQHQNQLHSATDSR
                     GSSSTDTTSTGSDVVNLSNSKHSTQQTNTMKSEKQTALFIGDLPGNVTEDMLHNIFNK
                     FKSFNSVKICVDSNTKKSLGYGYLNFGDPKDAENAVDEYNYMPIFGREIRMMPSLRNT
                     YFRKNIGTNVFFSNLPLDNTKLTTRVFYDEFKKFGKILSCKLDRRKNIGFIYFENDAA
                     AKEAIKQYNGKEFFDSTIMCGVHFDRNVRKSPEFEQKINRINNLTVVKEKLEMEDDNN
                     VTTDPSENGKKDVVAGNDTDDDDDDKAVGNATKSLVEETNKESKNTKLPHPNAIFVKN
                     LPINPSHDNLLNFFSKIGPVKSVYTSDVSKFDSSWAFITYKRIQDTKTAIEKLNGCKY
                     MKRTIEVKKTERHHLEESQFENNTRPNNYKKTVFLTNLSVICNEEFLNFLCGQERIKT
                     ERVVVRYYEEKTDTYSGYVRCASRNDAQRLFELMENKLLGDSEVKASWQQPKDVKLIE
                     VEPSYRNHDNNGNTSNDRRSRGSKHGYVYRAPAPNYRPPKNVRNFNKPSGSRVSQNPQ
                     MIYHHPNPYHQLQQQHYIGNIHQPMVPRAAAVMGDSSINKGVGIGISIEEPSRKAYSY
                     EAKKQLITMLKKETKRCIDFLQHPVATRDENVSTIASYIMDVYYKPNYDTLAQLLLLK
                     TGNNYYERVFQSQVELAIEKLGLQER"
     gene            complement(<739092..>740764)
                     /locus_tag="KLLA0_A08360g"
                     /db_xref="GeneID:2896733"
     mRNA            complement(join(<739092..740316,740718..>740764))
                     /locus_tag="KLLA0_A08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451369.1"
                     /db_xref="GeneID:2896733"
     CDS             complement(join(739092..740316,740718..740764))
                     /locus_tag="KLLA0_A08360g"
                     /note="similar to Saccharomyces cerevisiae YFR024C-A LSB3
                     or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
                     YHR016C YSC84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451369.1"
                     /db_xref="GeneID:2896733"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:Q6CXH0"
                     /translation="MGINNPIPRSLKSETKKAAKVLASFVKPNQVLSANDVIPPEVLK
                     SAKGLAIITVLKAGFLFSGRAGSGVIVARLPDGGWSAPSAIAMAGAGAGGMVGLELTD
                     FVFILNTADAVKSFSQFGSITLGGNVSVAAGPLGRNAEAAASASTSGVAAIFAYSKTK
                     GLFAGVSLEGSVIIERREANRKFYGNNCTAKMILSGRVRPPPSVDPLFRVLESRAFNY
                     RSPRGDNYDDDDDYDEDEDGEYYNDIPSSFDSDDLDSQRPNTRSTRRRANSYRSTTSD
                     DSDDYLDEDEERYSSSRYSRRQGPSSNSRWEDEVYDLNDRFERTNLNTRNARGGPSRP
                     KSEKPDFGSSSFSRGSPRGNSSANSPARNSGAPKAVALYTFKGEESGDLPFRKGDVIS
                     IIKKSESQDDWWTGRVNGKEGIFPANYVELV"
     gene            <741712..>742857
                     /locus_tag="KLLA0_A08382g"
                     /db_xref="GeneID:2896718"
     mRNA            <741712..>742857
                     /locus_tag="KLLA0_A08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451370.1"
                     /db_xref="GeneID:2896718"
     CDS             741712..742857
                     /locus_tag="KLLA0_A08382g"
                     /note="similar to uniprot|Q757L8 Ashbya gossypii AEL018C
                     AEL018Cp and similar to uniprot|P32792 Saccharomyces
                     cerevisiae YHR017W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451370.1"
                     /db_xref="GeneID:2896718"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG9"
                     /translation="MSDQVLDYCFGAYKHTVDAVCNSGKNTVDLAKGLVKKTKSLYDK
                     SLKGLSDEELANLYEDPAIHSESTSNMFSKMGNRVWAHRGLLLVGVGLTSAGLLLYSS
                     THYLMNALPTHLTDDNQVLLVLGDIRDPVVRNQVNELYRRRFIVFVCKRKLKYGTGEP
                     EDDFTIDDLTSDDGGIFYIDADSSGLASFIQYMNDHSEKQLRSILFMPNLSYYPSGNT
                     LSSKLVTNEVQENILNYYGVLEKLIPHFAGNAFKKLQLIFFNPSLSKNLQLKHHSVEH
                     LVSGLISTFYETMKIEYSHQCDVYMCHIGILGIGGNASTFKYLSVKGSNISKSLCEPI
                     YQLILSRDYMWLRLKRWLSGSILYCGKGSALTSWLGYLCPLWLLDLF"
     gene            complement(<743192..>744577)
                     /locus_tag="KLLA0_A08404g"
                     /db_xref="GeneID:2896396"
     mRNA            complement(<743192..>744577)
                     /locus_tag="KLLA0_A08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451371.1"
                     /db_xref="GeneID:2896396"
     CDS             complement(743192..744577)
                     /locus_tag="KLLA0_A08404g"
                     /note="highly similar to uniprot|P04076 Saccharomyces
                     cerevisiae YHR018C ARG4 Argininosuccinate lyase catalyzes
                     the final step in the arginine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451371.1"
                     /db_xref="GeneID:2896396"
                     /db_xref="GOA:Q6CXG8"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR009049"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="InterPro:IPR029419"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG8"
                     /translation="MAEKQKLWGGRFTGETDPLMHLYNASLPYDYKMYKADLEGTKVY
                     TSGLQKIGLLTEDELSKIHAGLKQIEQEWSDGSFVREADDEDIHTANERRLGEIIGRG
                     IAGKVHTGRSRNDQVATDMRIYCRDILNGTVLPALSSLIKVILQRAEEEIDVLMPGYT
                     HLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSPLGAGALAGHPYGIDREFLA
                     AGLNFNGVIGNSLTAVADRDFVVEIMFWGSLFMNHISRFAEDLIIYSTAEFGFIQLSD
                     AYSTGSSLMPQKKNPDSLELLRGKSGRVFGQLAGFLMSIKSIPSTYNKDMQEDKEPLF
                     DCLTTVEHSILIATGVISTLAIHKEKMEGALTMDMLATDLADYLVRKGVPFRETHHIS
                     GQAVALAESLNVSGIDKINLQQYKSIDERFEQDVFEVFNFEKSVERRDATGGTAKVAV
                     LKQLKNLASQL"
     gene            complement(<745048..>746712)
                     /locus_tag="KLLA0_A08426g"
                     /db_xref="GeneID:2896402"
     mRNA            complement(<745048..>746712)
                     /locus_tag="KLLA0_A08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451372.1"
                     /db_xref="GeneID:2896402"
     CDS             complement(745048..746712)
                     /locus_tag="KLLA0_A08426g"
                     /note="highly similar to uniprot|P38707 Saccharomyces
                     cerevisiae YHR019C DED81 Cytosolic asparaginyl-tRNA
                     synthetase required for protein synthesis catalyzes the
                     specific attachment of asparagine to its cognate tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451372.1"
                     /db_xref="GeneID:2896402"
                     /db_xref="GOA:Q6CXG7"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG7"
                     /translation="MSVYVNEFSGVDESTVAGTEQQPFKTAAFALYSKAESEPKEIYV
                     FKKEDDGAEGAYVEISASALKKAKKGVEGLKKKAAKQKELEQKQQEQEAKNAAKKLEA
                     MNITIEEDLSLPKAERRKIRSAYDAVDKRVKVSGWVHRLRNNKSVVFIILRDGTGFLQ
                     TVLTGDLARSYQIVNLTLETTITLYGTIKVVPESKSAPGGVELFVDYFEIVGPAPSGE
                     NAFTNRVQENADPSILLDQRHLMLRGETLSAVMKVRAALMKSIRRVYDEEGLTEVNPP
                     CMVQTQVEGGSTLFKLDYYGEEAFLTQSSQLYLETCLAALGDVYCIQESFRAEKSHTR
                     RHLSEYTHIEAELCFLDFDDLLSHIERVITKTIQYVLEDPVAGPLVKKLNPNFQAPQL
                     PFKRMEYKDAIEWLKEHGIKNEEDKEFQFGDDIAEAAERKMTDTIGVPILLTRFPLEI
                     KSFYMKRCDDDKRVTESVDVLMPTVGEITGGSMRIDDTEELMAGFKREGIDPAPYYWF
                     IDQRKYGTCPHGGYGLGTERILAWLCDRFTVRDCSLYPRFSGRCKP"
     gene            <747134..>749152
                     /locus_tag="KLLA0_A08448g"
                     /db_xref="GeneID:2896380"
     mRNA            <747134..>749152
                     /locus_tag="KLLA0_A08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451373.1"
                     /db_xref="GeneID:2896380"
     CDS             747134..749152
                     /locus_tag="KLLA0_A08448g"
                     /note="highly similar to uniprot|P38708 Saccharomyces
                     cerevisiae YHR020W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451373.1"
                     /db_xref="GeneID:2896380"
                     /db_xref="GOA:Q6CXG6"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG6"
                     /translation="MSLEETFSKLQINASDDAVVVKSLVFKPKTPKSQTPVPIVVVAL
                     HSTTTPSGLIASVTSTKDPRLARDELFQSQFKIQSGKEFHLGHLAQAEGAFKLLLDQQ
                     LVALADDTVLQLNDEKFVKKSDLIGKYLNSFEPLEVDFSQVVEVAKKEASAPAPAKSA
                     ASLEDAKLIGVTVDKALDFSGWYQQILTKGEMLDYYDVSGCYILRPASYAIWEQIQRW
                     FDDRIKGLGVQNAYFPMFVSSRVLEKEKDHIEGFAPEVAWVTRAGTSELDEPIAIRPT
                     SETVMYPYYAKWIQSYRDLPIKLNQWNSVVRWEFKHPQPFLRTREFLWQEGHTAHLTK
                     EAAEEEVMQILDFYAGVYEELLAVPVVKGRKTEKEKFAGGDFTTTCEGYIPQTGRGIQ
                     GATSHHLGQNFSKMFNISVENPLGSEHPKIFAYQNSWGLSTRVIGVMVMIHSDNKGLV
                     IPPRVSQFQSVVLPVGITTKTSDEQRAKIHENARAIESRLKKAGIRAFGDYNDNYTPG
                     WKFSQYELKGIPLRIELGPKDLEKEQVTCVRRNDGKKIVVSLNDLEKRIPEILEELQQ
                     DLFNKAKELFDTHRVIVDEWKDFVPALNKKNVILSPWCGVEECEEDIKDASAKKDDGE
                     EIEVDDKSPSMGAKSLCIPFNQPTLKPGQKCVKCTRLAKTYCMFGRSY"
     gene            complement(<749442..>750446)
                     /locus_tag="KLLA0_A08470g"
                     /db_xref="GeneID:2896845"
     mRNA            complement(<749442..>750446)
                     /locus_tag="KLLA0_A08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451374.1"
                     /db_xref="GeneID:2896845"
     CDS             complement(749442..750446)
                     /locus_tag="KLLA0_A08470g"
                     /note="similar to uniprot|P38635 Saccharomyces cerevisiae
                     YFR025C HIS2 Histidinolphosphatase catalyzes the eighth
                     step in histidine biosynthesis mutations cause histidine
                     auxotrophy and sensitivity to Cu Co and Ni salts
                     transcription is regulated by general amino acid control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451374.1"
                     /db_xref="GeneID:2896845"
                     /db_xref="GOA:Q6CXG5"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG5"
                     /translation="MYSHHSHSGDYVAHGVDPLEDIITEVKRRKFHTWCMTEHMPRLE
                     LELLYPEEKTNESSTEEDLKILVKKFEAYMIHAKRIKDRETASENGLHILIGFEIEGC
                     DLEHMRYANELLRRNNNVLQFMVGSVHHVHNIPIDFNQEKWNEALKVSGNNLRQLLYD
                     YFTIQRKMLETTQPLVVGHFDLIRLFLPDDMRVDLESGQVLSEGGTLVKDLESVMTQW
                     SDVKQLIVESLKYVVSYGGVVEINSAGLRKGKVDPYPHRDIVNLSKEVTPSIRYVTSD
                     DAHGVSQIAVCYDEMLNYIENVVQLKQISYLEEQDDGNIQIKDIFVEEVKRSEFWSIK
                     "
     gene            <751047..>752168
                     /locus_tag="KLLA0_A08492g"
                     /db_xref="GeneID:2896313"
     mRNA            <751047..>752168
                     /locus_tag="KLLA0_A08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451375.1"
                     /db_xref="GeneID:2896313"
     CDS             751047..752168
                     /locus_tag="KLLA0_A08492g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451375.1"
                     /db_xref="GeneID:2896313"
                     /db_xref="GOA:Q6CXG4"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG4"
                     /translation="MAKVVVVGAGISGLSVAHSLLELYGRDKIEELVIIARDIPGTFT
                     SYDYTSPWAGANWDSFAAPDDHAQIKRDTVTYEWFTELARSKPETGVKEYTLKLVTRK
                     ETIPWFVRDNFVRDLKQMSEEELKYRNLDPQDYHGFEFTTFTVTPSTYKFWMVNEIKK
                     MGGKLRQLAKIDAIENIPEIVGFVPDLVINATGVHAGQFLRHYEPSEVEKVYPVKGQI
                     VQIYEDLPFQIVVEPLPKDDNPASDQFLNMFPRGDGGCIIGGIMRKNDWSNTVDDELT
                     KKIVEVCKRHTPELKNPTIYNSYVALRPGRKDGVRVEYSEFDLPKNQGKLKVIHNYGI
                     GGAGYQASRGLALEASALAAANVLGLPKFISRKACPYKL"
     gene            complement(752342..752414)
                     /locus_tag="KLLA0_A08514r"
                     /db_xref="GeneID:2896778"
     tRNA            complement(752342..752414)
                     /locus_tag="KLLA0_A08514r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2896778"
     gene            <753262..>754161
                     /locus_tag="KLLA0_A08536g"
                     /db_xref="GeneID:2896716"
     mRNA            <753262..>754161
                     /locus_tag="KLLA0_A08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451376.1"
                     /db_xref="GeneID:2896716"
     CDS             753262..754161
                     /locus_tag="KLLA0_A08536g"
                     /note="some similarities with uniprot|P25587 Saccharomyces
                     cerevisiae YCL005W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451376.1"
                     /db_xref="GeneID:2896716"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG3"
                     /translation="MGLLALAETSLGFITRILATLYLYTLQLMMSTVYMSVRTVHKVV
                     IHPVKRIIHYVVVIPSEIIFRNLAALVLLPINIPLYILFGSSVKSLYHSFDANATTFG
                     VIMLSQYVLSMLILGFTLGIMTGVFLSSFHKFVPIPNIYWEPSIGGFIESIKGLLFSR
                     PTESPREHPYRVPIPRLSTKRQSNMPDSSLYTDANVDAAASAAVSSILETASDLDLDL
                     MPHHQPDIGNMTPLSLPDTNEDSDQELGSDEDLSEMSRFWGNEQGYGVDTIRTEMTDD
                     INHLIYRNRIKKDAENVVDIRNL"
     gene            complement(754348..754419)
                     /locus_tag="KLLA0_A08558r"
                     /db_xref="GeneID:2896312"
     tRNA            complement(754348..754419)
                     /locus_tag="KLLA0_A08558r"
                     /product="tRNA-Arg"
                     /db_xref="GeneID:2896312"
     gene            <754857..>756479
                     /locus_tag="KLLA0_A08580g"
                     /db_xref="GeneID:2896309"
     mRNA            <754857..>756479
                     /locus_tag="KLLA0_A08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451377.1"
                     /db_xref="GeneID:2896309"
     CDS             754857..756479
                     /locus_tag="KLLA0_A08580g"
                     /note="uniprot|Q874C6 Kluyveromyces lactis PGS1
                     CDP-diacylglycerol-glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451377.1"
                     /db_xref="GeneID:2896309"
                     /db_xref="GOA:Q6CXG2"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG2"
                     /translation="MFHRLRSGIERLTCLPVWSNTYKRPVNTRPIVESVKSVSMATVT
                     EESDQQVRKLKLTGQDGNGFLDMVKEKLSFLNTKVYLRQGEVEILDHPVQFYSTLKNK
                     ISAAQNRVFMASLYLGKTENDLINCISDSLKKNKDLKVYFMVDGLRGTRETPNKCSAS
                     LLAELEKEFGERVEIRLYRTPEFVGWKTLIPKRFNEGLGLQHMKIYGVDEEVILSGAN
                     LSNDYFTNRQDRYYVFKNKFLSDYYFKVHQLVSKISYRVRHANNEQKYHLEWPESNVA
                     VEPLKDKHKFIEKCSSIFTDFLRGPSSMGNAHLIKDFSQYPTIVYPVSQFTPLFQPHH
                     DVSTEKPGVLSILSCLSNPMSRWTFTAGYFNMLPEIKQRLLDSPSIQGQVITASPYAN
                     GFFQSPGVSGHLPDAYLYLSQGFLKDVHRHGKENHIKLREWKHGIVNQANGWSYHAKG
                     LWLSEPGNDKRPCLTIVGSSNYTRRAYSLDIETNAIVLTKDEQLKTAMQNEIDNLLKN
                     TKEVTLGSFEEDPDRHISTGVKLATKILGNRL"
     gene            complement(<756584..>757493)
                     /locus_tag="KLLA0_A08602g"
                     /db_xref="GeneID:2896755"
     mRNA            complement(join(<756584..757326,757472..>757493))
                     /locus_tag="KLLA0_A08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451378.2"
                     /db_xref="GeneID:2896755"
     CDS             complement(join(756584..757326,757472..757493))
                     /locus_tag="KLLA0_A08602g"
                     /note="similar to uniprot|P25565 Saccharomyces cerevisiae
                     YCL002C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451378.2"
                     /db_xref="GeneID:2896755"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG1"
                     /translation="MFQRGCKFGVLYQKRYDRLHKSIYGLSYDMYALDIISRLMMIYI
                     SLQYMFSPLIRKQLANRFPLFYPLDGQKVVVNFFLLMAETGMIYFNLKVMKQLINYRK
                     TKHIHQGFSVYLFWTLALCMVFHVFTLACSTVYLPESDMGKFGIFYVEHVNYIWVNVQ
                     FFQCVKFVPQISLNWMGNCTKGLSSKFVIMSLVSSVAGVLSLYVNSTDATNFFLVPWN
                     SYPLFVFICQTMSVLLILYQAQYLYIKNSPYLPKRT"
     gene            <758042..>758590
                     /locus_tag="KLLA0_A08624g"
                     /db_xref="GeneID:2896414"
     mRNA            <758042..>758590
                     /locus_tag="KLLA0_A08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451379.1"
                     /db_xref="GeneID:2896414"
     CDS             758042..758590
                     /locus_tag="KLLA0_A08624g"
                     /note="highly similar to uniprot|Q75ET0 Ashbya gossypii
                     AAL002W AAL002Wp and similar to YCL001W uniprot|P25560
                     Saccharomyces cerevisiae YCL001W RER1 Protein involved in
                     retention of membrane proteins including Sec12p in the ER
                     localized to Golgi functions as a retrieval receptor in
                     returning membrane proteins to the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451379.1"
                     /db_xref="GeneID:2896414"
                     /db_xref="GOA:Q6CXG0"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:Q6CXG0"
                     /translation="MDLNTEEASADKLTSEIRRIGTLYQYYLDQLTPHVKYRWAALGG
                     LVFLFIVRIVISQGWYVVCYALGIYLLNQFLAFLTPKFDVSLQQNEQNEEMEAGEMTD
                     EFRPFIRRLPEFKFWHNSIRAAVLCFFMTFFSVFDIPVFWPILLMYFIVLFALTMRRQ
                     INHMIKYKYVPLDIGKKKYASK"
     gene            <758933..>760099
                     /locus_tag="KLLA0_A08646g"
                     /db_xref="GeneID:2896423"
     mRNA            <758933..>760099
                     /locus_tag="KLLA0_A08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451380.1"
                     /db_xref="GeneID:2896423"
     CDS             758933..760099
                     /locus_tag="KLLA0_A08646g"
                     /note="highly similar to uniprot|Q75ES9 Ashbya gossypii
                     AAL001W AAL001Wp and similar to YNL001W uniprot|P33309
                     Saccharomyces cerevisiae YNL001W DOM34 Probable
                     RNA-binding protein functions in protein translation to
                     promote G1 progression and differentiation required for
                     meiotic cell division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451380.1"
                     /db_xref="GeneID:2896423"
                     /db_xref="GOA:Q6CXF9"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF9"
                     /translation="MRLINKVTGSHSGERAILTLQPQDKEDLFTLYNIINTDDEIIFK
                     KKVTSKTEEGGKKKATQLEKLRIKVVSSEFEPQHEFLRYKGVTTEDDYSNANQDLPVG
                     KFFSFTIDFSYPFTLIKDDYNSYVDNLVKQACNIEGRSDMAAVVLQEGISHICLINSF
                     STVLKHKIEYSIPKKKRGTDIMKFDDKVEKFYRATYASMVRHFDFDTLKCIIICSPGF
                     YAKTLYDKVMQYAQEDQNKKILANTGKFLVAHCSTGYLQGIDEVLKDPAYKHKLEDAK
                     NSKEALVMDDFLDHLNKDDFKAWYGEHEITKAAELAAIDTLLISDSWMRSDDVNVRKK
                     SLNLINEVEQTGGKAYIFSSLHNIGEELDRLTGLACILKYPVPDLDEDIDEEEE"
     misc_feature    760404..760598
                     /note="Centromere Klla0A"
     gene            complement(<761149..>762084)
                     /locus_tag="KLLA0_A08690g"
                     /db_xref="GeneID:2896731"
     mRNA            complement(<761149..>762084)
                     /locus_tag="KLLA0_A08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451381.1"
                     /db_xref="GeneID:2896731"
     CDS             complement(761149..762084)
                     /locus_tag="KLLA0_A08690g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451381.1"
                     /db_xref="GeneID:2896731"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF8"
                     /translation="MTKLVACAERKRDRLKRALHESNEKLASKLHQLKLRLSREDKNN
                     FAKVLTTRYSTHTINDDQFNTKPGDFEQSSVLFRDKKPKKRMLHWFLDFKTRTNNGVL
                     SNDKATVNGNLKAQVYDAVMYDGTLVIENQSNPIPQFVEPIPWDISMKRETITNCDPA
                     SIVESSSIYSQRDVYLTEKSLLSVGRLSACIGKPHTFSGFLTTADRSISDVLQTNDEH
                     ILPTNITITEEEWLANIRCSNSDPLITSSFISELKENTHMLKTVNCNSHRPVLKDIIH
                     DSETYSKYSTNSNDYQISMTNIQLEKDNNNRLLDY"
     gene            complement(<762700..>763440)
                     /locus_tag="KLLA0_A08712g"
                     /db_xref="GeneID:2896811"
     mRNA            complement(<762700..>763440)
                     /locus_tag="KLLA0_A08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451382.1"
                     /db_xref="GeneID:2896811"
     CDS             complement(762700..763440)
                     /locus_tag="KLLA0_A08712g"
                     /note="highly similar to uniprot|P53200 Saccharomyces
                     cerevisiae YGR001C Protein with similarity to
                     methyltransferase family members; required for replication
                     of Brome mosaic virus in S. cerevisiae, which is a model
                     system for studying replication of positive-strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451382.1"
                     /db_xref="GeneID:2896811"
                     /db_xref="GOA:Q6CXF7"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF7"
                     /translation="MSDSESDGELQLSSHTLAALQAFRNEEQQREEEFQKMMNQADEE
                     YERKKRQQGMDLFKEDWQLSQFWYSDNTADTLAEALLEGADEDTVIAVVSAPSVYAAI
                     LKKPDSEIPTKHIYLFEFDKRFSLLAGEDKFFFYDFANPLDFDDKLKGKVDRLLIDPP
                     FLNEHCQTNSSITAKALLAPKTDEKTSKGVPKHRLMSCTGERMSEVIAKVYPDTKITT
                     FYPEHANGLSNEFRCYANFEWDQWKFSE"
     gene            <763946..>767434
                     /locus_tag="KLLA0_A08734g"
                     /db_xref="GeneID:2896340"
     mRNA            <763946..>767434
                     /locus_tag="KLLA0_A08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451383.1"
                     /db_xref="GeneID:2896340"
     CDS             763946..767434
                     /locus_tag="KLLA0_A08734g"
                     /note="similar to uniprot|P34111 Saccharomyces cerevisiae
                     YAL001C TFC3 Largest of six subunits of the RNA polymerase
                     III transcription initiation factor complex (TFIIIC); part
                     of the TauB domain of TFIIIC that binds DNA at the BoxB
                     promoter sites of tRNA and similar genes; cooperates with
                     Tfc6p in DNA binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451383.1"
                     /db_xref="GeneID:2896340"
                     /db_xref="InterPro:IPR007309"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF6"
                     /translation="MTETTVLSPDELVQKVIDEISFRKGRISLNELWDYASEYVDLND
                     DNMKGYTLSNVLAHPDTILLLSGKIVNKSSMQYEDVVKNADSVQIGITDDRLWLTLTG
                     HTKKEASVVGLAFDLLLEVAASKDKGINTMELAKNTGQDPRSVTGRIKKFSHLVTMNQ
                     LVYKGHLVKSLTLNRFVTEKQKKPYVNIKQHLSEIVQVVKNSKNGVRQVIDLKREMGF
                     DKEKRLSKAFTSAISWLDQQGYLKKVIVISPANPSIKIRCVQFVKSYFPEEVTGNNEF
                     EDESADEDENEGDGDEGGTGNDDVEKTSLDEEELMEGFDKVNATNILQDSNLVIQEAP
                     SEKKEVTINRFYPLQTQIYSMADKAGLTGISTLDLISKFVGPDYKRCFSKNTEYFIEG
                     TSQKSSKSFSDNDIGLVKIYDFEGKKKFHRIFTKKNFARLTDQEAGSRHKSLPEIEEQ
                     PHTLEELSKMNFVPLNASLRYMNDGDKDVFFWHGELDIPASTKTSVRGRKRITLPDAA
                     AKPKRIKVANPTVDMKIEHDEPQIARNGTSITVNGFTGSSLKSIQRQKALLTVLKNSG
                     GVRFIGDKFYDSISKSMGTDMILDKKTLKKESEILAESGKLKIVEDPNTRRRLLCLPE
                     ISDEKIEEYLIDSKDTRGKFNTEVVCKEDIYFFDQTEKDRFHRSAKAAKRIKEFERKN
                     KKGQSSTAVDVSIEPALAPKKLRKRTTAAKKGASTKEAKPSSKSKSKKTEIPSNIRTT
                     FHSGTKEGITALVYAVAITKSIKGQIAWDEITKLFPHNAIENLKKQWRVKRVRMGESG
                     WRALMEKWRKIMVEAIKDERATLADAEQLNLVKLVDLWLSVEKDSTHTVKLYKEYSVN
                     RAKYTFVPLTNKSKTETKGKGIAMSSMIQRECFLLNKKYSYQESVQPKSKSVEDEIKT
                     VVRSMLFDKTLVEAGEVDILQQFNHEQVDKVILDMAKERLVTFVDSSKLQLTDKIYDV
                     LKYLGDPSFLENSSAFRKTLIELFNNKNTLVLSEEPQRHIPCVLLDVIDNFNIKSAVV
                     PLEVQHKKMYYTTRQYEVRALTPPLVFYSVDTIKEKKVKKVNIPVNKPFSRLWINGNS
                     EIRPSVWKSVISILLKEILFNPGITESVISNRYATLLSSEEVSEVVKWLSNTQRISAI
                     DYGGYTVCDGWYFALG"
     gene            <767756..>769534
                     /locus_tag="KLLA0_A08756g"
                     /db_xref="GeneID:2896407"
     mRNA            join(<767756..767845,768005..>769534)
                     /locus_tag="KLLA0_A08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451384.2"
                     /db_xref="GeneID:2896407"
     CDS             join(767756..767845,768005..769534)
                     /locus_tag="KLLA0_A08756g"
                     /note="similar to uniprot|P39705 Saccharomyces cerevisiae
                     YAR002W NUP60 Subunit of the nuclear pore complex (NPC)
                     functions to anchor Nup2p to the NPC in a dynamic process
                     that is controlled by the nucleoplasmic concentration of
                     Gsp1p-GTP potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451384.2"
                     /db_xref="GeneID:2896407"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF5"
                     /translation="MTNNRKSYIVRNSIAPYKKPTHSVVTGNSRKPSFFNKIKSFFQN
                     QEVRQKEAKNEPKHIANGQRRSTSSFSVPGGFYDSQAAAESSAILSRALGAQTAESTF
                     ADDNEAEEEDPNVSNAKLASFFQEKGDRPLTEMEMEGVISVMKRCRSVSSTPFGSRII
                     SESKTIPNSKVLRTTSESVATPLKATSYTPRYEDSSVGNNSIRSTRSSVTRRIFDYSK
                     VPSPYRTTVYKYSAATLPSKSANATLPLQPTETKNKITRNRSPPKKLSNTASALMSIL
                     DGDNDRNDHTKLSIASNLANPYSSHVSRVRKSKPIAETTTHSPSTPAKVTDKPHVDHQ
                     ESSNTGLQTNTSLKEISKSVNGVSHPEEPHKVEEPNTLNNNNTTQYKPSVSSSLRQTV
                     VAETSPAKDQTTKQLSAEQIFGNSNSNKPASSFSFSFQKPEPFVLPSMGSTSENNKTD
                     SIESKTGLKAPPKSKLSPLPTVESPSIIEPEAEIGDKIDPNTTSKIPAPAVISTKMQD
                     QFTFGEVPKSNVDPASIDKAKVEQYKSMFIF"
     gene            complement(<769697..>770350)
                     /locus_tag="KLLA0_A08778g"
                     /db_xref="GeneID:2896737"
     mRNA            complement(<769697..>770350)
                     /locus_tag="KLLA0_A08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451385.1"
                     /db_xref="GeneID:2896737"
     CDS             complement(769697..770350)
                     /locus_tag="KLLA0_A08778g"
                     /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
                     YAR002C-A ERP1 Protein that forms a heterotrimeric complex
                     with Erp2p Emp24p and Erv25p member along with Emp24p and
                     Erv25p of the p24 family involved in ER to Golgi transport
                     and localized to COPII-coated vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451385.1"
                     /db_xref="GeneID:2896737"
                     /db_xref="GOA:Q6CXF4"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF4"
                     /translation="MFMFQVLLQLLVLFQLPLNAYAFYYYGNTGERRCFHKELTKDTL
                     LKGKYQLSIYDNSEEAYVLNNGQETSVQIMVEEVFDNNHRVVNQKGSASGDFTFTAMQ
                     SGEHLICFQPTSRGGRVKTMMDIEFQVGSLAEVDSKKKSTIQTLQNKVQILIDKVNGI
                     RREQDLVREREAMFRDASESANSRAMWWSIVSLIVLGGTCAWQLSHLRTFFVKQKVL"
     gene            <770989..>772308
                     /locus_tag="KLLA0_A08800g"
                     /db_xref="GeneID:2896487"
     mRNA            <770989..>772308
                     /locus_tag="KLLA0_A08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451386.1"
                     /db_xref="GeneID:2896487"
     CDS             770989..772308
                     /locus_tag="KLLA0_A08800g"
                     /note="similar to uniprot|P39706 Saccharomyces cerevisiae
                     YAR003W SWD1 Subunit of the COMPASS complex which
                     methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451386.1"
                     /db_xref="GeneID:2896487"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF3"
                     /translation="MANLLLQDPFGVLKEYPEKLTHTLEVPVAAVCVKFSPRGDYLAV
                     GCSNGAIIIYDMDSLKPIAMLGTHSGAHTRSVQSVCWSNDGRYLWSSGRDWYAKLWDM
                     TQPTKCFQQYKFDGPLWSCHVVRWNVCIVTVVEEPTAYVLTLTDRQNAFHCFPLLEQD
                     QDISGHGYTLVACPHPTIESIIITGTSKGWINAFQLDLESGFEDKIRCCYEEKIANAN
                     IKQIIISPSGTRIAINGSDRTIRQYQLIVEDNESEGGSSHSVSIELEHKYQDIINRLQ
                     WNTIFFSNHSGEYLVASAHGSSAHDLYLWETSSGSLVRVLEGADEELLDIDWNFYSMR
                     IASNGFESGWVYMWSIVIPPKWSALAPDFEEVEENIDYQEKENEFDIMDDDNNLQAMT
                     EAEEIAIDLCTPEKYDVRGNDISMPSFVIPIDYEGVIIQQHWAHQEQ"
     gene            <772565..>774313
                     /locus_tag="KLLA0_A08822g"
                     /db_xref="GeneID:2896500"
     mRNA            <772565..>774313
                     /locus_tag="KLLA0_A08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451387.1"
                     /db_xref="GeneID:2896500"
     CDS             772565..774313
                     /locus_tag="KLLA0_A08822g"
                     /note="similar to uniprot|P53197 Saccharomyces cerevisiae
                     YGL003C CDH1 CDC20 homolog 1 protein required for Clb2 and
                     Ase1 degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451387.1"
                     /db_xref="GeneID:2896500"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF2"
                     /translation="MQNPFVNNPPSSSPVKRSQVPGGRINKRPTSSATTNMSNSSSSS
                     SLLASPVRRPRSTSSAGSGFADRFIPNRTEMDLNTVSSIRSNPSIPAFKPSNGSDNRL
                     EWERERQAHQTFDIVLKNELFGELLNTDSNSGDTISRIQYSESLERPTTPPSGHRDGG
                     DTDEDEEQTYQNLNSEPPTTPRRNHSSFLHHDSHRPTSNSTKGVSLFSYGSRSQSNRL
                     HSSNLDLGPNATASMMNNQYFQSLSPMRPESQKLLLSPGKKFREIAKVPYRVLDAPSL
                     ADDFYYDLIDWSSTDVLAVALGKSIFLSDNTTNDVTHLATSESDFTSLSWVDSGSHLA
                     VGLSSGIVEIYDVLKNKCIRTLSGHVDRVACLSWNNHVLSSGSRDRKILHRDVRAPEP
                     FFEQIDTHSQEVCGLKWNVNENKLASGGNDNMVYVYDGTLRQPMLSMEEHTAAVKAMA
                     WSPHTRGVLATGGGTADKKLKIWNISKAVKLNEVDTGSQLCNMLWSKNTDEIITSHGY
                     SKYNLTLWNYPTLEPMAVLKGHSFRVLHLTLSADGTTVVSGAGDETLRYWKLFDKPKS
                     RGYQDSLITNAFDNLR"
     gene            complement(<774642..>776507)
                     /locus_tag="KLLA0_A08844g"
                     /db_xref="GeneID:2896480"
     mRNA            complement(<774642..>776507)
                     /locus_tag="KLLA0_A08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451388.1"
                     /db_xref="GeneID:2896480"
     CDS             complement(774642..776507)
                     /locus_tag="KLLA0_A08844g"
                     /note="similar to uniprot|P22336 Saccharomyces cerevisiae
                     YAR007C RFA1 Subunit of heterotrimeric Replication Factor
                     A (RF-A) which is a highly conserved single-stranded DNA
                     binding protein involved in DNA replication repair and
                     recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451388.1"
                     /db_xref="GeneID:2896480"
                     /db_xref="GOA:Q6CXF1"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR007199"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF1"
                     /translation="MGVQLLEGDLLDIFRIPERYNNPTGGIYQVVQTKKTETNAKKNL
                     ILINDGKYHVKALLRNKAAEAAQQAELERGDVFKVLNAECAVIKEKKKFVLLVDEIEI
                     VSRGLDLFNNATEFVDAYLGEHMNELVTLTDNGAVASEAASAAASATSSMTSKMAPTS
                     TSNIPAPQPRSVPKAKSNNGSSQNSRPIFAIEQISPYQNNWTIKARVSFKGDLKKWQN
                     NRGEGHILNVNLLDSSGEIRATAFNDNAIKFNEILQEGKAYFVSKARVQPAKPQFSNL
                     KHPYELSLERDCVVEECMNEDANDVPEMHFNFIKLNDVNNVEKNTAIDVVGILKSVGP
                     HFELAAKSGKKFDRRDVEIVDDSGACISLGLWGEQAIKFNLPEGSVVALKGVRVTDFN
                     GKSLSMGNTSSLFANPDIQEAYTLKGWYDANASNTTFKALKTESGGGADTSKFIADRT
                     TIARAIESNLGRSEKGDYFSVKAAVSFLKVDNFAYPACLNEGCQKKVIMQSDGTWRCE
                     KCDMNHPHPKYRYMLTISIMDQTGQIWLTLFNDQAEQLVGVSANELTELKENNNQAFV
                     ALTQKVQMNEYDFRIRAREDNYNNETRIRYTVANLHDLRWKAEADFLAAELLKAL"
     gene            <776960..>778231
                     /locus_tag="KLLA0_A08866g"
                     /db_xref="GeneID:2896499"
     mRNA            <776960..>778231
                     /locus_tag="KLLA0_A08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451389.1"
                     /db_xref="GeneID:2896499"
     CDS             776960..778231
                     /locus_tag="KLLA0_A08866g"
                     /note="similar to uniprot|P53196 Saccharomyces cerevisiae
                     YGL004C RPN14 Putative non-ATPase subunit of the 19S
                     regulatory particle of the 26S proteasome localized to the
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451389.1"
                     /db_xref="GeneID:2896499"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:Q6CXF0"
                     /translation="MRVEEWNICSEFDDILDDVRGEKVASDKIWVSRSSGEPLYDLEF
                     DVRLDSRGNVGFHNANTSDKISFQRVRPHLYELTGPDATAGHLASFQSPKKRFQLPSD
                     IGAVDLTSIDITNVFDPEIRLVCGDTNGGIYVLRKNTGTNYSGPLQEVIKLPEAHASH
                     ITKTQFFPNGHGFLSSSIDMRLKIWDASTGTELRTFIGHTRSVNDFAMVDRGRNFVSA
                     SSDGSLKLWECSTSACVFTLNSNDGINCISLANYQGNPATTSYNALDHSNEYNTEGKA
                     VFAGHDSGIITFHDIYNRKKILDILPASKSACVTLTSQHIAGDDHYLFAGYSDGTIVS
                     WDTRNVSKPVETLQVNDNDSISRLFLAHNTLNVSSGVQFAFNVPVLDGKFNFNKLTHL
                     IRPYDEVTDFCVDESHQNVWCVGKNGMLLKY"
     gene            <778534..>779286
                     /locus_tag="KLLA0_A08888g"
                     /db_xref="GeneID:2896498"
     mRNA            <778534..>779286
                     /locus_tag="KLLA0_A08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451390.1"
                     /db_xref="GeneID:2896498"
     CDS             778534..779286
                     /locus_tag="KLLA0_A08888g"
                     /note="similar to uniprot|P53195 Saccharomyces cerevisiae
                     YGL005C COG7 Component of the conserved oligomeric Golgi
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451390.1"
                     /db_xref="GeneID:2896498"
                     /db_xref="UniProtKB/TrEMBL:Q6CXE9"
                     /translation="MSRRISGANDPLLDMFFDDDFVPQAFVDILLSSFQTSQLEELKT
                     NCSSLLSKMDYYSGHITKELESTIQVLQKPAELIIYAANEEQQGTTKLEYYLDTLANS
                     VNLLETDVKAIDKQLEELNSKYEDSNEVTETLSKLTAAKEHLVTVKRSFDLLKTIMDI
                     SIQDDQEKLQHISLDDFKLALLTLQETIIITLKKPQNDATDLLKKIDAFIELKTVLKG
                     LQKFYIPYTEFAQAIQKEKDNYLNSKDTLDEL"
     gene            complement(<779526..>783368)
                     /locus_tag="KLLA0_A08910g"
                     /db_xref="GeneID:2896403"
     mRNA            complement(<779526..>783368)
                     /locus_tag="KLLA0_A08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451391.1"
                     /db_xref="GeneID:2896403"
     CDS             complement(779526..783368)
                     /locus_tag="KLLA0_A08910g"
                     /note="similar to uniprot|P38929 Saccharomyces cerevisiae
                     YGL006W PMC1 May be involved in depleting cytosol of Ca2
                     ions putative vacuolar Ca2 ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451391.1"
                     /db_xref="GeneID:2896403"
                     /db_xref="GOA:Q6CXE8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:Q6CXE8"
                     /translation="MSSLNEGVDEAHSPSLTGRESFVGLQSKKDENKTVETEEQTRPL
                     NKGVTSTSIGAVKPLKHHDTQITMMSVNRMTKASSFKLAPSQLSELHDPKSLTAFNNV
                     FDNDESNLYTYLQTDRTNGLTIQDEDIESLERTQVYGLNRIPERKGKSFLRLVWEAFN
                     DKTMILLTVAAVISFALGLYETLGQPPEYDPEGNEIVKVEWVEGVAIMIAVVVVVLVG
                     AINDYQKELQFAKLNKKKDDRDVVVIRNGDEHLISIHDLLVGDVISLQTGDVVPADAV
                     LISGSCECDESALTGESDTIKKVALKPALEKYKQIFEKDPTIDIGSHGVGEKVPDPLL
                     ISGSKLLSGIGNAVITSVGENSVNGRIMMALKTESESTPLQERLSNLADNISIYGCMA
                     ALVLFIILFIRFLTYLPNGKKYHDLPPAQKGSKFMNIFITAVTVIVVAVPEGLPLAVT
                     LALAFATTRMTKDGNLVRVLRACETMGSATAICSDKTGTLTENRMTVVKGFAGNLGFD
                     DTTHAENKEIKSAVVLRSNCDASLLTDILSNISLNSTAFENKESQHKDKDVDENPYHK
                     SRKSLFPWSRNNRTSQLIADAMKENDEQFLGSKTETALLAFAQKSLGMKDVHKLRTKP
                     SDLGIDKVVQVIPFESSRKWGAIAVQLADNKGYRFYAKGAAEILLKVCSNQRNSDNSI
                     VPMNQDLYDESFKKIQDMASHALRTISLVHRDFKEWPPKEFADSTDPSIASPDLVMGH
                     ELDHKNLSSEGMTLDAMVGLQDPLREGVKESVEQCQRAGVTVRMVTGDNILTARAISR
                     NCNILSEEGYNDPECAMEGPTFRKLPYKKMLRVIPKLRVLARSSPEDKRILVETLKKM
                     GEVVAVTGDGTNDAPALKLADVGFSMGISGTEVAREASDIILMTDDFTAIVNAIKWGR
                     CVSVSIKKFIQFQLTVNITAVILTFVSAVASAEETSVLTAVQLLWVNLIMDTLAALAL
                     ATDKPDEFILDRKPKGRDAPLIAVSTWKMILGQAALQLTVTFVLHFRGKEIFFPNKRT
                     ITAHEQEQLNAMTFNTFVWLQFFKLIVTRKLDEADGISKFKDRLTANNLNFFQHLFRN
                     YYFICIALLIGGFQILIMFVGGAAFSIARQTPAMWATAIICGLISLPVGLFIRACPDE
                     WALAIFPRRLVRAILYVFGLEFIFKRNKNKKQHDEDEEASLLVEYANDSSLVESTAFQ
                     RAKSDMISHKVHPPTSEPSKYNPITAINRWRSSSGDENESEEEHSFIASVTMVPTLVG
                     GAVGGFSHITGPNENKKQ"
     gene            <784599..>785492
                     /locus_tag="KLLA0_A08932g"
                     /db_xref="GeneID:2896707"
     mRNA            <784599..>785492
                     /locus_tag="KLLA0_A08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451392.1"
                     /db_xref="GeneID:2896707"
     CDS             784599..785492
                     /locus_tag="KLLA0_A08932g"
                     /note="similar to uniprot|P39707 Saccharomyces cerevisiae
                     YAR008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451392.1"
                     /db_xref="GeneID:2896707"
                     /db_xref="GOA:Q6CXE7"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="InterPro:IPR016690"
                     /db_xref="UniProtKB/TrEMBL:Q6CXE7"
                     /translation="MEYRESFTKAMSEKAKIYLVGSNLEDGDGDDASSVVPVLYDVDD
                     IAKIREHGVAGVLIGTLGGAPQQNVFLGVPLRLMMEEALWLVEVGHAVFRHVMGQDLI
                     KSLKGLDGEKLQKFKDDRANDVAQQLEWKRANFLRKMKTLRGASDVAVPSDVINERDE
                     QLMKQSIFIETKDTSAVIEPSLNDQTIDQRKICEQILRQNEKLRLNYKVYKKLREMGY
                     FMSPGARFGGRYVAYPGDPLRYHSHLTVQDARSKDEEIDLLNMINGARLGTSVKKTWV
                     LPGINENGDAEFYSVEWAGFG"
     gene            785743..785824
                     /locus_tag="KLLA0_A08965r"
                     /db_xref="GeneID:2896742"
     tRNA            785743..785824
                     /locus_tag="KLLA0_A08965r"
                     /product="tRNA-Ser"
                     /db_xref="GeneID:2896742"
     gene            785915..785987
                     /locus_tag="KLLA0_A08987r"
                     /db_xref="GeneID:2896746"
     tRNA            785915..785987
                     /locus_tag="KLLA0_A08987r"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:2896746"
     gene            <787768..>790467
                     /locus_tag="KLLA0_A09031g"
                     /db_xref="GeneID:2896449"
     mRNA            <787768..>790467
                     /locus_tag="KLLA0_A09031g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451395.1"
                     /db_xref="GeneID:2896449"
     CDS             787768..790467
                     /locus_tag="KLLA0_A09031g"
                     /note="highly similar to uniprot|P05030 Saccharomyces
                     cerevisiae YGL008C PMA1 Plasma membrane H -ATPase pumps
                     protons out of the cell major regulator of cytoplasmic pH
                     part of the P2 subgroup of cation-transporting ATPases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451395.1"
                     /db_xref="GeneID:2896449"
                     /db_xref="GOA:P49380"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /translation="MSAATEPTKEKPVNNQDSDDEDEDIDQLIEDLQSHHGLDDESED
                     DEHVAAGSARPVPEELLQTDPSYGLTSDEVTKRRKKYGLNQMSEETENLFVKFLMFFI
                     GPIQFVMEAAAILAAGLEDWVDFGVICGLLFLNAAVGFIQEYQAGSIVDELKKTLANS
                     AVVIRDGNLVEVPSNEVVPGDILQLEDGVVIPADGRLVTEDCFIQIDQSAITGESLAV
                     DKRFGDSTFSSSTVKRGEAFMIVTATGDSTFVGRAAALVNKAAAGSGHFTEVLNGIGT
                     ILLILVIVTLLLVWVASFYRTNKIVRILRYTLAITIVGVPVGLPAVVTTTMAVGAAYL
                     AKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLHEPYTVEGVDPDDLMLTACLA
                     ASRKKKGLDAIDKAFLKSLISYPRAKAALTKYKLLEFHPFDPVSKKVTAIVESPEGER
                     IICVKGAPLFVLKTVEEEHPIPEDVRENYENKVAELASRGFRALGVARKRGEGHWEIL
                     GVMPCMDPPRDDTAQTVNEARHLGLRVKMLTGDAVGIAKETCRQLGLGTNIYNAERLG
                     LGGGGDMPGSELADFVENADGFAEVFPQHKYNVVEILQQRGYLVAMTGDGVNDAPSLK
                     KADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTSRQIFHRMYSYVVYRIALSLH
                     LEIFLGLWIAILNRSLNIDLVVFIAIFADVATLAIAYDNAPYSPKPVKWNLRRLWGMS
                     VILGIILAIGTWITLTTMFVPKGGIIQNFGSIDGVLFLQISLTENWLIFITRAAGPFW
                     SSIPSWQLSGAVLIVDIIATMFCLFGWWSQNWNDIVTVVRVWIFSFGVFCVMGGAYYM
                     MSESEAFDRFMNGKSRRDKPSGRSVEDFLMAMQRVSTQHEKEN"
     gene            complement(<792171..>793367)
                     /locus_tag="KLLA0_A09075g"
                     /db_xref="GeneID:2896828"
     mRNA            complement(<792171..>793367)
                     /locus_tag="KLLA0_A09075g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451397.1"
                     /db_xref="GeneID:2896828"
     CDS             complement(792171..793367)
                     /locus_tag="KLLA0_A09075g"
                     /note="uniprot|P40952 Kluyveromyces lactis KLLA0A09075g
                     KYE1 NADPH dehydrogenase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451397.1"
                     /db_xref="GeneID:2896828"
                     /db_xref="GOA:P40952"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /translation="MSFMNFEPKPLADTDIFKPIKIGNTELKHRVVMPALTRMRALHP
                     GNVPNPDWAVEYYRQRSQYPGTMIITEGAFPSAQSGGYDNAPGVWSEEQLAQWRKIFK
                     AIHDNKSFVWVQLWVLGRQAFADNLARDGLRYDSASDEVYMGEDEKERAIRSNNPQHG
                     ITKDEIKQYIRDYVDAAKKCIDAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIE
                     NRARFVLEVVDAVVDAVGAERTSIRFSPYGVFGTMSGGSDPVLVAQFAYVLAELEKRA
                     KAGKRLAYVDLVEPRVTSPFQPEFEGWYKGGTNEFVYSVWKGNVLRVGNYALDPDAAI
                     TDSKNPNTLIGYGRAFIANPDLVERLEKGLPLNQYDRPSFYKMSAEGYIDYPTYEEAV
                     AKGYKK"
     gene            <794827..>797244
                     /locus_tag="KLLA0_A09097g"
                     /db_xref="GeneID:2896735"
     mRNA            <794827..>797244
                     /locus_tag="KLLA0_A09097g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451398.1"
                     /db_xref="GeneID:2896735"
     CDS             794827..797244
                     /locus_tag="KLLA0_A09097g"
                     /note="similar to uniprot|Q750N6 Ashbya gossypii AGL086C
                     AGL086Cp and some similarites with YGL014W uniprot|P25339
                     Saccharomyces cerevisiae YGL014W PUF4 member of the PUF
                     protein family YGL014W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451398.1"
                     /db_xref="GeneID:2896735"
                     /db_xref="GOA:Q6CXE1"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CXE1"
                     /translation="MNIDPVSVPETINAALGQLHLDDVVEKPNSNSNTQEPDQETGND
                     AAPIAAATETISNNRGNGNNATSATNGGTIPQQLQQQEFFMGDSLVPGPSGPGPAPMF
                     APHMMNPFMPYHPMMHMPHSGFFPGAQDQMFPPPDSSAAVDFNLSLSPSGGSAVPGAG
                     NMTGGVNDSAIPGSDLMMHYPQQYMNHNGQRPMFWMNPDLNSSAIDDTTAGEDPQNQD
                     SFVRGASFTLESSEQGNDAKVPGANTSRRQTFHAVSATDLLNNSTSSPTETTDATGTN
                     ASATSPEASASKKEMQDRVYPQAAAYPYTGALLQPNPVLSGHPLGHHPHPIGSPFPGY
                     GFNTAFSPVPGPTNTLNAGSPAISADGKEANSSGDPSGQSNRHVHSGTNSPGLSQPGS
                     LPMSGPNPWMFAAPHGSPNFLVPHPHHPGHAGPPAGHQRPQSNNPQHRKRHFNNNGSS
                     RSNFGNMKPHGKPQRFEDGSRYQDAVLEQFVGSIYSLCKDQHGCRFLQRQLDENGEEV
                     ASTIYSEIKDHICELMNDPFGNYLMQKLFERINQRDRVEIVKNCSPQFMDIALDAHGT
                     RALQKLVECTDTEEETQILVASLQPSILSLSRDFKSNHVVQKMLENFSNKDTQFIYDA
                     ACDDIIKISNHRNGCCVVQRCLDFGNTEQLDALCGKIVEKSFELTMNPYGNYVIQYIL
                     TKEKDQATPDFKYTKKIVDVLKFNAIDLSLNKFGSNVVESILRTPAVSDVMITKILNS
                     NDESGLLKLLHDSYGNYVLQTALDIVKDSNASLFSLLSDSLKPLLVGQIRNTPHGRRI
                     AALLQAE"
     gene            complement(<797533..>800781)
                     /locus_tag="KLLA0_A09119g"
                     /db_xref="GeneID:2896723"
     mRNA            complement(<797533..>800781)
                     /locus_tag="KLLA0_A09119g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451399.1"
                     /db_xref="GeneID:2896723"
     CDS             complement(797533..800781)
                     /locus_tag="KLLA0_A09119g"
                     /note="weakly similar to uniprot|P12383 Saccharomyces
                     cerevisiae YGL013C PDR1 Zinc cluster protein that is a
                     master regulator involved in recruiting other zinc cluster
                     proteins to pleiotropic drug response elements (PDREs) to
                     fine tune the regulation of multidrug resistance genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451399.1"
                     /db_xref="GeneID:2896723"
                     /db_xref="GOA:Q6CXE0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CXE0"
                     /translation="MVDIFQPAVSPPGLSEEAARSDSASSGVNGDRTAIPRDSNGNGT
                     GKPRRKVSRACDSCRKKKIKCSGTLPCKSCETYGCECVYSHAPYGVAKGKKKTAKSDS
                     SAFTKEKLSVQSIPNSTVAILNPEIDGNSYAPSRTGFSEATITGVQSHLHSSRSSFGR
                     DSSSGPSATGSMSVTQTSHPVGFSCPRRFDPVKDDASTNINDPSSDDINRYPILYISN
                     AEIESRIAKLKECVSSLRRNDGPQSESIMYAIKNIEFEIQTLNNKLARPCINHELTSN
                     PELNRDKSVCFEAKLMKNHESNYVSLNRYVKINTNKLEEYLQKPPMVDVKHGLYFPGQ
                     WLSLRGVGYFVKDFMKHAKCNIKELKENIYLILRQFDIMSAVEIKNAECWGAPVELYC
                     QNFSVKVRKDERVQHLLRKIPASLLNKVIATKSEFKLENWNHIINNTSETSVSSATDA
                     FHWIIAIMEVNKNEYQKLSKHHKLSAQQRGDDIITETLFFIEAEELLFTLGLHFFKQI
                     SIARVHSEPLTFLDDLLDFVMNIFWIDGHQIFTCLLSSAIQTMRLCGMDHWETYLVMD
                     ERMADSRRNLWWKAFIWDQYSVFITGSRPVFSTVDIQGPLFPGFMRKMKFIDHQDLMA
                     NFDEQFNLENVDFSSSDLTRRETIAFVIFLSCFFAHQFQCKIVFSDRFSNFRIFALSK
                     SEKIKMAEEVLSELRIYKHRLDILNEGFKRYLESGLKKVDPKENSDLEDPGIFWYEIT
                     REVSLTFCVVSSVHIIARLNPSPEVVSISQEMKKFRKNIGVSWKITMQYLEQNNSLYD
                     LFFMSKLVALVAVSYVGENIAYFKHASFDDVCSFVKICRFFDYSGINCGSVENTRIQR
                     TLLQIQFLLKILVRCVVSVHVQSHKKTIENLLQQLASSKYPEYQETIVKLFDPTFNYF
                     SPTLNALKESELHLQIKSWLTETLYGSVLSLPNNLFFDDIFPTYTPSAGSSVADQRDI
                     PPNYFTEAVDTVNGTVIANKNPHFSSTERYNGNNELKNGLDSSDKTEGFQNPVSSASP
                     SKLSEPSNHIDQGTTFNLGTIYDFADHGDFDRLFSFIWDDFVGAPVSSTEKE"
     gene            <801373..>803655
                     /locus_tag="KLLA0_A09141g"
                     /db_xref="GeneID:2896513"
     mRNA            <801373..>803655
                     /locus_tag="KLLA0_A09141g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451400.1"
                     /db_xref="GeneID:2896513"
     CDS             801373..803655
                     /locus_tag="KLLA0_A09141g"
                     /note="weakly similar to uniprot|P38863 YHR172W
                     Saccharomyces cerevisiae SPC97 Component of the
                     microtubule-nucleating Tub4p (gamma-tubulin) complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451400.1"
                     /db_xref="GeneID:2896513"
                     /db_xref="GOA:Q6CXD9"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD9"
                     /translation="MEDRGVVESVFLLNDKVGPFGRRVNPAPLCSEEIKVRTYPIEKT
                     SNDRVQESLVVRDLLLVLQGYEGVYIRYNSSYRRDSMTGPEYKVVKMMNVTFKSFSKK
                     LIKIGSIFVKLDKFQQWCCDERYGRVMHRLGHEVRIFLYENYLSCIKELEIRFQQDVK
                     FSIRDLEMVLEDGFIYKFRLLDQIVDRIMDSTRERSEMDRVQMDFNNFMDDLRRDTND
                     ELDLRVLYDTRVSLFVKGGSLIIIVQQIMEQEQGDIRHVEFLSLICDSLNRVYGQMFV
                     EWMQEGKLNDYHEEFLISDTVADVDEEKLANTIDNERLWDTRFVIRKDGLLPQFRDKE
                     LQQKILMTGKIWNLIAICCGNTALKPRSWGTSVTNIDITNMTFLKGYVNECYQQANEK
                     CLKMYYEGYHMDKFLNLIHDQSYVHGVIDQLWNTKFLSKTLFELTRSPTESTLHKIQR
                     HFDDILKEISVEDTYRHMILSKLTSVKIDTCPFYETLRQFIDEQETGLLNADNFQQLK
                     GMLVAEEQNHTSQGSNELDEGRKSKKKKNATPTAMYVQFETSIPYPLNIIWTKPVMVQ
                     YQMIQRLLLILSYHERLLEDTWFEISKNKHWRRNSSQQSEYETHGMIFEDNNDDDDDG
                     VRYFYVRGQCIRLARILHFQMRSMVKSKRNQVTSAAAAATAVAATGTHPMQEDLLQIQ
                     QHVQDHVTNIVSLSGLTSLPQIELQEATLHVIHSFIRFVASWRRTSDDELSGSSGWIT
                     RMDTLRQYVSVWSDLTRTNS"
     gene            <804448..>805761
                     /locus_tag="KLLA0_A09185g"
                     /db_xref="GeneID:2896838"
     mRNA            <804448..>805761
                     /locus_tag="KLLA0_A09185g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451402.1"
                     /db_xref="GeneID:2896838"
     CDS             804448..805761
                     /locus_tag="KLLA0_A09185g"
                     /note="highly similar to uniprot|P00924 Saccharomyces
                     cerevisiae YGR254W ENO1 Enolase I and to uniprot|P00925
                     Saccharomyces cerevisiae YHR174W ENO2 Enolase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451402.1"
                     /db_xref="GeneID:2896838"
                     /db_xref="GOA:Q70CP7"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /translation="MPISKVYARSVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGVH
                     EALELRDGDKSKWLGKGVLTAVSNVNNIIAPALVKANVDVTNQQQVDDLLLSLDGTAN
                     KSKLGANAILGVSLAASKAGAAAKNVPLYQHLADLAGAKTQPFVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGAETFAEALRMGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPN
                     IQTAEEALDLIVDAIKAAGYEGKIDIGLDCASSEFYKDGKYDLDFKNPESDPSKWLSG
                     PQLADLYHELVKKYPIVSIEDPFAEDDWEAWSHFYKTAGVQIVADDLTVTNPVRIATA
                     IEKKAADALLLKVNQIGSLSESIKAANDSFAANWGVMVSHRSGETEDTFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQLLRIEEELGSNAIFAGKKFHNGNQL"
     gene            <806124..>806531
                     /locus_tag="KLLA0_A09207g"
                     /db_xref="GeneID:2896664"
     mRNA            <806124..>806531
                     /locus_tag="KLLA0_A09207g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451403.1"
                     /db_xref="GeneID:2896664"
     CDS             806124..806531
                     /locus_tag="KLLA0_A09207g"
                     /note="some similarities with uniprot|P38865 Saccharomyces
                     cerevisiae YHR175W CTR2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451403.1"
                     /db_xref="GeneID:2896664"
                     /db_xref="GOA:Q6CXD6"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD6"
                     /translation="MSSHHHPAEPETGMCSMDMTFNWNTENVCVVFKSWSINSHSQLL
                     FSCLAIFLLSYGYEYLKHHIRLVNQNLSGTLSRRNRVQSSLWYGLQYSISILLMLIYM
                     TYNGYLIAAVLLGAMFGNFHWAQSPAVQLLPCH"
     gene            <806734..>808005
                     /locus_tag="KLLA0_A09229g"
                     /db_xref="GeneID:2896516"
     mRNA            <806734..>808005
                     /locus_tag="KLLA0_A09229g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451404.1"
                     /db_xref="GeneID:2896516"
     CDS             806734..808005
                     /locus_tag="KLLA0_A09229g"
                     /note="similar to uniprot|P38866 Saccharomyces cerevisiae
                     YHR176W FMO1 Flavin-containing monooxygenase localized to
                     the cytoplasmic face of the ER membrane catalyzes
                     oxidation of biological thiols to maintain the ER redox
                     buffer ratio for correct folding of disulfide-bonded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451404.1"
                     /db_xref="GeneID:2896516"
                     /db_xref="GOA:Q6CXD5"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD5"
                     /translation="MVSIGIIGAGPAGIAAARVLIANDRSYDIDLFETSSKIGGVWNY
                     DPQSNNTAMYDVLETNLSSHLMAFKDYPFTNIDPNIKTFPGREQVQQYLESYYDSTVA
                     NYSKLGLFTEKRVISLEKVDSHWELKADSDDSTYIYDYIVVANGHFNKPFIPTVPGSY
                     QWKNQSHSKNFVNSEHYRGLNVVVVGNASSATDIATQISTTASKVYHSVKPDSETNWP
                     ANSIIEVVSQIQSLDEPNSNTVHFIDGTSIQNVDHIIWATGFQYGVPFLKSYHSDLFR
                     NQSNRLYNLWEQIVYKPDPTIFFSLLPKNIIPFQLAELQASIIDLVILGSITKSDMVD
                     ADNESITSSDYHSLPTPKDIEYYQHLGSIVARHGPDSKFKPLTWTDSLVQERISSSKV
                     KAERQKLLVQWAIHQNLQNKPYSIPPDDFTG"
     gene            <808253..>810319
                     /locus_tag="KLLA0_A09251g"
                     /db_xref="GeneID:2896510"
     mRNA            <808253..>810319
                     /locus_tag="KLLA0_A09251g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451405.1"
                     /db_xref="GeneID:2896510"
     CDS             808253..810319
                     /locus_tag="KLLA0_A09251g"
                     /note="similar to uniprot|P38699 Saccharomyces cerevisiae
                     YHR178W STB5 binds Sin3p in two-hybrid assay Zinc finger
                     (6-Cys)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451405.1"
                     /db_xref="GeneID:2896510"
                     /db_xref="GOA:Q6CXD4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD4"
                     /translation="MGTETDGGGEISGPNKKASHSCSRCRRLKKKCSKDLSTCTNCAK
                     ANEPCDYPGRAPRRKRKEIEEAMLLGELSNDRTKRVKSGQQPNKSNTKPEIVATDVSQ
                     RGGNDIIEPGLRTPQQSLVSASSVASFLNLLNTLNHTNGSTVNESNMREENSNMPRPV
                     QRVRSQHGVMPDKVSDSSKDESRAGEGTTAGTGNGIKQERSDAVASHAGLTEHERHRS
                     ESTPITASAIQIEAVLSVFKGGRTTPMKMPLNIERPLYDRFIAAFFKHNHKSYPLMNK
                     IEFLNKVSTIRDFNKLPEEESNAFVFQLHMIMAIGCTTLQRAGMLTSEEEGLSEHFAY
                     LAMKNFCPVMHLQNLETIKCLLLLGIYSFFEPKGVSSWTISGLIMRLCIGFGLNRALT
                     PKKLKTMSVIDVEMRYRAFWAFYSFERLVATSLGRISCLSDDDISVPPPRALFEEEKD
                     DIEVTNMMISLRRIGGRIYRKVHSVGAARRKLNAEEKKNVIDKLRQELDELYKLETFK
                     IHSAKQETNNITFHHSDTWLSMRYYQLQIMIYRPSALIPKPAMDSLTILGDACLKSLK
                     YTYNLYQKKLLPLNWITLFRVLTICNTMLYCLCQWSIDIIESKIEIHQCIEVLRHFGA
                     KWVFAAKCAEIFSSIINTILDISLSNGRVPNMDKLTRELFGASNEYQEILDENNVDIS
                     WVDSIV"
     gene            810512..810583
                     /locus_tag="KLLA0_A09273r"
                     /db_xref="GeneID:2896508"
     tRNA            810512..810583
                     /locus_tag="KLLA0_A09273r"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:2896508"
     gene            <810967..>811647
                     /locus_tag="KLLA0_A09295g"
                     /db_xref="GeneID:2896505"
     mRNA            <810967..>811647
                     /locus_tag="KLLA0_A09295g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451406.1"
                     /db_xref="GeneID:2896505"
     CDS             810967..811647
                     /locus_tag="KLLA0_A09295g"
                     /note="similar to uniprot|P38869 Saccharomyces cerevisiae
                     YHR181W SVP26 Component of Sed5p vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451406.1"
                     /db_xref="GeneID:2896505"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD3"
                     /translation="MIIQLLSYAGTVLGFIFLTLSTASGLYYLSELVEEYTEPTRRLL
                     YRAIYTIIGIYVLLLLFDGFPWLLTAFSIFTYVVYLQNMKHFPYISLTNPTLMLSCVL
                     VLINHYLWFKYFNDVDIPPQFRFDPNYVPRRRASFAEVASFFGICVWFIPFALFVSLS
                     AGENVLPTHIERKKNEDGDGAESSRGVRRRAKGLAKIVIDYIREYFYSIGKLFGLKDS
                     KKDEGLLL"
     gene            <811860..>813809
                     /locus_tag="KLLA0_A09317g"
                     /db_xref="GeneID:2896461"
     mRNA            <811860..>813809
                     /locus_tag="KLLA0_A09317g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451407.1"
                     /db_xref="GeneID:2896461"
     CDS             811860..813809
                     /locus_tag="KLLA0_A09317g"
                     /note="weakly similar to uniprot|P38870 Saccharomyces
                     cerevisiae YHR182W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451407.1"
                     /db_xref="GeneID:2896461"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD2"
                     /translation="MDLRYTFWSPVSTVSVNSLYDAITQDIQSIMRLSQFLNHLNNVW
                     NASLLSMKKAPDPKVTIVGEQVVEKITESLKSYKVDTTSLDHLLKRYESLLGQCKENK
                     GRDASLIKELKQWKTLKLEIQDQSVVYDKDKDDHHCPVAGGILQFPSRTVMFKFLRWL
                     KDDIKYSKRFIPISKLPNEYFSGKQLIESIRKQYPDSVVSLYQQEKLGQWFMSEGYMA
                     HYNDLLGVRKAFSCNGYYCWKELDQQKSVKYNLATVNGLIWEQWSKYTMQKLQFETNH
                     FNQMDQLAQLREELVQTMKHFNGTLEDTWHITSKESVKPSSVTVQSMYEQNMGSIGFY
                     VTSNEPIIKYNSETTKFEMTSPIPDDITGNSLLHRLIDEIEIETEDHVENIKRCWITE
                     FDLINWHRIKEDLLRRWMRVQTGDKDDYASLNLTLEKKVLLLKGWLIELDDSIIPSEI
                     CEESVRNNQSILKSFQGSGDNLRKDQNRIRCIVRILRHLAWLKEKSGEALDDVLSVPL
                     KIPVTHYFMRCQHQVPNKIGAFKALLLQSVEEGFQQWYQLMESTPTVPSVLVDDTNLS
                     LPPGVLTASVADTATATAPPPSHHVTTDFIPKPFKASSSGSNASSTTSSTAGSHTATT
                     TADPREKRRSGTPLLQIMPDVSSST"
     gene            <814960..>816438
                     /locus_tag="KLLA0_A09339g"
                     /db_xref="GeneID:2896460"
     mRNA            <814960..>816438
                     /locus_tag="KLLA0_A09339g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451408.1"
                     /db_xref="GeneID:2896460"
     CDS             814960..816438
                     /locus_tag="KLLA0_A09339g"
                     /note="highly similar to uniprot|P53319 Saccharomyces
                     cerevisiae YGR256W GND2 and to uniprot|P38720
                     Saccharomyces cerevisiae YHR183W GND1 6-phosphogluconate
                     dehydrogenase(decarboxylating)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451408.1"
                     /db_xref="GeneID:2896460"
                     /db_xref="GOA:F2Z6B1"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:F2Z6B1"
                     /translation="MSEPAGDIGLIGLAVMGQNLILNAADHGFTVVAYNRTVSKVDHF
                     LANEAKGKSIIGAHSVEELCRNLKRPRRIILLVKAGDAVDAFIQQLLPFLEKGDIIID
                     GGNSHFPDSNRRYDELKEKGIYFVGSGVSGGEEGARYGPSLMPGGAEEAWPHIKDIFQ
                     SISAKSDGEPCCDWVGPAGSGHYVKMVHNGIEYGDMQLITEAYDIMKRIGGFTDKEIG
                     EVFSQWNKGVLDSFLVEITRDILLYDDVDGTPLVEKILDSAGQKGTGKWTAINALDLG
                     MPVTLIGEAVFARCLSSLKDERVRASKLLPGPQIPKDAVKERQQFVDDLEQALYASKI
                     ISYAQGFMLIREAGKTYGWKLNNPAIALMWRGGCIIRSVFLGEITKAYRENPELENLL
                     FNKFFADAVEKAQSGWRKTIGLAVSYGIPTPAFSTALSFYDGYRSERLPANLLQAQRD
                     YFGAHTFRVLPEAASENLPADQNIHINWTGKGGNVSASSYQA"
     gene            <816911..>818611
                     /locus_tag="KLLA0_A09361g"
                     /db_xref="GeneID:2896457"
     mRNA            <816911..>818611
                     /locus_tag="KLLA0_A09361g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451409.1"
                     /db_xref="GeneID:2896457"
     CDS             816911..818611
                     /locus_tag="KLLA0_A09361g"
                     /note="weakly similar to uniprot|P38871 Saccharomyces
                     cerevisiae YHR184W SSP1 Protein involved in the control of
                     meiotic nuclear division and spore formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451409.1"
                     /db_xref="GeneID:2896457"
                     /db_xref="UniProtKB/TrEMBL:Q6CXD0"
                     /translation="MEEPDEVDEYSYSELDRPQYPTPKVIDSKKIYERLKSKVQFWKH
                     QDVDGSSFNTMDKRQQELWKLIRDSPLKFNQNNGAPESKEAHASPLQPIGESANTFLT
                     DNDKDVNVGDQFIKVSPMKITALDQSPLFEVHSTTKELTGPSPPVLVERLTDKLHFKK
                     VGLKRIQDRLGKIADSKENVARNYNKLASEITAWCSLCLERDSELDLLTDLQQVLAAD
                     KKSEQTMTRLFMMINAKLEYVAKREENMLQERKDMNALTKKYDALRVRKGDQSMETQY
                     LKENLQRKRTSLQQLTEQYYESLSKILREEFTRACFTIYEMGSELKDVTRDFSLQSIE
                     LLKNGNDSDYIDGFLEDVRKLRADKQWNKLSMQEKNNPNKLAELVGNLYNGQDSLLRI
                     ASNKVPIKFSPLPLHENASTSTLDPQHFKASEGLDLSMSQYGTDKYNDITTNKFMLKK
                     PLFTDVRPVSQQPLQTLQNLRAPVSSHGATGSAGGGATRQRNLASNIANNYPYQRGPS
                     LVRSKAEPNGLRNEIISENVSAESIADADDKEVVIKFGHDLTNSFIEADQLLATNAWD
                     "
     gene            complement(<818752..>819852)
                     /locus_tag="KLLA0_A09383g"
                     /db_xref="GeneID:2896456"
     mRNA            complement(<818752..>819852)
                     /locus_tag="KLLA0_A09383g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451410.1"
                     /db_xref="GeneID:2896456"
     CDS             complement(818752..819852)
                     /locus_tag="KLLA0_A09383g"
                     /note="similar to uniprot|P53320 Saccharomyces cerevisiae
                     YGR257C MTM1 Mitochondrial protein of the mitochondrial
                     carrier family involved in activating mitochondrial Sod2p
                     probably by facilitating insertion of an essential
                     manganese cofactor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451410.1"
                     /db_xref="GeneID:2896456"
                     /db_xref="GOA:Q6CXC9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC9"
                     /translation="MSGDRSSTAIMKERMLSACAGSFLTSFFLTPMDVVRIRLQQQVM
                     LPDCSCGAASELKGSVGTEVIYDHVVANKNSPKIFWQDVCFQDIQCKNSALRFNSTWE
                     AFTKISEVEGLATLWRGLSITLLMAIPANVVYFSGYEMFRDHSPMRDSYPSLNPLFCG
                     ATARMVAATTVAPLELIKTRLQSIPRSRKDTTTQMMFKDLLKETRNEIRSGGYKVLFK
                     GLEITLWRDVPFSAIYWGSYEFYKKNFWIDFSEQCLRWNLSPNWDFFINSFIGGSVSG
                     SSAALLTHPFDVGKTRMQITMDIENKQRNTLVSPKKRVSARGMFKFLYNIKQTEGYGA
                     LYTGLIPRVMKIAPSCAIMISTYELSKRLFAV"
     gene            complement(<820161..>820970)
                     /locus_tag="KLLA0_A09405g"
                     /db_xref="GeneID:2896479"
     mRNA            complement(<820161..>820970)
                     /locus_tag="KLLA0_A09405g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451411.1"
                     /db_xref="GeneID:2896479"
     CDS             complement(820161..820970)
                     /locus_tag="KLLA0_A09405g"
                     /note="some similarities with uniprot|P38872 Saccharomyces
                     cerevisiae YHR185C PFS1 Sporulation protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451411.1"
                     /db_xref="GeneID:2896479"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC8"
                     /translation="MMEAMGTQKPLGVNSTILNKHIPTKSPTKRTRTRMTLERADVRN
                     KGRIRYKTNVQDLNFLDSMDTSCDTGPQMIQLPSQSPYNQHFYQSNNSGNRNPDVSFH
                     SLPPEYEELQLQSQKQYQMQLQQHNYYSSSPVRHQPPEQQNAPQLPPRADNINTSMLV
                     FNSSGFNNCSPHSSVPIVTGFPSYFNPRQAKNMPHGEKVERWMENLPIYFEESEQMTH
                     TNCFSISDDSEFWEEDEFDNDLDDGIALTNSVEIIFLQQKRITALINKLYH"
     gene            complement(<821244..>824279)
                     /locus_tag="KLLA0_A09427g"
                     /db_xref="GeneID:2896490"
     mRNA            complement(<821244..>824279)
                     /locus_tag="KLLA0_A09427g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451412.1"
                     /db_xref="GeneID:2896490"
     CDS             complement(821244..824279)
                     /locus_tag="KLLA0_A09427g"
                     /note="similar to uniprot|P07276 Saccharomyces cerevisiae
                     YGR258C RAD2 Single-stranded DNA endonuclease cleaves
                     single-stranded DNA during nucleotide excision repair to
                     excise damaged DNA subunit of Nucleotide Excision Repair
                     Factor 3 (NEF3) homolog of human XPG protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451412.1"
                     /db_xref="GeneID:2896490"
                     /db_xref="GOA:Q6CXC7"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC7"
                     /translation="MGVHSLWDIVSPVAKPVRLESLNERRMAVDASIWIYQFLKAMRN
                     KEGDALRNAHIIGFFRRICKLLYYGIKPVFVFDGGVPVLKLNTIRERKERRQGKRDTA
                     NATARRLLARQIHQSQTDKESSPKKKKQSPDENGQTGSETGSFFYPHDEYHLPEIKGF
                     SYEKDDLRITDTDDYKTVMEQIDDLDGIDLDSINPASKEFDELPKSTQYLILSALRLK
                     SRLRLGYTKEQLEHVFSDSMEFSKFQIEMVKRRNFFTQKLMNVTGMHDGGASKLDDEV
                     VNRVSGQRDRKYALIRTDNGWALSLTGNDGSESTKAIKLDEDEEEDASQLDWEEVDTK
                     PKPKKKQLDYSMNASLLPRLSTTKTQGGSQSFFDKRPDLAPSTSHLLDEDEDDGTNDH
                     PAVNNVEKEDDNDSNEDDYAMLLKETKAMSEYQRRQKELPVQKNIIPQVEVNIESTES
                     ESDGEFEDVNFKPTVISNSEGGPSNSAAHRPSNDNTVSSIVEKPSAIPIIDHKVSQQN
                     LDSIVSKIPEFSFSLSMRGKAFEDNEKSEPGETAPTSTDTQEKQAQEVPAWFSSTANR
                     NPYSSSSFVADREKSDVRPEDQYGILTGEAAQELVKNRIGYHHPELIDLDQLERDDNE
                     DEVEDDAVIEVSKRDLNEQKSPSGKGFSTTKDSTSSRISEGNDSDSDNLVESESAATR
                     EQLPILDYDFYEDEEERLAEQLTREQEDYNHFKSTLNPNLVNTAFLEDELFEQQKKDK
                     RDADEVTIEMIHEIQSLLSRFGIPYITAPMEAEAQCATLLQLKLVDGVITDDSDVFLF
                     GGTHVYKNMFQEKNYVEYYSLDLFDQKLGLDRDKLIQLAQLLGSDYTPGLRGIGPVMG
                     VEILAEFGSLKEFAKWYNEGQFDKQKLEGETAFQKQLRKRLVSNEIILDDNFPSEAVY
                     DAYIHPTVDADKTKFVWGSPDLDKLRSFLQQTIGWDKAKSDEVLIPLIRDLNKRKATG
                     VQKRINEFFPVQYLQQDKQYKLGKRIETATSKLKKRRTE"
     gene            <825574..>827106
                     /locus_tag="KLLA0_A09449g"
                     /db_xref="GeneID:2896477"
     mRNA            <825574..>827106
                     /locus_tag="KLLA0_A09449g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451413.1"
                     /db_xref="GeneID:2896477"
     CDS             825574..827106
                     /locus_tag="KLLA0_A09449g"
                     /note="similar to uniprot|P53322 Saccharomyces cerevisiae
                     YGR260W TNA1 High affinity nicotinic acid plasma membrane
                     permease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451413.1"
                     /db_xref="GeneID:2896477"
                     /db_xref="GOA:Q6CXC6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC6"
                     /translation="MAVISVRGLDAVVSKDESLGEEVVEGNIDACKESVRSHEHDDNA
                     SYDEPPSLTHPMESRVVRKMDLYLVPLMCMLYFLSNLDKSNIGNAEVAGLSESLNLTG
                     NQYGNCVTVFYATYIFFDPIGANLLKIIGPKYMMTGCLICFGAISLGTAWVKDYGHLL
                     LVRVLLGAFEATIYPSINMYLSICYRREQYAIRFAWVFFAACISSSFGGLISYGCSKI
                     NGSLNAWQYIYIVEGCISLGFAPFYALGLANNLEESWFWTAEERQYIVDRYETMSTFN
                     PADKFEWSQVWLAVKDLKTWVSAVALFCIDMTAFGLTVFMPIIITSMGFSSVNAQLMT
                     VPVYFLTAITFFACAYVSDRIRIRSPFIVGACISCATGLAIVLGSDVHGVRLFGIFVL
                     ALGIYVNASMNCLWLSGNNGNYFKRATALGINLFVGSSSGLVSGQIFRAEDKPRYALG
                     LAICLGLQVFAAMLTVVQYYMYRRLNKQKQALIKRCEELDEPIPHDEHLSDMNPQFKY
                     MY"
     gene            complement(<827264..>831784)
                     /locus_tag="KLLA0_A09471g"
                     /db_xref="GeneID:2896485"
     mRNA            complement(<827264..>831784)
                     /locus_tag="KLLA0_A09471g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451414.1"
                     /db_xref="GeneID:2896485"
     CDS             complement(827264..831784)
                     /locus_tag="KLLA0_A09471g"
                     /note="some similarities with uniprot|P38873 Saccharomyces
                     cerevisiae YHR186C KOG1 Subunit of TORC1 a
                     rapamycin-sensitive complex involved in growth control
                     that contains Tor1p or Tor2p Lst8p and Tco89p contains
                     four HEAT repeats and seven WD-40 repeats may act as a
                     scaffold protein to couple TOR and its effectors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451414.1"
                     /db_xref="GeneID:2896485"
                     /db_xref="GOA:Q6CXC5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC5"
                     /translation="MVVYGPQPLTRLNTETRHGFEEQYSSEKLLEAHASNFIFYYDDK
                     RHRTNGNPVPEEVKQEDKDGYYQPIPDWKIVKDRQKTVAAALLLCLNLGVDPPDVTKT
                     QPCARLESWVDPLAFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCN
                     SLRRASKDERILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYV
                     WDCNSAGNIVSNFKKFVQKRLRDDREGNHDMASPSPTEAYTECVQLASCANNELLPMN
                     PELPADFFTCCLTNPIEISVKVFLMQSPLKDTKYSVFFQDNDPRRKETGVNEMPNITI
                     PGKLSERRTPLGELNWIFTAITDTIAWTSLPRALFKKLFRHDLMVAALFRNFLLAKRI
                     MPWYNCHPVSDPELPDSIADHPMWRSWDLAIDEVLTKLLESAHANAKNSNFPESQFIS
                     QPNEGNETNDGLQSKNTIGNLSSMSLVNFSSTAHTSSGNSASHPTTSQQQQQQFTKFF
                     EQNLTAFDLWVKYGANSRHPPEQLPIVLQVLLSQVHRVRTLVLLSRFLDLGPWAVYLS
                     LSIGIFPYVSKLLQSPAHELKPILVFIWARIFSIDYKNTQTELIKERGYQYFVKMLVP
                     EFGVPRGHSVSSAGSPLTMNVPASSSTQRYQMYQQQQQQQAYNNATLLSNNNTTDEQK
                     AMAAFVLSCFVRDFPLGQKHCFSTELVNKLCFFIENSEVPLLRQWCIILLGQLYIHNP
                     LHKTLCLENENMNTIIESLKDPIPEIRCAALLAIKYFLSEEDDVNIILKLQQEFQQQL
                     QQFQAQLQLLQSQQNQQQQQQQGNQQNSTHHIQQQYYQIQQQSQQVQTSMSQLQSINL
                     RNLKQFEIKTIITTLSLVNDGSPMVRKELIIFLSQVVERYIEFFTVIAFTEISTEIVA
                     LETNGHEDDSRNPTSVGHGSIFNTVWKALLISSEDPFVENRELAGDVVDYILIKLNEH
                     SKLAEMVKEMEQYILKRSVVNVKGFTSPNKLPAIRRPASLSNGKHDHYRNDTVSDRRV
                     FSMNSILKALGFANDQDSYSDHESTSSGNGKMAQGLSLMGIEYGTSPRAFPAMYRKRD
                     TPLTLPLESCFLNYCSEYFQEPQMKKQEADEPGSIEFTAREWKRNRNEAIIQETQSQK
                     ELALYGDWSHKIVTFDNKTQPKILLFTQFDNYIAASDDRDNITIYDWSTQEKLSRFSN
                     GNPFGTKITDMKFLNDDDTPLLLAGSSDGIVNIYKDFHDTEDLFMISSWRGLTDLLLT
                     PRSTGLLTEWQQSRGSLLVTGDVKIIRIWDALTESVEVDIPAKSSSLITSLTSDQFSG
                     NIFVAGYSDGSIRVYDRRMDPRDSMIRLWKTPKSDNSPVGSWVNNIHLQRGGYRELVS
                     GTNNGVVALWDIRADKPVCTFTDEGEPGKKLGSTMTSMQVHEHASIIATGTKEIKLWT
                     TSGDLLRTFKNHGSSHSGPISGMTTGARSSPFISTMAFHPHRMMLTANNSHDTTFNIY
                     ECLDNRRDYMYY"
     gene            <832430..>833317
                     /locus_tag="KLLA0_A09493g"
                     /db_xref="GeneID:2896331"
     mRNA            <832430..>833317
                     /locus_tag="KLLA0_A09493g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451415.1"
                     /db_xref="GeneID:2896331"
     CDS             832430..833317
                     /locus_tag="KLLA0_A09493g"
                     /note="similar to uniprot|P38874 Saccharomyces cerevisiae
                     YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p-subcomplex
                     of RNA polymerase II elongator complex which is a histone
                     acetyltransferase iki1 mutations confer resistance to the
                     K. lactis toxin zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451415.1"
                     /db_xref="GeneID:2896331"
                     /db_xref="GOA:Q6CXC4"
                     /db_xref="InterPro:IPR019519"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC4"
                     /translation="MASTNNNPKVLLKRTFSLKEQSSLILCTDTMAQSSRFVVEEFLD
                     NIPDEMPIVFVSFETPNRPKYARQFIDASGKTTQQLVAALQPYLPQPQEQAPKMHLVI
                     FDTFNYIGSESLTQFISTIASPFVTILATYHQSIPAWRPAELQNYPTAIQLLQFIANT
                     VIEVTPKTSIDEDDLDADLSRFVIPKNLNNPTYYITLTNKRKSGRAIKNKFLINSKTH
                     DYEYVIEKQEPVTDESPEMFEGLTTFNLNTSEKQKLAKDQVELPYLEAQSFNSGGAIV
                     YEFEKDDDYDEEDPYEDPF"
     gene            complement(<833455..>835386)
                     /locus_tag="KLLA0_A09515g"
                     /db_xref="GeneID:2896850"
     mRNA            complement(<833455..>835386)
                     /locus_tag="KLLA0_A09515g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451416.1"
                     /db_xref="GeneID:2896850"
     CDS             complement(833455..835386)
                     /locus_tag="KLLA0_A09515g"
                     /note="similar to uniprot|P38875 Saccharomyces cerevisiae
                     YHR188C GPI16 Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds GPIs to newly synthesized proteins human PIG-Tp
                     homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451416.1"
                     /db_xref="GeneID:2896850"
                     /db_xref="GOA:Q6CXC3"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC3"
                     /translation="MRLQNWIPVLLLAAIVTAEVDFEVNPVDNETESVQQDVIDESWN
                     AEPGESSRITQSSKFLSLEHPIEYNFREHLDLTPLPNNFLLASFQFYMQSEPFGIDRD
                     QHESSEYSHHTVFPKPVGPIMSQTNTRQLHLRFTHGLWDSQEWGQLPHNGLKSGGTGV
                     ELWAIVEAPSKEEALKSWITLANSLSGLFCASINFIDTSKTTFPVSSFLPKEDEAIPL
                     LNQSNHLYLMRATLANEPVCTENLTPFVKLLPTRGKSGISSLLDGHKIFDSNWHSLSI
                     DVNTVCDESTANCHFVMEEFIETVVNVPNALARADRPIPKPLPGDELRCDTNRPHDAF
                     QCFPLPQSKEVSFSISKLFGKKIRGGSLLGEQSSKICVHVPSHWDVMIQVDESYFATD
                     DNCFDLNNNKPHDVRLETTDSKSVLPSKKTPIYVSRALTGYGQDRGGLRSVFRNPSNE
                     AVELVYFESLPWFMGVYLSSLAIESDDPELTLDSVVKSTFYSPARDRERPTHLERAMI
                     IPPNTAFAISFQFDKSLLKYAEYPPDANHGFEIEAAVAAVLTPERYEARTSSLLLSLS
                     TPDFSMPYNVIILTSTVMGLAFGTLFNLISKQLITLEEADKILASTGPRAKLLRVKAK
                     IVNMLQGNKNKIIKSAKYE"
     gene            <835653..>838517
                     /locus_tag="KLLA0_A09537g"
                     /db_xref="GeneID:2896398"
     mRNA            <835653..>838517
                     /locus_tag="KLLA0_A09537g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451417.1"
                     /db_xref="GeneID:2896398"
     CDS             835653..838517
                     /locus_tag="KLLA0_A09537g"
                     /note="similar to uniprot|P49955 Saccharomyces cerevisiae
                     YMR288W HSH155 U2-snRNP associated splicing factor that
                     forms extensive associations with the branch site-3'
                     splice site-3' exon region upon prespliceosome formation;
                     similarity to the mammalian U2 snRNP-associated splicing
                     factor SAP155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451417.1"
                     /db_xref="GeneID:2896398"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC2"
                     /translation="MEAIKFEKSGQRHSLTGQYTAPRAILESTVGKDEGDDELTANQK
                     QRSLYNKQSDYHKRRFLRNLDEEVDEEQVKDVKRRKTDKDGDKEEESGGGYTMPKTSQ
                     HIITELSEEMVTEVPGVRNLQFFKPSDRQHFAILFDERSPEDMTEEERKQKQVLKLVL
                     KVKNGLPSSRKIALRALTQKAPSFGAPLLFDSILPILLDKTLEDEEHQLMLKLMDRIL
                     FQLQDLVKPYTHKLLIVLCPMLIDPVPLTRSTGRDIITTLAKAVGLPTMIYTMRPDLD
                     HEDEYVRNTTARAMAVVSKAFGVSQTIPFLRLVCRSKKSWKARHTGIKIIQQIAILVG
                     IGSLPYLDDLIACIEKGFQDEHPPVRIIAAQTVSSLAQSCQPYGIERFNPVLEPLWRG
                     VKQNRGRELAAFLKALGFLIPLMDPEYASYYAEEVMKIVKREFNSPNEDMKKTVLFVI
                     QKLSVTEGVTPQYLRKELAAEFFKQFWVRRSALDRQLNNIVTFTTVLLANKTGAAFTL
                     EKLIYPLKDESEPFRTMGAHAVNRVVKALGMTDVDERLEARLLDALLIAFQDQTNGER
                     IVYRSIGTVAKSLNTRMKPYISPVSSIILEHLKHKKPLVRTHAASLCALLIPVFKHCE
                     ETALINKFNIILFESLGEVYPEVLAAIISAMDKAAAQIRLTDLQPPPNQILLSLTPIL
                     RNNHPLVQESTVKLVGRIARRGPEYVSPKEWMRICSELLEMLKSPVKSIRVAANRTFG
                     YIAKAIGPQDVLVTLLNNLKVQERQLRVNTSIAIGIVAKTCGPFVVIPALMNEYRTPD
                     TNVQNGILKALAFILEYIGPMSKDYIYPLIPLLQDALTDRDLVHRQTAATCIKHLAFN
                     CAGRGLEDAFIHCMNLLLPNVFETSPHVISRILEGLEGLRMALGPGVSMNYAWGGLFH
                     PAKNVRNAYWKLYNGAYVAQPDALVPYYPVNEVEELNLLL"
     gene            complement(<838592..>840970)
                     /locus_tag="KLLA0_A09559g"
                     /db_xref="GeneID:2896855"
     mRNA            complement(<838592..>840970)
                     /locus_tag="KLLA0_A09559g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451418.1"
                     /db_xref="GeneID:2896855"
     CDS             complement(838592..840970)
                     /locus_tag="KLLA0_A09559g"
                     /note="similar to uniprot|P46682 Saccharomyces cerevisiae
                     YGR261C APL6 beta3-like subunit of the yeast AP-3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway suppressor of loss
                     of casein kinase 1 function putative beta adaptin
                     component of the membrane-associate clathrin assembly
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451418.1"
                     /db_xref="GeneID:2896855"
                     /db_xref="GOA:Q6CXC1"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC1"
                     /translation="MVDSIQRITSVLQSARDLTFGAAAVASSRIGESSYTQYSKSIDP
                     EALTRLLSSRNSREVKDAMKRVMSLMATNDPTVDLKSMFADILKNISSEDVKVKRMVC
                     IYLLRFAESDPNVALLSVNTIQKNLQDRDPEAKALALKALSDINVASLYPITLQSVKK
                     CVSDASPLVRATSAMTLFKLFQDSKSHDEEDDVRRHDLVPLLQELLADPDPLVISCTL
                     VVLQNCLPDRLDLLHGHFRRYCAVLPSLSHWAQSLLVEMFIRYSKHFIKRPVFVNRED
                     RSETPLPETPELVDSWFLEANDLIIDPDLDLFLTSLKPLLFSSNASVIISVSRALFML
                     APLSKFREFGMPHCLVKALQLSSTENRCIIVQMIAYYASIDPEAFASLYRSFLPTADD
                     DPIVGSYKLTIISLLITDKNVKDIIHELKYYITTYRDPAIVKKALSTLVVCAHNSNAF
                     SAHIMKWLLSFMENDNLTDSEVTSEYVNVIRHLIQINPSKNLSVMLKLSQIITETDNL
                     SAYAKAGIIWLFGEYIHVEPRIVPDVLRKLIPKFADESTEARLQILILAAKLLSFDID
                     RCESDYDFEQSRIAHLYDAVMYLAKFDDDFDIRDKVRSLSSLFSHERFEILTLLLQAA
                     KPWPALSLFTYGDKASDLAHLELSPEVLNSLKVPQWSTEVPEVDRTPVETNNFMKNKS
                     SISSNTFFASRTRANYQQPKASSPISSKSSSPEPKTFTSSKGKTYKLQSLDEFFADIP
                     EKPKKTKIVIEEESETESDVAQLEESSSDESDDTDDIEEGEEDDRSSTSSDP"
     gene            complement(841221..841293)
                     /locus_tag="KLLA0_A09581r"
                     /db_xref="GeneID:2896834"
     tRNA            complement(841221..841293)
                     /locus_tag="KLLA0_A09581r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2896834"
     gene            <841883..>843100
                     /locus_tag="KLLA0_A09603g"
                     /db_xref="GeneID:2896321"
     mRNA            <841883..>843100
                     /locus_tag="KLLA0_A09603g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451419.1"
                     /db_xref="GeneID:2896321"
     CDS             841883..843100
                     /locus_tag="KLLA0_A09603g"
                     /note="similar to uniprot|Q03266 Saccharomyces cerevisiae
                     YMR289W ABZ2 4-amino-4-deoxychorismate lyase catalyzes the
                     third step in para-aminobenzoic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451419.1"
                     /db_xref="GeneID:2896321"
                     /db_xref="GOA:Q6CXC0"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:Q6CXC0"
                     /translation="MPSGELNDAALAAIKEKIGQDTIEQNFNISSQDFQILATIRYDP
                     HFTHVFEPDGNDSVEYDHCLSQLDPQLTSLMDSSSFLQSDDSGSLGNGLLDYLDSSSV
                     NSSPISEGFEFNASSAIQRDPVFQSLYGTNYSHTQQGEATVDDVDIWSIYYDRFFLLG
                     EHYKRLKLALAFFQWKLALTPRMLLTQLIHSLPIQESLSIEDKMKALLSASTPYKMRV
                     LVNKDGTMKIEAHELPQFLTTCPSTHEYLVQNLLSGYLDHAPTWDVYINPEPIVVSPF
                     TTFKTTKRDHYNKARENMEVLKLSVQDPRPKSEVLVYNDLYQLMEGSITNVAVKSKPT
                     ENSNAFRYTTPYLSSGCLCGVTRYFLLRKGLLQEDSIDVRDLSVGDEILLFNGIIGCV
                     KGVIRNSVDFSNT"
     gene            complement(<843147..>843938)
                     /locus_tag="KLLA0_A09625g"
                     /db_xref="GeneID:2896318"
     mRNA            complement(<843147..>843938)
                     /locus_tag="KLLA0_A09625g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451420.1"
                     /db_xref="GeneID:2896318"
     CDS             complement(843147..843938)
                     /locus_tag="KLLA0_A09625g"
                     /note="highly similar to uniprot|P53323 Saccharomyces
                     cerevisiae YGR262C BUD32 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451420.1"
                     /db_xref="GeneID:2896318"
                     /db_xref="GOA:Q6CXB9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /translation="MSAEIIASIADVLTDNIPLTPISQGAEAVVFTSPVHPYLPKNRT
                     DGDDKLYILKYRPEKKYRHPVIDKTLTKHRTLGESRLLAKLRLIDGLNVPKLIGCDPY
                     HGCIWLEFLGEDLPNGHGFSNLKNFLWMNASDPYSDLVRDTMINVGKQIGLMHWNDYC
                     HGDLTTSNIVLVRAGEDWQPYLIDFGLGSISTLVEDKGVDLYVLERAIISTHSSFANR
                     YNLWVLEGFKSVFESHGKAGLGKYKDLIRRFEEVRLRGRKRSMIG"
     gene            complement(<844245..>846578)
                     /locus_tag="KLLA0_A09647g"
                     /db_xref="GeneID:2896823"
     mRNA            complement(<844245..>846578)
                     /locus_tag="KLLA0_A09647g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451421.1"
                     /db_xref="GeneID:2896823"
     CDS             complement(844245..846578)
                     /locus_tag="KLLA0_A09647g"
                     /note="highly similar to uniprot|P00958 Saccharomyces
                     cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
                     complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
                     which increases the catalytic efficiency of both tRNA
                     synthetases also has a role in nuclear export of tRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451421.1"
                     /db_xref="GeneID:2896823"
                     /db_xref="GOA:Q6CXB8"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB8"
                     /translation="MTNIRRNGDRFTTKRATDTLRPISLAMASSHISFDQSKGHTSAL
                     QLANNIKLAYALLSSGNLKLEENKDVLIPQLVIDSTGFRLFDANAILRYVLNDFEEEE
                     SNEYNFAVSSLEAFASHKDPIKEHLAEAVQKSLDNYLTSVEEPLSATRIVIFANTYAL
                     DPAAVEARITSLPERLQEALKLAKTKIVRSSTDYKHTGAVNVSQEHLMKSQDAEILPK
                     EGERNILITSALPYVNNVPHLGNIVGSVLSADIYSRFAKGRNYNALYICGTDEYGTAT
                     ETKALEDGVTPRELCDKYHKVHSDVYKWFQIGFDYFGRTTTEKQTAIAQDIFMKLYDR
                     GFLEEQTMKQLYCPAHKGYLADRYVEGTCPKCGYEDARGDQCDKCGALLNPFELIDPR
                     CKLDDGVPEPRDSDHIFMSLDKLEPEIKKWVDEASSKGNWSKNSKTITQSWLKEGLHP
                     RCITRDLVWGTPVPLENYKEKVLYVWFDACIGYVSITANYTNKWEQWWKNPNNIDLYQ
                     FMGKDNVPFHTVIFPGSQLGTGDDWTMLHHLNTTEYLQYEGGKFSKSRSIGVFGNNAQ
                     EIGLSPSVWRYYLISVRPETSDSQFSWSDFAARNNSELLANLGNFVNRVVKFVNAKYN
                     GVVPDFNVDNLPGYAQLKKDIDEILTNYVDNMEKVHLRRGLEIAMTLSARGNQFLQDN
                     KLDNSLFAQEPAKSDAVVGVALNIIYTVASIMSPFIPETSEIIYRMLNAPALRIDDHF
                     NLPIRPGHNINKAEYLFSRIDEKDVEKWRSKHSGKQV"
     gene            complement(<847036..>848529)
                     /locus_tag="KLLA0_A09669g"
                     /db_xref="GeneID:2896371"
     mRNA            complement(<847036..>848529)
                     /locus_tag="KLLA0_A09669g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451422.1"
                     /db_xref="GeneID:2896371"
     CDS             complement(847036..848529)
                     /locus_tag="KLLA0_A09669g"
                     /note="highly similar to uniprot|Q03532 Saccharomyces
                     cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
                     localizes to both the nuclear periphery and nucleolus
                     highly enriched in nuclear pore complex fractions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451422.1"
                     /db_xref="GeneID:2896371"
                     /db_xref="GOA:Q6CXB7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /translation="MAGNKRVRDAESEQDHAETETVVKDTATTGEVEGSFSDLKLSDG
                     TMKAIGKMGFTQMTAVQTRTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIEMLHSLKFK
                     PRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLMKGVNIL
                     IATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSML
                     FSATQTTKVEDLARISLRPGPLFINVDSEKDTSTADGLEQGYVVCESDKRFLLLFSFL
                     KRNQKKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGI
                     LVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPTELG
                     FLRYLKAAKVPLNEYEFPTNKIANVQAQLEKLIKSNYYLHQIAKDGYRSYLQAYASHS
                     LKTVYQIDKLDLAKVAKSYGFPVPPKVNITIGASGKTPATKKRRTKD"
     gene            <849221..>851305
                     /locus_tag="KLLA0_A09691g"
                     /db_xref="GeneID:2896333"
     mRNA            <849221..>851305
                     /locus_tag="KLLA0_A09691g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451423.1"
                     /db_xref="GeneID:2896333"
     CDS             849221..851305
                     /locus_tag="KLLA0_A09691g"
                     /note="similar to uniprot|P53326 YGR266W Saccharomyces
                     cerevisiae probably contains a single transmembrane span"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451423.1"
                     /db_xref="GeneID:2896333"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB6"
                     /translation="MSDASTWFNEVDPRELYADKVIGCDGCGDSPLNGKKDGIVCGPI
                     LRLINVDYEKNLYRGSMLIVTKGEVAEPKVEFQVGQSEEKNLGSESKHPNLETGQFVA
                     TKFYSESDYSFYRYAIEIELDSVERMCKYSIDGKLEPQYRFFIPSQTTNFNTISVSCN
                     GFSLSVDTTKFKGSMWYDILRKHANVHYHVILGGGDQIYSDSIKLYCESFQNWLKTSD
                     PIKKYSTKCSPEMRSDMDQFYLKEYLEWFGYGHWKGSTENSRTTQRCFPIAMSTIPSI
                     NMFDDHDIIDGYGSYSHKFMFTDVFKSVGKSAYKYYMLFQHHTSIEEPEAYNKEKCWV
                     IGAQPGAYIGEKSHSVYTRLGPTMAVLGIDCRTERKLTEICSKKTYDILFDKLAQDAK
                     LGKLDHLLLMLGVPIAYPRLVWLEYIFSSKFLFIFKWLSKKGILAKGLVNEFNGDVEL
                     LDDLNDHWCAHYHKKERNYLLARLQDFSAKQGIRVTILSGDVHLASVGRFKSKVHTHH
                     ITSAKVDQDKKVLNEPEKDVRLMLNVISSAVVNTPPPDQMAKLLQKRVKNHHFDASTD
                     EDSVPIFTTDVDGENRSSNAFMNRRNWSDIIPVTTVLKNKYLNDQYKFEIGDKIVPGR
                     VGIKTQIDEKTNIGHIPYPVTEKGIIATIHIEKDTSSAESETVGYTIPIPELQATEEN
                     LSHAGIKHLDLA"
     gene            <851952..>853625
                     /locus_tag="KLLA0_A09713g"
                     /db_xref="GeneID:2896833"
     mRNA            <851952..>853625
                     /locus_tag="KLLA0_A09713g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451424.1"
                     /db_xref="GeneID:2896833"
     CDS             851952..853625
                     /locus_tag="KLLA0_A09713g"
                     /note="similar to uniprot|Q03533 Saccharomyces cerevisiae
                     YMR291W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451424.1"
                     /db_xref="GeneID:2896833"
                     /db_xref="GOA:Q6CXB5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB5"
                     /translation="MSIATSDYSRIDDKVWPTANRTGPKEDPSKYHCTYVTKKVALGD
                     GHFSVVKECMNTMTGDRYAMKLVHKSLVMDKLQLIQREVSVLKRVSSLIRELETLNQK
                     VAGSGSNHGDVFEGHHHVLQLFDFFETSKSIVLVTQLCESEDLYDKILNAGHLDLETQ
                     VKPFTACLLSALQFLHGNGIIHRDLKAENVLFRLKTKTNMIELPRDDAMYDKSAHDLI
                     LADFGLAISTETGSKEFVGTISYLAPELVACKNSGKQSSIQNGRLKPYGTGVDVWALG
                     VLCYFMACGYMPFDCETDAETMEYIANSDYYMDEDMSKDDKYKQFWSFLEKCFEVDMD
                     KRASADELSAHSFVCPQYFPNKSPTPIIDSPRAPALRVSKSSTSLHSLEPPSRSASTV
                     SLNLNEPMKRSDSREVNLNRIRETLRKTLSMTSIKREPNVLLNVPSGSNSANFNRASS
                     TLKLEPEPPNVALMNGCLCATPESCSNFTTSPSMSRNGSKNNLQTAIGSWNESSLSGL
                     NSGATLAFDRNSFDFTKLNNTSLSPSVPTSSSSNDARKDKIVFQLGEDD"
     gene            complement(<854163..>854900)
                     /locus_tag="KLLA0_A09735g"
                     /db_xref="GeneID:2896322"
     mRNA            complement(<854163..>854900)
                     /locus_tag="KLLA0_A09735g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451425.1"
                     /db_xref="GeneID:2896322"
     CDS             complement(854163..854900)
                     /locus_tag="KLLA0_A09735g"
                     /note="highly similar to uniprot|P51601 YGR267C
                     Saccharomyces cerevisiae FOL2 GTP-cyclohydrolase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451425.1"
                     /db_xref="GeneID:2896322"
                     /db_xref="GOA:Q6CXB4"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB4"
                     /translation="MENKHISHVSQIERRATPLNIRPASPYTLNPTVEKDGLSWPSIG
                     ARERAEETDEEEQKRVGRIADAVKTILSELGEDTEREGLLDTPTRYAKAMLYFTKGYQ
                     DNIMNDVIKNAVFEEDHDEMVIVRDIEIFSLCEHHLVPFFGKVHIGYIPNKKVLGLSK
                     LARLAEMYARRFQVQERLTKQIAMALSDILKPRGVAVVIEATHMCMVSRGVQKTGSST
                     VTSCMLGYLRESHKTREEFLNLLGRRY"
     gene            complement(<855406..>855999)
                     /locus_tag="KLLA0_A09757g"
                     /db_xref="GeneID:2896843"
     mRNA            complement(<855406..>855999)
                     /locus_tag="KLLA0_A09757g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451426.1"
                     /db_xref="GeneID:2896843"
     CDS             complement(855406..855999)
                     /locus_tag="KLLA0_A09757g"
                     /note="some similarities with uniprot|P40325 YGR268C
                     Saccharomyces cerevisiae HUA1 uncharacterized ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451426.1"
                     /db_xref="GeneID:2896843"
                     /db_xref="GOA:Q6CXB3"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB3"
                     /translation="MKSESDIQPDEHLPSYDEVLRQDTAAASQQQQQLPPNPPPRPTQ
                     PPARPPRPSNAIPAYHHSTSTFSSSTSTSTGNKKLPWTYPPGYYCKKCGNTGTKIKTQ
                     QKCKKCWSKFYKPPPAQPPRPSAGPRPAFVYSNVTMPPQNFVINSAPIVVRPGDSRIG
                     GMMCNNCNGTGRVRFFLDKEPCPVCYGLGRILTGPTY"
     gene            complement(<856553..>857008)
                     /locus_tag="KLLA0_A09779g"
                     /db_xref="GeneID:2896853"
     mRNA            complement(<856553..>857008)
                     /locus_tag="KLLA0_A09779g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451427.1"
                     /db_xref="GeneID:2896853"
     CDS             complement(856553..857008)
                     /locus_tag="KLLA0_A09779g"
                     /note="some similarities with uniprot|P40325 Saccharomyces
                     cerevisiae YGR268C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451427.1"
                     /db_xref="GeneID:2896853"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB2"
                     /translation="MAASVKQSGILPSYDEAVGQGSSTGASRHQEASNDEPNDEPNDE
                     SNDASNDIPNNATNSTTTSSCNTGTDIDQLPWTYPPWYYCRRCGNTGVETRTQRRCRT
                     CWSRFNRRQFPARRGLILTVVLLGVAVVKHLGKHVSNASHASHAAHATD"
     gene            <857479..>858089
                     /locus_tag="KLLA0_A09801g"
                     /db_xref="GeneID:2896377"
     mRNA            join(<857479..857506,857695..>858089)
                     /locus_tag="KLLA0_A09801g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451428.1"
                     /db_xref="GeneID:2896377"
     CDS             join(857479..857506,857695..858089)
                     /locus_tag="KLLA0_A09801g"
                     /note="similar to uniprot|Q03554 Saccharomyces cerevisiae
                     YMR292w GOT1 evolutionarily conserved non-essential
                     protein present in early Golgi cisternae that may be
                     involved in ER-Golgi transport at a step after vesicle
                     tethering to Golgi membranes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451428.1"
                     /db_xref="GeneID:2896377"
                     /db_xref="GOA:Q6CXB1"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB1"
                     /translation="MSSWLSESQQFGAVFTFGGCLFFLFGIFTFFDRALLAVGNILFL
                     LGVLLMIGPHKTLKFFTRPTKRRGTLFLVFGIFMILCKWTFLGFIIESLGIVGLFGDF
                     FGVILQLLRSIPIIGPVLSHPTIAPVLDRIAGVSVLPV"
     gene            <858458..>862417
                     /locus_tag="KLLA0_A09823g"
                     /db_xref="GeneID:2896382"
     mRNA            <858458..>862417
                     /locus_tag="KLLA0_A09823g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451429.1"
                     /db_xref="GeneID:2896382"
     CDS             858458..862417
                     /locus_tag="KLLA0_A09823g"
                     /note="similar to uniprot|P40340 Saccharomyces cerevisiae
                     YGR270W YTA7 Protein of unknown function member of
                     CDC48/PAS1/SEC18 family of ATPases potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451429.1"
                     /db_xref="GeneID:2896382"
                     /db_xref="GOA:Q6CXB0"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXB0"
                     /translation="MTLHSKSGDDESGTHTEFYDDNGIAHTTPRLLKKVNYAEIENGY
                     DYIEESDTNSGGTAAVGANYSDTGTGRRRGRRPGQRNKRVRDDDDDDDVSFHEEDVDD
                     DDDDDDDVDDGDEYIDPADDRKRIARRRDKNFIVKDDEDGSDGNEDYSIKEEDLDEDE
                     DDGDEDEEDDDGTVRRGRRPKRSAARSTRREQPPRKLRPHRTRSSRVVDDDEDDDDTV
                     GSGRHRSASARTREALTLEDEIRELQEDSPIREKRSLRERTKPVNYTIPPPLSENQIG
                     AMEATSVPGIPPGTLPYQSSVYQSPRGKRGLHSGQSFGPIRRLFPTGGPFGGNDVTAI
                     FGKNVQFYNSNPNALNEQSNKFLDSDSSDDEILALGMKPKPKDPSKQKKKKKPEIADL
                     DPLGVDMNINFDDVGGLDNYIDQLKEMVALPLLYPELYQNFNITPPRGVLFHGPPGTG
                     KTLMARALAASCSNEKRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKHQPAIIFF
                     DEIDGLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQIIIIGATNRPDAVDPALRRPG
                     RFDREFYFPLPDLKARDKILHIHTKKWNPPISDQFISKLASLTKGYGGADLRALCTEA
                     SLISIQRKFPQIYKSEEKLKIDPKSVRVKARDFMLALEKIVPSSARATGSTAQPLPKY
                     VEPLLAQQFINVKDQLNLLLPKQSTKLKSGSSIIQYYLENEDLEDSDDEEGTGFDKHE
                     FLKLIKKSRVCKPKLLITGPPGNGLQYIASATLHFLEDYNIQMLDIPTLVSESSRTME
                     AALVQTFAEAKKRQPSVICIPNLELWLQACPQSCLITLTTLFRSLQSNENVVLLAIAD
                     GLSRAEIEDGPLAMFSFGPNIVNINEPSPHQRFMYFKTVADLIKMKPTQYIESRKRKK
                     PLPKLPVVETSQEIDENGRLLTEEEKLRLELKKFQHQDMKLKNTLKIKLSGLMDLFKN
                     RYKRFRKPPIDDTFLIHLFEPETFAANQGWQPAYVKDGDMILEVATGRKFYNMDLDII
                     EERLWNGYYSEPKQFLKDIELIYLDATTSADRERVIKASEMFANAQVGIEDISQPEFV
                     AECKATRQRELLRQELFIKEKSERVDKEQQILLQNNPTQTDSIATVELTTASGNQVQS
                     QAQLDAGTLDLGETSQVEPFTTQPVNFGTNDADLAKTDTVQDYSESRLTNAENGFAQT
                     SHNNSHLTVDTEDATNKEQEKQPPSVTEAEVEPEAQSEPEPESEPESELEPEPEFVYD
                     ESRALSLISALEKNTQNFTVEKLEEVYASIANVIWNNRLSWDKTDALDQLEGLIKTL"
     gene            complement(<862467..>863876)
                     /locus_tag="KLLA0_A09845g"
                     /db_xref="GeneID:2896507"
     mRNA            complement(<862467..>863876)
                     /locus_tag="KLLA0_A09845g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451430.1"
                     /db_xref="GeneID:2896507"
     CDS             complement(862467..863876)
                     /locus_tag="KLLA0_A09845g"
                     /note="similar to uniprot|Q03557 Saccharomyces cerevisiae
                     YMR293C Uncharacterized ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451430.1"
                     /db_xref="GeneID:2896507"
                     /db_xref="GOA:Q6CXA9"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA9"
                     /translation="MSIKTALSRLQQIPEIQSRYNVFTYVNERASSQLESIDKNTTAD
                     KPLNYTLAAIKDNIATKNMPSTCASKILDGYMSPFDATVVSLLLEAGTVIAGKANMDE
                     FGMGSAGIHSHFGPTFNPLFDHKDRVIAGGSSSGSAAAVASGVVDFALGTDTGGSVRL
                     PASYTSTFGFKPSYGRLSRHGVISYAQSLDTVGVFANDLSMIDRVFSLLDKHDKKDPT
                     SLSEELRHKFTSLTTKRKTLRIGIPEEFSQESVPAEFRAAMTAIIKRLMKKGHEVYPV
                     SIPSVKNALSIYYTLSPAEAVSNLSRYDGVRYGYRAESDVEDGTLFTPTRSAFGPEVQ
                     NRIILGNYNLCSESFKNNYIKAQKLRVQLINDFDRAFRFPNVLSGNSVNKDGVDIMLS
                     LTSTSFPTTYDEVVSEENKNPLNTYINDIFTMPMSLCGLPTMTVPAGHAFGIQVFSQH
                     GNDYELLDACSEIDALVNS"
     gene            <864111..>865193
                     /locus_tag="KLLA0_A09867g"
                     /db_xref="GeneID:2896421"
     mRNA            <864111..>865193
                     /locus_tag="KLLA0_A09867g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451431.1"
                     /db_xref="GeneID:2896421"
     CDS             864111..865193
                     /locus_tag="KLLA0_A09867g"
                     /note="similar to uniprot|Q75D83 Ashbya gossypii ABR141W
                     ABR141Wp and some similarites with YMR294W uniprot|P36224
                     Saccharomyces cerevisiae YMR294W JNM1 Component of the
                     yeast dynactin complex consisting of Nip100p Jnm1p and
                     Arp1p required for proper nuclear migration and spindle
                     partitioning during mitotic anaphase B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451431.1"
                     /db_xref="GeneID:2896421"
                     /db_xref="GOA:Q6CXA8"
                     /db_xref="InterPro:IPR028133"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA8"
                     /translation="MAVEIIDLSTEVEQLGLQGDTGKEVYETSDVEETPDQVVITEAN
                     EDIIEEEIPKVQENNERFEHSVLSSEDTDFSGKLYALPTYNIRHINETRRQRLARIRR
                     ELLEIEQDSEEDGSSNELQNLKQLYETLAQSTESTMENIQSQLVIASDEDTENEVTLP
                     NIRIEINQLKQLEDIEHKISILESQIGPSNTNKSITSIINELHREINILKLDEPTLTG
                     FQNKMKEISDQYDQSIIGRRAQKDPNLSTDIERKLKSTESKVNDIYDKYNILNKYSEV
                     IPQITERVQSLNVLHTSVNDMNDTVSEINDHMSSVHSQIEKWSSLLESTSRQLTDREQ
                     SFKRTRHQLELQLNDLEVRIGKLSGQ"
     gene            <865422..>871304
                     /locus_tag="KLLA0_A09889g"
                     /db_xref="GeneID:2896409"
     mRNA            <865422..>871304
                     /locus_tag="KLLA0_A09889g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451432.1"
                     /db_xref="GeneID:2896409"
     CDS             865422..871304
                     /locus_tag="KLLA0_A09889g"
                     /note="highly similar to uniprot|P53327 Saccharomyces
                     cerevisiae YGR271W SLH1 SKI2-like helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451432.1"
                     /db_xref="GeneID:2896409"
                     /db_xref="GOA:Q6CXA7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA7"
                     /translation="MSTTYSVHSVGSYMKAMEVMVSAAQAFPHLDTSTIPKVDEELKK
                     GTKRSDNRNKLLVTSQDRNEWDDIFEEFANLSSDNLQSLITSNHSASNAQAQVYKELF
                     RLLDNVDSDFPRDQLLQQLIELLRNNENTGTADQDLFDYLGAENIELISFLIENQEIL
                     KHTPIEHMSNSDTYEGNRFMTEEDMRRQVLKNREKGKNAKLATAQRKVKYPHVFRQSE
                     DAGSSMLSFAGQKFALPAGSMRYTFQTHEEITIPCAVPKRKFDIPLVKVSDLDEYCRK
                     VFEYDYLNKVQSLVYPVAYNTNGNMLICAPTGAGKTDIALLTILNTIKQFSVINEEGG
                     FDIEYDDFKIIYVAPLKALAAEITDKFARKLSVFDVKVRELTGDMQLTKREILETQVI
                     VTTPEKWDVVTRKASGDNDLTSKVKLLILDEVHLLHEDRGSVIESLVARTLRQVESSQ
                     TMIRILGLSATLPNFVDVADFLGVNRNVGMFYFDQSFRPKALEQHLIGCRGKAGSKQC
                     RENTDKVAYEKAVEMMKLGNQVMIFVHSRKDTVKTARTLISMARDNYEMDLFTSNDAS
                     VTIFQKELSKHKDKDLKELFQSGFGVHHAGMSRSDRNITEKMFKSGAVNVLVCTATLA
                     WGVNLPADCVIIKGTQVYDSKKGGYTDLGISDVIQIFGRAGRPGFGSDYGTAYLCTSN
                     DRLDHYVDLITQQHPIESRLGAKVVDNLNAEISLGTVTNVEEGVKWLGYTYMFVRMKQ
                     NPFTYGIDWEEIRNDPQLYEKRRQIIITAARRLHSLQMIVFDEVSMHFIPKDLGRIAS
                     EFYLLNESVEIFNQVANPRATEADVLAMISMSSEFDSIKFREEESNELNKLLDCAVEC
                     QISGDVDSSPGKTNILLQAYVSQSRINDSALNSDANYIAQNSARICRALLLIGINRRW
                     GTFSKVMLDICKSIEKRMWAFDHPLCQFDLPDTILRNIKAKNPSMEMLLDMDAAELAD
                     LVHNQKMGGKLYRIISRFPRVDIDAEIFPITTNVMRVHISLLPNFEWDYHVHGDAQFF
                     WVFVEESNQSSILHFEKFILNKRQLSNPHEMDFMIPLSDPLPPQVIVKVVSDTWIGCE
                     SAHTISFQHLIRPHNETLQTRLQKLNPLPTSALKNPLVESIYPFKYFNPMQTMVFHTL
                     YHSNVSTFVGSPTGSGKTVVAELAIWHAFRDYPGSKVVYIAPMKALVRERVNDWRKRI
                     TPVTGDRIVELTGDSVPDPQDIKDATIVITTPEKFDGISRNWQTRKFVQNVSLIIMDE
                     IHLLASDRGPILEMIVSRMNYVSSQTKKPIRLLGMSTAVSNAFDMASWLGVKGNGLYN
                     FPSSVRPVPLKMYIDGFPDNLNFCPLMKTMNKPAFMAIKQHSPEKPVLLFVASRRQTR
                     LTALDLIHLCGMEDNPRRFLHIDDEEELQYYISKVSDDTLKLSLQFGIGLHHAGLIES
                     DRAISHELFLRSKIQILVATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDIL
                     QMMGRAGRPAYDTSGTAIVYTKESKKMFYKHFLNVGFPVESSLHKVLDDHMGAEIASG
                     TISTKQEALDFLNWTFLFRRAHHNPTYYGINDDTSTSGINKYLSDLVNNTLDNLKESR
                     CVEIYGTNIYSTPYLSISSYYYISHKTIRSLLKQINSNASFQDVLKWLSLAVEYNELP
                     VRNGEIIMNVEMSAQSRYSIESTFIDEFELPMWDPHVKAFLLLQAYLSRAELPIVDYH
                     QDTISVLDQSLRILQAYVDVAAELGYFNTVMTLIKAMQCVKQGYWYEDDPISALPGAH
                     LKRDDRIEFGDDGWPLPDNGYKMSLDSLARLQDDNGAKNKVKNIMSRQYHVTPDHQKR
                     MLREISRLPILDNIVFTSQTSNESLVLKATHHNRVPKEFSVYCAKYPKTQRELWFAIA
                     YQNDELIMLKRCQPRLGPNGKGLLSFDFVVPEDIRGKELDFVLVSDALDIKYHLKHKL
                     ME"
     gene            complement(<871390..>872076)
                     /locus_tag="KLLA0_A09911g"
                     /db_xref="GeneID:2896384"
     mRNA            complement(<871390..>872076)
                     /locus_tag="KLLA0_A09911g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451433.1"
                     /db_xref="GeneID:2896384"
     CDS             complement(871390..872076)
                     /locus_tag="KLLA0_A09911g"
                     /note="similar to uniprot|P53328 Saccharomyces cerevisiae
                     YGR272C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451433.1"
                     /db_xref="GeneID:2896384"
                     /db_xref="GOA:Q6CXA6"
                     /db_xref="InterPro:IPR019310"
                     /translation="MSGKSKRPRQRHDSSLQLASVIGAGANKIKKQIRNVERLLQKRR
                     DVLPDTVIVEKERMLEGLKFELKEAELRQVGRKNAKKYHMVRFFERKKALRRYKQASK
                     KVIADPENKRFQNELRDCTIDLCYVVNFPRLSKYIALYPTGSSDAKELSEEVKKGLDS
                     TDAKRTEFRNLVAKQLDEGTLPVSLSQILEGKRLNKDSTGVMLEEEQVEEEATEKQFN
                     DEEEEDDFFE"
     gene            complement(<872665..>873258)
                     /locus_tag="KLLA0_A09933g"
                     /db_xref="GeneID:2896835"
     mRNA            complement(<872665..>873258)
                     /locus_tag="KLLA0_A09933g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451434.1"
                     /db_xref="GeneID:2896835"
     CDS             complement(872665..873258)
                     /locus_tag="KLLA0_A09933g"
                     /note="similar to uniprot|Q03559 Saccharomyces cerevisiae
                     YMR295C Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451434.1"
                     /db_xref="GeneID:2896835"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA5"
                     /translation="MGVFNRRSSGDSSSHGSTGSNEVKITKEDRQHLKVRTASVHDPI
                     LEAVQEMQPFEQAADTFQGNMNRQSHVPTGELKDVFGQPIQQPDVSNPTRSRDERPLD
                     TIRGFEYSISGDPTWSQQLETPQYGFRVRPGFQAYTGGVAGNGNDHHGYPSNLNMNTN
                     TTNSYQQQGVYQAPVSDANKEQKTKKKRGFFGRKKKD"
     gene            complement(<873688..>875355)
                     /locus_tag="KLLA0_A09955g"
                     /db_xref="GeneID:2896379"
     mRNA            complement(<873688..>875355)
                     /locus_tag="KLLA0_A09955g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451435.1"
                     /db_xref="GeneID:2896379"
     CDS             complement(873688..875355)
                     /locus_tag="KLLA0_A09955g"
                     /note="similar to uniprot|P25045 Saccharomyces cerevisiae
                     YMR296C LCB1 Component of serine palmitoyltransferase
                     responsible along with Lcb2p for the first committed step
                     in sphingolipid synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451435.1"
                     /db_xref="GeneID:2896379"
                     /db_xref="GOA:Q6CXA4"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA4"
                     /translation="MIDSVNVPEVLPSSIPVPSAVISSASYLWFYFITFFKLIPGAHY
                     VIDYVEKSHQDDPYRTFVEVLLILYSIVYFLSKPKKKGAVDQPKLSEKEIDNLIEEWE
                     PEPIVVPDERNEWRLAKIPVIEGSGADNVINITRDNGKEAYASAFNLCSFNFLQLSKH
                     PRVVEIAKEIIKNYGVGSCGPAGFYGNEDVHYNLEYDLASFFGTENSVLYGQDFCVSS
                     SVIPAFTKRGDVIVADDKISVSSQNALQLSRSTVYYYKHNDMASLENLLHELDEAEKK
                     EKLPAIPRKFIVTEGIFHRTGEIAPLPELVQLKRKYKYRLFIDETFSIGVLGATGRGL
                     TEYYNINRATSIDITVGSLATAIGSSGGFVLGDNVMVRHQRIGSNAYCFSASLPPYAV
                     RTASTVLQMMDEDNSSVTKLRYLSNKLHEWFQTDTELLRYIEVTSHRDSSVLHFQLTD
                     AQRQQKFGSSIESVFQESQYQQQHCISDHFVESWEKEEIFLQAIVDTVLIDGNILISR
                     DTIVLKQETLPVTPNISICCNSSMEESQLLDAYNVIRIAIIKHCSEA"
     gene            <876594..>878201
                     /locus_tag="KLLA0_A09977g"
                     /db_xref="GeneID:2896412"
     mRNA            <876594..>878201
                     /locus_tag="KLLA0_A09977g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451436.1"
                     /db_xref="GeneID:2896412"
     CDS             876594..878201
                     /locus_tag="KLLA0_A09977g"
                     /note="similar to uniprot|P00729 Saccharomyces cerevisiae
                     YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
                     involved in protein degradation in the vacuole and
                     required for full protein degradation during sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451436.1"
                     /db_xref="GeneID:2896412"
                     /db_xref="GOA:Q6CXA3"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR008442"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA3"
                     /translation="MRTASVLCALAGCASALSVQNKLPGRTALDKAIDALGLSSSDVL
                     SSLPNHLKTAWNEMGMLFPQEAGQLEFLSKPRGKITKHDKWDYVVKPESFVSTANVNN
                     DNVGNYQLRVKKIKDPKVLGVDPDVKQYSGYLDVEDEDKHFFYWFFESRNDPKNDPII
                     LWLNGGPGCSSLTGLFFELGPSSVGEEIKPIYNPHSWNSNASVIFLDQPVNVGYSYSS
                     SEGVSNTVAAGKDVYAFLQLFFQQFPEYASGQDFHIAGESYAGHYIPVFATEILSHPT
                     EERSFNLTSVLIGNGLTDPLSQYPYYEPMACGEGGEPSVLEPEQCDNMLETLPRCLNL
                     IQSCYEYESVWSCVPASIYCNNAQMGPYQSTGKNVYDIRKECQGELCYDEMKYMDEYL
                     NLDFVKEAVGAEVDNYESCNFDINRNFLFAGDWMKPYHKHVTELLEQDLPVLIYAGDK
                     DFICNWLGNQAWTNLLPYKDAEEFAKQPVKNWVTSVGKKAGKVKNFDKFTFLRVYGAG
                     HMVPFDQPENALDMVNDWVNGKFDFEH"
     gene            <878563..>879006
                     /locus_tag="KLLA0_A09999g"
                     /db_xref="GeneID:2896365"
     mRNA            <878563..>879006
                     /locus_tag="KLLA0_A09999g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451437.1"
                     /db_xref="GeneID:2896365"
     CDS             878563..879006
                     /locus_tag="KLLA0_A09999g"
                     /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
                     YMR298W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451437.1"
                     /db_xref="GeneID:2896365"
                     /db_xref="GOA:Q6CXA2"
                     /translation="MATQQNKNRVYILLQYVLAALVLIAAVEYFKYKTRISYEWFHCT
                     VQSEELFDHPEGSPLKLWAIGGPSCDKRGELKTIMKRITMDFDPNVEPVKFCIVEDTK
                     VKSIHYPIEDGNKGDPGYISFVGYERDSDVVEQACASYAATVFNL"
     gene            complement(<879152..>882253)
                     /locus_tag="KLLA0_A10021g"
                     /db_xref="GeneID:2896394"
     mRNA            complement(<879152..>882253)
                     /locus_tag="KLLA0_A10021g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451438.1"
                     /db_xref="GeneID:2896394"
     CDS             complement(879152..882253)
                     /locus_tag="KLLA0_A10021g"
                     /note="similar to uniprot|P46677 YGR274C Saccharomyces
                     cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451438.1"
                     /db_xref="GeneID:2896394"
                     /db_xref="GOA:Q6CXA1"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA1"
                     /translation="MPRVAGSSGSKKQGKAKKDFSNEDDAYNALFGGEFGALDISNYT
                     SGGGNGKQDETEHLPNAIDFEDEDELADEELPEEEEPSHSPNRHNEGSFQRSLTEDDE
                     YMTLMDHGDVMHEVDAAGFEVQGNNALFMESTYQSFGPEQHQFNEYDEQHRRLMEEQR
                     RKQEEQNAKEEQLLFQSYFPELKPGRVLRMTKIAPKPLAKYQWQRELYLRNRILKPLI
                     PIKVKFQVQKDTKKLFKMRSKSVKPWQSAISEFSEVQRRNVIKVAYDEIYKEDTVDDK
                     KDEHDEVIPEDLLIVADEWDYEKIVDDRENEEPMTSNKRNPPAVENTLEEDGKDWEWN
                     EDDIINGKVSAKEPPIDMNDERLLILPNENKIESAQKVVKPLIPYNEKSLLAKFNISN
                     DDTYKILKKNYQKKIRSTISNLNIEHSQPATRLQSPFYKVVLPKDQLRHFHRNHFGKR
                     IRPGTNIVFSKIKTRKRKKDKGKDVHEIFQHSADLTVGDSAQVFLMEYSEQQPVALSK
                     FGMANKLINYYRKTGETDSSRPKLPVGETHVLGVQDKSPFWNFGFVSPGNIVPTLYNN
                     MVRAPVFKHEVSKTDFLLVKSLGNGSGNRFYLRQINHLFAVGQTFPVVEVPGPNSRKV
                     TAMGKNRLRMVVYRILNKSPENRLLVKQVARHFPEQNDMQNRQRLKEFMKYQREGDDQ
                     GFWKLKEGEVLLDNENVKKMVTPEDVSLVESMYYGQQFQEDIDFYNFDERAKELEENL
                     IFWNATKNFLNATQMRAMIQIHGPGDPTGCGEGFSFLKTSMKGGFVKSGSKDQPQIAG
                     GHSYNVAQQQKAYEEEISRTWYNQAKSLSIQNPFEEMDDPDIVNESNKHVPSTRPDEK
                     VLRITRKKRDSNGIIQRQTVIVRDPRVIQGYLRAYEKRREEAERNLGLDELINDNITI
                     VGGENEEERQLKQKKLLEEQLAKLEKSKERRQARKAAREKTKDGKVSKSKNTTRRCAT
                     CGAIGHIRTNKSCPMYNGGVAANAAAAQGSNGTSTSKVGTESSTPIAPSTPSASVPDL
                     GDN"
     gene            <882810..>883271
                     /locus_tag="KLLA0_A10043g"
                     /db_xref="GeneID:2896389"
     mRNA            <882810..>883271
                     /locus_tag="KLLA0_A10043g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451439.1"
                     /db_xref="GeneID:2896389"
     CDS             882810..883271
                     /locus_tag="KLLA0_A10043g"
                     /note="weakly similar to uniprot|P53330 Saccharomyces
                     cerevisiae YGR275W RTT102 Regulator of Ty1 Transposition;
                     regulator of Ty1 transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451439.1"
                     /db_xref="GeneID:2896389"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:Q6CXA0"
                     /translation="MSLISRANRLGGFTTDAKHWEYEWSTTAKQNENGTDEKVKYKFK
                     QWVKKDHPLRDVVEDDTDVLNLDEFDRTKIAKKNARVQEKSGPDSLSINDIRGAVGGS
                     DIPGFSGSDAKKEAESEAAVETPVVETPAEETPAEDTPAEVKDQEGDVKME"
     gene            complement(<883467..>885515)
                     /locus_tag="KLLA0_A10065g"
                     /db_xref="GeneID:2896387"
     mRNA            complement(<883467..>885515)
                     /locus_tag="KLLA0_A10065g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451440.1"
                     /db_xref="GeneID:2896387"
     CDS             complement(883467..885515)
                     /locus_tag="KLLA0_A10065g"
                     /note="similar to uniprot|P53331 Saccharomyces cerevisiae
                     YGR276C RNH70 3'exoribonuclease required for 5S and
                     tRNA-Arg3 maturation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451440.1"
                     /db_xref="GeneID:2896387"
                     /db_xref="GOA:Q6CX99"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:Q6CX99"
                     /translation="MSNSASGSPKSTVCVSPAKNADQLPALGTSQGFADSNSVFPPPA
                     GTSDNASLSVRSRVERLSICEGNTSKDEILSKLGRTGSNGGKDNRDDDVVTDISHSQS
                     GSKRRRRRSSAVQGSSLENLKHDNISASSLAVPKKKKKSTKAVNLSVEKISKPLSIKD
                     LRDLVLFSFRDTNNSPNWLQIDNRAALQRVVVLFAPGLLPSDFSIGAGSDSKMTSFAE
                     NLEKLTNTHTLPSVLFSDPATYWYNLPICAPGSKNSLFSAYNSFVNVGLNKKEKERKR
                     LQLSKKKVVMSDLLMSIDDLIENDYPIHLDSPGLIEEFKETLEKLYSSPYYSEWTDTK
                     TIDRDGPRTFAIDCEMCMSENGHVLTRCSIVNFDGDLIYDKLVKPDVPIIDYLTKYSG
                     ITEEKLRDVTTTLKDVQEDLLNIISSKDVLIGHSLQSDLNVLKLRHPNIVDTAVIYEH
                     KAGPPFRPALRYLASEYLNVDIQKDTGLGHDSYEDAKTCMELTKLKIVNGLTFGIGFN
                     TENLFHRLSRNGISSMILNDSASKQSNVLKIENHEVHVRCKDDQMVADEICEHINEHN
                     LFVGRLRELEYAREFAACNNRDTEVLTEELALENMGKRITKIYENLPSSAMLLICSGT
                     GDTREWIKIMSELNKLDKEDRAVEKSKREAEIQASIKTARDAISFMTIKTNNVNNESQ
                     "
     gene            complement(<885994..>887106)
                     /locus_tag="KLLA0_A10087g"
                     /db_xref="GeneID:2896557"
     mRNA            complement(<885994..>887106)
                     /locus_tag="KLLA0_A10087g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451441.1"
                     /db_xref="GeneID:2896557"
     CDS             complement(885994..887106)
                     /locus_tag="KLLA0_A10087g"
                     /note="weakly similar to uniprot|Q04949 Saccharomyces
                     cerevisiae YMR299C DYN3 Dynein light intermediate chain
                     (LIC) localizes with dynein null mutant is defective in
                     nuclear migration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451441.1"
                     /db_xref="GeneID:2896557"
                     /db_xref="GOA:Q6CX98"
                     /translation="MATKLEAFINDLRLQCETNDTTKYVSIVLFCEKETTLKLFFQYI
                     DGIDTNSEPKLAVLSPTLSPVGYYTKEITTEDGWQVILNITCIPPPWKSSSIDLLPSI
                     LKSDPEKSSKRFVLLLDWINEDQSYWLEDIEGLFVQLKQVSPETKAAGSVMMLHSDYC
                     KHLENTHTKWSSTAIDFMHQSLRTLALHLKISLYSDLKNSVLAAKSAVGVPLSTEEQK
                     SLIDMVNLENVNVTYGSDSLNKIAMIDENFPLSVYKDNLSTLKHDFSDVIPEIKPRNM
                     GSCAITEPIKPLPDLQSLIPDVQGQLSHLYELQRKNSSLKRVTNQPAVVQDIGQDNTM
                     ALNDIASDNNHLQHVPDDDSALDSLVHGIVQRHQIS"
     gene            complement(<887498..>889027)
                     /locus_tag="KLLA0_A10109g"
                     /db_xref="GeneID:2896821"
     mRNA            complement(<887498..>889027)
                     /locus_tag="KLLA0_A10109g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451442.1"
                     /db_xref="GeneID:2896821"
     CDS             complement(887498..889027)
                     /locus_tag="KLLA0_A10109g"
                     /note="highly similar to uniprot|P04046 YMR300C
                     Saccharomyces cerevisiae ADE4 Phosphoribosylpyrophosphate
                     amidotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451442.1"
                     /db_xref="GeneID:2896821"
                     /db_xref="GOA:Q6CX97"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:Q6CX97"
                     /translation="MCGVLGICLADQTAAVAPELFDGCLFLQHRGQDAAGISTCGQRG
                     RLYQCKGNGMARDVFTQQRMAGLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGICM
                     GHNGNLVNTQAIQRYMDEDVHRHINTDSDSELLLNIFAAELEKYNKYRVNNDDIFHAL
                     EGVYRLCRGGYACVGMVAGFAMIGFRDPNGIRPLLFGTRTNADGTKDYMLASESVVLK
                     AHNFNDFRDLKPGEAVIVPKDCSKSEPEFRQVVPVNSYRPDLFEYVYFARPDSVLDGI
                     SVYHTRLAMGVKLAESVLKSIKPEDVDVVVSVPDTARTCALECANTLNKPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNPMESEFKGKRVLIVDDSIVRGTTSKEIINMARES
                     GALKVYFASAAPAIRFNHIYGIDLADTKQLVAYDKTEEEIQHELGCDEVIYQSLDDLI
                     DCCKTPQIQKFEVGVFTGQYVTGVEDGYLLELEKARAMNVLKASAKAESDIGIYNSGD
                     Y"
     gene            complement(<889688..>891850)
                     /locus_tag="KLLA0_A10131g"
                     /db_xref="GeneID:2896392"
     mRNA            complement(<889688..>891850)
                     /locus_tag="KLLA0_A10131g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451443.1"
                     /db_xref="GeneID:2896392"
     CDS             complement(889688..891850)
                     /locus_tag="KLLA0_A10131g"
                     /note="similar to uniprot|P40416 Saccharomyces cerevisiae
                     YMR301C ATM1 Mitochondrial inner membrane transporter
                     exports mitochondrially synthesized precursors of
                     iron-sulfur (Fe/S) clusters to the cytosol member of the
                     ATP-binding cassette (ABC) transporter family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451443.1"
                     /db_xref="GeneID:2896392"
                     /db_xref="GOA:Q6CX96"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /translation="MIMFRSLSVTPVWKAGLSLSHRSIPINSRLSSVRNYISIGCANK
                     TGSRLLRSAGVSSQYKDFRRFNSSSNGNGTDKNASVAPKTEVKKIVPPKPSTNGKSKT
                     PTISELRIMKDLFKYIWPSGDNKVKIRVLIALALLIGAKLLNVQVPFFFKQTIDSMNI
                     EWGPDVATVLPVAITMTILSYGAARFGAVMFGELRNAVFAKVAQNAIRKVSLQTFQHL
                     MKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHMIPITFEISVVCGILTYQFGS
                     SFAAMTFVTMLLYSFFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNE
                     EYLANKYHQSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYMGASGVMEGALTV
                     GDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPE
                     HLPCEIKFENVTFGYQPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDP
                     QQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFGRINATDNEIVTAI
                     EKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALD
                     THTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLENGAVREEGTHNALLAN
                     PNSLYSELWNIQENLDMLEDELEDELKLEKEPRTSKKD"
     gene            complement(<892398..>893099)
                     /locus_tag="KLLA0_A10153g"
                     /db_xref="GeneID:2896404"
     mRNA            complement(<892398..>893099)
                     /locus_tag="KLLA0_A10153g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451444.1"
                     /db_xref="GeneID:2896404"
     CDS             complement(892398..893099)
                     /locus_tag="KLLA0_A10153g"
                     /note="highly similar to uniprot|P40302 Saccharomyces
                     cerevisiae YMR314W PRE5 20S proteasome alpha-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451444.1"
                     /db_xref="GeneID:2896404"
                     /db_xref="GOA:Q6CX95"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:Q6CX95"
                     /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYA
                     VVVALKRNADELSSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRK
                     LALERAGYLLSDKAQKNTQSYGGRPYGVGLLLIGYDNTGAHLLEFQPSGNTLELYGTA
                     IGARSQGAKTYLERVLDDFREIEDADELIKHGVEALRHSLKDETLSTKNLSIAIVGHD
                     KPFTIYDGEDVQPYL"
     gene            <893626..>895401
                     /locus_tag="KLLA0_A10175g"
                     /db_xref="GeneID:2896406"
     mRNA            <893626..>895401
                     /locus_tag="KLLA0_A10175g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451445.1"
                     /db_xref="GeneID:2896406"
     CDS             893626..895401
                     /locus_tag="KLLA0_A10175g"
                     /note="similar to uniprot|P40308 Saccharomyces cerevisiae
                     YMR313C TGL3 Triacylglycerol lipase of the lipid particle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451445.1"
                     /db_xref="GeneID:2896406"
                     /db_xref="GOA:Q6CX94"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:Q6CX94"
                     /translation="MFYQRIMMWFKRVFFYFFYLLLNNVPKTVWDILHVVTDIYMFWW
                     RKFMDKVRPRSRTMYREAVAGLYGCDDYEEWYEKASLVDELTGVDLWRRNFFSKRFDF
                     EAVLEQYAALMESLEEDDFETVKSRFTNTGPTMLRNFAGIVDKRLFTKSLVGTKLLIE
                     QYLDKVVDTLYLLTAHPEVVQRTFFQRCKLSLGATALALQGGSLFGLFHLGVLKGLLD
                     RNLLPNIINGTSMGACVASMACCLSDGELEDLLTGNRLVSTIKRDTALMKECGYGNID
                     EHFNIGTLVENVVHNGYSKDVYLFIKFIQKSVIGDLTFEEAFQRTGKVLNIVVHPTNK
                     NICPNLLNYVTTPNVLISSAIDCSFGTNTISKNTWLLGKNIENKIVDYLDRKEPHYQE
                     LKFSAPQYVQDSSQLEAPYTRLTELFNVNNFIVSLARPYLAPLALNDLKHDIRTSEYY
                     YYKRFPYIDPGSYSPMQLSKVTKLEPLAFKFKYHLERKMKHILTMELKHRVEIMDSLG
                     LLSNWIKRIAIDEKTPRSATEVAIVPHMNSLSVSRIIEGRLDNINYWMKCGQESTWPV
                     ISLVKTRCAVEFTLDDIIKGFKKSI"
     gene            complement(<895418..>896227)
                     /locus_tag="KLLA0_A10197g"
                     /db_xref="GeneID:2896559"
     mRNA            complement(<895418..>896227)
                     /locus_tag="KLLA0_A10197g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451446.1"
                     /db_xref="GeneID:2896559"
     CDS             complement(895418..896227)
                     /locus_tag="KLLA0_A10197g"
                     /note="similar to uniprot|Q04868 Saccharomyces cerevisiae
                     YMR312W ELP6 Elongator protein part of the HAP subcomplex
                     of Elongator which is a six-subunit component of the RNA
                     polymerase II holoenzyme required for Elongator structural
                     integrity and histone acetyltransferase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451446.1"
                     /db_xref="GeneID:2896559"
                     /db_xref="UniProtKB/TrEMBL:Q6CX93"
                     /translation="MSVQKQELQIFSDHSVLSRHLFTDSSSNLVLVTDTVATNASWFV
                     NALVETVTLGGPVSLNGNNSGSNSGLSSSDPVKVVVGSFLNHQSYFTTAFDRLKVPRN
                     RYNVLQIAEDLVVKNVGKPVDVVIEWVLKQFEESLSNSPSVVILEKPEILMALFKLNS
                     DELHLKLINPLLKLCSLLIVVNSVESFDNDFPEHLGKDTVEFVRFTTSCFHKSFLVLS
                     VRPLDTGKAKDVTGTLAITRGGALLDIPALHVVENQYLFHDLKENTTLFYR"
     gene            <896931..>898358
                     /locus_tag="KLLA0_A10219g"
                     /db_xref="GeneID:2896484"
     mRNA            <896931..>898358
                     /locus_tag="KLLA0_A10219g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451447.1"
                     /db_xref="GeneID:2896484"
     CDS             896931..898358
                     /locus_tag="KLLA0_A10219g"
                     /note="similar to uniprot|Q75BF2 Ashbya gossypii ADL388W
                     ADL388Wp and some similarites with YHR206W uniprot|P38889
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451447.1"
                     /db_xref="GeneID:2896484"
                     /db_xref="GOA:Q6CX92"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:Q6CX92"
                     /translation="MDDLGEQLSEGHKDDYDNGIGSVPGGSGSNGKGKSQRTSFNDFV
                     RKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD
                     FHKVKRKKNEVSEGIQNAWEFNHQYFRRHDEAGLDNIRRKPSSQKKILVDENSVIVRK
                     LGGAPGDDGAFIAGDEEGMTAKMLLKNTVNKTKFNQLKRKVEDMENQVQYLTNENHNM
                     KLDLQKIQSKYNMALESLLSTESFNSQLISNFQILVDALSQQGLKVPVGLSFEKGNSR
                     ADNKSHQQRQISDSTGSTPNANIPGLSVNTTLQKQEPIELLPMDQHPVLRPGFHVLLV
                     EDDSVCIQLCSKFLRKYGCSVEVVTDGLSAISTLEKQRFDLVLMDIVMPNLDGATATS
                     IVRSFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYLKDRIPL
                     SEQRQNSNNDPKAYVEEPMLKKPHI"
     gene            complement(<898752..>900230)
                     /locus_tag="KLLA0_A10241g"
                     /db_xref="GeneID:2896390"
     mRNA            complement(<898752..>900230)
                     /locus_tag="KLLA0_A10241g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451448.1"
                     /db_xref="GeneID:2896390"
     CDS             complement(898752..900230)
                     /locus_tag="KLLA0_A10241g"
                     /note="similar to uniprot|P38890 Saccharomyces cerevisiae
                     YHR207C SET5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451448.1"
                     /db_xref="GeneID:2896390"
                     /db_xref="GOA:Q6CX91"
                     /db_xref="InterPro:IPR001214"
                     /translation="MVHLKLETLRLNDEDQSTGSSLITPSRTQLCDEVVRWWKEEPAA
                     EDMLIDTLYEHLIRRRSNWSVTKDELYQALKSHKLYTPELNELDSYTGDIRPSTVTDA
                     DIAQLNKKLLDKVTIADTEFGKGLVATDDIRKGGLVFHEQLPLTVIPQLDKQPLVSRG
                     KCCGLCSAFTTLSSQLIIKNNLDCNMCNTIWCSKQCKKLDTTHSVLKHATSRNSLCNS
                     SNWIKFENFCLQESLVAAYAVGVIYARHVMQPTSNLWKLFTSLCSVSQRVRWQASDSI
                     NVGGTFDASCNGKLYADVSAPNMETQWSDAFEMFAKSFPKCDMDYEDFLNLTGTFNLN
                     QIMGQVYPLVAHINHSCEPNVRYELEPKHGIKLYARKDIKKGEQLRLTYVNPLHGVTL
                     RRRELRVNYGFLCHCPRCCQEWEKRQKIVSDPSNHAISSEAAHSSTTARRKSSMKSCR
                     PSLKELLENGDEFDLEIPSDVNSKRRMSVRFNSHVTLAVEEE"
     gene            <900517..>901284
                     /locus_tag="KLLA0_A10263g"
                     /db_xref="GeneID:2896474"
     mRNA            <900517..>901284
                     /locus_tag="KLLA0_A10263g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451449.1"
                     /db_xref="GeneID:2896474"
     CDS             900517..901284
                     /locus_tag="KLLA0_A10263g"
                     /note="similar to uniprot|P40098 Saccharomyces cerevisiae
                     YER182W FMP10 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451449.1"
                     /db_xref="GeneID:2896474"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:Q6CX90"
                     /translation="MFRIIRDPLLRNTIRRASTDATSESIAAAARQAKFVVKKPSSNR
                     KWTNVLIFGTCFGIGWFTTQHLTLTDIMAWWFYGKLPDTDSKLIDYRDELNQRCDNLS
                     IVKQLLSKGYVAVYKQPDADATNTLIDKTLRAPGAICIPPRIYYNPTTKDTVSVYHLG
                     MKLTGYPFLVHGGILATVLEDTMRDSVKLVTGKSAEVTQRLKLNYSFPTLANQFVVVR
                     RTKWEQKGKNDVEIEAELLDQSGRRPLVRGKANFKLN"
     gene            complement(<901341..>902216)
                     /locus_tag="KLLA0_A10285g"
                     /db_xref="GeneID:2896818"
     mRNA            complement(<901341..>902216)
                     /locus_tag="KLLA0_A10285g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451450.1"
                     /db_xref="GeneID:2896818"
     CDS             complement(901341..902216)
                     /locus_tag="KLLA0_A10285g"
                     /note="similar to uniprot|P40099 Saccharomyces cerevisiae
                     YER183C FAU1 5 10-methenyltetrahydrofolate synthetase
                     involved in folic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451450.1"
                     /db_xref="GeneID:2896818"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:Q6CX89"
                     /translation="MRIIEKWSRETGTRHPTCCRGQIAGCISYKPVFCCLVFPVIDSQ
                     VSIPLVLGSDFASVIFAQVRCTCMTHQDSAMISQKQVLRTQVKAMLRGLSQAELARQS
                     EIVSRHALSLVNAKGFTHIACFLNMDHSEMKTEPLVESLFKQGKTVYLPRCSSTSVSK
                     QVDLRQDGALKRPHLVFYRFDSLAQVQALQPQGKYKLREPVRTDPEPLPTPALEVILM
                     PGVAFCKKNGARMGHGAGYYDDYISRHIHYTGKKPLLVGLALEEQLVDDVPLEQHDYT
                     VDCLVCGDGTVKWYT"
     gene            <902374..>903597
                     /locus_tag="KLLA0_A10307g"
                     /db_xref="GeneID:2896849"
     mRNA            <902374..>903597
                     /locus_tag="KLLA0_A10307g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451451.1"
                     /db_xref="GeneID:2896849"
     CDS             902374..903597
                     /locus_tag="KLLA0_A10307g"
                     /note="highly similar to uniprot|P38891 Saccharomyces
                     cerevisiae YHR208W BAT1 Mitochondrial branched-chain amino
                     acid aminotransferase homolog of murine ECA39 highly
                     expressed during logarithmic phase and repressed during
                     stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451451.1"
                     /db_xref="GeneID:2896849"
                     /db_xref="GOA:Q6CX88"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:Q6CX88"
                     /translation="MNYIGLRNCARAVSSRVSIPSRGIKSHILTSYRAMSLDASKVKI
                     TKVETPSKPRPNDELVFGQTFTDHMLTIEWTAENGWGVPEIKPYGNLSLDPSSCVFHY
                     AFELFEGLKAYRTPDNKISMFRADKNMERMNKSAARICLPSFNSDELIKLIGKLIEQD
                     KHLVPQGQGYSLYIRPTMIGTTNGLGVGTPDRALLYVITSPVGPYYKTGFKAVRLEAT
                     DYATRAWPGGVGDKKLGANYAPCILPQLQAAERGYQQNLWLFGPEKNITEVGTMNVFF
                     VFKDSKTGKKELVTAPLDGTILEGVTRDSILQLARENLNSDEWIVSERYYTITEVEER
                     AAKGELVEAFGSGTAAVVSPIKEIGWNGHDIQVPLLPGEQCGPLTKQVAEWIADIQYG
                     RKEHKGWSRIVADLN"
     gene            <903873..>905792
                     /locus_tag="KLLA0_A10329g"
                     /db_xref="GeneID:2896842"
     mRNA            <903873..>905792
                     /locus_tag="KLLA0_A10329g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451452.1"
                     /db_xref="GeneID:2896842"
     CDS             903873..905792
                     /locus_tag="KLLA0_A10329g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451452.1"
                     /db_xref="GeneID:2896842"
                     /db_xref="GOA:Q6CX87"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:Q6CX87"
                     /translation="MVGTIEMKKVARSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQC
                     DYSRTLKWGGRPFKDNRVSKKMKFEHTYVVEGICAVDLNAATGKQATKVKKNKKMITK
                     KTVVVKEEEPVQEKQLQELVQELEKPPLSEPVIEIERVEEEGNSPQRVNMALVSSTPL
                     SPLSLSLFDGSKDELDDSIAGSQRIGGFHNDDDDLVQSLDLEFFMPSISLPSLMIPDL
                     LLQSPEMAESFDFFVNQTSKLLVPAPSSIYTRNPFFNFLPRMAMSNTALMNLLLVFGA
                     NHKHKILQYQELSNGDSSLVANDLLINTFTNLMGQLTNFDSRNSDSTLATILLLAAFD
                     IFFGDKKQKWRTHVYGARKIMKERISNDTGSVMLSNNSADVEQEYFLLRWFAYTDIIS
                     SLSSTNSINNIHKLTTLRYEMETTIKDSLMQKMMLLKDIEYFTGMEVICLWLLAEISR
                     LVNEKETATNNIFPQDLILRALELDHKMVSYLKASELKRNEIFQSYYLSKTDAITTES
                     YGAYRILRATNQIFSLTGVLQLKRRVLGLPPSSPIVIELVKNITELIETWIEFGSSAE
                     TCIIFCIFSCGCELMAPELHHYRPLYLQHLLSLIQKGVSSAEQARNIVEECWSSNKQW
                     WDIFKEKSLDVTFAL"
     gene            complement(<906401..>907087)
                     /locus_tag="KLLA0_A10351g"
                     /db_xref="GeneID:2896548"
     mRNA            complement(<906401..>907087)
                     /locus_tag="KLLA0_A10351g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451453.1"
                     /db_xref="GeneID:2896548"
     CDS             complement(906401..907087)
                     /locus_tag="KLLA0_A10351g"
                     /note="weakly similar to uniprot|Q9A7D3 Caulobacter
                     crescentus CC1790 Hypothetical protein CC1790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451453.1"
                     /db_xref="GeneID:2896548"
                     /db_xref="GOA:Q6CX86"
                     /db_xref="InterPro:IPR009097"
                     /db_xref="InterPro:IPR015069"
                     /db_xref="UniProtKB/TrEMBL:Q6CX86"
                     /translation="MSFKFDDNGVVKTFHGNTIICHIPQQTDFFNRLLDFYRFAKRLS
                     FYDKITLLPPSSYHVTIMNCCHEHDRSVGHWPTGLGADASISECHNHLAQLFKDANFR
                     DQGTNPSGVELKVHIPPKDELPSSKPRSINVIVKPSNTSQETAIKQLRDSISALTGLE
                     DPSHDSIKFHITLAYINEELKDSEVEELNSHLGNLHCILDRDCPVVQLGEPEFVTFED
                     MFYFHLVTKL"
     gene            complement(<907244..>907864)
                     /locus_tag="KLLA0_A10373g"
                     /db_xref="GeneID:2896325"
     mRNA            complement(<907244..>907864)
                     /locus_tag="KLLA0_A10373g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451454.1"
                     /db_xref="GeneID:2896325"
     CDS             complement(907244..907864)
                     /locus_tag="KLLA0_A10373g"
                     /note="some similarities with uniprot|P32805 Saccharomyces
                     cerevisiae YGL254W FZF1 Transcription factor involved in
                     sulfite metabolism sole identified regulatory target is
                     SSU1 overexpression suppresses sulfite-sensitivity of many
                     unrelated mutants due to hyperactivation of SSU1 contains
                     five zinc fingers"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451454.1"
                     /db_xref="GeneID:2896325"
                     /db_xref="GOA:Q6CX85"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:Q6CX85"
                     /translation="MEKRPKRYVCPIESCGKKYSRPCLLRQHVRSHTNEKPFHCPEPG
                     CDKAFLRPSHLRVHMLSHSKVKPYNCSVCGKGFATKQQFQRHQQTHTQNQDDTSTYQC
                     GYYGCPFNAPSKEALNEHVLELHLIHEILDQNPPLQTPPHWDNLQCQDSSCSGYPSFQ
                     SSLELLEHYDEYHIYIPESLLKYSFEENINTSSSEYSADGLYTDLE"
     gene            complement(<908097..>908981)
                     /locus_tag="KLLA0_A10395g"
                     /db_xref="GeneID:2896702"
     mRNA            complement(<908097..>908981)
                     /locus_tag="KLLA0_A10395g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451455.1"
                     /db_xref="GeneID:2896702"
     CDS             complement(908097..908981)
                     /locus_tag="KLLA0_A10395g"
                     /note="similar to uniprot|P53750 Saccharomyces cerevisiae
                     YNR064C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451455.1"
                     /db_xref="GeneID:2896702"
                     /db_xref="GOA:Q6CX84"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR000639"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:Q6CX84"
                     /translation="MTDSRIQTFHTATLSNNTKVWYREAGDKSNPSIVLLHGYPTSST
                     MFRHLIPLISDKFHVIAPDLPGFGFTEVPEDYHYSFDNLAATVREFLKEINVTRFAIY
                     VFDYGSPVGFRLALKDPSSITGIVTQNGNAYEEALGDEFWGFIKKYWQTTQTDPVFVK
                     PLSQFIADRKNVDDQYFIGVKDKTAIEPAAYTLDFALLQRPGQTDIQLKLFHDYQNNL
                     TIYPAIHEFLKAHRIPVLAAWGKNDYIFTPEGAEAFGKHAQKFKLTLLDSGHFALETH
                     VQDIAHDINTFLHDNIAL"
     gene            complement(<910347..>912176)
                     /locus_tag="KLLA0_A10417g"
                     /db_xref="GeneID:2896726"
     mRNA            complement(<910347..>912176)
                     /locus_tag="KLLA0_A10417g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451456.1"
                     /db_xref="GeneID:2896726"
     CDS             complement(910347..912176)
                     /locus_tag="KLLA0_A10417g"
                     /note="uniprot|Q9Y746 Kluyveromyces lactis KLLA0A10417g
                     INV1 Invertase precursor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451456.1"
                     /db_xref="GeneID:2896726"
                     /db_xref="GOA:Q9Y746"
                     /db_xref="InterPro:IPR001362"
                     /db_xref="InterPro:IPR013148"
                     /db_xref="InterPro:IPR013189"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018053"
                     /db_xref="InterPro:IPR023296"
                     /translation="MLKLLSLMVPLASAAVIHRRDANISAIASEWNSTSNSSSSLSLN
                     RPAVHYSPEEGWMNDPNGLWYDAKEEDWHIYYQYYPDAPHWGLPLTWGHAVSKDLTVW
                     DEQGVAFGPEFETAGAFSGSMVIDYNNTSGFFNSSTDPRQRVVAIWTLDYSGSETQQL
                     SYSHDGGYTFTEYSDNPVLDIDSDAFRDPKVFWYQGEDSESEGNWVMTVAEADRFSVL
                     IYSSPDLKNWTLESNFSREGYLGYNYECPGLVKVPYVKNTTYASAPGSNITSSGPLHP
                     NSTVSFSNSSSIAWNASSVPLNITLSNSTLVDETSQLEEVGYAWVMIVSFNPGSILGG
                     SGTEYFIGDFNGTHFEPLDKQTRFLDLGKDYYALQTFFNTPNEVDVLGIAWASNWQYA
                     NQVPTDPWRSSMSLVRNFTITEYNINSNTTALVLNSQPVLDFTSLRKNGTSYTLENLT
                     LNSSSHEVLEFEDPTGVFEFSLEYSVNFTGIHNWVFTDLSLYFQGDKDSDEYLRLGYE
                     ANSKQFFLDRGHSNIPFVQENPFFTQRLSVSNPPSSNSSTFDVYGIVDRNIIELYFNN
                     GTVTSTNTFFFSTGNNIGSIIVKSGVDDVYEIESLKVNQFYVD"
     gene            complement(<913342..>915246)
                     /locus_tag="KLLA0_A10439g"
                     /db_xref="GeneID:2896429"
     mRNA            complement(<913342..>915246)
                     /locus_tag="KLLA0_A10439g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451457.1"
                     /db_xref="GeneID:2896429"
     CDS             complement(913342..915246)
                     /locus_tag="KLLA0_A10439g"
                     /note="similar to uniprot|P38731 Saccharomyces cerevisiae
                     YHL040C ARN1 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to
                     ferrirubin ferrirhodin and related siderophores"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451457.1"
                     /db_xref="GeneID:2896429"
                     /db_xref="GOA:Q6CX82"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:Q6CX82"
                     /translation="MSTEKNSVVGEDKVLKSTYSDDETNVIKSVNGAGVGVDEKQAGP
                     TDLNEYGIPDYLKSSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRS
                     FYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAIVFYVVGT
                     IIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWPFIINT
                     WISGNIVDVAKPEQNWSWDIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELSSQK
                     TYYQTHGLVQSLVQLFWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAPFI
                     LGFVLIPFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTILM
                     VAVNESVTSATRISSVSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFH
                     FRSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQSVTSHENMATVTALSYTMYRIGSA
                     VGSAVSGAIWTQLLYKQLLQHLDGDATLAASFYGSPLTYIAQYPWGTPVRDGVVQAYR
                     YVQKYEVLVALVFTAPLFVFSLCLRDPPLTNEVAHENIKQGEYVDVEDDDPVANWIHD
                     KWSRIRRKSD"
     gene            <916547..>917332
                     /locus_tag="KLLA0_A10461g"
                     /db_xref="GeneID:2896724"
     mRNA            <916547..>917332
                     /locus_tag="KLLA0_A10461g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451458.1"
                     /db_xref="GeneID:2896724"
     CDS             916547..917332
                     /locus_tag="KLLA0_A10461g"
                     /note="similar to uniprot|P36087 Saccharomyces cerevisiae
                     YKL070W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451458.1"
                     /db_xref="GeneID:2896724"
                     /db_xref="GOA:Q6CX81"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:Q6CX81"
                     /translation="MYIPSHLEVTDLDKQVSVIKQYPLGVLFNYNSAKTGLLDYFKSG
                     KPPSGTDRVDSVMCATHVPFHYVEDPEGKTKGKLIAHLAGQNQHIAMLEENANCLVVF
                     QSVDSYVSPEWYPLKKKTHKFVPTWDFACVHVYGRAKIIHDDEEWLLGMLNSITDQEE
                     KKRPDTTTVSEKDEDHSGEKGEVPIHRWKVEEAEKRYLSQAMKNIVGLEIEIDHVQSK
                     FKFHQDQPPVNVNGVLDGYAKELDPKKAQELEKFTRQQYPREL"
     gene            complement(<917868..>918620)
                     /locus_tag="KLLA0_A10483g"
                     /db_xref="GeneID:2896781"
     mRNA            complement(join(<917868..918293,918576..>918620))
                     /locus_tag="KLLA0_A10483g"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_451459.1"
                     /db_xref="GeneID:2896781"
     CDS             complement(join(917868..918293,918576..918620))
                     /locus_tag="KLLA0_A10483g"
                     /note="highly similar to uniprot|P26781 Saccharomyces
                     cerevisiae YDR025w RPS18A or uniprot|P26781 Saccharomyces
                     cerevisiae YBR048w RPS18B ribosomal protein"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_451459.1"
                     /db_xref="GeneID:2896781"
                     /db_xref="GOA:Q6CX80"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="InterPro:IPR028333"
                     /db_xref="UniProtKB/TrEMBL:Q6CX80"
                     /translation="MSTELTVQSERAFQKQPHIFTNPKAKANRKTKRWYKNVGLGFKT
                     PKTAIEGSYIDKKCPFTGLVSIRGKILTGTVVSTRMHRTIVIRRDYLHYVPKYNRYEK
                     RHKNVPAHVSPAFRVQVGDIVTVGQCRPISKTVRFNVLKVASATGKANKQFAKF"
     gene            <918705..>919115
                     /locus_tag="KLLA0_A10505g"
                     /db_xref="GeneID:2896671"
     mRNA            <918705..>919115
                     /locus_tag="KLLA0_A10505g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451460.1"
                     /db_xref="GeneID:2896671"
     CDS             918705..919115
                     /locus_tag="KLLA0_A10505g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451460.1"
                     /db_xref="GeneID:2896671"
                     /db_xref="UniProtKB/TrEMBL:Q6CX79"
                     /translation="MYLVSYCTYEPNVFFMLKSGKLGIWMGAGWPWRPWRPIGRNPWA
                     GFPGESPGNGFGKDSLWAGSLVGQGIGGPTAPELGSILPFLGTPSRAKLGSFRPVSSH
                     LLCPPTLSPLSPTLPTCSTPANQLFQNTAEAPYT"
     gene            complement(<919456..>920004)
                     /locus_tag="KLLA0_A10527g"
                     /db_xref="GeneID:2896416"
     mRNA            complement(<919456..>920004)
                     /locus_tag="KLLA0_A10527g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451461.1"
                     /db_xref="GeneID:2896416"
     CDS             complement(919456..920004)
                     /locus_tag="KLLA0_A10527g"
                     /note="similar to uniprot|P38231 Saccharomyces cerevisiae
                     YBR047W FMP23 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451461.1"
                     /db_xref="GeneID:2896416"
                     /db_xref="UniProtKB/TrEMBL:Q6CX78"
                     /translation="MLKFSRTFTTFSRLSSRAVSNRVIIPPKALTDLGQPTLKSLRSE
                     YKQLPENSNFIDKFYTELQKFHDEFLVPRLNKHYTDFDENPDDLVFELEKYIELHIIP
                     SHSVRTQKSDLMAQGINLPMVYCETLGDKMVIERFIEFCRSVRYTLRLNGGHSFIFDI
                     MLQSNSVFQDFEKSKYQQTKEQ"
     gene            <921022..>922083
                     /locus_tag="KLLA0_A10549g"
                     /db_xref="GeneID:2896670"
     mRNA            <921022..>922083
                     /locus_tag="KLLA0_A10549g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451462.1"
                     /db_xref="GeneID:2896670"
     CDS             921022..922083
                     /locus_tag="KLLA0_A10549g"
                     /note="highly similar to uniprot|P38230 Saccharomyces
                     cerevisiae YBR046C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451462.1"
                     /db_xref="GeneID:2896670"
                     /db_xref="GOA:Q6CX77"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:Q6CX77"
                     /translation="MFSAVRSVVSSGIKTSIRTMSTIPGVQKVVLIRENGGPEVLKYE
                     EDYPVPKIGATDLLIKNKYAGINFIEVYFRKGIYPSEKPYVLGREAVGEVVAKGDQVD
                     KYNVGDKVAYLSASTFAQFTKYPQNGHLIKLPKDISAEKEKIIAGSLVQGLTPLTFID
                     EAYNVQKGDFILVYAAAGGVGLIFDQLLKARGARTIAVASTDEKLQLAKEYGAEFLIN
                     STKDDIVEKVKEFTNGEGVAAAFDSIGKDTFETTLQVVKRKGTIVSFGNASGAVPPFS
                     INRLSPKNLKLVRPQLFAYVADPSEWEHYSSELIRLIDSGELKITISKVYPLKDYKEA
                     TEDLESRKTVGKLILEIPE"
     gene            <922516..>924201
                     /locus_tag="KLLA0_A10571g"
                     /db_xref="GeneID:2896667"
     mRNA            <922516..>924201
                     /locus_tag="KLLA0_A10571g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451463.1"
                     /db_xref="GeneID:2896667"
     CDS             922516..924201
                     /locus_tag="KLLA0_A10571g"
                     /note="weakly similar to uniprot|P38229 Saccharomyces
                     cerevisiae YBR045C GIP1 Meiosis-specific protein proposed
                     to be a regulatory subunit of the protein phosphatase
                     Glc7p, required for spore wall formation and proper septin
                     organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451463.1"
                     /db_xref="GeneID:2896667"
                     /db_xref="UniProtKB/TrEMBL:Q6CX76"
                     /translation="MATASLLTSIVHHDSGGLPSGTKRAKLKRLFSSLSGVTPTSENR
                     SLGYETPPTLSPDEFAGISPTKQAFKKMRFFFSRHWHGMDQGEPDHCYSTNNDDQSVG
                     NYSCYNKYKTDGQQLERLFNEAVVDKRPPVTRDDAVRKMAPFEAMDPRFANNWMKNIQ
                     DFNITFSPVDTEPSIVIPSSSDVLKTKIATATEKGQREGQLSPDNHSKSSGVYRALAN
                     QAISYCNSGSATQKSSSYEYGNPSALPDLLYGLESLPTVSGKDCSTPPQCPSVQLIQD
                     RDDFGLLTSGGRSLKNGSKIFSATTQQSPKNELVEPNSGSQKVVIPTFREETGLEVHS
                     IASNLQVGTLTESDLIKLASAKRRSFMDAKFYDEESEISDDEQEEHQGSKHVPCHEPS
                     LQNLKSAANCDNATGKSEKNDTVKFNKYSYLVIYDASTKCLYSESTDKLTLRIPNEIT
                     DATDNSIYIAAESTPYQESTMLKSILKRRTNEQEDIEAERAKKCDEIDATDFLQFVEN
                     HESKKRRGEQLLVLARERQLQNYYDDQAVPTIKIRKERPSYSDFEDEYNQNLE"
     gene            complement(<924496..>925875)
                     /locus_tag="KLLA0_A10593g"
                     /db_xref="GeneID:2896393"
     mRNA            complement(<924496..>925875)
                     /locus_tag="KLLA0_A10593g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451464.1"
                     /db_xref="GeneID:2896393"
     CDS             complement(924496..925875)
                     /locus_tag="KLLA0_A10593g"
                     /note="highly similar to uniprot|P07284 Saccharomyces
                     cerevisiae YDR023W SES1 seryl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451464.1"
                     /db_xref="GeneID:2896393"
                     /db_xref="GOA:Q6CX75"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:Q6CX75"
                     /translation="MLDITQFIEEKGGNPELIRKSQIARGASVEIVDEIIAGYKEWVK
                     TRFQVDELNKQLNKVQKEIGLKFKNKEDASELLAEKDRIVAEKKVLSEREQEEDKQLR
                     SKVNQVGNIVHPSVVVSNDEENNELVRSWMPENIKEVAQVATATGAEAKLSHHEILLR
                     LDGYDPERGVKITGHRGYFFRNYGVFLNQALINYGLSFLASKGYTPLQAPVMMNKDVM
                     AKTAQLSEFDEELYKVLDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYVGYSS
                     CFRREAGSHGKDAWGVFRVHAFEKIEQFVLTEPEKSWEEFDKMINYSEEFYQSLGLPY
                     RVVGIVSGELNNAAAKKYDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLCATQRALCCVLENYQTDEGLKVPEVLRKYIPGEPEFLPYVKELPK
                     NSTSNKKKN"
     gene            926295..926368
                     /locus_tag="KLLA0_A10615r"
                     /db_xref="GeneID:2896607"
     tRNA            926295..926368
                     /locus_tag="KLLA0_A10615r"
                     /product="tRNA-Val"
                     /db_xref="GeneID:2896607"
     gene            <926574..>927005
                     /locus_tag="KLLA0_A10637g"
                     /db_xref="GeneID:2896658"
     mRNA            <926574..>927005
                     /locus_tag="KLLA0_A10637g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451465.1"
                     /db_xref="GeneID:2896658"
     CDS             926574..927005
                     /locus_tag="KLLA0_A10637g"
                     /note="weakly similar to uniprot|Q03939 Saccharomyces
                     cerevisiae YDR022C CIS1 Protein involved in microtubule
                     assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451465.1"
                     /db_xref="GeneID:2896658"
                     /db_xref="InterPro:IPR018621"
                     /db_xref="UniProtKB/TrEMBL:Q6CX74"
                     /translation="MESPVLLVKNANAATNASNLGLLGQKQNSYTVDENTWFLNNISF
                     IFEDDDPSQHDEDQLDYENVIIIDSEPSGTVNNVEMLSERWQLLAFDQNPRDNCISLT
                     VMNELSADLGQNTDISGLDNLSKLYHERNAQIRKLLDSIAP"
     gene            complement(<927059..>928255)
                     /locus_tag="KLLA0_A10659g"
                     /db_xref="GeneID:2896649"
     mRNA            complement(<927059..>928255)
                     /locus_tag="KLLA0_A10659g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451466.1"
                     /db_xref="GeneID:2896649"
     CDS             complement(927059..928255)
                     /locus_tag="KLLA0_A10659g"
                     /note="highly similar to uniprot|Q12099 Saccharomyces
                     cerevisiae YDR021W FAL1 Nucleolar protein required for
                     maturation of 18S rRNA member of the eIF4A subfamily of
                     DEAD-box ATP-dependent RNA helicases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451466.1"
                     /db_xref="GeneID:2896649"
                     /db_xref="GOA:Q6CX73"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSFNRDDDSKLKFKTSKKLKVSATFESMNLKPDLLRGIYFYGFE
                     YPSSIQSRAISQIISGKDVIAQAQSGTGKTATFTIGLLQAIDSKSKELQALVLSPTRE
                     LASQSESVISNLGDYLNVTAHACTGGKALQQDIKKVSKNCQVVSGTPGRVLDMIKRQV
                     LNVRNCKILVLDEADELLGETLGFKQQIYDIFTKLPPTIQVVVVSATMSKDILEITKK
                     FMSDPVKILVKRDEISLDVIKQYYVDVEKEEWKFDTLCDLYDSLTITQCVIFCNTRKK
                     VDWLSRKLTQTNFSVSSMHGDMKQEERDQVMNDFRSGKARVLISTDVWARGIDVQQIS
                     LVINYDIPDNLENYIHRIGRSGRFGRKGVAINFITKEERPKLKEIESHYRIKIKPTPA
                     NLEELS"
     gene            <928563..>929657
                     /locus_tag="KLLA0_A10681g"
                     /db_xref="GeneID:2896660"
     mRNA            <928563..>929657
                     /locus_tag="KLLA0_A10681g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451467.1"
                     /db_xref="GeneID:2896660"
     CDS             928563..929657
                     /locus_tag="KLLA0_A10681g"
                     /note="similar to uniprot|Q08144 Saccharomyces cerevisiae
                     YOL018C TLG2 member of the syntaxin family of t-SNAREs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451467.1"
                     /db_xref="GeneID:2896660"
                     /db_xref="GOA:Q6CX72"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:Q6CX72"
                     /translation="MFRDRTNLFLSYRRTFPHQRLSSTKHLRSNKDLENQPFIGSDDG
                     NNDEDMVAMDDFSRQLPPKFFDLTFQVDESLSAVDQLLLQLTKLYQKNSLPGFQDNKQ
                     DEEEIEQISFQVIKRFQECFGVIKTLTRIKDSQYSNGKQLSKDELRILDNLEKNYALK
                     VQDKSQKFRILQNNHLKFLNKDDFKPLPTTKSSNDTLMLLEEEVEGDEVNNIDSYSKQ
                     TLQKQNQKLQDNNQQFLQQRDEEITQLAKGVLEVSTIFREMQSLIIDQGTVVDRIDYN
                     LENTVIELKQAQKELDKATHYQKRSQKCKIILFLSLVVLALFLLVMLKPHHHTIRESA
                     PSKSHKPPGSQVEVNSPNGDPLLDPESNVE"
     gene            complement(<929877..>931715)
                     /locus_tag="KLLA0_A10703g"
                     /db_xref="GeneID:2896651"
     mRNA            complement(<929877..>931715)
                     /locus_tag="KLLA0_A10703g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451468.1"
                     /db_xref="GeneID:2896651"
     CDS             complement(929877..931715)
                     /locus_tag="KLLA0_A10703g"
                     /note="some similarities with uniprot|Q08157 Saccharomyces
                     cerevisiae YOL019W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451468.1"
                     /db_xref="GeneID:2896651"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:Q6CX71"
                     /translation="MAKRFTFGFATLLFFLQCVALAFLILACVSAPVFDNVRLASFDG
                     IHYGVFGYCEDDGGSCSSAQANYHPENLDDDDSNWKMNNDSRKALGSILIVTPIAAGL
                     TFLALVTSFLCQFRFFDSSTFWFVMNFLFSILAFLSSALICIVVILLFYPHVTWYSYI
                     LIASAVLNLVCLPLCFFARSQTASNSKNGLVDEEDEDRSSTSIRDKFYKEEFNQTEVT
                     NLDAPSIPDYYKGSKIVTSNTLNSNTITDSDVPSSYMNNGSVAATTANTAVVPPQGLA
                     TMAAANSYQRHSNNNDATLLHNAVPKQPYSAINQSGTNSSMNSSSRALSSGRITAPNN
                     NYSQQNFSQMGEIGSLAPSSVYAEHIAGGSSGVIASDLQQGNNRGQSQDELTQPPKTQ
                     QDVLQDIINGVLSEDEEEFLKQNTVDPSERPAMDTFDDDGINDDDSQFTSVSQRGINP
                     NYYQGRGGVQYIPPTHGPLQNQLQGQVQNPAMAQGMVPNGMHPTQPPVVGGQYYPPLP
                     NQAGPQQGYYHPPPLPVQQQQPQQPQPPYSAGPSASDFLLQSNPEFSIGTGPASYGNS
                     QRSAGLNSAPASSMHYKPAYRKRLPRKNNLPLHPCQETVPMEHFKF"
     gene            complement(932445..932543)
                     /locus_tag="KLLA0_A10725r"
                     /db_xref="GeneID:2896663"
     tRNA            complement(join(932445..932481,932504..932543))
                     /locus_tag="KLLA0_A10725r"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:2896663"
     gene            <933157..>933618
                     /locus_tag="KLLA0_A10769g"
                     /db_xref="GeneID:2896636"
     mRNA            <933157..>933618
                     /locus_tag="KLLA0_A10769g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451469.1"
                     /db_xref="GeneID:2896636"
     CDS             933157..933618
                     /locus_tag="KLLA0_A10769g"
                     /note="similar to uniprot|P43594 Saccharomyces cerevisiae
                     YFR011C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451469.1"
                     /db_xref="GeneID:2896636"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="UniProtKB/TrEMBL:Q6CX70"
                     /translation="MGAQPSKPAETKVYVPETPVNFESKLIAQIDNSTESDFIRSQKA
                     ERYLQEKVSAKLSDLESEALKEFETKLQSSILPDDSKSAGDALSTKLVNEKVDQLKVR
                     LSKLQEAHKAKSTDKVTATKKTLTECLLKNKEKPLNCYDEVDQFKKAVLEI"
     gene            complement(<934135..>935733)
                     /locus_tag="KLLA0_A10791g"
                     /db_xref="GeneID:2896629"
     mRNA            complement(join(<934135..935573,935718..>935733))
                     /locus_tag="KLLA0_A10791g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451470.1"
                     /db_xref="GeneID:2896629"
     CDS             complement(join(934135..935573,935718..935733))
                     /locus_tag="KLLA0_A10791g"
                     /note="similar to uniprot|P43593 Saccharomyces cerevisiae
                     YFR010W UBP6 Ubiquitin-specific protease situated in the
                     base subcomplex of the 26S proteasome releases free
                     ubiquitin from branched polyubiquitin chains deletion
                     causes hypersensitivity to cycloheximide and other toxic
                     compounds"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451470.1"
                     /db_xref="GeneID:2896629"
                     /db_xref="GOA:Q6CX69"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:Q6CX69"
                     /translation="MSDLEFNIKHAGKVYPITINADAKAADLRAKVEALTLVPQERQK
                     YMVKGGLTDNETLVSSVIKAKATVMVLGTPDANLVFKPTDDTKFLEDLTDKERLMQED
                     TIPMGLRNMGNTCYFNASLQALYRIKPLREKVLAYNEPNPDLHGQLVIQLRNCFNAFA
                     QRKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLLHTIDTVFGESLS
                     SKFEIEFQTTVKDTLNETDVQTKIESDKKLQCHISGTTNFLKNGLTESLVEKVEKRSE
                     ATGSNSIFENSKKITKLPEYLTVQFVRFYWKRSTGKKSKILRKVQFPFQLDVADLLTP
                     EYATAKIKVRDELREVDKQREDDLKEFNQNILEHVPLSLTPAERYETQMALEESKREH
                     WLAEFAKKFPKDLRQGENPSSVYNLIGVVTHQGANSDSGHYQAFVRDDADENKWYKYN
                     DDKVYVVTREKVEQLAGGGESDSALILIYKGFGL"
     gene            complement(<936126..>937880)
                     /locus_tag="KLLA0_A10813g"
                     /db_xref="GeneID:2896623"
     mRNA            complement(<936126..>937880)
                     /locus_tag="KLLA0_A10813g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451471.1"
                     /db_xref="GeneID:2896623"
     CDS             complement(936126..937880)
                     /locus_tag="KLLA0_A10813g"
                     /note="similar to uniprot|P38967 Saccharomyces cerevisiae
                     YOL020W TAT2 Tryptophan permease high affinity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451471.1"
                     /db_xref="GeneID:2896623"
                     /db_xref="GOA:Q6CX68"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CX68"
                     /translation="MKEDEYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKED
                     KNKNIVRRMIDSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALAT
                     GGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYI
                     CQWYFVLPIELIASAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSL
                     VKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALANGFKGVASVFVTASYSLGG
                     SEMVCLCSAETDPKELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS
                     PFVIAIKLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVD
                     RAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRL
                     AMKAQNRSLDELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESF
                     FKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDLETDRKNIDIEIVKQEVRER
                     EMYLASKPWYIRFYNFWC"
     gene            <938712..>941738
                     /locus_tag="KLLA0_A10835g"
                     /db_xref="GeneID:2896617"
     mRNA            <938712..>941738
                     /locus_tag="KLLA0_A10835g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451472.1"
                     /db_xref="GeneID:2896617"
     CDS             938712..941738
                     /locus_tag="KLLA0_A10835g"
                     /note="highly similar to uniprot|Q08162 Saccharomyces
                     cerevisiae YOL021C DIS3 Nucleolar exosome component
                     involved in rRNA processing and RNA degradation binds
                     Gsp1p/Ran and enhances the GEF activity of Srm1p
                     implicated in mitotic control homologous to the E. coli
                     RNase R of the RNase II family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451472.1"
                     /db_xref="GeneID:2896617"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:Q6CX67"
                     /translation="MATVQQLRRKRISDGLTVTQKVFVRSRNGSAQKVVREHYLRKDI
                     PCLSRICDICPNIIVPNAAGELPKFVLSETPQELQGLGKHYVVVDANIIIQSIDLLEN
                     PNCFFDVIVPQIVLDEVRNKSYPIYTRIRALCRDSEDDVKRFVVFHNEFSEYTFIDRT
                     GNESINDRNDRAIRKTVEWYTNHLKGKGINIVFVTNDRLNRQAALKDSLVAKSLAEYV
                     DMLPNSEEIKDLIPNLAPISGMSSKMLEDDPEGHGAAKAEFSFPEYYSTSRIMGGLKN
                     GSLYQGSIQISEYNFLEGTVSLPTFKKPVLVLGQKNLNRAFNGDLVVVELLPQSEWKA
                     PSTVTMDSEHFNVNDNPDNDGEDDEGEPSGVLDDSGAIMSDKDRRLLAQSAILAQKSN
                     KVQPTARVVGITRRSWRQYVGQITPTSVDPQSSGTQNVFVILMDKCLPKIRIRTRLAK
                     QLLNKRIVISVDCWPENYRYPLGHFVRDLGDIESAQAETEALLLEHDVEYRPFSKKVL
                     DCLPKEGHDWKAPEDLTDPEAIRNDPLLPSRKDFRDKLICSIDPPGCVDIDDALHAKQ
                     LPNGNWEVGVHIADVTHFVKPGTALDAEGASRGTSVYLVDKRIDMLPMLLGTDLCSLK
                     PYVDRFAFSVVWELDNDANIVGVDFTKSVIRSREAFSYEKAQNRIDDETAKDELTLGM
                     RALLQLSKKLKQKRLDAGALNLASPEVKVHMDSETSDPNEVEIKKLLDTNSLVEEFML
                     LANISVARKIYEAFPQTAMLRRHAAPPSTNFELLNEMLQVRKGMSISLESSKALADSL
                     DRCEDPNDSYLNTLIRIMSTRCMMAAQYFHAGAFSYADFRHYGLAVDIYTHFTSPIRR
                     YCDVVAHRQLAGAIGYEALDLSHRDKQKMEMICRNINKKHRNAQFAGRASIEYYVGQV
                     MRNNESTETGYVIKVFNNGIAVLVPKFGVEGLIRLENLTENPQSAEFIEDQFSLRFVD
                     KNGVSKEVSVFDKVEVQLKSVLDPATSKRKAQLLLK"
     gene            complement(<941784..>944042)
                     /locus_tag="KLLA0_A10857g"
                     /db_xref="GeneID:2896717"
     mRNA            complement(<941784..>944042)
                     /locus_tag="KLLA0_A10857g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451473.1"
                     /db_xref="GeneID:2896717"
     CDS             complement(941784..944042)
                     /locus_tag="KLLA0_A10857g"
                     /note="highly similar to uniprot|P43535 Saccharomyces
                     cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
                     kinase activity forms a complex with Gcn1p proposed to
                     stimulate Gcn2p activation by an uncharged tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451473.1"
                     /db_xref="GeneID:2896717"
                     /db_xref="GOA:Q6CX66"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CX66"
                     /translation="MSNIGLQLRQSAPQVDSIVTDYVLGYFNHLSNATYDAVQSKQLD
                     LDSEVSFLRDLLLNAGANSEKISKVINEMEGKLSGQLKENQAKLELTGDTSKRLLDIN
                     VLQSHNSKDNLNNSLAALGVSGDIEHAGRKMETRVDLKKLRKAEDKIAKKVAKRNNKF
                     VKYEASKLINEGEDDDYDSFYLKINPLEFGSGAGKSKDIKIDTFDLYVGDGQRILSNA
                     QLTLSYGRRYGLVGQNGIGKSTLLKALSRRELNVPKHISVLHVEQEIRGDETKALQSV
                     LDADVWRKQLLSEESKINERLQEIENLRKEFNEESLEVKKLDNERTDLEEHLEQISEK
                     LIDMESDKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLD
                     EPSNMLDVPSIAYLAEYLKTYPATVLVVSHDRAFLNEVATDIIYQHNERLDYYRGQDF
                     DTFYATKEERRKTAQREYENQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPIL
                     EPPEEEKVVNFHFPDCEKLSPPIIQLQDVSFSYKESDPLLTDVNLDVQMDSRISLVGA
                     NGCGKTTLLKVMMEQLRPTKGFVSRNPRLRIGYFTQHHVDSMDLNQSAVDWMSTAFPG
                     KTDEEYRRHLGAFGISGSLGIQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLD
                     TAGLDALVDALKSFNGGVLMVSHDISVINSVCNEIWVSEGGKVQRFDGTIFDYRDYII
                     ANAGKAGFVKRQ"
     gene            complement(944431..944501)
                     /locus_tag="KLLA0_A10879r"
                     /db_xref="GeneID:2896428"
     tRNA            complement(944431..944501)
                     /locus_tag="KLLA0_A10879r"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:2896428"
     gene            <945121..>946407
                     /locus_tag="KLLA0_A10901g"
                     /db_xref="GeneID:2896442"
     mRNA            <945121..>946407
                     /locus_tag="KLLA0_A10901g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451474.1"
                     /db_xref="GeneID:2896442"
     CDS             945121..946407
                     /locus_tag="KLLA0_A10901g"
                     /note="similar to uniprot|P25040 Saccharomyces cerevisiae
                     YOL022C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451474.1"
                     /db_xref="GeneID:2896442"
                     /db_xref="GOA:Q6CX65"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:Q6CX65"
                     /translation="MSNIEEIHSAGEEDEYDYKTKKKSDVYLGLVDAAIKEDDEVLVE
                     DTFIGGEPCWLAPDSPPSEEILRCDSCKSADFMKLLVQAFAPVDLGIIEPICEKKKIN
                     LTTKSYINPDYTRVLYVFYCTKCKRKNGSVKCIRGVKKTTSVDTLGQKMEQLQTTEFQ
                     LNPFSANEVDSNSNKNPFDKNPFAVTGSKSGEAANPFAAAASNPFAQTENIKPEPKTG
                     ASNAPVSQKTLRKLHDQKKDKEFDSSKAFPGYFLFVEEETFKSTPDHLKLPKNLKIDK
                     TALELPDDAFDSLEENQMKLDPRTEKISKFLDDDVFQKFQEVVSYNPGQVLRYDLGGL
                     PLYYAKTPKEFEDLVAKPAYNPSSRRVFEMQLMPKMILDLEEEVSLTDGMDWGTIMVY
                     TDIENYIPKFDENQVGYVQEVVKVQWEPIDYDEVKG"
     gene            complement(<946489..>948501)
                     /locus_tag="KLLA0_A10923g"
                     /db_xref="GeneID:2896601"
     mRNA            complement(<946489..>948501)
                     /locus_tag="KLLA0_A10923g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451475.1"
                     /db_xref="GeneID:2896601"
     CDS             complement(946489..948501)
                     /locus_tag="KLLA0_A10923g"
                     /note="similar to uniprot|P25038 Saccharomyces cerevisiae
                     YOL023W IFM1 Mitochondrial translation initiation factor
                     2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451475.1"
                     /db_xref="GeneID:2896601"
                     /db_xref="GOA:Q6CX64"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CX64"
                     /translation="MKPMLSTVPLRPCCRLTSRLPLLTRSIHISGINLAGKHKKRSFP
                     SKELKKLTFDIPNHTSVNNLSNLLNVRLEKLIQDLKKLGFTHASSNYILTKGYIELIL
                     QEYNYDFEVNEVVNSSNVYDELKSPMNPRFLETRPPIVTIMGHVDHGKTTILDYLRKS
                     SIVSQEHGGITQHIGAFQCVAPISRKLITFLDTPGHAAFLKMRERGANITDIIVLVVS
                     VEDSIMPQTLEAIKHAKNSGNELIVAITKIDRISNLKERAEAIEKVENSLIVNDIELE
                     KIGGDVQVVHISAKTGENMDQLEESIISLSDIMDLKAEKNVKTVCEGWVLESEVKKAV
                     GNVATVLLKKGVMNKGDILISGNSICKVRAMLNEHGAQVTKALPSQAVEIVGWKSLPN
                     AGDEVIQAKSESIAKKYVARRQHLLQEEKEAETVEKLNDERVAQSETKALKNDIDEVD
                     EDEEQAEVESGPKDVNFIIKADVSGSVEAIVQSIEHLGNDEVKCNIVGSSVGVPAEND
                     LKMAKITGSTILCFNLDNVPNDIINNKDKIPVKQFNVIYKLIEDVTETLTDNLKPIFE
                     EKQIAAVEIREIFEFKVKRNFIKIAGCKVINGKVSRNSLVKVIRGPEEEVIYKGRIST
                     IKQGKETVQDVNKGNECGITLENDFEGYQAGDKLIVYESVKIPRFL"
     gene            complement(<948881..>950086)
                     /locus_tag="KLLA0_A10945g"
                     /db_xref="GeneID:2896435"
     mRNA            complement(<948881..>950086)
                     /locus_tag="KLLA0_A10945g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451476.1"
                     /db_xref="GeneID:2896435"
     CDS             complement(948881..950086)
                     /locus_tag="KLLA0_A10945g"
                     /note="weakly similar to uniprot|P23180 Saccharomyces
                     cerevisiae YHL021C FMP12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451476.1"
                     /db_xref="GeneID:2896435"
                     /db_xref="GOA:Q6CX63"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="InterPro:IPR012776"
                     /db_xref="UniProtKB/TrEMBL:Q6CX63"
                     /translation="MTIQIVDSVENRSFDNYVTIKLNDSLYLFHLVYLRDNCTGKESF
                     HGETHQRLIDIFNDIDLEKDLNGTVVVEGDELVVKWFDGHISRFTERWLLNHAYYPEK
                     NVINNKAVKLPNRITWCKQEFNELKQASDHFKNDYNHINDDSTKKIIFNEIYQYGFTL
                     IDNVPVSLDATKEVSELISIIRPTHYDTGVWDFTSDLSKKDTAYTSLAIDMHTDGNYW
                     YETPGLQLFHLLLHDGQGGETRICDVAHILKLIKDKANEDESWQETLEILTKQPIEFH
                     QSGESENVFIENRYPILQVDKDGELIQCRWNTSDRTSMLKGTKYPVNEIYRAMARFND
                     LINDTDNYVRFPLAPGTILVFDNWRVLHARTAFNGKRRLCGSYLTRDDFLARYRSLLF
                     NREQWLESV"
     gene            complement(<950412..>950942)
                     /locus_tag="KLLA0_A10967g"
                     /db_xref="GeneID:2896604"
     mRNA            complement(<950412..>950942)
                     /locus_tag="KLLA0_A10967g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451477.1"
                     /db_xref="GeneID:2896604"
     CDS             complement(950412..950942)
                     /locus_tag="KLLA0_A10967g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451477.1"
                     /db_xref="GeneID:2896604"
                     /db_xref="UniProtKB/TrEMBL:Q6CX62"
                     /translation="MSTPGHRLHHKHKHAHDLFPPENKQFMESRDFTGLDNPPEPKRT
                     PNPFAEKNDSKEDSYVNALLSSVSQKLKNQQQHPSSTREQRHIFQQKSVPLSAEESPN
                     SGDEIKFSNGYNEEERPDRVNREGKKKNGELGLGSLNGTEQAPAPPPPIRRNSSLYED
                     FKKAYYHDTHMFDSHK"
     gene            complement(<951316..>952923)
                     /locus_tag="KLLA0_A10989g"
                     /db_xref="GeneID:2896621"
     mRNA            complement(<951316..>952923)
                     /locus_tag="KLLA0_A10989g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451478.1"
                     /db_xref="GeneID:2896621"
     CDS             complement(951316..952923)
                     /locus_tag="KLLA0_A10989g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451478.1"
                     /db_xref="GeneID:2896621"
                     /db_xref="UniProtKB/TrEMBL:Q6CX61"
                     /translation="MNLLAKDEDLRYMALKGYIDSNWQNVEPIPTEDNSSASSDEERV
                     VLMGLHDTSVLIQDLASTSLIQSFCKCKDIAAVYTLFHSLLNDMSLPCTRGLKTLLVS
                     TSAEGRPVSVSLENVTKYCLNLVEHQHLMQSIHWDVFIELINHYSELKPLDSLFLQEL
                     VPLNPPDNVIKAVVPHLSRSLISNYNNFDAQQLLMISESYPHKFTRDKANSILTECVD
                     QSSDVSLEKVKMCYNLFWFWYTPQGGVPTEILNLLDRFKNITKDEGDLNDASDSDEFD
                     ISLSEDEDSVPMYEETQTGNGNQEEVNEVISQFESLISSASSFTQQHQTTTPSSQITQ
                     PPRLYSEILVSTPADSEELLETWLKEYQDYDLNLTKSIIDQILESEFTLFQWQWLITM
                     ASRLPTDAVVQFLPRSVTFLKPMKRFVQVIQVGNLKQRQDDALNLRLQLWSLIDSLLN
                     FDDPLNLDQVFVLTLIIPYLQYGLKDCVKDSTFQPVLLSILDKLKDHCSPLIITNEPL
                     LQSLEELNQEQHPWIIPTINSIKFKML"
     gene            <953797..>955047
                     /locus_tag="KLLA0_A11011g"
                     /db_xref="GeneID:2896489"
     mRNA            <953797..>955047
                     /locus_tag="KLLA0_A11011g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451479.1"
                     /db_xref="GeneID:2896489"
     CDS             953797..955047
                     /locus_tag="KLLA0_A11011g"
                     /note="highly similar to uniprot|P00560 Saccharomyces
                     cerevisiae YCR012W PGK1 3-phosphoglycerate kinase
                     catalyzes transfer of high-energy phosphoryl groups from
                     the acyl phosphate of 1 3-bisphosphoglycerate to ADP to
                     produce ATP key enzyme in glycolysis and gluconeogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451479.1"
                     /db_xref="GeneID:2896489"
                     /db_xref="GOA:P14828"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /translation="MSLSSKLTVKDLDVTGKRVFIRVDFNVPLDGKKITSNQRIVAAL
                     PTIQYVLEKKPKAIVLASHLGRPNGEVNDKYSLAPVADELSRLLQKPVTFLHDCVGEE
                     VTNAVNNAKDGEVFLLENLRFHIEEEGSRKVDGNKVKADKAAVTKFREQLSSLADVYV
                     NDAFGTAHRAHSSIVGFDLPNRAAGFLLSKELQYFAKALENPTRPFLAILGGAKVADK
                     IQLIDNLLDKVDSLIIGGGMAFTFKKVLENTEIGDSIYDAAGAELVPKLVEKAKKNNV
                     KIVLPTDFVIGDKFSADANTKVVTDKEGIPSGWQGLDNGPESRKAFAATVAEAKTIVW
                     NGPPGVFEFAPFAKGTEALLDAVVASSQAGNTVIIGGGDTATVAKKYGVVDKISHVST
                     GGGASLELLEGKELPGVTFLSNKQ"
     gene            complement(<955278..>956798)
                     /locus_tag="KLLA0_A11033g"
                     /db_xref="GeneID:2896422"
     mRNA            complement(<955278..>956798)
                     /locus_tag="KLLA0_A11033g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451480.1"
                     /db_xref="GeneID:2896422"
     CDS             complement(955278..956798)
                     /locus_tag="KLLA0_A11033g"
                     /note="weakly similar to uniprot|P25615 Saccharomyces
                     cerevisiae YCR014C POL4 Probable homolog of mammalian DNA
                     polymerase beta may function in double-stranded DNA break
                     repair DNA polymerase IV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451480.1"
                     /db_xref="GeneID:2896422"
                     /db_xref="GOA:Q6CX59"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR018944"
                     /db_xref="InterPro:IPR019843"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:Q6CX59"
                     /translation="MLNGHKFLVLPNEDTSRRRYMRTLIDKNGGQHGVEIGLIDDSFV
                     HGDHIINHKLFYKEMNPNDVPLDQLRLFKLSDLTKWLKHRFLDFSKPLKLHEEVVVET
                     DSQESNTGVPDTHQVTSPSETHDTADTNVSHSSDANLIMPMNNPNYKLIKVLKSLEKR
                     YKLQNDTFRYLGYMKMIKILQNVRVKIESEEDAIENGLSKGLSKKIPFLLKLGESGSE
                     LKMDTSEQTLLYFQECHGIGAFKSKQYVNMGYSTFEDLIPYMNWTQLTGLAFYEDWQL
                     SIPREETMKHEAIIRKAMNEVNENLCMEITGSYRRGQPRSGDIDIVVHMPGQNDLNYI
                     SRELEKVIIKLTETGYIICPLNLNETLKSLFQPWFHKLFSHFNKPFDVKAYDEPVHKF
                     YCGAAVTKYEPDRIKDADALTLKGNDKKYKMDIGKTCRRVDFLLAEYQGLGATNVYFT
                     GNNNFNKKCRTIAKQKGYVLSNDGIYKDGQLIPVADEYEILDMIGVDKLKPTERNL"
     gene            complement(<956792..>957493)
                     /locus_tag="KLLA0_A11044g"
                     /db_xref="GeneID:2896627"
     mRNA            complement(<956792..>957493)
                     /locus_tag="KLLA0_A11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451481.1"
                     /db_xref="GeneID:2896627"
     CDS             complement(956792..957493)
                     /locus_tag="KLLA0_A11044g"
                     /note="some similarities with uniprot|P25616 Saccharomyces
                     cerevisiae YCR015C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451481.1"
                     /db_xref="GeneID:2896627"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:Q6CX58"
                     /translation="MLKRILVLDFDGTITTSDTTSIIGQSVYNLKSVPVAWTHYTKIY
                     EECYIPKPENLAPDAWKVVCDYERASRRCELSSINELELQDHFKDVVIKDLLQLVKEK
                     VDIRPGLQELMQQYNKTYVLSLNWSKDLIHDLTGISKSDIYCNELKSRDGEVYSGQFT
                     KQILTGWDKYEMLKEICDLDKVQGDQSITYIGDSFGDLPCILAKEVDGYIIGDRLKHL
                     DIDVPTIQRFDEVKC"
     gene            <958239..>959087
                     /locus_tag="KLLA0_A11066g"
                     /db_xref="GeneID:2896844"
     mRNA            <958239..>959087
                     /locus_tag="KLLA0_A11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451482.1"
                     /db_xref="GeneID:2896844"
     CDS             958239..959087
                     /locus_tag="KLLA0_A11066g"
                     /note="similar to uniprot|P25617 Saccharomyces cerevisiae
                     YCR016W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451482.1"
                     /db_xref="GeneID:2896844"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:Q6CX57"
                     /translation="MSEHVPAWKRFQIKKSEEGNQIDDELDSLIVSTHLSNGSLSKKE
                     KRRIIRGGNADSKSTGNKVAKKSKDRKREKLAKEDRLKKKETVLKDQLRYLIDFYTLK
                     LEVELPEAVKELPSVKENVSIISPSEELADKNVVRDVWKFSKQKQNWLIKHFVITDEI
                     PSAFNPLLVRYFQDLQGGSKAQLQESCLDVIEKQNKYLEQQKEEMAKIVLGEATEASK
                     DQEKQSADDESKDKDVKTEMSKKSDESEEDTANKINEILPPSQELLERVRSMLDTWGV
                     KYELNS"
     gene            <959342..>962446
                     /locus_tag="KLLA0_A11088g"
                     /db_xref="GeneID:2896397"
     mRNA            <959342..>962446
                     /locus_tag="KLLA0_A11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451483.1"
                     /db_xref="GeneID:2896397"
     CDS             959342..962446
                     /locus_tag="KLLA0_A11088g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451483.1"
                     /db_xref="GeneID:2896397"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="UniProtKB/TrEMBL:Q6CX56"
                     /translation="MNRNIETVNEEGSFVVDLLRKPFKLPSRYDDLPWESIEESKLTE
                     TDILDRKHVFPLLKVMPIRLFTTDIERSEMFESLKQYCQTERYNKFGADWPNELADSM
                     GLDSLLDWDFDMEQIDDTASIPEYSPNHLLILTERTIHVLGSDAKFLAPNRIVDALVI
                     PNQKCSDKNDTCILCLASGEIYSMDFHYHQTAEKYDIELVCSYKLDNVPPKFTAKLTY
                     SSTNDLIGFVTSMHLMCVLSLHKRERAFFKLDFNVLLQLGCDIDTITWQSGKLLYIDY
                     FKKNHVRVVEQDVQGYGFFECNFIINDVKDEDKILLLDRDNVLLVEGSMKKANIVSAG
                     TEKIDVGSLDLVFASSADIIDYSLFKVIEEPFKSVNFLILNNWVILLSLVTDSNKVLV
                     SELTRLAIPIDGLILERVVGYNEIAILVLSRGEVIRYTVDLNDITFQDTGINKLAIKP
                     TVMLLNNILDEQWVFEGYEKIDHIYKYEHSTLLHSKNKLYDIPAKSADIQITFDLITF
                     MSEFKVFHDVRVIDLKCAVSGSFQFGSISIRSDDPEVQQYVLIGISSICAPESYYLEI
                     VKGEQIKFQLIDDLLPETEDTFIEFFTVRGTFLSITANNLYINDLEDIKQLPLPFSIK
                     GAKSICIPKDIFSILIWNEDEISITDWKSGTTTSINIPEGFEKLHDIIEINGEHVLRF
                     DQSIASIDLEKLEVLGSDFRNSLNCEGVLNEVWLKNCSSKTASLTSVRSLVEGRLEIL
                     STDGNRTFVDAGTQMCLEPFVYPWVIAYSTSEIKIVNVQDGHVCAVFESDSLILNVYC
                     GDRKGRNIFVLYEDGMSVNELLIDVTRGKLIELIGTDSLNWNEYKWPLQVAGGSRIIL
                     NDNAFKFLKIDTNGKTFVKQGPRKVPGSIITYGMLDDSNKHMCIFSYDTITHTLWCNI
                     FTIQNSELTHLSEITVSKDLNIIGAPQGSSNTSIHGQFYAVTTENNHIYVWRVRSDGN
                     SNWNVTLWQTINPGNKPETEFNDDTFYFTQNYMLQLPQNTDKTPATIHCTIPSSYRQL
                     FRDP"
     gene            <964084..>965739
                     /locus_tag="KLLA0_A11110g"
                     /db_xref="GeneID:2896650"
     mRNA            <964084..>965739
                     /locus_tag="KLLA0_A11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451484.1"
                     /db_xref="GeneID:2896650"
     CDS             964084..965739
                     /locus_tag="KLLA0_A11110g"
                     /note="uniprot|P49374 Kluyveromyces lactis KLLA0A11110g
                     HGT1 High-affinity glucose transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451484.1"
                     /db_xref="GeneID:2896650"
                     /db_xref="GOA:P49374"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /translation="MSLKNWLLLRDIQYEGTFYKKFPHVYNIYVIGFIACISGLMFGF
                     DIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLISPNFSDAFGRKVSLH
                     ICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSEISPPKIRGTISG
                     LFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQMVPGLILMVGVFFIPESPRWLA
                     NHDRWEETSLIVANIVANGDVNNEQVRFQLEEIKEQVIIDSAAKNFGYKDLFRKKTLP
                     KTIVGVSAQMWQQLCGMNVMMYYIVYIFNMAGYTGNTNLVASSIQYVLNVVMTIPALF
                     LIDKFGRRPVLIIGGIFMFTWLFSVAGILATYSVPAPGGVNGDDTVTIQIPSENTSAA
                     NGVIASSYLFVCFFAPTWGIGIWIYCSEIFNNMERAKGSALSAATNWAFNFALAMFVP
                     SAFKNISWKTYIIFGVFSVALTIQTFFMFPETKGKTLEEIDQMWVDNIPAWRTANYIP
                     QLPIVKDEEGNKLGLLGNPQHLEDVHSNEKGLLDRSDSASNSN"
     gene            complement(<967049..>969982)
                     /locus_tag="KLLA0_A11132g"
                     /db_xref="GeneID:2896647"
     mRNA            complement(<967049..>969982)
                     /locus_tag="KLLA0_A11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451485.1"
                     /db_xref="GeneID:2896647"
     CDS             complement(967049..969982)
                     /locus_tag="KLLA0_A11132g"
                     /note="similar to uniprot|P25618 Saccharomyces cerevisiae
                     YCR017C CWH43 Putative sensor/transporter protein involved
                     in cell wall biogenesis contains 14-16 transmembrane
                     segments and several putative glycosylation and
                     phosphorylation sites null mutation is synthetically
                     lethal with pkc1 deletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451485.1"
                     /db_xref="GeneID:2896647"
                     /db_xref="GOA:Q6CX54"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:Q6CX54"
                     /translation="MVSIRGSVIAWTHTVCAASAFIAALVVGYTLHFEKIVANAWYRY
                     PDEWFPSVSATIGDRYPERSIFQILIALTALPRFLLLFTHYYLNRSLFTLLVGIVRTI
                     TCGGWVYITSTDDHDAHDVFMISYIVLTIPWDYMIIKHSQYKEWKKILMTAFFGTLIP
                     LIYWFIQHQVHRRAGAYSVYAYFEWSLIVLDIAFDALACQDFEQIKISVSDWSATEDE
                     NIVVPTEYIVETEEQVDITVTETVEEKLNDSSVEELSDDENIQQEHSRLLESNDNEIT
                     ILLKETEDIMYPNDLPVPPSQDSFMYVIVNTFNSFMFWTTVTSLFCMLWHFPLWYMGI
                     SGYEAVILSTLSPVFLYIPLVTVVVDQYGMLLANVFSIGAFFIDTPETRLLTVALATA
                     LIVMTFALNLNSLNSSSIGKFSLTWIMGLILSVVVKMGFFTNNPLWAIMNENNGGLNI
                     PGLVVSTLFALITPFTNSCHLWNRSKTTTRLPFFRKLLVSTGFGSLVFAIHQSLTDAS
                     TLIYWCWEGWNSHKGPLAWPWAGLVCVAMIGGALTGKQSSRTISMTLAISTLALAVPQ
                     VKEWFRFVFGVLPYVVSIIWIIPSYFELVNYIQSPGFLSYSFFIYILFVLAHVWTVAY
                     AFVPYGWILREKLPQVLCFSTTFILAGLIEFDSFKPYEGIAKSFTKKIRVVAVGLLLL
                     TGIFTYQIRPTLVPEPYHPEANLITAGIWTIHFGFDNDLWASEDRMTHLIKDMQLDIV
                     GLLETDTQRITTGNRDLTAKMAHDLGMYADFGPGPNKHTWGCVLLSKFPIIKSEHHLL
                     PSPVGELAPAIHATIEAYGELVDVFVFHSGQEEDEEDRRLQSEAMAELMGSTDRPSIL
                     LSYLVTKPHQDNYNIYVSDKSQMYDIDPTDEDRWCEYILYKKLKRAGYARVSRATITD
                     TELQVAKFQVLPDIDEVDEDYLYGYRRLPTKNVHRSFKFPKKFMGDGERGHHYHVFDE
                     PRYFN"
     gene            970437..970509
                     /locus_tag="KLLA0_A11154r"
                     /db_xref="GeneID:2896648"
     tRNA            970437..970509
                     /locus_tag="KLLA0_A11154r"
                     /product="tRNA-Lys"
                     /db_xref="GeneID:2896648"
     gene            complement(<970974..>973133)
                     /locus_tag="KLLA0_A11176g"
                     /db_xref="GeneID:2896528"
     mRNA            complement(<970974..>973133)
                     /locus_tag="KLLA0_A11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451486.1"
                     /db_xref="GeneID:2896528"
     CDS             complement(970974..973133)
                     /locus_tag="KLLA0_A11176g"
                     /note="highly similar to uniprot|P32775 Saccharomyces
                     cerevisiae YEL011W GLC3 Glycogen branching enzyme involved
                     in glycogen accumulation green fluorescent protein
                     (GFP)-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451486.1"
                     /db_xref="GeneID:2896528"
                     /db_xref="GOA:Q6CX53"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /translation="MTGDNNDIPENVRGVVEIDSWLTPFAKVLSERRYLADEWRYKIE
                     HSTNSEGRDTTLAQFARDAYKSFGLHADPGSLEIRYKEWAPNAVRAFLIGEFNSWNEN
                     ANEMQRDEYGIFTTVVPPVVDDSGNKQYGIPHDSKVKVCFQLADGSRIYRLPAWITRA
                     TQPDKETAKQWGPSYEARFWNPPVHYSFKNKRPGFMRDTDSLRIYEAHVGISTPEPKV
                     GSYKEFTQNVLPRIKDLGYDAIQLMAIMEHAYYASFGYQVTNFFAASSRFGTPDELKE
                     LVDTAHGMGILVLLDVVHSHASKNVTDGLNQFDGSDHQYFHSLASSRGEHPLWDSRLF
                     NYGHFEVQRFLLANLAFYIDVYQFDGFRFDGVTSMLYLHHGVGEGGAFSGDYNEYLSS
                     ERSFVDHEALAYLMLANDLVRELLPDNGITIAEDVSGYPTLCMPRHLGGAGFDYRLAM
                     ALPDMWIKLLKESRDEDWEMGHIVHTLVNRRHREKVVAYTESHDQALVGDKTLAFWLM
                     DAAMYTDMTILKESTPVVDRGIALHKLIRLITHSLGGEAYLNFEGNEFGHPEWLDFPN
                     VNNGDSYHYARRQFNLVDDPLLRYQYLYQFDKAMQTTEKNYKWLNTPQAYVSLKHEVD
                     KVIAFERNGLLFIFNFHPTESFTDYRIGVNEPGCYRIVLNSDKHEYGGWDRIDESQSK
                     YFTTDLKWNERNNFIQVYIPNRTALVLALDSRVRNGN"
     gene            complement(<973755..>974529)
                     /locus_tag="KLLA0_A11198g"
                     /db_xref="GeneID:2896399"
     mRNA            complement(join(<973755..974358,974525..>974529))
                     /locus_tag="KLLA0_A11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451487.1"
                     /db_xref="GeneID:2896399"
     CDS             complement(join(973755..974358,974525..974529))
                     /locus_tag="KLLA0_A11198g"
                     /note="similar to uniprot|P28263 Saccharomyces cerevisiae
                     YEL012W UBC8 Ubiquitin-conjugating enzyme that negatively
                     regulates gluconeogenesis by mediating the glucose-induced
                     ubiquitination of fructose-1,6-bisphosphatase (FBPase);
                     cytoplasmic enzyme that catalyzes the ubiquitination of
                     histones in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451487.1"
                     /db_xref="GeneID:2896399"
                     /db_xref="GOA:Q6CX52"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:Q6CX52"
                     /translation="MSSNSKRRIETDVMKLLMSDHDVELVEDKMQEFHIKFHGPKDTP
                     YEKGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDAASGSICLDVINSTWSPLYDLLN
                     IVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYINKYATKEKYIQQFGKW
                     NSSDDTDDEDEDADMDESDDEQAHDDNDSMELSDIEVSDDDD"
     gene            complement(<974831..>975076)
                     /locus_tag="KLLA0_A11209g"
                     /db_xref="GeneID:9487437"
     mRNA            complement(<974831..>975076)
                     /locus_tag="KLLA0_A11209g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999304.1"
                     /db_xref="GeneID:9487437"
     CDS             complement(974831..975076)
                     /locus_tag="KLLA0_A11209g"
                     /note="similar to uniprot|Q9URQ5 Saccharomyces cerevisiae
                     YCR020W-B HTL1 Subunit of the RSC chromatin remodeling
                     complex, a multisubunit complex that functions in
                     transcriptional regulation,chromosome stability and
                     establishing sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999350.1"
                     /db_xref="GeneID:9487437"
                     /db_xref="UniProtKB/TrEMBL:B5RSI8"
                     /translation="MTTTQGTEQPQDLKVNLKTITAEDLLSRRANMVELFNLLDDSSR
                     TELFLGSSEDREKKLASLRKRLQSVQQEVETLKSESD"
     gene            <975454..>975729
                     /locus_tag="KLLA0_A11220g"
                     /db_xref="GeneID:2896611"
     mRNA            <975454..>975729
                     /locus_tag="KLLA0_A11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451488.1"
                     /db_xref="GeneID:2896611"
     CDS             975454..975729
                     /locus_tag="KLLA0_A11220g"
                     /note="similar to uniprot|P23059 Saccharomyces cerevisiae
                     YCR020C-A MAK31 Non-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type required for
                     replication of dsRNA virus member of the Sm protein
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451488.1"
                     /db_xref="GeneID:2896611"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:Q6CX51"
                     /translation="MTDLSNVHLHDLLSETLYINLDQKRSLTGKLIAIDCKANLLLDE
                     VVENNDGHVRKMGLVSVPFVSVRSVKVRRELVDTINALKLNISSQYV"
     gene            complement(<975786..>976844)
                     /locus_tag="KLLA0_A11242g"
                     /db_xref="GeneID:2896640"
     mRNA            complement(<975786..>976844)
                     /locus_tag="KLLA0_A11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451489.1"
                     /db_xref="GeneID:2896640"
     CDS             complement(975786..976844)
                     /locus_tag="KLLA0_A11242g"
                     /note="similar to uniprot|P23060 Saccharomyces cerevisiae
                     YCR019W MAK32 Protein necessary for structural stability
                     of L-A double-stranded RNA-containing particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451489.1"
                     /db_xref="GeneID:2896640"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:Q6CX50"
                     /translation="MGLLTTNGMLIIDEIETASSHYYDVLGGGGTYAMLGASICCTDL
                     SLRKELLWIVDRGMDFPKQLTETIESWDTGCVFRDDNERLTTRGYNVYGPNDFRSFKY
                     LAPKKRIDVSDWCESFGVKAVQRVSCYHLLCSADRVADILDKLAEELSFEGTLKTGQT
                     FIWEPIPDLCNVEHLEGIKKLLNGPYHFIFSPNAEEGARMLGETEPTELSDCSTILLK
                     LAALIKPGNICVLRCGKKGSLALICNKNPSNDDIIHFPAYHYKTPECVIDPTGGGNTF
                     LGAFAFAYAMCKDISIASICGNIAAGCAIEQIGVPSHNGMHWNKTTFADRLLYYLSTY
                     ELKQGHSEILNSLQPMKY"
     gene            977210..977281
                     /locus_tag="KLLA0_A11264r"
                     /db_xref="GeneID:2896408"
     tRNA            977210..977281
                     /locus_tag="KLLA0_A11264r"
                     /product="tRNA-Met"
                     /note="transfer RNA iMet (CAT) cove"
                     /db_xref="GeneID:2896408"
     gene            complement(<978095..>979834)
                     /locus_tag="KLLA0_A11286g"
                     /db_xref="GeneID:2896638"
     mRNA            complement(<978095..>979834)
                     /locus_tag="KLLA0_A11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451490.1"
                     /db_xref="GeneID:2896638"
     CDS             complement(978095..979834)
                     /locus_tag="KLLA0_A11286g"
                     /note="highly similar to uniprot|P39968 Saccharomyces
                     cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
                     protein that interacts with Atg13p required for the
                     cytoplasm-to-vacuole targeting (Cvt) pathway interacts
                     with Nvj1p to form nucleus-vacuole junctions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451490.1"
                     /db_xref="GeneID:2896638"
                     /db_xref="GOA:Q6CX49"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MGLCCSCLRGESSLEDSTGLPIAENEREAVTSLLEFLENKDQYD
                     FYSGKPLRALTTLVYSDNLNLQRSAALAFAEITEKYVSPVSRDVLEPILMLLTNPDPQ
                     IRIASCAALGNLAVNNENKLLIVEMGGLEPLIEQMKSDNVEVQCNAVGCITNLATQDD
                     NKIEIAQSGALVPLTKLARSSNIRVQRNATGALLNMTHSGENRKELVDAGAVPVLVSL
                     LSSMDADVQYYCTTALSNIAVDESNRRYLSKHAPKLVTKLVSLMNSTSPRVKCQATLA
                     LRNLASDTNYQLEIVRAGGLPDLVQLIQSDSLPLVLASVACIRNISIHPLNEGLIVDA
                     GFLPPLVKLLDYQESEEIQCHAVSTLRNLAASSEKNRAEFFQSGVIEKFKQLALTCPI
                     SVQSEISACFAILALSDNTKYDLLQQDVLKVLIPMTMSQDQEISGNSAAAVANLISRV
                     SNLEKILEYWGQPNDGIKGFLIRFLSSDFPTYEHIALWTILQLFECHNETIYKLIKED
                     QKLVNGVKKIADENYAVAREYMQDGQDTNIDHNGNSNNIEGNGRSNKQSSEKEDASFE
                     LYNITQQIIQFLV"
     gene            complement(<980616..>982022)
                     /locus_tag="KLLA0_A11308g"
                     /db_xref="GeneID:2896643"
     mRNA            complement(<980616..>982022)
                     /locus_tag="KLLA0_A11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451491.1"
                     /db_xref="GeneID:2896643"
     CDS             complement(980616..982022)
                     /locus_tag="KLLA0_A11308g"
                     /note="weakly similar to uniprot|P39998 Saccharomyces
                     cerevisiae YEL015W EDC3 Non-essential conserved protein of
                     unknown function plays a role in mRNA decapping by
                     specifically affecting the function of the decapping
                     enzyme Dcp1p localizes to cytoplasmic mRNA processing
                     bodies"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451491.1"
                     /db_xref="GeneID:2896643"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:Q6CX48"
                     /translation="MLNFKGYQIEIELKDGKRITGTLKQVSPKSLTLTDAVFQDGGVS
                     PVFKIKADKLYDLKVLKLPPNANVKMNNGNGNGNGNGKQEKEKEKGKERDRFTEKADE
                     IWDTEMSSDFDFQGNLQRFNKKDAFKDFQNVEIPKDETKIPHNEMVTAGNVKETTSDS
                     DKITESINITHLLRNDSIAASLANQRKTFTCGSKNKIKVPLATPIQLLEMEKIADEKF
                     MLPLKTSLEHSGIHISRLLRNMLKSYTPPATSDSDAVPTVVAFVSGGRSGSRCISALR
                     CLLYIKDIRCIIVNPFINERESFDDDISTEQINKIKTLNNVHFPDSLAKLKELLQNEP
                     PSIIIDALQGFDDTVSDLDFSPDSNDNIAQYIKWINSHETVSACLEVISFDCPAHIDP
                     SSGDVIESDFVHPTTILSTGWPLHCLPKLTQILPDWRNTYVYDTGVPQQTYLLKPNLR
                     KFYKLDIYPGFSGTQELK"
     gene            <982552..>983124
                     /locus_tag="KLLA0_A11330g"
                     /db_xref="GeneID:2896668"
     mRNA            <982552..>983124
                     /locus_tag="KLLA0_A11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451492.1"
                     /db_xref="GeneID:2896668"
     CDS             982552..983124
                     /locus_tag="KLLA0_A11330g"
                     /note="similar to uniprot|P25378 Saccharomyces cerevisiae
                     YCR027C RHB1 Putative Rheb-related GTPase involved in
                     regulating canavanine resistance and arginine uptake;
                     member of the Ras superfamily of G-proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451492.1"
                     /db_xref="GeneID:2896668"
                     /db_xref="GOA:Q6CX47"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:Q6CX47"
                     /translation="MSVRDRKIIVLGSRNVGKTTLLVQLTESHFVESYYPTIENQFIH
                     EFVLKKPNGTELKFNLDIVDTSGQDEFSMINAKSMLGVAGCILMYSVANRHSFEIVEL
                     IRDKMLDMLGLLELPMVLVGNKIDLDRQVSYKEGEELAKRLKCGFVEICVKQGSGIEM
                     PFKTLIQKIEGYEDGNTKADQGQSEGCSIM"
     gene            complement(<983428..>984372)
                     /locus_tag="KLLA0_A11352g"
                     /db_xref="GeneID:2896386"
     mRNA            complement(<983428..>984372)
                     /locus_tag="KLLA0_A11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451493.1"
                     /db_xref="GeneID:2896386"
     CDS             complement(983428..984372)
                     /locus_tag="KLLA0_A11352g"
                     /note="some similarities with uniprot|P32573 Saccharomyces
                     cerevisiae YNL202W SPS19 late sporulation specific gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451493.1"
                     /db_xref="GeneID:2896386"
                     /db_xref="GOA:Q6CX46"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:Q6CX46"
                     /translation="MQKTMAQEVRSATPLNPTIPSITDVLPSFRLDGHVTIVTGAAGG
                     LAHTLSQALVSQGSELALMDLSLPSLENVKTELELFQKQNNIPPVKISLWACDISNAD
                     EVEMVVKSIPSSHKGIVPQKLVHTAGFCQNINAHEYDAEKAQKLVNVNLLGSLYICQS
                     MARQLLARRTRRKSISEHIDESGEAMPQFPEASFVLIGSMSGLIVNTPQPQCAYNMSK
                     AGVIHLVKSLAAEWAKFGIRVNAISPGYIATALTKKVISQSQEGAALQKEWTNRIPLG
                     RMAEPKEFIGSMLYLLSRSASSYTTGENMVVDGGYVCW"
     gene            complement(<985471..>987336)
                     /locus_tag="KLLA0_A11374g"
                     /db_xref="GeneID:2896596"
     mRNA            complement(<985471..>987336)
                     /locus_tag="KLLA0_A11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451494.1"
                     /db_xref="GeneID:2896596"
     CDS             complement(985471..987336)
                     /locus_tag="KLLA0_A11374g"
                     /note="some similarities with uniprot|P25353 Saccharomyces
                     cerevisiae YCR026C NPP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451494.1"
                     /db_xref="GeneID:2896596"
                     /db_xref="GOA:Q6CX45"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024873"
                     /db_xref="UniProtKB/TrEMBL:Q6CX45"
                     /translation="MPTADSEFELEFSDLEDPLDFLDSPTWSQRLKSYVNRSKNYLKK
                     WYYVTPFNTGIELQTWNGTELQDDDDNDHIFDNIGVVRAKKKTYIWKWITFVLSIIAT
                     LLLSILVISSLKHKQKKLTHSAAKLEPGSTSFKTLVISLDGFHPGYISELRTPFLNQL
                     FTPSNQINDTLVAPYMIPSFPSQTFPNHWTMITGQFPHHHGIIANRFWDSKNDVEFQI
                     NDISSRMNTFWNQSYPLWFFTNEIHLNTHTHMWPGSEQIHSDPLRNPTIVDSFNIDEP
                     LNDKLNTIRTALQNESTTLTFAYVPVVDTMGHKYGNLIDSGHSKVLKEVDDFLEQLFA
                     DVDENVNILVISDHGMSTILKENVYVWETLFGDLSTIPAIVKLYDDANTLIYTNQEDM
                     ETAYKQLDPHIPEQCELVRSTDIFPDVSNEIIHERIPQLLITCEPGYQIVRQSKYDKL
                     PKRFGTHGFRKDHPDMRSLFLGKGPFFADLRSNLNDQYIKPFDNIQIFSLLLQLCGTD
                     DIDVNVDADLKFWKHLIPLGKFSEVSKSMWENYPDSEFNKLWNNYIEETISEKPSATT
                     SSIATSTISPTSSTIHDSTPTSERHPSLGEIIDEVEDTINDILHKIWPSNDKGND"
     gene            complement(<987998..>988912)
                     /locus_tag="KLLA0_A11396g"
                     /db_xref="GeneID:2896696"
     mRNA            complement(<987998..>988912)
                     /locus_tag="KLLA0_A11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451495.1"
                     /db_xref="GeneID:2896696"
     CDS             complement(987998..988912)
                     /locus_tag="KLLA0_A11396g"
                     /note="weakly similar to uniprot|P39996 Saccharomyces
                     cerevisiae YEL017W GTT3 Protein of unknown function with a
                     possible role in glutathione metabolism as suggested by
                     computational analysis of large-scale protein-protein
                     interaction data GFP-fusion protein localizes to the
                     nuclear periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451495.1"
                     /db_xref="GeneID:2896696"
                     /db_xref="UniProtKB/TrEMBL:Q6CX44"
                     /translation="MSTVLEKFKKVELIDLADKLGLSVSTSNTKPTLVLKILDHLESL
                     DEPVDLNEYPELQLYYEALAEDNDEEDSEEEESSLDDEEEEDEQDIKEMFDRSDLPTK
                     SPACLWFSNLRFVNKVTNSPYYFRFHEFVDDVQWTTQEWNETVQDYLSTLHTVKQLVL
                     AVELFVFVKSLIQFNWYRFPSPDFVTFYPSQRDFILSVSFWFIFSRMIPSIVSYYFNF
                     VRHELFAIEFDPLVYHLTKVLISLQFLYNSPSVKKEIELLLSSDYSICQLLSHGYNVG
                     LFCWKFQLGHLPLIANSAAVIIALYVLA"
     gene            complement(<990779..>991606)
                     /locus_tag="KLLA0_A11440g"
                     /db_xref="GeneID:2896743"
     mRNA            complement(<990779..>991606)
                     /locus_tag="KLLA0_A11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451497.1"
                     /db_xref="GeneID:2896743"
     CDS             complement(990779..991606)
                     /locus_tag="KLLA0_A11440g"
                     /note="weakly similar to uniprot|P39995 Saccharomyces
                     cerevisiae YEL018W EAF5 Esa1p-associated factor, subunit
                     of the NuA4 acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451497.1"
                     /db_xref="GeneID:2896743"
                     /db_xref="GOA:Q6CX42"
                     /db_xref="InterPro:IPR026226"
                     /translation="MFKEFLLLDVLYDELLNSQTNKVSLIRLRTGFNDHKIHKFTRME
                     DIKINEILDMIKEMFPNQTSLNDGQITFYHLQINEIQNKIMDVYERCQRDLVGKLAKN
                     EKELKRGKVGKVSHTGSNGNKSNSSSSSSSTSAISNGAGAAGATTHSVLSTPAASTST
                     TTNNSSKVDYMKSRRGKILAMYRDTVIAKLESFEQFKEVFSSFEKVNHNEVIKMENDL
                     KKLKTLHLNNLIDLQWNLQNCVTNGIMSMGHEDTNRVLLAQDELDMTINFVRNAMDN"
     gene            <991845..>992615
                     /locus_tag="KLLA0_A11462g"
                     /db_xref="GeneID:2896721"
     mRNA            <991845..>992615
                     /locus_tag="KLLA0_A11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451498.1"
                     /db_xref="GeneID:2896721"
     CDS             991845..992615
                     /locus_tag="KLLA0_A11462g"
                     /note="similar to uniprot|P38632 Saccharomyces cerevisiae
                     YEL019C MMS21 Protein involved in DNA repair mutants are
                     sensitive to the alkylating agent methyl methanesulfonate
                     and show increased spontaneous mutation and mitotic
                     recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451498.1"
                     /db_xref="GeneID:2896721"
                     /db_xref="GOA:Q6CX41"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:Q6CX41"
                     /translation="MTSRLVLPDVLPITSKRHDILHQITLPDLSREISAAKSSIQDSV
                     IGLLSSYPKYPTDRVDEINELESAYKDLLRMESRQKFLNSKLTEMKSKYTQQSSDAPR
                     LNRENWDSFLNNEYNLINVRKEWIKLQSEEVEIDKKDQWLRVFCALPYIWSDPTRIIP
                     NDPFETDAAQEEEGEDIKVEGGVVELTCPVSVKKFQSPMISVKCHHTIDNESLQSLFQ
                     QGKSIQCPVSGCNKTLTSRDFVPDRLMHIRVLISELRE"
     gene            <992734..>994158
                     /locus_tag="KLLA0_A11484g"
                     /db_xref="GeneID:2896374"
     mRNA            <992734..>994158
                     /locus_tag="KLLA0_A11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451499.1"
                     /db_xref="GeneID:2896374"
     CDS             992734..994158
                     /locus_tag="KLLA0_A11484g"
                     /note="similar to uniprot|P25345 Saccharomyces cerevisiae
                     YCR024C SLM5 Mitochondrial asparaginyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451499.1"
                     /db_xref="GeneID:2896374"
                     /db_xref="GOA:Q6CX40"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:Q6CX40"
                     /translation="MISKIEGISGETLRCGSVRVRDHKLYTGPPAMRLPVTLKRVFET
                     ARTNGGTPVKIDQVSGWVKNVRPLKTITFVEIQDGTTLQDLTVVLKQGAPSFKPSLGQ
                     SVTVLHPEIVQRKNQQFETLCMPENLKLIGPTVEYPVQNKQTSLPTLRKLPEFKHRTT
                     YLSNLLRFRHKVESQLTKTLDGLDFTMVRPPILTSIDCEGAGEMFNLKQDHWDEIVNL
                     TVSSQLHLEVLMMGLGRVYCLQPCFRAEKSDTNRHLCEFWMLEVEASFVDKNESLMDL
                     VELMVKSVVLSLSETKDLPKYFPVGCNIDITSRWAKLLQDWKRITYTDAVEALLSSGV
                     KFEHDLAWGKDLNSEHERWLCDHFGGPVFVTNYPRDCKAFYMKLRPDGTTVECFDLLF
                     PEIGEIVGGSVREDDYDTLKQEIERRDMASNQLDWYLNLRKEGTVPHGGFGIGIERLV
                     SYLYGNPNIRDSIPFHRTAGQIDL"
     gene            <994478..>994870
                     /locus_tag="KLLA0_A11506g"
                     /db_xref="GeneID:2896376"
     mRNA            <994478..>994870
                     /locus_tag="KLLA0_A11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451500.1"
                     /db_xref="GeneID:2896376"
     CDS             994478..994870
                     /locus_tag="KLLA0_A11506g"
                     /note="similar to uniprot|P53903 Saccharomyces cerevisiae
                     YNL149C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451500.1"
                     /db_xref="GeneID:2896376"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="InterPro:IPR016809"
                     /db_xref="UniProtKB/TrEMBL:Q6CX39"
                     /translation="MEVLQNLKTNLYQTFDIDLQHAIRLIVIVGGYFFLRQIAQRELA
                     KRQLKNQLAEKDDEAIRSVAAGTSDGSTADQGESSANGSSFGWGNRTRQRVKKQEELL
                     ESEIQRLQENGAVLDPEDDKDIEDLLID"
     gene            <995143..>995889
                     /locus_tag="KLLA0_A11528g"
                     /db_xref="GeneID:2896705"
     mRNA            <995143..>995889
                     /locus_tag="KLLA0_A11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451501.1"
                     /db_xref="GeneID:2896705"
     CDS             995143..995889
                     /locus_tag="KLLA0_A11528g"
                     /note="similar to uniprot|P17890 Saccharomyces cerevisiae
                     YNL151C RPC31 RNA polymerase III subunit C31 contains
                     HMG-like C-terminal domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451501.1"
                     /db_xref="GeneID:2896705"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:Q6CX38"
                     /translation="MSFRGSRGKSSSTFSNLPFGLSYSDVSAKGSTELPLIPLPLNHP
                     SNELEREIAIHYINFKNALKDGPFFTGSMELISEEDQEEGDTENAKNKRKNKPSLQVD
                     ADGLNDGIERYSDKYLKRRKIGTSIDEHPFNIDFFPKELYHVMGINKKKLIQLSKLDK
                     SKTLFGLNGSKEEDEAVGRALLEKMSGMVDDDEENEEGNEEKEADKDDIDEDDEFEED
                     DDDDYNAEKYFDDGDDDLGGDDEYPDEAEF"
     gene            complement(<996087..>997151)
                     /locus_tag="KLLA0_A11550g"
                     /db_xref="GeneID:2896655"
     mRNA            complement(<996087..>997151)
                     /locus_tag="KLLA0_A11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451502.1"
                     /db_xref="GeneID:2896655"
     CDS             complement(996087..997151)
                     /locus_tag="KLLA0_A11550g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451502.1"
                     /db_xref="GeneID:2896655"
                     /db_xref="UniProtKB/TrEMBL:Q6CX37"
                     /translation="MIRQDGKLIILPSKITVGKQLEVGTYFMLKLGQNAIRFNSIRGN
                     LELNVRAADWDTNMEFIIFRRRPRLKNDLLGCRRRDVLDQDFININKLRPKALREYYV
                     VWKSVELNSLAKDVQFIVDIEFFPSSGPIIPLKSPQSPSEKSSPVIKTKLPKQLPQSP
                     ESKPATTPRDQESSPKFFPRLRRHSRHQRRNDLNIDSDDIVYDNVIIYDGKEKAVVAG
                     NYTHGLKSYEAESSDTSGVYSFIEQNKEKIRNYDYDTLVIKETPKDLLNNEYARLQLG
                     DKLMFIHSFPSANVKLTGYLGNGRWSVPETNETRRQLYVLQQPTLPPPRVPPKCPKGM
                     LWEEYYLLNKEKYIREVMRN"
     gene            complement(<997457..>998623)
                     /locus_tag="KLLA0_A11572g"
                     /db_xref="GeneID:2896771"
     mRNA            complement(<997457..>998623)
                     /locus_tag="KLLA0_A11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451503.1"
                     /db_xref="GeneID:2896771"
     CDS             complement(997457..998623)
                     /locus_tag="KLLA0_A11572g"
                     /note="similar to uniprot|P53901 Saccharomyces cerevisiae
                     YNL152W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451503.1"
                     /db_xref="GeneID:2896771"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:Q6CX36"
                     /translation="MSNNVITGANGRLDVYVSKAKDLPNLRKLDKQDPFVKLRVAHLT
                     EISPVIYRGGQTPKFDYHCVFQLTPDIKPLLCVELYDDHDHKHGSKLIGKCDVDLLPA
                     LLSDPEEGHDRWYHLKRGPLEAGKVYIELTFVPNNISEDRRDNVPKISSSVQSRSVPP
                     LPSDPPELHAQYELQTSASEQRFVASASPGQYVHGSHIKSPLPDLPINLDTSRSSHAS
                     SERIDFDSSMGSNATANTYHSQQSQSTDGLMDKLKLIKEKLNYFKNGSSVPSTESITN
                     TAMDLEVLQKVVGGGLESSSSSRIPTNIDEPSPMNHLPTKSFVEPPLPPLPTTPSRLS
                     SQSSVRHSAGQKYPLKSPVRQPTTPRLPNLPNSFSSPSSRSGSVSPTRRRPPPL"
     gene            complement(<998888..>1003480)
                     /locus_tag="KLLA0_A11594g"
                     /db_xref="GeneID:2896772"
     mRNA            complement(<998888..>1003480)
                     /locus_tag="KLLA0_A11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451504.1"
                     /db_xref="GeneID:2896772"
     CDS             complement(998888..1003480)
                     /locus_tag="KLLA0_A11594g"
                     /note="similar to uniprot|P53552 Saccharomyces cerevisiae
                     YNL139C RLR1 Required for LacZ RNA expression from certain
                     plasmids suppressor of the Transcriptional (T) defect of
                     Hpr1 (H) by Overexpression (O) plays a role in
                     transcription elongation by RNA polymerase II Involved in
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451504.1"
                     /db_xref="GeneID:2896772"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="UniProtKB/TrEMBL:Q6CX35"
                     /translation="MALYDCLNNLASNLPNDEQVTYFDKTFFDEPSRGVETIISQYLS
                     LDASSQKSDYVYDLFLEAFSLINGKSDESEFLNLDAISKIVSALCNEDRYNFELFVSL
                     ANSYPWEANNGFNDLVGCAKDLQLEVCIYLNDQILSKGTERWSKDFWSAFKKSIVPEF
                     FLLQKPNLFLECSTGFSQLITLLNIAFEDVDKFQSVQYYSKQLKYIMGKYKLDPIRCM
                     DILLQVSSYHVVHHFEFILELLQSTDYWPSSNLANCSRYEQLNQGGNPIATRLIVNYL
                     NNGKPDANYIDLVVHLIKGGFVSFAAIFDCLTPYDTDIDEFVERKLTTLEKESLEGSL
                     NPLAMASVLTDEDNTISKNTEGDKTNTAADTGISEKEKEALLRETVEKSPKWKLVERL
                     LVNGHFVPGLYALFKYPRFFAVNDSLVKSLLEVFDNMIEPLTVKLSPSAISEHCRPLL
                     KLSHNGIPTKQDRLIRQYRSLGKDYKYIQGTEFVFYNKDWRQNLTPIETIENLVHYSH
                     LIFESIGPRIILNAKLVEHICAIAEKNILDNLEDETVMDLWINYCRKFMLPVLGLVED
                     EQFVANAIYSVMKHFPFERRYFMYHELSTKIAEDNIHVRLQFNKYQKRIRSLLKSLSI
                     DNIAFKCRDVANFVSCNPLSTLDSILKQIENYDKVSELIVISAEFFSEFAYDVLQYTL
                     LIKLTSERPTLQDDGITPKMWISRLSLFIAGLAKGCSKMSMSNIFVFLVKNLYKDPSL
                     TLAILKELISQVAGIQTLYDVNWNTLLMISSGSFLKQIGRNLILDFRDKYYQPSKTIV
                     NYLLELNAVSEMIIMLTNLNLKIQTDNNVHYKILSAKCDESNALLWSFIEMLKHILTE
                     EQFKANILPFNVLIEKYQFPVEWAFDIWRHYFDTKLARSENDADEINEILYETDFKGI
                     NFENIDKRLFIDFWRLSLYDIRLEEDLYTKQKIIYEDKRKAAKVLKERHSLLSTIQTV
                     KFDLSQHASVFEKTKNMIKMNKETWFPEFSRERITSFLQHCVVPRLIFSPFDAIFCAT
                     FITETFNIEEVIDILGQFTSSNILGTLLFSSTVNESSNIATFLKDIITKIENWRHTTL
                     LDDDKIKPVIYDLYYQLTEQLSFTLEDSNYMSIRNTIQFLNAISEIFPVVDEHLELVL
                     DTLDHLIEHEQREDIILPSNALKGHLKARLKNASKTSDFREVSAEEQQQLQDEMNLIK
                     RYQDMKEAAKAEQSRKEEAELKEKEREKAKQQDAENGAATSSLTAPSMSSISNNSPSP
                     SQVMDGFYKIEKYIKDAEYTRAIPLIYDSNTQSDFRKLIKAPGNISGFRNKLKILFED
                     YYHRVTSNPPDHYRSVFENFIQRCKSAPLPQTKTPGSMYEDEVVPVKPSSKYSGERWN
                     SNTSSNRPIPSEPRKAASSRYQHGIASTTLPRAPANASKPPDTSSRPSGPASSGSSSR
                     FQNTLPSGPRKDSSSNRSISNSNTSQLPSRPFNQGKKFVNTPSEPRKRQSDESYQSSS
                     RFSNVKKPKLNDRSTNNQSPLPSGPKRQSGGSRYSR"
     gene            <1003776..>1004115
                     /locus_tag="KLLA0_A11605g"
                     /db_xref="GeneID:9487484"
     mRNA            join(<1003776..1003778,1003855..>1004115)
                     /locus_tag="KLLA0_A11605g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002999305.1"
                     /db_xref="GeneID:9487484"
     CDS             join(1003776..1003778,1003855..1004115)
                     /locus_tag="KLLA0_A11605g"
                     /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
                     YNL138W-A RCP10 Component of the U2 snRNP, associated with
                     the SF3b complex; conserved in Ashbya gossypii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002999351.1"
                     /db_xref="GeneID:9487484"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:B5RSI9"
                     /translation="MSNKVKEELIYEDMRKKHPGVGSARTTKEEWSNTISKDTYASLA
                     IHQNLLEYYTLASGFPSKRDAQLTLLRKLANPPKPIKRDIGND"
     gene            complement(<1004255..>1004896)
                     /locus_tag="KLLA0_A11616g"
                     /db_xref="GeneID:2896372"
     mRNA            complement(<1004255..>1004896)
                     /locus_tag="KLLA0_A11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451505.1"
                     /db_xref="GeneID:2896372"
     CDS             complement(1004255..1004896)
                     /locus_tag="KLLA0_A11616g"
                     /note="some similarities with uniprot|P38833 Saccharomyces
                     cerevisiae YHR127W (H)igh copy (S)uppressor of (N)34
                     dominant negative allele of SEC4. Suppression is very
                     specific to this allele. It has no affect on the analogous
                     YPT1 allele. No homology or known function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451505.1"
                     /db_xref="GeneID:2896372"
                     /db_xref="UniProtKB/TrEMBL:Q6CX34"
                     /translation="MASQHRNGNSKSRNGGGKGVGKGSNSLFGRVGNSSGQNPVLQKK
                     QTLERAEKAKAEKAKAKTGLTFLGGKLVLAADLQGNKMKASSDKNKQQIQSNKRVNLL
                     HNLKNRARSKQRNNSDNSNNKKLVISLKESLKCLKIRNLPIGTNPSNLQRVLQQMGNC
                     KVTDLKVIDLPTGSAHAEVFASNMDLETLHKRFNQAEIDGRRILTEISSQPEL"
     gene            <1005270..>1006913
                     /locus_tag="KLLA0_A11638g"
                     /db_xref="GeneID:2896762"
     mRNA            <1005270..>1006913
                     /locus_tag="KLLA0_A11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451506.1"
                     /db_xref="GeneID:2896762"
     CDS             1005270..1006913
                     /locus_tag="KLLA0_A11638g"
                     /note="similar to uniprot|P17555 Saccharomyces cerevisiae
                     YNL138W SRV2 Adenylyl cyclase-associated protein
                     N-terminal domain appears to be involved in cellular
                     responsiveness to RAS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451506.1"
                     /db_xref="GeneID:2896762"
                     /db_xref="GOA:Q6CX33"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:Q6CX33"
                     /translation="MTETNFSVQGYNLVKLLKRLEDATARLEDVTIYQEGYVQSKFGL
                     EKDGKVDGFADSVTASSAERIASAGSGASAASKEAATPVATAPNSTGESKEEEPKSIQ
                     EFKHFIEQNVDPLVKLSAEIDPTVEKAVVFLANAFKAQLVFLKAAVQSKKPDFSSSAF
                     VKGLTPINENIFSIGELKEENRNSKYFAHLNAISEGSPLFSWIAGSTPVSTITDFKDA
                     AQFWTNRILKEFRSTDPKSVEWVQQFLSVFDSLKLYVKEYHTTGVTWNDTTGEDFETV
                     YERVSNEGSGASSSGATSSEPHSSGAGAPPPPPPPPPASVFEVNEQSKEQESGGIGAV
                     FAELNQGENITKSLKKVEKSQQTHKNPELRASGKVSDKAVPPPKPKKPSTLKTKKPPR
                     KELIGNKWFIENYEDEAEPLVIETKIDESVFIGKCVNTLVQIKGKVNAVTVNETEKCS
                     LVLDSSISGVDIIKCLRFGIQVENTLPQITIDASDSGSIYLSKNSLQAQIFTSSSTGI
                     NINTPTGPDGDFVEVPLPEQMIHTFVEGKLQTKIYEHAG"
     gene            complement(<1007120..>1008568)
                     /locus_tag="KLLA0_A11660g"
                     /db_xref="GeneID:2896766"
     mRNA            complement(<1007120..>1008568)
                     /locus_tag="KLLA0_A11660g"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_451507.1"
                     /db_xref="GeneID:2896766"
     CDS             complement(1007120..1008568)
                     /locus_tag="KLLA0_A11660g"
                     /note="similar to uniprot|P27929 Saccharomyces cerevisiae
                     YNL137C NAM9 Mitochondrial ribosomal component of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_451507.1"
                     /db_xref="GeneID:2896766"
                     /db_xref="GOA:Q6CX32"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:Q6CX32"
                     /translation="MPRKAVLLNSLSRGKVRTSFNKYNLFNLYKKSQVSFRSKTLYQQ
                     KWTSKQETRAYHGEHLTESRWQSVFEPQLNSVAQLDASLRGGDIEPTPILLQTYAVLE
                     KRLDFALFRAMFASSVRQARQFILHGNVHVNGVKITSPGYALKAGDVFNVRPEKVLQA
                     LGAKKPSLKEALKVDNTQIFLWNKYILEARKNPRKFWDEKIEKLRTMDSNDPKKQEFL
                     SFLENYNKTMHIQMRKELDQTSNEYLLAKIFSTVNRVNDVEKLAVKDFLGEFYNNENL
                     AAKGFEIYREVKSAKAVETIAGKPLAEIPNEQGELLKVATGITKPVDNTNDALKKKFR
                     AINHTIVDLRHFYETVVREHYNDKMASVDSVDIPYDAKWAEKLPLHQKINVPELLENE
                     PAAQKAINLPWQKGVFGRNDPSKPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVYLR
                     DPVARPGQSEVITPFGLPVHERSYMYYVRRGK"
     gene            <1008960..>1010168
                     /locus_tag="KLLA0_A11682g"
                     /db_xref="GeneID:2896753"
     mRNA            <1008960..>1010168
                     /locus_tag="KLLA0_A11682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451508.1"
                     /db_xref="GeneID:2896753"
     CDS             1008960..1010168
                     /locus_tag="KLLA0_A11682g"
                     /note="some similarities with uniprot|P53911 Saccharomyces
                     cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
                     acetyltransferase complex which acetylates the N-terminal
                     tails of histones H4 and H2A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451508.1"
                     /db_xref="GeneID:2896753"
                     /db_xref="GOA:Q6CX31"
                     /db_xref="InterPro:IPR012423"
                     /translation="MSAVKIESPRGQTWSKVEEIRLFKWMMLFKPAGIHKHFHMVCLL
                     ERLNKPDQYPIKLLQSDKGSSDKVFSGEDVWEQLSRYYNLEKADEVENQPYPEFYNDD
                     GPTETTNKKTEGDAQLDNDDDSDNDVDNCDELKRNIIPLQNRLQQETEFELSWEDYGE
                     LMLEHARDHEVEDIKQEETASADDKAKLKGAESQDTQVEQESEEPREREKDIDEKDTE
                     QNNVQAKQEMATTPPVSVGESVSELANEPVDEPVDAHKKPRTRRSTRLTRSQKRGIDD
                     ESENKEDQPHGGNTDEKEDVEHDTEGRSGSEKESTADAADTTATKQVTFADESEGAAK
                     ESANSPTGKAEENETESSQQPRPKKQKVAAAEEVPEDLADVDSPARRTRRKSITKPTT
                     RLSSRLRSRK"
     gene            complement(<1010467..>1010811)
                     /locus_tag="KLLA0_A11704g"
                     /db_xref="GeneID:2896522"
     mRNA            complement(<1010467..>1010811)
                     /locus_tag="KLLA0_A11704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451509.1"
                     /db_xref="GeneID:2896522"
     CDS             complement(1010467..1010811)
                     /locus_tag="KLLA0_A11704g"
                     /note="highly similar to uniprot|P20081 Saccharomyces
                     cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans
                     isomerase (PPIase) binds to the drugs FK506 and rapamycin
                     also binds to the nonhistone chromatin binding protein
                     Hmo1p and may regulate its assembly or function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451509.1"
                     /db_xref="GeneID:2896522"
                     /db_xref="GOA:Q6CX30"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /translation="MSETIEGNVQILRLSPGDSTNFPKPGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDAAIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNA
                     TLVFDVELLKIN"
     gene            <1012732..>1013991
                     /locus_tag="KLLA0_A11748g"
                     /db_xref="GeneID:2896614"
     mRNA            <1012732..>1013991
                     /locus_tag="KLLA0_A11748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451511.1"
                     /db_xref="GeneID:2896614"
     CDS             1012732..1013991
                     /locus_tag="KLLA0_A11748g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451511.1"
                     /db_xref="GeneID:2896614"
                     /db_xref="GOA:Q6CX28"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:Q6CX28"
                     /translation="MHFQPVLSFLIAAAGFVSTVTSADSDASEKFILEPSDLESIIKA
                     LQEVDHTIDIPHLQLSNVTNGTAAISVSNSATFDLVGVKDATTLQVTKDGYLVSVSAN
                     GGIKYATIAAAAADPAVLFTADQSYASPGFSISGGNLALNGTDSWLLSVNSTDLTFKA
                     NGASLLNGETVNIPLSLAAVGTSGGSTVPDYLPSLTINSGADIQKRHNQDSHDHSNYT
                     YGSGFKHGNHTHGSNYTHHTDYSNHTHTQPPQFSDLSGDFTTTVTHETTALEPKVTFQ
                     KRADAVSQIGDGQIQAGTGSTAVAETTPAAAETTSAAAETTPAAAETTSAAAETTPAA
                     AETTPAAVETTSAAVETTPAAAETTPATETTPAVVTSAVETTPVAVTTAASSTQALST
                     YAGAGVKQLASSSGLFAAACVLGSLLI"
     gene            <1014918..>1016663
                     /locus_tag="KLLA0_A11770g"
                     /db_xref="GeneID:2896715"
     mRNA            <1014918..>1016663
                     /locus_tag="KLLA0_A11770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451512.1"
                     /db_xref="GeneID:2896715"
     CDS             1014918..1016663
                     /locus_tag="KLLA0_A11770g"
                     /note="similar to uniprot|P06775 Saccharomyces cerevisiae
                     YGR191W HIP1 High-affinity histidine permease also
                     involved in the transport of manganese ions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451512.1"
                     /db_xref="GeneID:2896715"
                     /db_xref="GOA:Q6CX27"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:Q6CX27"
                     /translation="MTHFSKNMDTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAEEK
                     DYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASL
                     VIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAIL
                     LPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAI
                     IGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGL
                     ELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVD
                     AAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSL
                     AHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHL
                     RFRHAMKHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATS
                     FFESYLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAEL
                     MKTKPFYIRLWNFWC"
     gene            <1017064..>1021095
                     /locus_tag="KLLA0_A11792g"
                     /db_xref="GeneID:2896708"
     mRNA            <1017064..>1021095
                     /locus_tag="KLLA0_A11792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451513.1"
                     /db_xref="GeneID:2896708"
     CDS             1017064..1021095
                     /locus_tag="KLLA0_A11792g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451513.1"
                     /db_xref="GeneID:2896708"
                     /db_xref="GOA:Q6CX26"
                     /db_xref="InterPro:IPR000331"
                     /db_xref="InterPro:IPR003913"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018515"
                     /db_xref="InterPro:IPR024584"
                     /db_xref="UniProtKB/TrEMBL:Q6CX26"
                     /translation="MINKVIICKQREHKRVPEAARHMSLSNSSHSSGSDSVRSSVFRE
                     FSLLLKRHNSDMKVRTLEEHKEWLDHLDSEADAKHRRKAILNITDNIDKYEKSEIPLI
                     WVKATSLLKRDVDNTESRMLLELLSKCCLHCGNEHSVRLMFYFTLIDFCCVMGDKITL
                     NRASLDSSLDLIFNGIDGLTHQGTDIVIFEQHATMNISQLLSLSLSNILNFNTRTCIS
                     FLSFLNNCLRNSTLTVDGLGMIIHCAQKTPSPEVLLCCFHTINILISTEHEDISDQST
                     YDLAYLITGAINLDNKFNQQLLKTLDALIESKYWDQFAYQLKILMESPDTNYLNLRGA
                     VTILTDFALQDKEDWFVWLTKIFERGNTMYGQILECIKTLITDDHFCEQGNGYVWYNE
                     ENMCLLKMLREILSVDVIRDNNPITIASIYNALFQALLSKKWELYGLKNSSDLLALVI
                     EHEELLSKEQISIIAQYLESYRDPFPQSSLTKILHMLDATDERTAAIVKYFANSYALF
                     DSACKKLIEKSVLELLSCDESQSVFVSCTEFLVVLSEYIPTDALKSYVEAYLVPKQPR
                     RKSIVSIGIDPHKIKWKLTEQSIALVRLFQRKIFMFPYLILTWRCCIKAKDTVALLVL
                     ARILMKMRIDADSLFYFCEETDIDGLTATLNRNTVIKPEGIDGSYLWKYPEDETTSYI
                     DKGTLGKKFDADCLAYIDISEWTELLIETLRKPLDWELYTYLLSHLCPQLANYHLFKN
                     DRHNIEILHDLILHQLKDGCPIKMGVGINKSDVQLAFVRTLSSLFPYYGFLGKSKADE
                     MIKISLGVLESSFEKTIVPLLHNFSVSCYEIPSSIKKHLNPLLETISIRLTKKQAIPC
                     LLEFLIALSDSPQIISPLTIDQLKRVFTIAFKLIEVSHDLKEEAEEADFVRHSFTDEQ
                     EASFNPSTSSFTVTKQMAHFYLTLSYQIISHWFIRISLSKRPLIAPFLMVKLSTLKRC
                     DDTEAYKDLVTRFTTTDLELRVETVTSDTPNSGDPHYLHEYWYRDGKILSIEVNTTTG
                     ASLVVTRGASGNSIFNVDPIVKKEPDSFDLFQFGKNTKPASANMFTPGYVLAQFSAED
                     TYEDMVRIEEPHLIKSIQLVDTIPVVEFHKIGLLYMGPNDTTEKDILSHSMEDGSHQY
                     KWFVNELGSIIKLDQNETFYIGGLNPGTDGEYALIWHDQKCQIVFHTVSLMPNDDKAD
                     PDRTMKKRHVGNNFINIYYDERKQDSFPFDIIKSQFNFINLVIKPMWNGKDEKDSVSE
                     FYKVKIYRAKEVPGIFSTSHFKIMHRQRLAAYVRHLCTVANTFAQIWHESVSSEHCST
                     WSRRFAHIKTIKTRLKNQSSGAS"
     gene            <1021526..>1022434
                     /locus_tag="KLLA0_A11814g"
                     /db_xref="GeneID:2896433"
     mRNA            <1021526..>1022434
                     /locus_tag="KLLA0_A11814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451514.1"
                     /db_xref="GeneID:2896433"
     CDS             1021526..1022434
                     /locus_tag="KLLA0_A11814g"
                     /note="highly similar to uniprot|P20459 Saccharomyces
                     cerevisiae YJR007W SUI2 Alpha subunit of the translation
                     initiation factor eIF2 involved in the identification of
                     the start codon phosphorylation of Ser51 is required for
                     regulation of translation by inhibiting the exchange of
                     GDP for GTP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451514.1"
                     /db_xref="GeneID:2896433"
                     /db_xref="GOA:Q6CX25"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="UniProtKB/TrEMBL:Q6CX25"
                     /translation="MSTSNCRFYENKFPEVDDVVMVNVQQIAEMGAYVRLLEYDNIEG
                     MVLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSAEDVIKCEERY
                     QKSKAVHSILRQCAEKYQVSLEDLYKAYAWPLSRKYGHAYDAYKMSIVDPNVWDGIES
                     ISDEIFQELKGQITRRLTPQAVKIRADVEVSCFSYEGIDAIKEALKSAEELSTEQMQI
                     KVKLVAAPLYVITTQSLDKDQGVQLLETAIAKIEEVILKYNGVCNVTMAPKAVTATED
                     AELQALLESKELEGRSDSEDEDSDYE"
     gene            <1023063..>1024028
                     /locus_tag="KLLA0_A11836g"
                     /db_xref="GeneID:2896431"
     mRNA            <1023063..>1024028
                     /locus_tag="KLLA0_A11836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451515.1"
                     /db_xref="GeneID:2896431"
     CDS             1023063..1024028
                     /locus_tag="KLLA0_A11836g"
                     /note="similar to uniprot|P47085 Saccharomyces cerevisiae
                     YJR008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451515.1"
                     /db_xref="GeneID:2896431"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:Q6CX24"
                     /translation="MSSVRPATHAGSWYSSSPALITTLQQLLSRDEAVPGTKHLISPH
                     AGYKYCGDTMALGYSKLDFTNVKRCIIMGPSHHIYFKNKIQVTSFDEVNTPFGDFKVD
                     GGLRNELLVGGKVVLMSKEVDMDEHSLEMQFPMLWAAAKLRGVDPTNIKILPLLVSHN
                     STKVDFELGKLLQKYVDDEETLFILSSDFCHWGRRFGYTGYVMESSDIDESLENDSEV
                     EYLTQRSFNHKSSHNVPIYKSIEILDQYAMDILGKNTENKYYDWKKYINVTGNTICGE
                     RPIGVFLCAMSLLNKPYQFNWAHYSQSSQCVDLEDSSVSYASGYF"
     gene            complement(<1024297..>1025292)
                     /locus_tag="KLLA0_A11858g"
                     /db_xref="GeneID:2896666"
     mRNA            complement(<1024297..>1025292)
                     /locus_tag="KLLA0_A11858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451516.1"
                     /db_xref="GeneID:2896666"
     CDS             complement(1024297..1025292)
                     /locus_tag="KLLA0_A11858g"
                     /note="highly similar to uniprot|P00358 TDH2, to YGR192C
                     uniprot|P00359 TDH3 and to YJL052W uniprot|P00360 TDH1
                     Saccharomyces cerevisiae glyceraldehyde 3-phosphate
                     dehydrogenases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451516.1"
                     /db_xref="GeneID:2896666"
                     /db_xref="GOA:Q6CX23"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /translation="MVRVAINGFGRIGRLVLRIALSRPNVEVVAINDPFISVDYAAYM
                     FKYDSTHGRFAGEVSHDENSLIIDGKKVLVFQERDPATLPWGEHNVDIAIDSTGVFKE
                     LDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDKYNGETIVSNASCTTNCLAPLAKV
                     VNNAFGIEEGLMSTIHSITATQKTVDGPSQKDWRGGRTASGNIIPSSTGAAKAVGKVL
                     PELQGKLTGMAFRVPTVDVSVVDLTVKLAKEATYDEIKAVIKKASENELKGILGYTED
                     AVVSSDFLGDTNSSIFDAAAGIQLSPKFVKLVTWYDNEYGYSTRVVDLVELVAKN"
     gene            <1029032..>1029448
                     /locus_tag="KLLA0_A11913g"
                     /db_xref="GeneID:2896616"
     mRNA            <1029032..>1029448
                     /locus_tag="KLLA0_A11913g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451519.1"
                     /db_xref="GeneID:2896616"
     CDS             1029032..1029448
                     /locus_tag="KLLA0_A11913g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451519.1"
                     /db_xref="GeneID:2896616"
                     /db_xref="UniProtKB/TrEMBL:Q6CX20"
                     /translation="MVFPICNENLFTEVCKSVNEDPSDVLRLAKKTAGRRSEKLKKRR
                     WRQCKVEEEEEEDPDVVPPTPKDKTIAFGKRRNRKENRNSHLFFKKYQILTSHSTLIT
                     GKKNVHRKRCKVPTEDENDVPVLSTIKRDSLLRVSI"
     gene            <1031062..>1034418
                     /locus_tag="KLLA0_A11935g"
                     /db_xref="GeneID:2896645"
     mRNA            <1031062..>1034418
                     /locus_tag="KLLA0_A11935g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_451520.1"
                     /db_xref="GeneID:2896645"
     CDS             1031062..1034418
                     /locus_tag="KLLA0_A11935g"
                     /note="some similarities with uniprot|P32768 Saccharomyces
                     cerevisiae YAR050W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_451520.1"
                     /db_xref="GeneID:2896645"
                     /db_xref="GOA:Q6CX19"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:Q6CX19"
                     /translation="MMLTKGFSLLLLFLLPFSNAESQNTDGGTILGCKPSKNSPSSGF
                     EVAYYHYPMVPSGKGCYNYDATYQTEAYQHGGYETYGGGLIGKSSGVTDLTFKSTAAS
                     NSCSKPVKARLPSNYNYNTQITVTNFSMLITGYFYAPKTGSYEFILDYIDDLTYLNVG
                     AGRAFDCCGKTSSVSNPGPFDLSVMWPQTQNTATVYLLGGFYYPLRIFYINREGVGGL
                     TVTFKDADGVLHKTFKNFIFSIPDGKECPVPVHTTTVPWDESYTTTFTTVSEYTNDSG
                     KTVTENVIVVQTPEVHTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTP
                     EVNTATTTYTGWTGTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTETTTYTGWT
                     GTETKTYATETITVTGEDGIPTIKTIYSVKTPEVNTATTTYTGWTGTETKTYATETIT
                     VTGEDGIPTIKTIYSVKTPEPETTAHTATTTYIKWGGKITTTYATEKVTFTGEDGKPT
                     IETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVK
                     TPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPY
                     GHTSTTAYTSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAY
                     TSWGGKITTTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKIT
                     TTYATEKVTFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKV
                     TFTGEDGKPTIETIYYVKTPVEKTPYGHTSTTAYTSWGGKITTTYATEKVTFTGEDGK
                     PTIETIYYVKTPVEKTTYGHTSTTAYTSWTGEYSTTFATKVVTIIGGDGKPTVKTIYS
                     VQTPESVKPSFSGWFSNTTTSHTITSSSTSSDSTTSDITSTEPIFSLTTVTTTSNGVT
                     TVYTTTCPIDTTLTESTSCESLTSKSKTEHETTSSQISYSTNSKEEEGEEDVFNNERP
                     TSTESNEELISSTQIVSLSQTEVTPSSDIIITSYASSATETVQEQHSFEGETQTLSSS
                     SSTADTISVFEGSAVKLLVTPFIAVFLALL"
     gene            <1041208..>1041834